This is a digital copy of a book that was preserved for generations on library shelves before it was carefully scanned by Google as part of a project
to make the world's books discoverable online.
It has survived long enough for the copyright to expire and the book to enter the public domain. A public domain book is one that was never subject
to copyright or whose legal copyright term has expired. Whether a book is in the public domain may vary country to country. Public domain books
are our gateways to the past, representing a wealth of history, culture and knowledge that's often difficult to discover.
Marks, notations and other marginalia present in the original volume will appear in this file - a reminder of this book's long journey from the
publisher to a library and finally to you.
Usage guidelines
Google is proud to partner with libraries to digitize public domain materials and make them widely accessible. Public domain books belong to the
public and we are merely their custodians. Nevertheless, this work is expensive, so in order to keep providing this resource, we have taken steps to
prevent abuse by commercial parties, including placing technical restrictions on automated querying.
We also ask that you:
+ Make non-commercial use of the files We designed Google Book Search for use by individuals, and we request that you use these files for
personal, non-commercial purposes.
+ Refrain from automated querying Do not send automated queries of any sort to Google's system: If you are conducting research on machine
translation, optical character recognition or other areas where access to a large amount of text is helpful, please contact us. We encourage the
use of public domain materials for these purposes and may be able to help.
+ Maintain attribution The Google "watermark" you see on each file is essential for informing people about this project and helping them find
additional materials through Google Book Search. Please do not remove it.
+ Keep it legal Whatever your use, remember that you are responsible for ensuring that what you are doing is legal. Do not assume that just
because we believe a book is in the public domain for users in the United States, that the work is also in the public domain for users in other
countries. Whether a book is still in copyright varies from country to country, and we can't offer guidance on whether any specific use of
any specific book is allowed. Please do not assume that a book's appearance in Google Book Search means it can be used in any manner
anywhere in the world. Copyright infringement liability can be quite severe.
About Google Book Search
Google's mission is to organize the world's information and to make it universally accessible and useful. Google Book Search helps readers
discover the world's books while helping authors and publishers reach new audiences. You can search through the full text of this book on the web
at jhttp : //books . qooqle . com/
Digitized by
Google
Digitized by
Google
THE
SACRED BOOKS OF THE EAST
[15]
Digitized by
Google
Uontoon
HENRY FROWDE
OXFORD TTNIVEBSITY PHESS WABEHOTTSE
AMEN CORNER
Digitized by
Google
THE
Aft/fa
SACRED BOOKS OF THE EAST
TRANSLATED
BY VARIOUS ORIENTAL SCHOLARS
•/jr.
AND EDITED BY
F. MAX MULLER
vol. xv
0rforH
AT THE CLARENDON PRESS
1884
[All rights reserved]
Digitized by LaOOQ lC
^o /rJ'
Digitized by
Google
THE UPANISHADS
TRANSLATED BY
F. MAX MOLLER
PART II
the k;at»a-upanishad
the muiv-daka-upanishad
the taittirlyaka-upanishad
THE B-ff/HADiRAiVYAKA-UPANISHAD
THE .SVETASVATARA-UPANISHAD
THE PRASitfA-UPANISHAD
THE MAITRAYAiVA-BRAHMAiVA-UPANISHAD
[ INJVKKSITY 7)
0rforfc
AT THE CLARENDON PRESS
1884
[All rights reserved']
Digitized by
Google
Digitized by
Google
CONTENTS.
Introduction .
ix If
Ka/Aa-upanisbad
xxi +-
Muwtfaka-upanishad
. xxvi
Taittirlyaka-upanishad
. xxvii S
Brzhadara»yaka-upanishad .....
xxx -V
.Svetiuvatara-upanishad
. xxxi
Prama-upanishad
xlii «^*
Maitr&ya«a-brahma«a-upanishad
. xliii ^~
Translation of the Katoa-upanishad .
. ifc/
Translation of the Miwzjaka-upanishad
• 3 7 /
Translation of the TaittirJyaka-upanishad .
• 45
Translation of the Bie/HAD^RAiVYAKA-uPANisHAD
• 73 u-
Translation of the .SvetA^vatara-upanishad .
. 231
Translation of the Pra^a-upanishad .
. 271 v
Translation of the MAiTRAYA^A-BRAHMAiVA-uPANiSHj
iD . 287
Transliteration of Oriental Alphabets adopted for the Trans-
lations of the Sacred Books of the East . . .347
Digitized by
Google
Digitized by
Google
vv l'M\ CI;mty
INTRODUCTION.
This second volume completes the translation of the
principal Upanishads to which .Sankara appeals in his
great commentary on the Vedanta-Sutras 1 , viz. :
i. .Oandogya-upanishad,
_ 2. Talavakara or Kena-upanishad,
3. Aitareya-upanishad,
4. Kaushitaki-upanishad,
_ 5- Va^asaneyi or fja-upanishad,
6. Ka^a-upanishad r -*' ""y-
— 7. MuWaka-upanishacV
8. Taittirtyaka-upanishacV
9. Br*had4ra«yaka-upanishad, ^
10. .Svetlrvatara-upanishad,
11. Prajwa-upanishad.
These eleven have sometimes 2 been called the old and
genuine Upanishads, though I should be satisfied to call
them the eleven classical Upanishads, or the fundamental
Upanishads of the Vedanta philosophy.
Vidy&rawya 3 , in his ' Elucidation of the meaning of all
the Upanishads,' Sarvopanishadarthanubhuti-praklya, con-
fines himself likewise to those treatises, dropping, however,
the 1st, and adding the Maitrayawa-upanishad, of which
I have given a translation in this volume, and the NW-
siwhottara-tapaniya-upanishad, the translation of which
had to be reserved for the next volume.
1 See Deussen.Vedinta, Einleitung, p. 38. 6'ankara occasionally refers also
to the Paingi, Agnirahasya, Gabala, and N&rayanfya Upanishads.
* Deossen, loc. cit. p. 8a.
5 I state this on the authority of Professor Cowell. See also Fitzedward
Hall, Index to the Bibliography of the Indian Philosophical Systems, pp. 116
and 236.
Digitized by
Google
UPANISHADS.
It is more difficult to determine which of the Upanishads
were chosen by 5arikara or deserving the honour of a special
commentary. We possess his commentaries on the eleven
Upanishads mentioned before 1 , with the exception of the
Kaushitaki 2 -upanishad. We likewise possess his commen-
tary on the Mawdukya-upanishad, but we do not know for
certain whether he left commentaries on any of the other
Upanishads. Some more or less authoritative statements
have been made that he wrote commentaries on some of the
minor Upanishads, such as the Atharvariras, Atharva-jikha,
and the NWsiwhatapani 3 . But as, besides Sankara^arya, the
disciple of Govinda, there is .Sankarananda, the disciple of
Anandatman, another writer of commentaries on the Upa-
nishads, it is possible that the two names may have been
confounded by less careful copyists *.
With regard to the Nnsiwshatapani all uncertainty might
seem to be removed, after Professor Ramamaya Tarka-
ratna has actually published its text with the commentary
of .Sankara^arya in the Bibliotheca Indica, Calcutta, 1871.
But some uncertainty still remains. While at the end of
each Khanda of the N^siwha-purvatapani we read that
the Bhashya was the work of the Paramahawsa-parivra-
,g-aka£arya .S'rl-.S'ahkara, the pupil of Govinda, we have no
such information for the N^zsiwha-uttaratapani, but are
told on the contrary that the words .Sri-Govindabhagavat
&c. have been added at the end by the editor, because he
thought fit to do so. This is, to say the least, very suspicious,
and we must wait for further confirmation. There is another
commentary on this Upanishad by Naraya«abha#a, the son
of Bha#a Ratnakara 6 , who is well known as the author of
Dipikas on several Upanishads.
* They have been published by Dr. Roer in the Bibliotheca Indica.
a Dr. Weber's statement that Sankara wrote a commentary on the Kaushitaki-
upanishad has been corrected by Deussen, loc. cit. p. 39.
3 See Deussen, loc. cit. p. 39.
* A long list of works ascribed to Sankara may be seen in Regnaud, Philo-
sophic de l'lnde, p. 34, chiefly taken from Fitzedward Hall's Index of Indian
Philosophical Systems.
5 See Tarkaratna's Vi^dpana, p. 3, 1. 5.
Digitized by
Google
c.\
\ /•;
INTRODUCTION.
XI
> v
I subjoin a list of thirty of the smaller Upanishads, pub-
lished by Professor Ramamaya Tarkaratna in the Biblio-
theca Indica, with the commentaries of Naraya«abha//a.
i. Sira-upanishad,pp.i-io; Dipika by Naraya«a,pp.42-6o.
2. Garbha-upanishad, pp. 11-15 ; „ pp. 60-73.
3. Nadavindu-upanishad, pp. 15-17; „ pp. 73-78.
4. Brahmavindu-upanishad, pp. 18-20 ; „ pp. 78-82.
5. Amrz'tavindu-upanishad, pp. 21-25; „ PP- 83-101.
6. Dhyanavindu-upanishad, pp. 26-28; „ pp. 102-114.
7. Te^fovindu-upanishad, pp. 29-30 ; „ pp. 1 14-118.
8. Yogarikha-upanishad, pp. 31-32 ; „ pp. 1 18-122.
9. Yogatattva-upanishad, pp. 33-34 ; „ pp. 122-127.
10. Sannyasa-upanishad, pp. 35-39 ; „ pp. 128-184.
11. Aru«eya-upanishad, pp. 39-41; „ pp. 184-196.
12. Brahmavidya-upanishad, pp. 197-203; „ ibidem.
13. Kshurika-upanishad, pp. 203-218; „ „
14. .ATulika-upanishad, pp. 219-228 ; „ „
15. Atharva-rikha-upanishad, pp. 229-238; „ „
16. Brahma-upanishad, pp. 239-259 ; „ „
17. Prawagnihotra-upanishad, pp. 260-271; „ „
18. Nilarudra-upanishad, pp. 272-280; „ „
19. Ka#/$ajruti-upanishad, pp. 281-294; „ „
20. Pi«d?a-upanishad, pp. 295-298 ; „ „
3i. Atma-upanishad, pp. 299—303 ; „ „
22. Ramapurvatapaniya-upanishad,
PP- 304-358 5 »
23. Ramottaratapaniya-upanishad,
PP- 359-3 8 4 » „ >,
24. Hanumadukta-Rama-upanishad,
PP- 385-393;
35. Sarvopanishat-sara^, pp. 394-404 ; „ „
26. Hawsa-upanishad, pp. 404-416; „ „
27. Paramahawsa-upanishad, pp. 41 7-436 ; „ „
28. Gabala-upanishad, pp. 437-455 ; » „
29. Kaivalya-upanishad, pp. 456-464 ; „ „
Kaivalya-upanishad, pp. 465-479 ; Dipika by
Sankarananda, „
30. Garuda-upanishad, pp. 480 seq. ; Dipika by
Narayawa, „
Digitized by
Google
Xll UPANISHADS.
We owe to the same editor in the earlier numbers of the
Bibliotheca the following editions :
Nmiwzhapurvatapani-upanishad, with commentary.
NWsi»mottaratapant-upanishad, with commentary.
Sha^akra-upanishad, with commentary by N4raya«a.
Lastly, Hara£andraVidyabhusha#a and Vi^vanatha Sastri
have published in the Bibliotheca Indica an edition of the
Gopalatapanf-upanishad, with commentary by VLrvervara.
These editions of the text and commentaries of the
Upanishads are no doubt very useful, yet there are many
passages where the text is doubtful, still more where the
commentaries leave us without any help.
Whatever other scholars may think of the difficulty
of translating the Upanishads, I can only repeat what I
have said before, that I know of few Sanskrit texts pre-
senting more formidable problems to the translator than
these philosophical treatises. It may be said that most of
them had been translated before. No doubt they have
been, and a careful comparison of my own translation with
those of my predecessors will show, I believe, that a small
advance, at all events, has now been made towards a truer
understanding of these ancient texts. But I know full well
how much still remains to be done, both in restoring a cor-
rect text, and in discovering the original meaning of the
Upanishads ; and I have again and again had to translate
certain passages tentatively only, or following the com-
mentators, though conscious all the time that the meaning
which they extract from the text cannot be the right one.
As to the text, I explained in my preface to the first
volume that I attempted no more than to restore the text,
such as it must have existed at the time when .Sankara
wrote his commentaries. As Sankara lived during the
ninth century A.D. 1 , and as we possess no MSS. of so early
a date, all reasonable demands of textual criticism would
thereby seem to be satisfied. Yet, this is not quite so.
We may draw such a line, and for the present keep within
it, but scholars who hereafter take up the study of the
1 India, What can it teach us ? p. 360.
Digitized by LaOOQ lC
INTRODUCTION. Xlll
Upanishads will probably have to go beyond. Where I had
an opportunity of comparing other commentaries, besides
those of .Sankara, it became quite clear that they often
followed a different text, and when, as in the case of the
Maitraya«a-brahma«a-upanishad, I was enabled to collate
copies which came from the South of India, the opinion
which I have often expressed of the great value of Southern
MSS. received fresh confirmation. The study of Grantha
and other Southern MSS. will inaugurate, I believe, a new
period in the critical treatment of Sanskrit texts, and the
text of the Upanishads will, I hope, benefit quite as much
as later texts by the treasures still concealed in the libraries
of the Dekhan.
The rule which I have followed myself, and which I have
asked my fellow translators to follow, has been adhered to
in this new volume also, viz. whenever a choice has to be
made between what is not quite faithful and what is not
quite English, to surrender without hesitation the idiom
rather than the accuracy of the translation. I know that
all true scholars have approved of this, and if some of our
critics have been offended by certain unidiomatic expres-
sions occurring in our translations, all I can say is, that we
shall always be most grateful if they would suggest trans-
lations which are not only faithful, but also idiomatic. For
the purpose we have in view, a rugged but faithful trans-
lation seems to us more useful than a smooth but mis-
leading one.
However, we have laid ourselves open to another kind
of censure also, namely, of having occasionally not been
literal enough. It is impossible to argue these questions
in general, but every translator knows that in many cases
a literal translation may convey an entirely wrong meaning.
I shall give at least one instance.
My old friend, Mr. Nehemiah Goreh — at least I hope he
will still allow me to call him so — in the 'Occasional
Papers on Missionary Subjects/ First Series, No. 6, quotes,
on p. 39, a passage from the .ffMndogya-upanishad, trans-
lates it into English, and then remarks that I had not
translated it accurately. But the fault seems to me to lie
Digitized by
Google
XIV UPANISHADS.
entirely with him, in attempting to translate a passage
without considering the whole chapter of which it forms
a part. Mr. Nehemiah Goreh states the beginning of the
story rightly when he says that a youth by name .Sveta-
ketu went, by the advice of his father, to a teacher to
study under him. After spending twelve years, as was
customary, with the teacher, when he returned home he
appeared rather elated. Then the father asked him:
Uta tam ade-ra m aprak sho 1 yenajruta^ jrutam bhavaty
amatam matani~avi§-#ata*« vi^-watam iti ?
I translated this : ' Have you ever asked for that instruc-
tion by which we hear what cannot be heard, by which we
perceive what cannot be perceived, by which we know what
cannot be known ? '
Mr. Nehemiah Goreh translates: 'Hast thou asked (of
thy teacher) for that instruction by which what is not heard
becomes heard, what is not comprehended becomes com-
prehended, what is not known becomes known?'
I shall not quarrel with my friend for translating man by
to comprehend rather than by to perceive. I prefer my
own translation, because manas is one side of the common
sensory (anta^karawa), buddhi, the other ; the original differ-
ence between the two being, so far as I can see, that the
manas originally dealt with percepts, the buddhi with con-
cepts 2 . But the chief difference on which my critic lays
stress is that I translated ajrutam, amatam, and avi^watam
not by ' not heard, not comprehended, not known,' but by
' what cannot be heard, what cannot be perceived, what
cannot be known.'
Now, before finding fault, why did he not ask himself
what possible reason I could have had for deviating from
the original, and for translating avi^wata by unknowable or
1 Mr. Nehemiah Goreh writes apralcshyo, and this is no doubt the reading
adopted by Roer in his edition of the iSTAandogya-upanishad in the Bibliotheca
Indica, p. 384. In Sankara's commentary also the same form is given. Still
grammar requires apraksho.
* The Pa^adasi (I, 20) distinguishes between manas and buddhi, by saying,
mano vimarsarupam syfid buddhi* syan nis£ayatmika, which places the difference
between the two rather in the degree of certainty, ascribing deliberation to
manas, decision to buddhi.
Digitized by
Google
INTRODUCTION. XV
what cannot be known, rather than by unknown, as every one
would be inclined to translate these words at first sight ? If
he had done so, he would have seen in a moment, that with-
out the change which I introduced in the idiom, the trans-
lation would not have conveyed the sense of the original, nay,
would have conveyed no sense at all. What could .Sveta-
ketu have answered, if his father had asked him, whether
he had not asked for that instruction by which what is not
heard becomes heard, what is not comprehended becomes
comprehended, what is not known becomes known? He
would have answered, ' Yes, I have asked for it ; and from
the first day on which I learnt the .Slksha, the ABC,
I have every day heard something which I had not heard
before, I have comprehended something which I had not
comprehended before, I have known something which I had
not known before.' Then why does he say in reply, 'What
is that instruction?' Surely Mr. Nehemiah Goreh knew
that the instruction which the father refers to, is the instruc-
tion regarding Brahman, and that in all which follows the
father tries to lead his son by slow degrees to a knowledge
of Brahman 1 . Now that Brahman is called again and again
' that which cannot be seen, cannot be heard, cannot be per-
ceived, cannot be conceived,' in the ordinary sense of these
words ; can be learnt, in fact, from the Veda only 2 . It was
in order to bring out this meaning that I translated arrutam
not by • not heard,' but by ' not hearable,' or, in better English,
by ' what cannot be heard V
1 In the Vedanta-Sara, Sadananda lays great stress on the fact that in this very
chapter of the iTAandogya-upanishad, the principal subject of the whole chapter
is mentioned both in the beginning and in the end. Tatra prakaranaprati-
padyasyarthasya tadadyantayor upadanam upakramasamharam. Yatha KAan-
dogyashash'AaprapaMake prakaranapratipidyagyadvittyavastmia ekam eva-
dvitiyam (VI, a, i) ityadav aitadatmyam idam sarvam (VI, 16, 3) ity ante *a
pratipadanam. ' The beginning with and ending with ' imply that the matter
to be declared in any given section is declared both at the beginning and at the
end thereof: — as, for instance, in the sixth section of the JSTAandogya-upanishad,
•the Real, besides which there is nought else' — which is to be explained in
that section — is declared at the outset in the terms, 'One only, without a second,'
and at the end in the terms ' All this consists of That.'
' Vedanta-Sara, No. 118, tatraivadvitiyavastuno manantaravishayfkaranam.
" See Muni. Up. 1, 1,6, adresyam agrahyam.
Digitized by
Google
XVI UPANISHADS.
Any classical scholar knows how often we must translate
invictus by invincible, and how Latin tolerates even
invictissimus, which we could never render in English by
' the most unconquered,' but ' the unconquerable.' English
idiom, therefore, and common sense required that av^"«ata
should be translated, not by inconceived, but by inconceiv-
able, if the translation was to be faithful, and was to give
to the reader a correct idea of the original.
Let us now examine some other translations, to see whether
the translators were satisfied with translating literally, or
whether they attempted to translate thoughtfully.
Anquetil Duperron's translation, being in Latin, cannot
help us much. He translates : ' Non auditum, auditum fiat ;
et non scitum, scitum ; et non cognitum, cognitum/
=" Rajendralal Mjtra translates : 'Have you enquired of your
tutor about that subject which makes the unheard-of heard,
the unconsidered considered, and the unsettled settled?'
He evidently knew that Brahman was intended, but his
rendering of the three verbs is not exact.
Mr. Gough (p. 43) translates : ' Hast thou asked for that
instruction by which the unheard becomes heard, the un-
thought thought, the unknown known?'
But now let us consult a scholar who, in a very marked
degree, always was a thoughtful translator, who felt a real
interest in the subject, and therefore was never satisfied with
mere words, however plausible. The late Dr. Ballantyne, in
his translation of the Vedanta-Sara 1 , had occasion to trans-
late this passage from the .O&ndogya-upanishad, and how
did he translate it? 'The eulogizing of the subject is the
glorifying of what is set forth in this or that section (of the
Veda) ; as, for example, in that same section, the sixth
chapter of the iOandogya-upanishad, the glorifying of the
Real, besides whom there is nought else, in the following
terms : " Thou, O disciple, hast asked for that instruction
whereby the unheard-of becomes heard, the inconceiv-
1 Lecture on the VedSnta, embracing the text of the Vedinta-SSra, Alla-
habad, 1851, p. 69. VedSntasata, with Nn'simha-Sarasvati's Subodhint, and
Ramatirtha's Vidvanmanora%ini, Calcutta, 1860, p. 89. Here we find the
right reading, aprakshai.
Digitized by
Google
INTRODUCTION. XVU
able becomes conceived, and the unknowable becomes
thoroughly known."'
Dr. Ballantyne therefore felt exactly what I felt, that in
our passage a strictly literal translation would be wrong,
would convey no meaning, or a wrong meaning ; and
Mr. Nehemiah Goreh will see that he ought not to express
blame, without trying to find out whether those whom he
blames for want of exactness, were not in reality more
scrupulously exact in their translation than he has proved
himself to be.
Mr. Nehemiah Goreh has, no doubt, great advantages in
interpreting the Upanishads, and when he writes without
any theological bias, his remarks are often very useful.
Thus he objects rightly, I think, to my translation of a
sentence in the same chapter of the ATAandogya-upanishad,
where the father, in answer to his son's question, replies :
'Sad eva, Somya, idam agra astd ekam evadvitlyam.' I
had tried several translations of these words, and yet I see
now that the one I proposed in the end is liable to be mis-
understood. I had translated : ' In the beginning, my dear,
there was that only which is, one only, without a second.'
The more faithful translation would have been : ' The being
alone was this in the beginning.' But ' the being' does not ,
mean in English that which is, to oi>, and therefore, to avoid
any misunderstanding, I translated ' that which is.' I might
have said, however, 'The existent, the real, the true (satyam)
was this in the beginning,' just as in the Aitareya-upani-
shad we read : ' The Self was all this, one alone, in the
beginning 1 .' But in that case I should have sacrificed the
gender, and this in our passage is of great importance,
being neuter, and not masculine.
What, however, is far more important, and where Mr.
Nehemiah Goreh seems to me to have quite misapprehended
the original Sanskrit, is this, that sat, to op, and atma, the
Self, are the subjects in these sentences, and not predicates.
Now Mr. Nehemiah Goreh translates: 'This was the ex-
istent one itself before, one only without a second ; ' and he
1 Atma v& idam eka ev&gra astt
[15] b
Digitized by
Google
XVU1 UPANISHADS.
explains : ' This universe, before it was developed in the
present form, was the existent one, Brahma, itself.' This
cannot be. If ' idam,' this, i. e. the visible world, were the
subject, how could the Upanishad go on and say, tad
aikshata bahu syam pra^-ayeyeti tat te^-o 's^^ata, ' that
thought, may I be many, may I grow forth. It sent forth
fire.' This can be said of the Sat only, that is, the
Brahman 1 . Sat, therefore, is the subject, not idam, for
a Vedantist may well say that Brahman is the world, or
sent forth the world, but not that the world, which is a
mere illusion, was, in the beginning, Brahman.
This becomes clearer still in another passage, Maitr. Up.
VI, 17, where we read : Brahma ha va idam agra asid eko
'nanta^, ' In the beginning Brahman was all this. He was
one, and infinite.' Here the transition from the neuter to
the masculine gender shows that Brahman only can be the
subject, both in the first and in the second sentence.
In English it may seem to make little difference whether
we say, ' Brahman was this,' or ' this was Brahman.' In
Sanskrit too we find, Brahma khalv idam vava sarvam,
' Brahman indeed is all this' (Maitr. Up. IV, 6), and Sarvaw
khalv idam Brahma, ' all this is Brahman indeed ' (KA&nd.
Up. Ill, 14, 1). But the logical meaning is always that
Brahman was all this, i. e. all that we see now, Brahman
being the subject, idam the predicate. Brahman becomes
idam, not idam Brahman.
Thus the Pa«£ada$i, 1, 1 8, says :
Ekadajendriyair yuktya jastre«apy avagamyate
Yavat \dmkid bhaved etad ida»«abdodita#z .fagat,
which Mr. A. Venis (Pandit, V, p. 667) translates : ' What-
ever may be apprehended through the eleven organs, by
argument and revelation, i. e. the world of phenomena, is
expressed by the word idam, this.' The Pa«£adaji then
goes on :
Idawz sarvam pura srishter ekam evadvitlyakam
Sad evastn namarupe nastam ity Aruwer v&kaA.
This Mr. Venis translates : • Previous to creation, all this
1 Sankara says (p. 398, 1. 5) : ekam evadvittyam paramarthata idam buddhi-
kale 'pi tat sad aikshata.
Digitized by
Google
INTRODUCTION. XIX
was the existent (sat), one only without a second : name and
form were not : — this is the declaration of the son of Aru«a.'
This is no doubt a translation grammatically correct, but
from the philosophical standpoint of the Vedanta, what is
really meant is that, before the smhri (which is not crea-
tion, but the sending forth of the world, and the sending
forth of it, not as something real, but as a mere illusion),
the Real alone, i.e. the Brahman, was, instead of this, i.e.
instead of this illusory world. The illusion was not, but the
Real, i.e. Brahman, was. What became, or what seemed to
change, was Brahman, and therefore the only possible
subject, logically, is Brahman, everything else being a pre-
dicate, and a phenomenal predicate only.
If I were arguing with a European, not with an Indian
scholar, I should venture to go even a step further, and try to
prove that the idam, in this and similar sentences, does not
mean this, i. e. this world, but that originally it was intended
as an adverb, meaning now, or here. This use of idam,
unsuspected by native scholars, is very frequent in Vedic
literature, and instances may be seen in Boehtlingk's Dic-
tionary. In that case the translation would be : ' The real
(to oi>), O friend, was here in the beginning.' This meaning
of idam, however, would apply only to the earliest utterances
of ancient Brahmavadins, while in later times idam was used
and understood in the sense of all that is seen, the visible uni-
verse, just as iyam by itself is used in the sense of the earth.
However, difficulties of this kind may be overcome, if
once we have arrived at a clear conception of the general
drift of the Upanishads. The real difficulties are of a very
different character. They consist in the extraordinary
number of passages which seem to us utterly meaningless
and irrational, or, at all events, so far-fetched that we can
hardly believe that the same authors who can express the
deepest thoughts on religion and philosophy with clearness,
nay, with a kind of poetical eloquence, could have uttered in
the same breath such utter rubbish. Some of the sacrificial
technicalities, and their philosophical interpretations with
which the Upanishads abound, may perhaps in time assume
a clearer meaning, when we shall have more fully mastered
b 2
Digitized by
Google
XX UPANISHADS.
the intricacies of the Vedic ceremonial. But there will
always remain in the Upanishads a vast amount of what
we can only call meaningless jargon, and for the presence
of which in these ancient mines of thought I, for my own
part, feel quite unable to account. ' Yes,' a friend of mine
wrote to me, after reading some of the Sacred Books of
the East, ' you are right, how tremendously ahead of other
sacred books is the Bible. The difference strikes one as
almost unfairly great.' So it does, no doubt. But some
of the most honest believers and admirers of the Bible
have expressed a similar disappointment, because they had
formed their ideas of what a Sacred Book ought to be,
theoretically, not historically. The Rev. J. M. Wilson, in
his excellent Lectures on the Theory of Inspiration, p. 32,
writes : ' The Bible is so unlike what you would expect ;
it does not consist of golden sayings and rules of life ; give
explanations of the philosophical and social problems of
the past, the present, and the future ; contain teachings
immeasurably unlike those of any other book ; but it con-
tains history, ritual, legislation, poetry, dialogue, prophecy,
memoirs, and letters; it contains much that is foreign to
your idea of what a revelation ought to be. But this is not
all. There is not only much that is foreign, but much that
is opposed, to your preconceptions. The Jews tolerated
slavery, polygamy, and other customs and cruelties of
imperfect civilisation. There are the vindictive psalms, too,
with their bitter hatred against enemies, — psalms which
we chant in our churches. How can we do so ? There are
stories of immorality, of treachery, of crime. How can we
read them?' Still the Bible has been and is a truly sacred,
because a truly historical book, for there is nothing more
sacred in this world than the history of man, in his search
after his highest ideals. All ancient books which have once
been called sacred by man, will have their lasting place in
the history of mankind, and those who possess the courage,
the perseverance, and the self-denial of the true miner, and
of the true scholar, will find even in the darkest and dustiest
shafts what they are seeking for, — real nuggets of thought,
and precious jewels of faith and hope.
Digitized by
Google
INTRODUCTION. XXI
I.
THE KA777A-UPANISHAD.
The KaA&a-upanishad is probably more widely known
than any other Upanishad. It formed part of the Persian
translation, was rendered into English by Rammohun Roy,
and has since been frequently quoted by English, French,
and German writers as one of the most perfect specimens
of the mystic philosophy and poetry of the ancient Hindus.
It was in the year 1845 that I first copied at Berlin the
text of this Upanishad, the commentary of Sankara(MS. 127
Chambers 1 ), and the gloss of Gopalayogin (MS. 224 Cham-
bers). The text and commentary of Sankara and the gloss
of Anandagiri have since been edited by Dr. Roer in the
Bibliotheca Indica, with translation and notes. There are
other translations, more or less perfect, by Rammohun Roy,
Windischmann, Poley, Weber, Muir, Regnaud, Gough, and
others. But there still remained many difficult and obscure
portions, and I hope that in some at least of the passages
where I differ from my predecessors, not excepting 6'ankara,
I may have succeeded in rendering the original meaning of
the author more intelligible than it has hitherto been.
The text of theJCa^a-upanishad is in some MSS. ascribed
to the Ya.g-ur-veda. In the Chambers MS. of the com-
mentary also it is said to belong to that Veda 2 , and in the
Muktikopanishad it stands first among the Upanishads of
the Black Ya^ur-veda. According to Colebrooke (Miscel-
laneous Essays, I, 96, note) it is referred to the Sama-veda
also. Generally, however, it -is counted as one of the
Atharva»a Upanishads.
The reason why it is ascribed to the Ya^ur-veda, is
probably because the legend of Na&ketas occurs in the
Brahmawa of the Taittiriya Ya^ur-veda. Here we read
(HI,* 8): >
Va^a^ravasa, wishing for rewards, sacrificed all his
MS. 133 is a mere copy of MS. 127.
Ya^urvede Ka/AavallJbhash) am.
Digitized by
Google
XX11 UPANISHADS.
wealth. He had a son, called Na&ketas. While he was
still a boy, faith entered into him at the time when the
cows that were to be given (by his father) as presents to
the priests, were brought in. He said: 'Father, to whom
wilt thou give me?' He said so a second and third time.
The father turned round and said to him: 'To Death, I
give thee.'
Then a voice said to the young Gautama, as he stood
up : ' He (thy father) said, Go away to the house of Death,
I give thee to Death.' Go therefore to Death when he is
not at home, and dwell in his house for three nights with-
out eating. If he should ask thee, 'Boy, how many nights
hast thou been here ? ' say, ' Three.' When he asks thee,
'What didst thou eat the first night?' say, 'Thy off-
spring.' 'What didst thou eat the second night?' say,
'Thy cattle.' 'What didst thou eat the third night?'
say, 'Thy good works.'
He went to Dea^h, while he was away from home, and
he dwelt in his house forthree nights without eating. When
Death returned, he asked : ' Boy, how many nights hast
thou been here?' He answered: 'Three.' 'What didst
thou eat the first night ?' ' Thy offspring.' ' What didst thou
eat the second night?' 'Thy cattle.' 'What didst thou eat
the third night ? ' ' Thy good works.'
Then he said: 'My respect to thee, O venerable sir!
Choose a boon.'
' May I return living to my father,' he said.
' Choose a second boon.'
' Tell me how my good works may never perish.'
--. Then he explained to him this Na^iketa fire (sacrifice),
and hence his good works do not perish.
' Choose a third boon.'
' Tell me the conquest of death again.'
Then he explained to him this (chief) Na^iketa fire
(sacrifice), and hence he conquered death again x .
This story, which in the Brahmawa is told in order to
explain the name of a certain sacrificial ceremony called
1 The commentator explains punar-mrityu as the death that follows after
the present inevitable death.
Digitized* by
Google
INTRODUCTION. XXUl
Na&keta. was used as a peg ^onwhkh_toJiang the doctrines
o ftheUpanishad . In its original form it may have constituted
one Adhyaya only, and the very fact of its division into two
Adhyayas may show that the compilers of the Upanishad
were still aware of its gradual origin. We have no means,
however, of determining its original form, nor should we even
be justified in maintaining that the first Adhyaya ever existed
by itself, and that the second was added at a much later
time. Whatever its component elements may have been
before it was an Upanishad, when it was an Upanishad it
consisted of six Vallis, neither more nor less.
The name of vaUt,_lit . creepe r, as a subd ivision o f a
Vedic work, is im port ant. It occurs again in the Taittirtya
Upanishads. Professor Weber thinks that valli, creeper, in
the sense of chapter, is based on a modern metaphor, and
was primarily intended for a creeper, attached to the jakhas
or branches of the Veda 1 . More likely, however, it was
used in the same sense as par van, a joint, a shoot, a
branch, i. e. a division.
Various attempts have been made to distinguish the
more modern from the more ancient portions of our Upani-
shad 2 . No doubt there are peculiarities of metre, gram-
mar, language, and thought which indicate the more
primitive or the more modern character of certain verses.
There are repetitions which offend us, and there are
several passages which are clearly taken over from other
Upanishads, where they seem to have had their original
place. Thirty-five years ago, when I first worked at this
Upanishad, I saw no difficulty in re-establishing what I
thought the original text of the Upanishad must have
been. I now feel that we know so little of the time and
the circumstances when these half-prose and half-metrical
Upanishads were first put together, that I should hesitate
1 History of Indian Literature, p. 93, note ; p. 157.
s Though it would be unfair to hold Professor Weber responsible for his
remarks on this and other questions connected with the Upanishads published
many years ago (Indische Studien, 1853, p. 197), and though I have hardly ever
thought it necessary to criticise them, some of his remarks are not without their
value even now.
Digitized by
Google
XXIV UPANISHADS.
before expunging even the most modern-sounding lines
from the original context of these Ved&ntic essays 1 .
The mention of Dhatrz, creator, for instance (KatA. Up.
II, 20), is certainly startling, and seems to have given rise
to a very early conjectural emendation. But dhat?7 and
vidh&tr/ occur in the hymns of the Rig-veda (X, 82, 2),
and in the Upanishads (Maitr. Up. VI, 8) ; and Dhitrz',
as almost a personal deity, is invoked with Pra^apati in
Rig-veda X, 184, 1. Deva, in the sense of God (Kat/i. Up.
II, 12), is equally strange, but occurs in other Upanishads
also (Maitr. Up. VI, 23 ; .SVetlrv. Up. I, 3). Much might
be said about setu, bridge (KatA. Up. Ill, 2 ; Mund. Up.
II, 2, 5), adar^a, mirror (KatA. Up. VI, 5), as being character-
istic of a later age. But setu is not a bridge, in our sense of
the word, but rather a wall, a bank, a barrier, and occurs
frequently in other Upanishads (Maitr. Up. VII, 7 ; AT^and.
Up. VIII, 4 ; Brih. Up. IV, 4, 22, &c), while adarras, or
mirrors, are mentioned in the B«Tiadara«yaka and the
.Srauta-sutras. Till we know something more about the
date of the first and the last composition or compilation of
the Upanishads, how are we to tell what subjects and what
ideas the first author or the last collector was familiar with ?
To attempt the impossible may seem courageous, but it is
hardly scholarlike.
With regard to faulty or irregular readings, we can never
know whether they are due to the original composers, the
compilers, the repeaters, or lastly the writers of the Upani-
shads. It is easy to say that adrejya (Mund. Up. 1, 1, 6)
ought to be admya ; but who would venture to correct that
form? Whenever that verse is quoted, it is quoted with
adr&rya, not adraya. The commentators themselves tell
us sometimes that certain forms are either Vedic or due to
carelessness (pramadapa/^a) ; but that very fact shows that
such a form, for instance, as samiyata ( Af^and. Up. 1, 1 2, 3)
rests on an old authority.
No doubt, if we have the original text of an author, and
can prove that his text was corrupted by later compilers
1 See Regnaud, Le Pessimisme Brahmanique, Annates du Musee Guimet,
1880 ; torn, i, p. 101.
Digitized by
Google
INTRODUCTION. XXV
or copyists or printers, we have a right to remove those
later alterations, whether they be improvements or corrup-
tions. But where, as in our case, we can never hope to gain
access to original documents, and where we can only hope,
by pointing out what is clearly more modern than the rest
or, it may be, faulty, to gain an approximate conception
of what the original composer may have had in his mind,
before handing his composition over to the safe keeping
of oral tradition, it is almost a duty to discourage, as
much as lies in our power, the work of reconstructing an
old text by so-called conjectural emendations or critical
omissions.
I have little doubt, for instance, that the three verses
16-18 in the first ValU of the KaA&a-upanishad are later
additions, but I should not therefore venture to remove
them. Death had granted three boons to Na£iketas, and
no more. In a later portion, however, of the Upanishad
(II, 3), the expression srmka vittamayt occurs, which I have
translated by ' the road which leads to wealth.' As it is
said that Na^iketas did not choose that srmka, some reader
must have supposed that a srmka was offered him by Death.
Srmka, however, meant commonly a string or necklace, and
hence arose the idea that Death must have offered a neck-
lace as an additional gift to Na/ftketas. Besides this, there
was another honour done to Na&ketas by Mrz'tyu, namely,
his allowing the sacrifice which he had taught him, to be
called by his name. This also, it was supposed, ought to have
been distinctly mentioned before, and hence the insertion
of the three verses 16-18. They are clumsily put in, for
after punar evaha,'he said again,' verse 16 ought not to have
commenced by tam abravit, ' he said to him.' They contain
nothing new, for the fact that the sacrifice is to be called
after Naftketas was sufficiently indicated by verse 19, 'This,
O Na£iketas, is thy fire which leads to heaven, which thou
hast chosen as thy second boon.' But so anxious was the
interpolator to impress upon his hearers the fact that the
sacrifice should in future go by that name, that, in spite
of the metre, he inserted tavaiva, 'of thee alone,' in
verse 19.
Digitized by
Google
XXVI UPANISHADS.
II.
THE MU7\rZ?AKA-UPANISHAD.
THIS is an Upanishad of the Atharva-veda. It is a
Mantra-upanishad, i. e. it has the form of a Mantra. But,
as the commentators observe, though it is written in
verse, it is not, like other Mantras, to be used for sacri-
ficial purposes. Its only object is to teach the highest
knowledge, the knowledge of Brahman, which cannot
be obtained either by sacrifices or by worship (upasana),
but by such teaching only as is imparted in the
Upanishad. A man may a hundred times restrain his
breath, &c, but without the Upanishad his ignorance
does not cease. Nor is it right to continue for ever in the
performance of sacrificial and other good works, if one
wishes to obtain the highest knowledge of Brahman. The
Sannyasin alone, who has given up everything, is qualified
to know and to become Brahman. And though it might
seem from Vedic legends that Grzhasthas also who con-
tinued to live with their families, performing all the duties
required of them by law, had been in possession of the highest
knowledge, this, we are told, is a mistake. Works and know-
ledge can be as little together as darkness and light.
This Upanishad too has been often translated since it
first appeared in the Persian translation of Dara Shukoh.
My own copy of the text and Ankara's commentary from
the MS. in the Chambers Collection was made in October
1844. Both are now best accessible in the Bibliotheca
Indica, where Dr. Roer has published the text, the com-
commentary by Sankara, a gloss by Ananda^«ana, and an
English translation with notes.
The title of the Upanishad, Mundaka, has not yet been
explained. The Upanishad is called Muwdaka-upanishad,
and its three chapters are each called Mundakam. Native
commentators explain it as the shaving Upanishad, that is,
as the Upanishad which cuts off the errors of the mind, like
a razor. Another Upanishad also is called Kshurika, the
razor, a name which is explained in the text itself as
Digitized by
Google
INTRODUCTION. XX VII
meaning an instrument for removing illusion and error.
The title is all the more strange because Muwrfaka, in its
commonest acceptation, is used as a term of reproach for
Buddhist mendicants, who are called ' Shavelings,' in oppo-
sition to the Brahmans, who dress their hair carefully, and
often display by its peculiar arrangement either their family
or their rank. Many doctrines of the Upanishads are, no
doubt, pure Buddhism, or rather Buddhism is on many points
the consistent carrying out of the principles laid down in
the Upanishads. Yet, for that very reason, it seems im-
possible that this should be the origin of the name, unless
we suppose that it was the work of a man who was, in one
sense, a Mundaka, and yet faithful to the Brahmanic law.
III.
THE TAITTIRlYAKA-UPANISHAD.
The Taittiriyaka-upanishad seems to have had its original
place in the Taittiriya-Ara«yaka. This Ara«yaka consists,
as Rajendralal Mitra has shown in the Introduction to his
edition of the work in the Bibliotheca Indica, of three por-
tions. Out of its ten Prapa/^akas, the first six form the
Arawyaka proper, or the Karma-ka#</a, as Sayawa writes.
Then follow Prapa//;akas VII, VIII, and IX, forming the
Taittiriyaka-upanishad ; and lastly, the tenth Prapa/^aka,
the Ya^-ftiki or Mahanarayawa - upanishad, which is called
a Khila, and was therefore considered by the Brahmans
themselves as a later and supplementary work.
.Sankara, in his commentary on the Taittiriyaka-upani-
shad, divides his work into three Adhyayas, and calls the
first Siksha-valli, the second the Brahmananda-vallJ, while
he gives no special name to the Upanishad explained in the
third Adhyaya. This, however, may be due to a mere
accident, for whenever the division of the Taittiriyaka-upani-
shad into Vallis is mentioned, we always have three 1 , the
1 .Sankara (ed. Roer, p. 14 1) himself speaks of two Vallts, teaching the
paramatmaf »ana (the SikshS-valif has nothing to do with this), and Anquetil
has Anandbli=Ananda-vallt, and Bharkbli=Bhr/gtt-vallJ.
Digitized by
Google
XXVU1 UPANISHADS.
«Siksha-valli, the Brahmananda-vallt, and the Blw'gu-valli 1 .
Properly, however, it is only the second Anuvaka of the
seventh PrapaAfcaka which deserves and receives in the text
itself the name of Sikshadhyaya, while the rest of the first
Valli ought to go by the name of Sawhita-upanishad 2 , or
Sawhiti-upanishad.
Sayawa 3 , in his commentary on the Taittiriya-arawyaka,
explains the seventh chapter, the .Sikshadhyaya (twelve
anuvakas), as Sawzhiti-upanishad. His commentary, how-
ever, is called Siksha-bhashya. The same Sayawa treats the
eighth and ninth Prapa/Aakas as the Viruwy-upanishad 4 .
The Ananda-valli and Bhr/gu-vallt are quoted among the
Upanishads of the Atharvawa 6 .
At the end of each Valli there is an index of the Anu-
vakas which it contains. That at the end of the first Valli
is intelligible. It gives the Pratikas, i. e the initial words,
of each Anuvaka, and states their number as twelve. At the
end of the first Anuvaka, we have the final words ' satyam
vadishyami,' and panka. ka, i. e. five short paragraphs at the
end. At the end of the second Anuvaka, where we expect
the final words, we have the initial, i. e. .rfksham, and then
panka, i. e. five sections in the Anuvaka. At the end of the
third Anuvaka, we have the final words, but no number of
sections. At the end of the fourth Anuvaka, we have the
final words of the three sections, followed by one para-
graph ; at the end of the fifth Anuvaka, three final words,
and two paragraphs, though the first paragraph belongs
clearly to the third section. In the sixth Anuvaka, we
have the final words of the two Anuvakas, and one para-
graph. In the seventh Anuvaka, there is the final word
1 The third Vallf ends with Bhrigur ity upanishat.
* See Taittirtyaka-upanishad, ed. Roer, p. 12.
8 See M. M., Alphabetisches Verzeichniss der Upanishads, p. 144.
4 The Anukramail of the Atreyt school (see Weber, Indische Stndien, II,
p. 208) of the Taittirtyaka gives likewise the name of Varun! to the eighth and
ninth PrapaMaka, while it calls the seventh Prapa/Aaka the Samhitt, and the
tenth PrapaMaka the Yag-tfiki-upanishad. That Anukramant presupposes, bow-
ever, a different text, as may be seen both from the number of Anuvakas, and
from the position assigned to the Ya^nikt as between the Samhitt and Varuni
Upanishads.
5 See M. M., Alphabetisches Verzeichniss der Upanishads.
Digitized by
Google
INTRODUCTION. XXIX
sarvam, and one paragraph added. In the eighth Anuvaka,
we have the initial word, and the number of sections, viz.
ten. In the ninth Anuvaka, there are the final words of one
section, and six paragraphs. In the tenth Anuvaka, there
is the initial word, and the number of paragraphs, viz. six.
In the eleventh Anuvaka, we have the final words of four
sections, and seven paragraphs, the first again forming an
integral portion of the last section. The twelfth Anuvaka
has one section, and five paragraphs. If five, then the sknti
would here have to be included, while, from what is said
afterwards, it is clear that as the first word of the Valli is
jam na^, so the last is vaktaram.
In the second Valli the index to each Anuvaka is given
at the end of the Valli.
ist Anuvaka : pratika : brahmavid, and some other catch-
words, idam, ayam, idam. Number of sections, ai.
2nd Anuvaka: pratika: annad, and other catchwords;
last word, pu£Ma. Sections, 26.
3rd Anuvaka: pratika: pra«am, and other catchwords;
last word, pukk/ta.. Sections, 2a.
4th Anuvaka: pratika: yata/*, and other catchwords;
last word, p\ikk/t&. Sections, 1 8.
5th Anuvaka : pratika : vi.g-wanam, and other catchwords ;
last word, pukMa. Sections, 23.
6th Anuvaka: pratika: asanneva, then atha (deest in
Taitt. Ar. 7). Sections, a8.
7th Anuvaka: pratika: asat. Sections, 16.
8th Anuvaka: pratika: bhishasmat, and other catch-
words; last word, upasankramati. Sections, 51.
9th Anuvaka : pratika: yataA — kutar£ana; then tam
(deest in Taitt. Ar.). Sections, 11.
In the third Valli the Anukramawi stands at the end.
1. The first word, bhriguA, and some other catchwords.
Sections, 13.
2. The first word, annam. Sections, 1a.
3. The first word, prawam. Sections, ia.
4. The first word, mana^. Sections, 1 a.
5. The first word, v\g wanam, and some other words. Sec-
tions, 1 a.
Digitized by
Google
XXX UPANISHADS.
6. The first word, ananda, and some other words. Sec-
tions, 10.
7. The first words, anma.m na nindyat, prawa^, ^ariram.
Sections, 11.
8. The first words, annam na pari£akshita, apo gyotih.
Sections, 11.
9. The first words, annam bahu kurvita p^'thivim aklra.
Sections, 11.
10. The first words, na ka«£ana. Sections 61. The last
words of each section are given for the tenth Anu-
vaka.
IV.
THE Bie/HADARAiVYAKA-UPANISHAD.
This Upanishad has been so often edited and discussed
that it calls for no special remarks. It forms paxt_j2f_the
6atapathaj2rihma»a. In the Madhyandina-jikha of that
Brlfimawa, which has been edited by Professor Weber,
the Upanishad, consisting of six adhyayas, begins with
the fourth adhyaya (or third prapaA&aka) of the fourteenth
book.
There is a commentary on the Brzhadarawyaka-upanishad
by Dviveda^rinarayawasunu Dvivedaganga, which has been
carefully edited by Weber in his great edition of the
.Satapatha-brahmawa from a MS. in the Bodleian Library,
formerly belonging to Dr. Mill, in which the Upanishad is
called Madhyandiniya-brahmawa-upanishad.
In the Ka«va-.rakha the Brz"hadara«yaka-upanishad forms
the seventeenth book of the Satapatha-brahmawa, consisting
of six adhyayas.
As Ankara's commentary and the gloss of Anandatirtha,
edited by Dr. Roer in the Bibliotheca Indica, follow the
Ka#va-.rakha, I have followed the same text in my trans-
lation.
Besides Dr. Roer's edition of the text, commentary, and
gloss of this Upanishad, there is Poley's edition of the text.
There is also a translation of it by Dr. Roer, with large
extracts from Sankara's commentary. 1
Digitized by
Google
INTRODUCTION. XXXI
V.
the svetAsvatara-upan!
The 6Vetajvatara-upanishad has been handed down as
one of the thirty-three Upanishads of the Taittiriyas, and
though this has been doubted, no real argument has ever
been brought forward to invalidate the tradition which
represents it as belonging to the Taittiriya or Black Ya^ur-
veda.
It is sometimes called .Svetajvatarawam Mantropanishad
(p. 274), and is frequently spoken of in the plural, as Sveta-
jvataropanishada^. At the end of the last Adhyaya we read
that Svetajvatara told it to the best among the hermits,
and that it should be kept secret, and not be taught to any
one except to a son or a regular pupil. It is also called
.Svetlrva 1 , though, it would seem, for the sake of the metre
only. The .SVetcLrvataras are mentioned as a Sakha 2 ,
subordinate to the /farakas ; but of the literature belonging
to them in particular, nothing is ever mentioned beyond
this Upanishad.
Svetajvatara means a white mule, and as mules were
known and prized in India from the earliest times, .Sveta-
jvatara, as the name of a person, is no more startling than
.Svetajva, white horse, an epithet of Ar^f una. Now as no
one would be likely to conclude from the name of one of
the celebrated Vedic .fo'shis, Syavajva, i.e. black horse,
that negro influences might be discovered in his hymns, it
is hardly necessary to say that all speculations as to Chris-
tian influences, or the teaching of white Syro-Christian
missionaries, being indicated by the name of .Svetajvatara,
are groundless 3 .
The .SVetlrvatara-upanishad holds a very high rank
among the Upanishads. Though we cannot say that it
is quoted by name by Badarayawa in the Vedanta-sfltras,
1 V&iaspatyam, p. 1222.
3 Catal. Bodl. p. 271 a ; p. 222 a.
' See Weber, Ind. Stud. I, pp. 400, 421.
Digitized by
Google
XXXU UPANISHADS.
it is distinctly referred to as jruta or revealed 1 . It is one
of the twelve Upanishads chosen by Vidyarawya in his
Sarvopanishad-arthanabhutipraklra, and it was singled out
by .Sankara as worthy of a special commentary.
The >SVetajvatara-upanishad seems to me one of the
most difficult, and at the same time one of the most
interesting works of its kind. Whether on that and on
other grounds it should be assigned to a more ancient or to
a more modern period is what, in the present state of our
knowledge, or, to be honest, of our ignorance of minute
chronology during the Vedic period, no true scholar would
venture to assert. We must be satisfied to know that, as
a class, the Upanishads are presupposed by the Kalpa-
sutras, that some of them, called Mantra-upanishads, form
part of the more modern Sawhitas, and that there are
portions even in the Rig-veda-sawhita 2 for which the
name of Upanishad is claimed by the Anukramawis. We
find them most frequent, however, during the Brahma#a-
period, in the Brahma«as themselves, and, more especially,
in those portions which are called Arawyakas, while a large
number of them is referred to the Atharva-veda. That,
in imitation of older Upanishads, similar treatises were
composed to a comparatively recent time, has, of course,
long been known 3 .
But when we approach the question whether among the
ancient and genuine Upanishads one may be older than
the other, we find that, though we may guess much, we
can prove nothing. The Upanishads belonged to Parishads
or settlements spread all over India. There is a stock of
ideas, even of expressions, common to most of them. Yet,
the ideas collected in the Upanishads cannot all have grown
up in one and the same place, still less in regular succes-
sion. They must have had an independent growth, deter-
mined by individual and local influences, and opinions
which in one village might seem far advanced, would in
another be looked upon as behind the world. We may
1 See Deussen, Vedanta, p. 24; Ved. Stea I, 1, 11; I, 4, 8; II, 3, 22.
* See Sacred Books of the East, vol. i, p. lxvi.
8 Loc. cit. p. lxvii.
Digitized by
Google
INTRODUCTION. XXX1U
admire the ingeniousness of those who sometimes in this,
sometimes in that peculiarity see a clear indication of the
modern date of an Upanishad, but to a conscientious
scholar such arguments are really distasteful for the very
sake of their ingeniousness. He knows that they will
convince many who do not know the real difficulties ; he
knows they will have to be got out of the way with no
small trouble, and he knows that, even if they should prove
true in the end, they will require very different support
from what they have hitherto received, before they can be
admitted to the narrow circle of scientific facts.
While fully admitting therefore that the Svetajvatara-
upanishad has its peculiar features and its peculiar difficul-
ties, I must most strongly maintain that no argument that
has as yet been brought forward, seems to me to prove, in
any sense of the word, its modern character.
It has been said, for instance, that the .Svetlrvatara-
upanishad is a sectarian Upanishad, because, when speak-
ing of the Highest Self or the Highest Brahman, it applies
such names to him as Hara (1, 10), Rudra (II, 17; III, 2 ; 4 ;
IV, 12; 21; 22), Siva (III, 14; IV, 10), Bhagavat (III, 14),
Agni, Aditya, Vayu, &c. (IV, 2). But here it is simply
taken for granted that the idea of the Highest Self was
developed first, and, after it had reached its highest purity,
was lowered again by an identification with mythological and
personal deities. The questions whether the conception of
the Highest Self was formed once and once only, whether
it was formed after all the personal and mythological deities
had first been merged into one Lord (Pra^apati), or whether
it was discovered behind the veil of any other name in the
mythological pantheon of the past, have never been mooted.
Why should not an ancient Rtshi have said : What we
have hitherto called Rudra, and what we worship as Agni,
or Siva, is in reality the Highest Self, thus leaving much of
the ancient mythological phraseology to be used with a
new meaning ? Why should we at once conclude that late
sectarian worshippers of mythological gods replaced again
the Highest Self, after their fathers had discovered it,
by their own sectarian names? If we adopt the former
C'53* c
Digitized by
Google
XXXIV UPANISHADS.
view, the Upanishads, which still show these rudera of
the ancient temples, would have to be considered as more
primitive even than those in which the idea of the Brah-
man or the Highest Self has reached its utmost purity. .
It has been considered a very strong argument in sup-
port of the modern and sectarian character of the 5veta-
jvatara-upanishad, that 'it inculcates what is called Bhakti 1 ,
or implicit reliance on the favour of the deity worshipped."
Now it is quite true that this Upanishad possesses a very
distinct character of its own, by the stress which it lays on
the personal, and sometimes almost mythical character of
the Supreme Spirit ; but, so far from inculcating bhakti,
in the modern sense of the word, it never mentions that
word, except in the very last verse, a verse which, if neces-
sary, certain critics would soon dispose of as a palpable
addition. But that verse says no more than this : ' If these
truths (of the Upanishad) have been told to a high-minded
man, who feels the highest devotion for God, and for his
Guru as for God, then they will shine forth indeed.' Does
that prove the existence of Bhakti as we find it in the
.SawaTilya-sutras 2 ?
Again, it has been said that the .Svetarvatara-upanishad
is sectarian in a philosophical sense, that it is in fact an
Upanishad of the Sankhya system of philosophy, and not
of the Vedanta. Now I am quite willing to admit that, in
its origin, the Vedanta philosophy is nearer to the Vedic
literature than any other of the six systems of philosophy,
and that if we really found doctrines, peculiar to the San-
khya, and opposed to the Vedanta, in the Svetajvatara-
upanishad, we might feel inclined to assign to our Upani-
shad a later date. But where is the proof of this ?
No doubt there are expressions in this Upanishad which
remind us of technical terms used at a later time in the
Sankhya system of philosophy, but of Sankhya doctrines,
which I had myself formerly suspected in this Upanishad,
1 Weber, Ind. Stud. I, 422; and History of Indian Literature, p. 238.
1 The Aphorisms of SiWilya, or the Hindu Doctrine of Faith, translated by
E. B. Cowell, Calcutta, 1878.
Digitized by
Google
INTRODUCTION. XXXV
I can on closer study find very little. I think it was
Mr. Gough who, in his Philosophy of the Upanishads, for
the first time made it quite clear that the teaching of our
Upanishad is, in the main, the same as that of the other
Upanishads. ' The Svetlyvatara-upanishad teaches,' as he
says, 'the unity of souls in the one and only Self; the
unreality of the world as a series of figments of the self-
feigning world-fiction ; and as the first of the fictitious
emanations, the existence of the Demiurgos or universal
soul present in every individual soul, the deity that projects
the world out of himself, that the migrating souls may find
the recompense of their works in former lives.'
I do not quite agree with this view of the Ijvara, whom
Mr. Gough calls the Demiurgos, but he seems to me per-
fectly right when he says that the Svetajvatara-upanishad
propounds in Sankhya terms the very principles that the
Sankhya philosophers make it their business to subvert.
One might doubt as to the propriety of calling certain
terms 'Sankhya terms' in a work written at a time when
a Sankhya philosophy, such as we know it as a system,
had as yet no existence, and when the very name sankhya
meant something quite different from the Sankhya system
of Kapila. Sankhya is derived from sankhya, and that
meant counting, number, name, corresponding very nearly
to the Greek \6yos, Sankhya, as derived from it, meant
originally no more than theoretic philosophy, as opposed
to yoga, which meant originally practical religious exer-
cises and penances, to restrain the passions and the senses
in general. All other interpretations of these words, when
they had become technical names, are of later date.
But even in their later forms, whatever we may think of
the coincidences and differences between the Sankhya and
Vedanta systems of philosophy, there is one point on which
they are diametrically opposed. Whatever else the San-
khya may be, it is dualistic ; whatever else the Vedanta
may be, it is monistic. In the Sankhya, nature, or whatever
else we may call it, is independent of the purusha ; in the
Vedanta it is not. Now the Svetlsvatara-upanishad states
distinctly that nature, or what in the Sankhya philosophy
c 2
Digitized by
Google
XXXVI UPANISHADS.
is intended by Pradhlna, is not an independent power, but
a power (jakti) forming the very self of the Deva. ' Sages,'
we read, 'devoted to meditation and concentration, have
seen the power belonging to God himself, hidden in its own
qualities.'
What is really peculiar in the .SvetiLrvatara-upanishad is
the strong stress which it lays on the personality of the
Lord, the i^vara. Deva, in the passage quoted, is perhaps
the nearest approach to our own idea of a personal God,
though without the background which the Vedanta always
retains for it. It is God as creator and ruler of the world,
as ijvara, lord, but not as Paramatman, or the Highest Self.
The Paramatman constitutes, no doubt, his real essence,
but creation and creator have a phenomenal character
only \ The creation is maya, in its original sense of work,
then of phenomenal work, then of illusion. The creator
is mayin, in its original sense of worker or maker, but
again, in that character, phenomenal only 2 . The Guwas
or qualities arise, according to the Vedanta, from prakn'ti
or maya, within, not beside, the Highest Self, and this
is the very idea which is here expressed by ' the Self-power
of God, hidden in the guwas or determining qualities.' How
easily that sakti or power may become an independent
being, as Maya, we see in such verses as :
Sarvabhuteshu sarvatman ya jaktir aparabhava
Guwa^raya namas tasyai jajvatayai parejvara 3 .
But the important point is this, that in the .Svetajvatara-
upanishad this change has not taken place. Throughout
the whole of it we have one Being only, as the cause of
everything, never two. Whatever Sankhya philosophers
of a later date may have imagined that they could discover
in that Upanishad in support of their theories 4 , there is not
one passage in it which, if rightly interpreted, not by itself,
but in connection with the whole text, could be quoted in
1 Prathamam tsvaratmana mayirflpenavatishfiate brahma ; see p. 280, 1. 5.
8 M&y! srigate sarvam etat.
8 See p. 279, 1. 5. Sarvfitman seems a vocative, like pareivara.
* .See Sarvadarsanasangraha, p. 152.
Digitized by
Google
INTRODUCTION. XXXV11
support of a dualistic philosophy such as the Sankhya, as
a system, decidedly is.
If we want to understand, what seems at first sight contra-
dictory, the existence of a God, a Lord, a Creator, a Ruler,
and at the same time the existence of the super-personal
Brahman, we must remember that the orthodox view of
the Vedanta 1 is not what we should call Evolution, but
Illusion. Evolution of the Brahman, or Pariwama, is hete-
rodox, illusion or Vivarta is orthodox Vedanta. Brahman
is a concept involving such complete perfection that with it
evolution, or a tendency towards higher perfection, is im-
possible. If therefore there is change, that change can
only be illusion, and can never claim the same reality as
Brahman. To put it metaphorically, the world, according
to the orthodox Vedantin, does not proceed from Brahman
as a tree from a germ, but as a mirage from the rays of the
sun. The world is, as we express it, phenomenal only, but
whatever objective reality there is in it, is Brahman, 'das
Ding an sich/ as Kant might call it.
Then what is Ijvara or Deva, the Lord or God ? The
answers given to this question are not very explicit. His-
torically, no doubt, the idea of the t^vara, the personal
God, the creator and ruler, the omniscient and omnipotent,
existed before the idea of the absolute Brahman, and
after the idea of the Brahman had been elaborated, the
difficulty of effecting a compromise between the two ideas,
had to be overcome, Isvara, the Lord, is Brahman, for what
else could he be ? But he is Brahman under a semblance,
the semblance, namely, of a personal creating and govern-
ing God. He is not created, but is the creator, an office
too low, it was supposed, for Brahman. The power which
enabled t^vara to create, was a power within him, not inde-
pendent of him, whether we call it Devatmajakti, Maya,
or Yrakriti. That power is really inconceivable, and it
has assumed such different forms in the mind of different
Vedantists, that in the end Maya herself is represented as
the creating power, nay, as having created l^vara himself.
1 Vedantaparibhasha, in the Pandit, vol. iv, p. 496.
Digitized by LaOOQ 1C
XXXV111 UPANISHADS.
In our Upanishad, however, f jvara is the creator, and
though, philosophically speaking, we should say that he was
conceived as phenomenal, yet we must never forget that
the phenomenal is the form of the real, and l^vara there-
fore an aspect of Brahman 1 . 'This God,' says Pramada
Dasa Mitra 2 , 'is the spirit conscious of the universe.
Whilst an extremely limited portion, and that only of the
material universe, enters into my consciousness, the whole
of the conscious universe, together, of course, with the
material one that hangs upon it, enters into the conscious-
ness of God.' And again, 'Whilst we (the ^-ivatmans)
are subject to Maya, Maya is subject to l^vara. If we
truly know I^vara, we know him as Brahman ; if we truly
know ourselves, we know ourselves as Brahman. This
being so, we must not be surprised if sometimes we find
fjvara sharply distinguished from Brahman, whilst at other
times Ijvara and Brahman are interchanged.'
Another argument in support of the sectarian character
of the .SVetajvatara-upanishad is brought forward, not by
European students only, but by native scholars, namely,
that the very name of Kapila, the reputed founder of the
Sankhya philosophy, occurs in it. Now it is quite true
that if we read the second verse of the fifth Adhyaya by
itself, the occurrence of the word Kapila may seem startling.
But if we read it in connection with what precedes and fol-
lows, we shall see hardly anything unusual in it. It says :
'It is he who, being one only, rules over every germ
(cause), over all forms, and over all germs ; it is he who,
in the beginning, bears in his thoughts the wise son, the
fiery, whom he wished to look on while he was born.'
Now it is quite clear to me that the subject in this verse
is the same as in IV, 1 1, where the same words are used,
and where yo yoniwz yonim adhitish/Aaty eka^ refers clearly
to Brahman. It is equally clear that the prasuta, the son,
the offspring of Brahman, in the Vedanta sense, can only
be the same person who is elsewhere called Hirawyagarbha,
1 Savisesham Brahma, or sabalam Brahma.
a Journal of the Royal Asiatic Society, 1878, p. 40.
Digitized by
Google
INTRODUCTION. XXXIX
the personified Brahman. Thus we read before, III, 4,
' He the creator and supporter of the gods, Rudra, the great
seer (maharshi), the lord of all, formerly gave birth to
Hirawyagarbha;' and in IV, 11, we have the very expres-
sion which is used here, namely, 'that he saw Hirawya-
garbha being born.' Unfortunately, a new adjective is
applied in our verse to Hirawyagarbha, namely, kapila,
and this has called forth interpretations totally at variance
with the general tenor of the Upanishad. If, instead of
kapilam, reddish, fiery 1 , any other epithet had been used
of Hirawyagarbha, no one, I believe, would have hesitated
for a moment to recognise the fact that our text simply
repeats the description of Hira«yagarbha in his relation
to Brahman, for the other epithet rishim, like maharshim,
is too often applied to Brahman himself and to Hira«ya-
garbha to require any explanation.
But it is a well known fact that the Hindus, even as early
as the Brahma#a-period, were fond of tracing their various
branches of knowledge back to Brahman or to Brahman
Svayambhu and then through Pra.fapati, who even in the
Rig-veda (X, 121, 10) replaces Hirawyagarbha, and some-
times through the Devas, such as Mrityu, Vayu, Indra,
Agni 2 , &c, to the various ancestors of their ancient families.
In the beginning of the Muwrfakopanishad we are told
that Brahman told it to Atharvan, Atharvan to Angir,
Ahgir to Satyavaha Bharadva^a, Bharadva^a to Angiras,
Ahgiras to .Saunaka. Manu, the ancient lawgiver, is called
both Hairawyagarbha and Svayambhuva, as descended from
Svayambhu or from Hirawyagarbha 3 . Nothing therefore
was more natural than that the same tendency should have
led some one to assign the authorship of a great philoso-
phical system like the Sankhya to Hirawyagarbha, if not
to Brahman Svayambhu. And if the name of Hirawya-
garbha had been used already for the ancestors of other
sages, and the inspirers of other systems, what could be
more natural than that another name of the same Hirawya-
1 Other colours, instead of kapila, are ntla, harita, lohitaksha ; see IV, 1; 4.
' See Vanua-brahmana, ed. Burnell, p. 10; Brihadaranyaka-up. pp. 185, 324.
8 See M. M., India, p. 372.
Digitized by
Google
xl UPANISHADS.
garbha should be chosen, such as Kapila. If we are told
that Kapila handed his knowledge to Asuri, Asuri to Pan-
£&rikha, this again is in perfect keeping with the character
of literary tradition in India. Asuri occurs in the Vamsas
of the .Satapatha-brahmawa (see above, pp. 187, 336) ; Tanka-
jikha 1 , having five tufts, might be either a general name or
a proper name of an ascetic, Buddhist or otherwise. He is
quoted in the Sankhya-sutras, V, 32 ; VI, 68.
But after all this was settled, after Kapila had been
accepted, like Hirawyagarbha, as the founder of a great
system of philosophy, there came a reaction. People had
now learnt to believe in a real Kapila, and when looking out
for credentials for him, they found them wherever the word
Kapila occurred in old writings. The question whether
there ever was a real historical person who took the name
of Kapila and taught the Sankhya-sutras, does not concern
us here. I see no evidence for it. What is instructive is
this, that our very passage, which may have suggested at
first the name of Kapila, as distinct from Hirawyagarbha
Kapila, was later on appealed to to prove the primordial
existence of a Kapila, the founder of the Sankhya philo-
sophy. However, it requires but a very slight acquaintance
with Sanskrit literature and very little reflection in order
to see that the author of our verse could never have dreamt
of elevating a certain Kapila, known to him as a great
philosopher, if there ever was such a man, to a divine rank 2 .
Hira«yagarbha kapila may have given birth to Kapila, the
hero of the Sankhya philosophers, but Kapila, a real human
person, was never changed into Hirawyagarbha kapila.
Let us see now what the commentators say. .Sankara
first explains kapilam by kanakas 3 kapilavar«am . . . .
Hira«yagarbham. Kapilo 'gra^a iti pura»ava£anat. Ka-
pilo Hirawyagarbho va nirdijyate. But he afterwards quotes
some verses in support of the theory that Kapila was a
1 For fuller information on Pa££ankha, Kapila, &c, see F. Hall's Preface
to Sankhya-pravafana-bhashya, p. 9 seq. ; Weber, Ind. Stud. I, p. 433.
1 Weber, Hist, of Indian Literature, p. 236.
* This ought to be Kanakavarnam, and I hope will not be identified with the
name of Buddha in a former existence.
Digitized by
Google
INTRODUCTION. xli
Paramarshi, a portion of Vish«u, intended to destroy error
in the Krrta Yuga, a teacher of the Sankhya philosophy.
Vig«anatman explains the verse rightly, and without any
reference to Kapila, the Sankhya teacher.
•Sankarananda goes a step further, and being evidently
fully aware of the misuse that had been made of this
passage, even in certain passages of the Mahabharata
(XII, 13254, 13703), and elsewhere, declares distinctly that
kapila cannot be meant for the teacher of the Sankhya
(na tu sankhyapraweta kapila^, namamatrasamyena tad-
graha«e syad atiprasangaA). He is fully aware of the true
interpretation, viz. avyakrztasya prathamakaryabhutaw
kapilaw vi£itravar«a/# g «anakriya.raktyatmaka/« Hirawya-
garbham ityarthaA, but he yields to another temptation,
and seems to prefer another view which makes Kapila
Vasudevasyavatarabhutaw* Sagaraputrawaw/ dagdharam, an
Avatara of Vasudeva, the burner of the sons of Sagara.
What vast conclusions may be drawn from no facts, may
be seen in Weber's Indische Studien, vol. i, p. 430, and even
in his History of Indian Literature, published in 1878.
Far more difficult to explain than these supposed allu-
sions to the authors and to the teaching of the Sankhya
philosophy are the frequent references in the .Svetlsvatara-
upanishad to definite numbers, which are supposed to point
to certain classes of subjects as arranged in the Sankhya
and other systems of philosophy. The Sankhya philosophy
is fond of counting and arranging, and its very name is
sometimes supposed to have been chosen because it num-
bers (sankhya) the subjects of which it treats. It is certainly
true that if we meet, as we do in the .SVetlrvatara-upani-
shad, with classes of things 1 , numbered as one, two, three,
five, eight, sixteen, twenty, forty-eight, fifty and more, and
if some of these numbers agree with those recognised in
the later Sankhya and Yoga systems, we feel doubtful as to
whether these coincidences are accidental, or whether, if not
accidental, they are due to borrowing on the part of those
later systems, or on the part of the Upanishads. I feel
1 See 1,4; 5; VI, 3.
Google
Digitized by '
xlii UPANISHADS.
it impossible to come to a decision on this point. Even so
early as the hymns of the Rig-veda we meet with these
numbers assigned to days and months and seasons, rivers
and countries, sacrifices and deities. They clearly prove the
existence of a considerable amount of intellectual labour
which had become fixed and traditional before the com-
position of certain hymns, and they prove the same in the
case of certain Upanishads. But beyond this, for the
present, I should not like to go ; and I must say that
the attempts of most of the Indian commentators at ex-
plaining such numbers by a reference to later systems of
philosophy or cosmology, are generally very forced and
unsatisfactory.
One more point I ought to mention as indicating the age
of the .Sveta\yvatara-upanishad, and that is the obscurity of
many of its verses, which may be due to a corruption of the
text, and the number of various readings, recognised as
such, by the commentators. Some of them have been
mentioned in the notes to my translation.
The text of this Upanishad was printed by Dr. Roer in
the Bibliotheca Indica, with Sankara's commentary. I have
consulted besides, the commentary of Vj^nanatman, the
pupil of Paramahawsa-parivra^akaMrya-jrfma^-Gnanotta-
ma£arya, MS. I. O. 1133; and a third commentary, by
.Sankarananda, the pupil of Paramaha/«sa-parivra£-aka£ar-
yanandatman, MS. I. 0. 1878. These were kindly lent me
by Dr. Rost, the learned and liberal librarian of the India
Office.
VI.
PRAS^A-UPANISHAD.
This Upanishad is called the Pra-rwa or Sha^-prarna-
upanishad, and at the end of a chapter we find occasionally
iti prajrtaprativa^anam, i.e. thus ends the answer to the
question. It is ascribed to the Atharva-veda, and occa-
sionally to the Pippalada-jakha, one of the most important
jakhas of that Veda. Pippalada is mentioned in the
Upanishad as the name of the principal teacher.
.Sahkara, in the beginning of his commentary, says:
Digitized by
Google
INTRODUCTION. xliii
Mantroktasyarthasya vistaranuvadidam Brahmawam ara-
bhyate, which would mean 'this Brahma«a is commenced
as more fully repeating what has been declared in the
Mantra.' This, however, does notead svin jarirad ; in VI, 27, ya«
jarirasya. Such a change seems phonetically so unnatural,
that the tradition must have been very strong to perpetuate
it among the Maitraya«as.
Now what is important for our purposes is this, that these
phonetic peculiarities run through all the seven chapters of
our Upanishad. This will be seen from the following list :
I. Final as changed into a before initial vowel 1 :
II, 3, tigmategaja urdhvaretaso (Comm. eta^Makha-
sanketapa/^aj MandasaA sarvatra).
II, 5, vibodha evam. II, 7, avasthita iti.
1 I have left out the restriction as to the accent of the vowels, because
they are disregarded in the Upanishad. It should be observed that this peculiar
Sandhi occurs in the Upanishad chiefly before iti.
Digitized by
Google
INTRODUCTION. xl
IX
III, 5, etair abhibhuta iti. IV, i, vidyata iti.
VI, 4, pra«ava iti ; bhumyadaya eko.
VI, 6, aditya iti ; ahavaniya iti ; surya iti ; ahankara
iti ; vyana iti. VI, 7, bharga iti.
VI, 7, sannivish/a iti. VI, 23, deva orikaro.
VI, 30, prayata iti. VI, 30, vinirgata iti.
II. Final e before initial vowels becomes a. For
instance :
I, 4, dmyata iti. II, 2, nishpadyata iti.
III, 2, apadyata iti. Ill, 2, pushkara iti.
IV, 1, vidyata iti. VI, 10, bhunkta iti.
VI, 20, amuta iti. VI, 30, eka ahur.
Even pragnhya e is changed to a in —
VI, 23, eta upasita, i. e. ete uktalakshawe brahma«t.
In VI, 31, instead of te etasya, the commentator seems to
have read te va etasya.
III. Final as before a, u, and au becomes a, and is then
contracted. For instance :
I, 4, vanaspatayodbhuta, instead of vanaspataya
udbhuta. (Comm. SandhLr Mandaso va, ukaro
vatra lupto drash/avyaA.)
II, 6, devaushwyam, instead of deva aushwyam.
(Comm. Sandhu MandasaA.)
VI, 24, atamavish/am, instead of atama-avish/am
(Comm. SandhLr Mandasa^); cf. KhknA. Up.
VI, 8, 3, aranayeti (Comm. visar^ntyalopa^).
IV. Final e before i becomes a, and is then contracted.
For instance :
VI, 7, atma ^aniteti for ^anita iti. (Comm. ^anlte,
^anati.)
VI, 28, ava/aiva for avata iva. (Comm. Sandhi-
vmldhi Mandase.)
V. Final au before initial vowels becomes a. For in-
stance:
II, 6, yena va eta anug^hita iti.
VI, 22, asa abhidhyata.
On abhibhuyamanay iva, see p. 295, note 2.
V, 2, asa atma (var. lect. asav atma).
C'5] d
Digitized by
Google
1 UPANISHADS.
VI. Final o of atho produces elision of initial a. For
instance :
III, 2, atho 'bhibhutatvat. (Comm. SandhLr kkkn-
dasaA.) Various reading, ato 'bhibhutatvat.
VI, i, so antar is explained as sa u.
VII. Other irregularities :
VI, 7, apo pyayanat, explained by pyayanat and
apyayanat. Might it be, apo 'py ayanat ?
VI, 7, atmano tma neta.
II, 6, so tmanam abhidhyatva.
VI, 35, dvidharmondham for dvidharmandham.
(Comm. ^andasa.)
VI, 35, tefasendham, i.e. te^asa-iddhan. (In explain-
ing other irregular compounds, too, as in I, 4, the
commentator has recourse to a ^andasa or pra-
madika licence.)
VI, 1, hira/zyavasthat for hirawyavasthat. Here
the dropping of a in avasthat is explained by
a reference to Bhaguri (vashri Bhagurir allopam
avapyor upasargayo^). See Vopadeva III, 171.
VIII. Virlishtepatha :
VII, 2, brahmadhiyalambana. (Comm. vLrlishta-
patha-f Mandasa/z.)
VI, 35, apyay ahkura for apy ankura. (Comm.
yakaraA pramadapa;/&ita/z.)
On the contrary VI, ^^, vltyante for viltyante.
If on the grounds which we have hitherto examined there
seems good reason to ascribe the Maitraya/za-brahma«a-
upanishad to an early rather than to i. late period, possibly
to an ante-Pa«inean period, we shall hardly be persuaded to
change this opinion on account of supposed references to
Vaish«ava or to Bauddha doctrines which some scholars
have tried to discover in it.
As to the worship of Vish/zu, as one of the many mani-
festations of the Highest Spirit, we have seen it alluded to
in other Upanishads, and we know from the Brahmawas
that the name of Vishwu was connected with many of the
earliest Vedic sacrifices.
Digitized by
Google
INTRODUCTION. li
As to Bauddha doctrines, including the very name of
Nirvawa (p. xlvi, 1. 19), we must remember, as I have often
remarked, that there were Bauddhas before Buddha. Bn'ha-
spati, who is frequently quoted in later philosophical writings
as the author of an heretical philosophy, denying the au-
thority of the Vedas, is mentioned by name in our Upanishad
(VII, 9), but we are told that this Bn'haspati, having become
6ukra, promulgated his erroneous doctrines in order to mis-
lead the Asuras, and thus to insure the safety of Indra, i.e. of
the old faith.
The fact that the teacher of King Bn'hadratha in our
Upanishad is called .Sakayanya, can never be used in sup-
port of the idea that, being a descendant of Saka 1 , he must
have been, like Sakyamuni, a teacher of Buddhist doctrines.
He is the very opposite in our Upanishad, and warns his
hearers against such doctrines as we should identify with
the doctrines of Buddha. As I have pointed out on several
occasions, the breaking through the law of the Ajramas is .
the chief complaint which orthodox Brahmans make against
Buddhists and their predecessors, and this is what .Saka-
yanya condemns. A Brahman may become a Sannyasin,
which is much the same as a Buddhist Bhikshu, if he has
first passed through the three stages of a student, a house-
holder, and a Vanaprastha. But to become a Bhikshu
without that previous discipline, was heresy in the eyes of
the Brahmans, and it was exactly that heresy which the
Bauddhas preached and practised. That this social laxity
was gaining ground at the time when our Upanishad was
written is clear (see VII, 8). We hear of people who wear red
dresses (like the Buddhists) without having a right to them ;
we even hear of books, different from the Vedas, against
which the true Brahmans are warned. All this points to
times when what we call Buddhism "was in the air, say the
sixth century B. c, the very time to which I have always
assigned the origin of the genuine and classical Upanishads.
The Upanishads are to my mind the germs of Buddhism,
1 Sakayanya means a grandson or further descendant of Saka; see Ganaratnli-
vall (Baroda, 1874), p. 57".
d2
Digitized by
Google
Hi UPANISHADS.
while Buddhism is in many respects the doctrine of the
Upanishads carried out to its last consequences, and, what is
important, employed as the foundation of a new social
system. In doctrine the highest goal of the Vedanta, the
knowledge of the true Self, is no more than the Buddhist
Samyaksambodhi ; in practice the Sannyasin is the Bhikshu,
the friar, only emancipated alike from the tedious discipline
of the Brahmanic student, the duties of the Brahmanic
householder, and the yoke of useless penances imposed on
the Brahmanic dweller in the forest. The spiritual freedom
of the Sannyasin becomes in Buddhism the common pro-
perty of the Sangha, the Fraternity, and that Fraternity is
open alike to the young and the old, to the Brahman and
the Sudra, to the rich and the poor, to the wise and the
foolish. In fact there is no break between the India of
the Veda and the India of the Tripi/aka, but there is an
historical continuity between the two, and the connecting
link between extremes that seem widely separated must
be sought in the Upanishads 1 .
F. MAX MULLER.
Oxford, February, 1884.
1 As there is room left on this page, I subjoin a passage from the Abhi-
dharma-kosha-vyakhyl, ascribed to the Bhagavat, but which, as far as style and
thonght are concerned, might be taken from an Upanishad : Uktant hi Bhaga-
vata : Prithivt bho Gautama kutra pratishMita ? Pn'thivi Brahmana abmanrfale
pratishrtita. Abmanrfalam bho Gautama kva pratish'Aitam ? Vayau pratish-
Mitam. Vayur bho Gautama kva pratishlAitaA ? Akase pratish/AitaA. Akasam
bho Gautama kutra pratishfAitam? Atisarasi Mahabrahmana, atisarasi Maha-
brahmana. Akasam Brahmanapratish/Aitam, analambanam iti vistaraA. Tas-
mad asty akasam iti VaibhashikaA. (See B«had-Ar. Up. Ill, 6, 1. Burnouf,
Introduction a l'histoire du Buddhisme, p. 449O
' For it is said by the Bhagavat : " O Gautama, on what does the earth rest?"
"The earth, O Brahmana, rests on the sphere of water." "O Gautama, on
what does the sphere of water rest?" "It rests on the air." "O Gautama, on
what does the air rest?" "It rests on the ether (akasa)." "O Gautama, on
what does the ether rest?" "Thou goest too far, great Brahmana; thou
goest too far, great Brahmana. The ether, O Brahmana, does not rest. It
has no support" Therefore the Vaibh£shikas hold that there is an ether,' &c.
Digitized by
Google
KA77£A-UPANISHAD.
I>5] e
Google
Digitized by '
Digitized by
Google
KA77/A-UPANISHAD.
FIRST ADHYAYA.
First VallJ.
i. VAgasravasa 1 , desirous (of heavenly rewards),
surrendered (at a sacrifice) all that he possessed. He
had a son of the name of Na&ketas.
2. When the (promised) presents were being given
(to the priests), faith entered into the heart of Naii-
ketas, who was still a boy, and he thought :
3. 'Unblessed 2 , surely, are the worlds to which
a man goes by giving (as his promised present at a
sacrifice) cows which have drunk water, eaten hay,
given their milk 3 , and are barren.'
4. He (knowing that his father had promised
to give up all that he possessed, and therefore his
son also)>said to his father : ' Dear father, to whom
wilt thou give me ?'
1 VS^ajravasa is called Arum Auddalaki Gautama, the father of
Na&ketas. The father of -Svetaketu, another enlightened pupil
(see A'Aand. Up. VI, 1, 1), is also called Arum (Udd&laka, comm.
Kaush. Up. 1, 1) Gautama. Svetaketu himself is called Arcweya,
i. e. the son of Arum, the grandson of Aru«a; and likewise Audda-
laki. Auddalaki is a son of Uddalaka, but .Sahkara (Ka/A.Up. 1, 1 1)
takes Auddalaki as possibly the same as Uddalaka. See Brih. kx.
Up. Ill, «, 1.
* As to ananda, unblessed, see Brih. Ar. Up. IV, 4, 1 1 ; Va^as.
Sawh. Up. 3 (Sacred Books of the East, vol. i, p. 311).
9 Anandagiri explains that the cows meant here are cows no
longer able to drink, to eat, to give milk, and to calve.
Digitized by
Google
KArffA-UPANISHAD.
He said it a second and a third time. Then the
father replied (angrily) :
' I shall give thee * unto Death.'
(The father, having once said so, though in haste,
had to be true to his word and to sacrifice his son.)
5. The son said : ' I go as the first, at the head
of many (who have still to die) ; I go in the midst
of many (who are now dying). What will be the
work of Yama (the ruler of the departed) which
to-day he has to do unto me' 2 ?
1 Dad&mi, I give, with the meaning of the future. Some MSS.
write dasyami.
2 I translate these verses freely, i. e. independently of the commen-
tator, not that I ever despise the traditional interpretation which the
commentators have preserved to us, but because I think that, after
having examined it, we have a right to judge for ourselves. .Sankara
says that the son, having been addressed by his father full of anger,
was sad, and said to himself: 'Among many pupils I am the first,
among many middling pupils I am the middlemost, but nowhere am
I the last. Yet though I am such a good pupil, my father has said
that he will consign me unto death. What duty has he to fulfil toward
Yama which he means to fulfil to-day by giving me to him ? There
may be no duty, he may only have spoken in haste. Yet a father's
word must not be broken.' Having considered this, the son com-
forted his father, and exhorted him to behave like his forefathers, and
to keep his word. I do not think this view of .Sankara' s could have
been the view of the old poet. He might have made the son say that
he was the best or one of the best of his father's pupils, but hardly
that he was also one of his middling pupils, thus implying that he
never was among the worst. That would be out of keeping with the
character of Na&ketas, as drawn by the poet himself. Na£iketas is
full of faith and wishes to die, he would be the last to think of
excuses why he should not die. The second half of the verse may
be more doubtful. It may mean what .Sankara thinks it means, only
that we should get thus again an implied complaint of Na/Jiketas
against his father, and this is not in keeping with his character. The
mind of Naftketas is bent on what is to come, on what he will see
after death, and on what Yama will do unto him. ' What has Yama
to do,' he asks, 'what can he do, what is it that he will to-day do unto
Digitized by
Google
i adhyAya, i vallI, 9. 3
6. ' Look back how it was with those who came
before, look forward how it will be with those' who
come hereafter. A mortal ripens like corn, like
corn he springs up again V
(Na&ketas enters into the abode of Yama Vai-
vasvata, and there is no one to receive him.
Thereupon one of the attendants of Yama is sup-
posed to say :)
7. ' Fire enters into the houses, when a Brahma»a
enters as a guest 2 . That fire is quenched by this
peace-offering ; — bring water, O Vaivasvata H
8. 'A Brahmawa that dwells in the house of a
foolish man without receiving food to eat, destroys
his hopes and expectations, his possessions, his
righteousness, his sacred and his JK»od deeds, and
all his sons and cattle *.'
(Yama, returning to his house aftST an absence
of three nights, during which time Na&ketas had
received no hospitality from him, says :)
9. ' O Brahmawa, as thou, a venerable guest, hast
dwelt in my house three nights without eating,
me ?' This seems to me consistent with the tfl Bcthe ancient story,
while .Sankara's interpretations and interpolates savour too much
of the middle ages of India.
1 Sasya, corn rather than grass ; tta, ifiov, Benfey ; Welsh haidd,
according to Rhys ; different from .rash-pa, ces-pes, Benfey.
* Cf. Vasish/Aa XI, 13 ; Sacred Books of the East, vol. xiv, p. 51.
3 Vaivasvata, a name of Yama, the ruler of the departed. Water
is the first gift to be offered to a" stranger who claims hospitality.
* Here again some words are translated differently from Saftkara.
He explains &r & as asking for a wished-for object, pratikshi as look-
ing forward with a view to obtaining an unknown object. Sahgata
he takes as reward for intercourse with good people; sun/7'ta, as
usual, as good and kind speech; ish/a as rewards for sacrifices;
purta as rewards for public benefits.
B 2
Digitized by
Google
KA7WA-UPANISHAD.
ft
therefore choose now three boons. Hail to thee!
and welfare to me!'
10. Na&ketas said : ' O Death, as the first of the
three boons I choose that Gautama, my father, be.
^) pacified, kind, and free from anger towards me ; and .
v thctt*he may'-knaw-fa* and-. greet me* when* I shaft*
have been dismissed by thee.'
ii. Yama said: 'Through my favour Auddalaki
Arum, thy father, will know thee, and be again towards
thee as he was before. He shall sleep peacefully
through the night, and free from anger, after having ^
seen thee freed from the'mouth of death.' |J
1 2. Na&ketas said : ' In the heaven-world there is
no fear ; thou art not there, O Death, and no one is
L. afraid on account of old age. Leaving behind both
hunger and thirst, and out of the reach of sorrow, all
rejoice in the world of heaven.'
13. 'Thou knowest, O Death, the fire-sacrificef *)
which lead* us to heaven ; tell it to me, for I am
full of faitfc^Those who live in the heaven-world
reach immortality ,-+- this I ask as my second boon.'
14. YantaNtiid : ' I tell it thee, learn it from me, *!
and when thou understandest that fire-sacrifice which < 1
leads to heaven, know, O Naiiketas, that it is the
attainment of the endless worlds, and their firm sup-
port, hidden in darkness V
15. Yama then told him that .fire-sacrifice, the
beginning of all the worlds 2 , and what bricks are
* 1 .
1 The commentator translates: *I tell it thee, attend to me who
knows the heavenly fire.' Here the nom. sing, of the participle
would be very irregular, as we can hardly refer it to bravimi. Then^;>
' Know this fire as a means of obtaining the heavenly world, knAspii
that fire as the rest or support of the world, when it assumes ;the^ '■>'-.
form of Vira^, and as hidden in the heart of men.'
2 .Sankara : the first embodied, in the shape of Vira^.
©
Digitized by
Google
I ADHYAYA, I VALLf, 21.
required for the altar, and how many, and how they
are to be placed. And Na&ketas repeated all as it
had been told to him. Then MWtyu, being pleased
with him, said again :
1 6, The generous 1 ^ being satisfied, said to him : >
' I give thee now another boon ; that fire-sacrifice
shall be named after thee, take also this many-
coloured chain 2 .' ♦
17. ' -He who has three times performed this Na& -
Jceta-rite.^and has been united with the three (father, j
mother, and teacher), and has performed the tHree
dutie^J^sjtudy^^sacnfic^^ljnj^iy^ Jnrth
and j ieath. When he has learnt and understood J'
•this fire, which knows (or makes us know) all/that is
born of Brahman 8 , which is venerable andi divinej,
then he obtains everlasting peace,'
18/ ' He w,ho knows the three Na&keta fires, and
knowingthe jhree, piles up the Na&keta sacrifice, he,
having first. thrown off the chains of death, rejoices
in the Wj9rld of heaven, beyond the reach of grief.'
19. 'jjFhis, O Na^iketas, is thy fire which leads
to heaveii, and which thou hast chosen as thy second
boon. That fire all men will proclaim 4 . Choose now,
O' Na^iketas, thy third boon.'
20. Na^iketafe said : ' There is that doubt, when a
man is dead, — some saying, he is ; others, he is not.
This I should like to know, taught by thee ; this is
the third of my boons.' 1 > -^
21. Death said: 'On this point even the gods (jj
1 Verses 16-18 seem a later addition.
8 This arises probably from a misunderstanding of verse II, 3.
8 G&tavedas.
* Tavaiva is a later addition, caused by the interpolation of
verses 15-18.
Digitized by
Google
KAFffA-UPANISHAD.
have doubted 'formerly ; it is not easy to understand.
That subject is subtle. Choose another boon, O
Na^iketas, do not press me, and let me off that
boon.'
22. Naiiketas said: 'On this point even the gods
have doubted indeed, and thou, Death, hast declared-
it to be not easy to understand, and another teacher
like thee is not to be found : — surely no other boon* •
is like unto this.'
23. Death said : 'Choose sons and grandsons who
shall live a hundred years, herds of cattle, elephants,
gold, and horses. Choose the wide abode of the
earth, and live thyself as many harvests as thou
desirest.'
24. 'If you can think of any boon equal to that,
choose wealth, and long life. Be (king), Naiiketas,
on the wide earth 1 . I make thee the enjoyer of
all desires.'
25. ' Whatever desires are difficult to attain among
mortals, ask for them according to thy wish ; — these
fair maidens with their chariots and musical instru-
ments, — such are indeed not to be obtained by
men, — be waited on by them whom I give to thee,
but do not ask me about dying.'
26. Naiiketas said : ' These things last till to-
morrow, O Death, for they wear out this vigour of
all the senses. Even the whole of life is short. Keep
thou thy horses, keep dance and song for thyself.'
27. ' No man can be made happy by wealth. Shall <
we possess wealth, when we see thee ? Shall we live, *
1 Mablbhumau, on the great earth, has been explained also by
mah& bhumau, be great on the earth. It is doubtful, however,
whether mahsl for mahin could be admitted in the Upanishads, and
whether it would not be easier to write mah&n bhumau.
Digitized by
Google
I ADHYAYA, I VALLf, 29.
as long as thou rulest ? Only that boon (which I
have chosen) is to be chosen by me.'
28. • What mortal, slowly decaying here below, and
knowing, after having approached them, the freedom
from decay enjoyed by the immortals, would delight
in a long life, after he has pondered on the pleasures
which arise from beauty and love 1 ?'
. 29. ' No, that on which there is this doubt, O Death,
tell us what the re is in tha t great Herea fter. Na£i-
•ketas does not choose another boon but that which
enters into the hidden wprld.'
1 A very obscure verse. .Sankara gives a various reading kva
tad&sthaA for kvadha^sthaA,in the sense of 'given to these pleasures,'
which looks like an emendation. I have changed a^iryatam into
ag&ryatam, and take it for an ace. sing., instead of a gen. plur.,
which could hardly be governed by upetya.
Digitized by
Google
KArffA-UPANISHAD.
Second VallJ.
i . Death said : ' The goo d is one thing, the pleasant
/another ; these two, having different objects, chain
a man. It is well with him who clings to the good ;
\he who chooses the pleasant, misses his end.' " •
2. ' The good and the pleasant approach man :•
the wise goes round about them and distinguishes
them. Yea, the wise prefers the good to the
pleasant, but the fool chooses the pleasant through
greed and avarice.'
3. ' Thou, O Na&ketas, after pondering all plea-
sures that are or seem delightful, hast dismissed
them all. Thou hast not gone into, the road 1 that
leadeth to wealth, in which" many men perish.'
4. 'Wide apart and leading to different points are
these two, ignorance, and what is known as wisdom.
I believe Na&ketas to be one who desires know-
ledge, for even many pleasures did not tear thee
away 2 .'
<A 5- ' Fools dwelling in darkness, wise in their own
conceit, and puffed up with vain knowledge, go
round and round, staggering to and fro, like blind
men led by the blind *.'. . _;
/ 6. ' The H ereafter never rises before the eyes of
/the careless child, deluded by the delusion of wealth.
"This is the world," he thinks, "there is no other ;" —
thus he falls again and again under my sway.'
7. ' He (the Self) of whom many are not even able
r - » Cf. 1, 16.
* The commentator explains lolupantaA by vtttkedam kr/'tavan-
taA. Some MSS. read lolupante and lolupanti, but one expects
either lolupyante or lolupati
3 Cf. Mum* Up. II, 8."
Digitized by
Google
i adhyAya, 2 VALLt, II.
tq hear, •whom many, even when they hear of him,
do not comprehend ; wonderful is a man, when found,
who is able to teach him (the Self) ; wonderful is
he who comprehends him, when taught by an able
teacher V
8. ' That (Self), when taught by an inferior man,
is not easy to be known, even though often thought
upon 2 ; unless it be taught by another, there is no
way to it, for it is inconceivably smaller than what /
is small 3 .'
9. ' That doctrine is not to be obtained 4 by argu-
ment, but when it is declared by another, then, O
dearest, it is easy to understand. Thou hast obtained
it now 5 ; thou art truly a man of true resolve. May
We have always an inquirer like thee'! '
10. Na&ketas said : ' I know that what is called a
treasure' is transient,\ior that eternal is not obtained
by "things which are not eternal^ Hence the Na&-
keta fire(-sacrifice) has been laidJsy me (first) ; then-,
by means of transient things, I have obtained what
is not transient (the teaching of Yama) 7 .'
1 1. Yama said : ' Though thou hadst seen the
fulfilment of all desires, the foundation of the world,
the endless rewards of good deeds, the shore where
1 Cf. Bhag?GM II, 29. a Cf. Mmd. Up. II, 4.
1$ » 1 rea( i awupramawat. Other interpretations: If it is taught by
*■ one who is identified with the Self, then there is no uncertainty. If
it has been taught as identical with ourselves, then there is no per-
ception of anything else. If it has been taught by one who is
identified with it, then there is no failure in understanding it (agati).
* Apaneyt; should it be ipanaya, as afterwards su^wSnaya?
8 Because you insist on my teaching it to thee.
• Unless no is negative, for Yama, at first, does not like to com-
municate his knowledge.
7 The words in parentheses have been added in order to remove
the otherwise contradictory character of the two lines.
Digitized by
Google
' /
IO KArffA-UPANISHAD. *
there is no fear, that which «> magnified by prai§e,
the wide abode, the rest \ yet being wise thou hast
with firm resolve dismissed it all.'
12.' The wise who, by means of meditation on his
•Self, recognises the Ancient, who is difficult to be
seen, who has entered into the dark, who is hidden
in the cave, who dwells in the abyss, as God, he
indeed leaves joy and sorrow far behind 2 .'
13. 'A mortal who has heard this and embraced
it, who has separated from it all qualities, and has
thus reached the subtle Being, rejoices, because he
has obtained what is a cause for rejoicing. The
house (of Brahman) is open, I believe, O Na&ketas.'
14. Na&ketas said: 'That which thou seest as
neither this nor that, as neither effect nor cause, as
neither past nor future, tell me that.' .
1 5. Yama said : ' That word (or place) which all -
the Vedas record, which all penances proclaim, which
men desire when they live as religious students, that
word I tell ttiee briefly, it is QmJL'
16. 'That (imperishable) syllable means Brahman,
that syllable means the highest (Brahman); he who
knows that syllable, whatever he desires/is his.'
1 7. ' This is the best support, thte is the highest
support; he who knows that support is magnified
in the world of Brahma.'
18. ' The knowing (Self) is not born, it dies not;
it sprang from nothing, nothing sprang from it. The
1 Cf. .ffMnd. Up. VII, 12, 2.
2 Yama seems here to propound the lower Brahman only, not yet
the highest. Deva, God, can only be that as what the Old, i. e. the
Self in the heart, is to be recognised. It would therefore mean, he
who finds God or the Self in his heart. See afterwards, verse 21.
8 Cf. Svet. Up. IV, 9; Bhag. GitS VIII, n.
Digitized by
Google
I ADHYAYA, 2 VALLl, 25. II
Ancient is unborn, eternal, everlasting ; he is not
killed, though the body is killed V
19. ' If the killer thinks that he kills, if the killed
thinks that he is killed, they do not understand ; for
this one does not kill, nor is that one killed.'
20. 'The Self 2 , smaller than small, greater than
great, is hidden ,m the heart of that creature. A
man who is free from desires and free from grief, sees
the majesty of the Self by the grace of the Creator V
21.' Though sitting stilj, he walks far; though lying t
down, he_goes everywhere *. Who, save myself, is able j
to know thatXiod who rejoices and rejoices' not ? '
22. ' The wise who knows the Self as bodiless
within the bodjes^ as unchanging among changing
things, as great and omnipresent, does never grieve.'
^' ' Tfe W?5 J! L? / a nnot 6eIgainMZ&y_the, Yfida,
nor_J?y ^^^^^^^^g, nor by much learning. He
w hom the Self chooses, J byJ]Km^"th e~5elf can be ;
gained. The Self chooses him (his body) as his own.'
2,4. ' But he "who has not first turned away from
his wickedness, who is not tranquil, and subdued,
or whose mind is not at rest, he can never obtain
the Self- ( e ven) by Jcnowledge.'
25. 'Who then knows where He is, He to whom
the Brahmans and Ksbatriyas are (as it were) but
food 6 , and death itself a condiment ?'
•>
1 As to verses 18 and 19, see Bhag. GM II, 19, 20.
8 Cf. Svet. Up. Ill, 20; Taitt. Ar. X, 12, 1.
s The commentator translates 'through the tranquillity of the
senses,' i. e. dhatuprasdddt, taking prasdda in the technical sense
of samprasSda. As to kratu, desire, or rather, will, 'see Bn"h. Ar.
IV, 4, 6-
4 Cf. Tal. Up. 5.
• Cf. I, 7-9 ; Mund. Up. Ill, 2, 3 ; Bhag. Giti I, 53.
6 In whom all disappears, and in whom even death is swallowed up.
Digitized by
Google
)/
12 KArHA-UPANISHAD.
Third VallI.
i . ' There are the two \ drinking their reward in
the world of their own works, entered into the cave
(of the heart), dwelling on the highest summit (the
ether in the heart). Those who know Brahman call
them shade and light ; likewise, those householders
^ who perform the Tri«aiiketa sacrifice.'
2. ' May we be able to master that Ni^iketa rite
which is a bridge for sacrificers ; also that which is
the highest, imperishable Brahman for those who
wish to cross over to the fearless shore V
5 3. ' Know the Self to be sitting in the chariot,
I iffy the body to be the chariot, the intellect (buddhi)
', \r the charioteer, and the mind the reins V
4. ' The senses they call the horses, the objects of
the senses their roads. When he (the Highest Self)
is in union with the body, the senses, and the mind,
..then wise people call him the Enjoyert'
5. 'He who has no understanding and whose mind
1 The two are explainedaj fhrhifhrr and log er Brahman, the
former being the lighr^tfielatter the shadow<*?/ta is explained
as reward, and connected with sukrz'ta, lit. good deeds, but fre-
quently used in the sense of svakn'ta, one's own good and evil
deeds. The difficulty is, how the highest Brahman can be said to
drink the reward (rjtapa) of former deeds, as it is above all works and
above all rewards. The commentator explains it away as a meta- .
phorical expression, as we often speak of many, when we mean one. *
(Cf. Mund. Up. Ill, 1, 1.) I have joined sukr/tasya with loke, loka
meaning the world, i. e. the state, the environment, which we made
to ourselves by our former deeds.
2 These two verses may be later additions.
* The simile of the chariot has some points of similarity with the
well-known passage in Plato's Phsedros, but Plato did not borrow
this simile from the Brahmans, as little as Xenophon need have
consulted our Upanishad (II, 2) in writing his prologue of Prodikos.
Digitized by
Google
i adhyAya, 3 vallI, 14. 13
(the reins) is never firmly held, his senses (horses) are
unmanageable, like vicious horses of a charioteer.'
6. ' But he who has understanding and whose mind 1
is always firmly held, his senses are under control, '
like good horses of a charioteer.'
7. ' He who has no understanding, who is unmind- /
ful and always impure, never reaches that place, but
enters into the round of births.'
8. ' But he who has understanding, who is mindful 1
and always pure, reaches indeed that place; from 1
whence he is not born again.'
9. ' But he^ who- has understanding for his cha- .
rioteer, and who holds the reins of the mind, he-'
reaches the end of his journey, and that is the/
highest place of V ishmi / /
v 10.' Beyond the senses there are thejahjects, beyond. -
the objects there is thejnind, beyond the mind there,
is the intellect, the Great Self is beyond the intellect/
i\. ' Beypnd the Great there is the Undeveloped,
beyond thi Undeveloped there is the Person
(purusha). ^evond. t he^S yson there is nothing —
thisjgjhe giklniie Iugnest road.'
i2/^*hat>elf is hidden in all beings and does not
shine forth, but it is seen by subtle seers through
their sharp and subtle^ intellect.'
13* 'A wiseTnan should keep down speech and
mind 1 ; he should keep- them within the Self which
is knowledge ; he should keep knowledge witftuh*
Sel f which is i he-Great ; and he should keep that
(the Great) within the Self which is the Quiet.'
i^-v ^.J 14. 'Rise, awake! having obtained your boons 2 ,
1 .Sankara interprets, he should keep down speech in the mind.
* Comm., excellent teachers.
Digitized by
Google
14 KATffA-UPANISHAD.
/
understand them ! The sharp edge of a razor is
difficult to pass over ; thus the wise say the path (to
the Self) is hard.'
15. 'He who has perceived that which is without
sound, without touch, without form, without decay,
without taste, eternal, without smell, without begin-
ning, without end, beyond the Great, .and unchange-
able, is freed from the jaws of death.'
16. 'A wise man who has repeated or heard the
ancient story of Na&ketas told by Death, is magni-
fied in the world of Brahman.'
17. ' And he who repeats this greatest mystery in
an assembly of Brahmans, or full of devotion at the
time of the .Sraddha sacrifice, obtains thereby infinite
rewards.'
Digitized by
Google
ii adhyAya, 4 vallI, 6. 15
SECOND ADHYAYA;
Fourth Valli".
4
1. Death said: 'The Self-existent pierced the
openings (of the senses) so that they turn forward:
therefore matr looks forward, not backward into
himself. > Some^ wise man, however, with his eyes
closed and wishing for immortality, saw the Self
behind.'
2. ' Children follow after outward pleasures, and \
fall into the snare of wide-spread death. Wise men /
only, knowing the nature of what is immortal, do
not. look for anything stable here among things
unstable.'
3. ' That by which we know form, taste, smell,
sounds, and loving touches, by that also we know
what exists besides^ This -is that (which thou hast
asked for).' *"
4. ' The wise, when he knows that that by which ^
he perceives all objects in sleep or in waking is the
great omnipresent Self, grieves no more.'
5. 'He who knows this living soul, which eafs-
honey (perceives objects) as being the Self, always ,
near, the Lord of the past and the future, hence-
fqrward fears no more. This is that.'
6. ' He who (knows) him 1 who was born first from
1 The first manifestation of Brahman, commonly called Hirawya-
garbha, which springs from the tapas of Brahman. Afterwards only
water and the rest of the elements become manifested. The text of
these verses is abrupt, possibly corrupt. The two accusatives,
tish/6antam and tish/Aantim, seem to me to require veda to be
supplied from verse 4.
Digitized by
Google
V
1 6 KAJ-ffA-UPANISHAD.
the brooding heat 1 (for he was born before the water),
who, entering into the heart, abides therein, and was
perceived from the elements. This is that.'
7. '(He who knows) Aditi also, who is one with
all deities, who arises with Pra«a (breath or Hira«ya-.
garbha), who, entering into the heart, abides therein,
and was born from the elements. This is that.'
8. ' There is Agni (fire), the all-seeing, hidden in
thle two fire-sticks, well-guarded like a child (in the
womb) by_the mother, day after day to be adored by
men when they awake and bring oblations. This
is that.'
9. 'And that whence the sun rises, and whither
it goes to set, there all the Devas are contained, and
no one goes beyond. This is that 2 .'
f 10. ' What is here (visible in the world), the same
is there (invisible in Brahman) ; and .what is there,*
the same is here. He who sees any. difference here
(between Brahman and the world), goes from death
to death.'
11. 'lyven by the mind this (Brahman) is to be
obtained, and then there is rio difference whatsoever.
He goes from death to death who sees any difference
here.'
12.' The person (purusha), of the size of. a thumb 8 ,
stands in the middle of the Self (body?), as lord 6f
the past and the future, and henceforward fears
no more. This is that'
1 3. ' That person, of the size of a thumb, is like
a light without smoke, lord of the past and the
future, he is the same to-day and to-morrow. This
is that.'
1 Cf. sr/sh/ikraraa. » Cf. V, 8.
8 <SVet. Up. Ill, 13.
Digitized by
Google
ii adhyAya, 4 vall!, 15. 17
14. 'As rain-water that has fallen on a mountain-
ridge runs down the rocks on all sides, thus does he,
who sees a difference between, qualities, run after
them on all sides.'
15. ' As pure water poured into pu re water remains
thj^sa^m^lluisjQ^ajitajna^is the Self of_a thinker
who knows.'
[>5] C
Google
Digitized by '
1 8 Y.ATH A-UPANISHAD.
Fifth Vall!.
i. ' There is a town with eleven x gates belonging
to the Unborn (Brahman), whose thoughts are never
crooked. He who approaches it, grieves no more,
and liberated (from all bonds of ignorance) becomes
free. This is that.'
2. ' He (Brahman) 2 is the swan (sun), dwelling in the-
bright heaven ; he is the Vasu (air), dwelling in the /
sky ; he is the sacrificer (fire), dwelling on the hearth/
he is the guest (Soma), dwelling in the sacrificial jar,;
he dwells in men, in gods (vara), in the sacrifice (rz'ta),
in heaven ; he is born in the water, on earth, in the
sacrifice {rite), on the mountains ^ he is the True
and the Great.'
3. ' He (Brahman) it is who sends up the breath
(pra«a), and who throws back the breath (apana).
All the Devas (senses) worship him, the adorable (or
the dwarf), who sits in the centre.'
4. 'When that incorporated (Brahman), who dwells
\ in the body, is torn away and freed from the body,
what remains then ? This is that.'
5. 'No mortal lives by the breath that goes up and
by the breath that goes down. We live. by another,
in whom these twtf* repose.'
6. ' Well then, O Gautama, I shall tell thee this
' mystery, the old Brahman, and what happens to the
Self, after reaching death.'
1 Seven apertures in the head, the navel, two below, and the one
at the top of the head through which the Self escapes. Cf. Svet.
Up. Ill, 18; Bhag. GitaV,i 3 .
4 Cf. Rig-veda IV, 40, 5.
Digitized by
Google
ii adhyAya, 5 vallI, 13. 19
7. ' Some enter the womb in order to have a body,
as organic beings, others go into inorganic matter,
according to their work and according to their
knowledge V * >
8. £j-Ie, the highest Person, who is awake in us
while we are asleep, shaping one lovely sight after
another, that indeed is the Bright, that is Brahman,
that alone is called the Immortal.} All worlds are
contained in it, and no one goes beyond. This
is that V
9. ' As the one fire, after it has entered the world,
though one, becomes different according to whateyer 1
it burns, thus the one Self within all things becomes),'
different, according to whatever Jt enters, and existsv
also without V
10. ' As the one air, after it has entered the world,
though, one, becomes different according to whatever *<"
it enters, thus the one Self within all things becomes
different, according to whatever it enters, and exists
also without.'
11. ' As the sun, the eye of the whole world, is not
contaminated by the external impurities seen by the
eyes, thus the one Self within all things is never (
contaminated by the misery of the world, being
himself without V
12. ' There is one ruler, the Self within all things,
who makes the one form manifold. The wise who
perceive him within their Self, to them belongs |
eternaj happiness, not to others V * •
1 3. ' There is one eternal thinker, thinking non- \S
1 Cf. Brch. Ar. II, 2, 13. " Cf. IV, 9; VI, 1.
• Cf. Brih. Ax. H, 5, 19. * Cf. Bhag. Gitd XIII, 54.
6 Cf. <Svet. Up.VI, 12.
C 2
V
Digitized by
Google
20 KA2*HA-UPANISHAD.
eternal thoughts, who, though one, fulfils the desires p
of many. The wise who perceive him within their
Self, to them belongs eternal peace, not to others V
14. ' They perceive that highest indescribable x
pleasure, saying, This is that. How then can 1,1} \
understand it ? a Has it its own light, or does it \-
reflect light ? '
15. ' The sun does not shine there, nor the moon
and the stars, nor these lightnings, and much less
this fire. When he shines, everything shines after
him; ]jyhis lightall this is lighted 2 .'
1 Cf. Svet. Up. VI, 13.
2 Cf.^Vet.Up.VI,i4; MuW. Up. II, 2, 10 ; Bhag. Glti XV, 6.
Digitized by
Google
II ADHYAYA, 6 VALL?, 4. 21
Sixth Vall!.
1. ' There is that ancient tree 1 , whose roots grow
upward and whose branches grow downward ; — that*
indeed is called the Bright* that is called Brahman,'
that alone is called the Immortal 4 . All worlds are
contained in it, and no one goes beyond. This >
is that.'
2. * Whatever there is, the whole world, when gone
forth (from the Brahman), trembles in its breath 6 .
That Brahman is a great terror, like a drawn sword.
Those who know it become immortal.'
3. ' From terror of Brahman fire burns, from terror
the sun burns, from terror Indra and Vayu, and
Death, as the fifth, run away 6 .'
4. ' If a man could not understand it before the
falling asunder of his body, then he has to take body ts^
again in the worlds of creation V
1 The fig-tree which sends down its branches so that they strike
root and form new stems, one tree growing into a complete forest.
8 Cf. Bhag. GM XV, 1-3. » Cf.V, 8,
4 The commentator says that the tree is the world, and its root
is Brahman, but there is nothing to support this view in the original,
where tree, roots, and branches are taken together as representing
the Brahman in its various manifestations.
5 According to the commentator, in the highest Brahman.
• Cf. Taitt. Up. II, 8, 1.
7 The commentator translates: 'If a man is able to understand
(Brahman), then even before the decay of his body, he is liberated.
If he is not able to understand it, then he has to take body again
in the created worlds.' I doubt whether it is possible to supply so
much, and should prefer to read iha £en nlrakad, though I find it
difficult to explain how so simple a text should have been mis-
understood and corrupted.
Digitized by
Google
22 KATOA-UPANISHAD.
*
5. ' As in a mirror, so (Brahman may be seen clearly)
here in this body ; as in a dream, in the world of
the Fathers j as in the water, he is seen about in the
world of the Gandharvas ; as in light and shade \ in
the world of Brahma.'
6. ' Having understood that the senses are distinct 2
» (from the Atman), and that their rising and setting
I (their waking and sleeping) belongs to them in their
I distinct existence (and not to the Atman), a wise
\ man grieves no more.'
7. ' Beyond the senses is the mind, beyond the
mind is the highest (created) Being 8 , higher than
that Being is the Great Self, higher than the Great,
the highest Undeveloped.'
8. ' Beyond the Undeveloped is the Person, the
all-pervading and entirely imperceptible. Every
creature that knows him is liberated, and obtains
immortality.'
9. 'His form is not to be'seen, no one beholds
him with the eye. He is imagined by the heart,
I by wisdom, by the mind. Those who know this, are
' immortal 4 .'
f~* 10. ' When the five instruments of knowledge stand
/stilL together with the mind, and when the intellect
Idoes not move, that is called the highest state.*'
1 1. ' This, the firm holding back of the senses, is
what is called Yoga. He must be free from thought-
lessness then, for Yoga comes and goes 6 .'
I Roer : 'As in a picture and in the sunshine.'
II They arise from the elements, ether, &c.
3 Buddhi or intellect, cf. Ill, 10.
* Much better in <Svet.Up. IV, 20: 'Those who know him by the
heart as being in the heart, and by the mind, are immortal.'
6 .Sahkara explains apyaya by apaya.
Digitized by
Google
ii adhyAya, 6 vallI, 17. 23
12. 'He (the Self) cannot be reached by speech, ^^j
by mind, or by the eye. How can it be apprehended
except by him who says : " He is ? " '
13. 'By the words " He is," is he to be apprehended,
and by (admitting) the reality of both (the invisible
Brahman and the visible world, as coming from
Brahman). When he has been apprehe nded b y the \
word s " He i s." the n his reality re veals itself.' L^
14. 'When all desires that dwell mtris heart cease, • l^
then^the mortal becomes immortal, and obtains
Brahman.'
\ 5. * Wheiuall. the ties 1 of the heart are severecjL. in-
here on earth, then the mortal becomes immortal— f
here ends the teaching V '*■
16. ' There are a hundred and one arteries of the
heart 8 , one of them penetrates the^ crown of the head 4 ^
Moving upwards by it, a 'man (at his death) reaches
the Immortal * ; the other arteries serve for departing
in different directions.'
1 7. ' The Person not larger than a thumb, the inner..
Self, is always. settled in the heart of men*. Let a
man draw that Self forth from his body with steadi-
1 :
1 Ignorance, passion, &c. Cf. Mund. Up. II, 1, 10; II, 2, 9.
s The teaching of the Ved&nta extends so far and no farther.
(Cf. Prama Up. VI, 7.) What follows has reference, according to the
commentator, not to him who knows the highest Brahman) for he
becomes Brahman at once and migrates no more ; but to him who
does not know the highest Brahman fully, and therefore migrates to
the Brahmaloka, receiving there the reward for his par#al knowledge
and for his good works.
» Cf..ffMnd.Up.VIII,6,6.
* It passes out by the head.
8 The commentator says: He rises through the sun (Mund. Up.
I, 2, 1 1) to a world in which he enjoys some kind of immortality.
• .Svet.Up.III, 13.
Digitized by
Google
24 KAr/TA-UPANISHAD.
ness, as one draws the pith from a reed 1 . Let
him know that Self as the Bright, as the Immortal ;
yes, as the Bright, as the Immortal 2 .'
1 8. Having received this knowledge taught by^-^
Death and the whole rule of Yoga (meditation$^
-a Naiiketa became free from passion 8 and death, and
obtained Brahman. Thus it will be with another
also who knows thus what relates to the Self.
19. May He protect us both! May He enjoy us
both ! May we acquire strength together ! May our
knowledge become bright! May we never quarrel 4 !
Om ! Peace ! peace ! peace ! Hari^, Om !
1 Roer : ' As from a painter's brush a fibre.'
* This repetition marks, as usual, the end of a chapter,
v.- 8 Virata, free from vice and virtue. It may have been v^ara,
Wr&f&em old age. See, however, Mvwd. Up. I, 2, 1 1.
^*^"r*f To, - t+ TTrw TTT T- TTT »/■» nr,t»
Cf. Taitt. Up. Ill, 1; III, 10, note.
i
Digitized
4d by Google
MIWZ7AKA-UPANISHAD.
Digitized by
Google
Digitized by
Google
MU;VZ>AKA-UPANISHAD.
FIRST MU-TOAKA.
First Khanda.
i. Br^jimA was the first of the Devas, the maker
of jjig^ unive rse, the preserver of the worl d. He I
tojdthejcnowledge of Brahman, the fou ndation of [
all knowledg e, to h is eldest son Atharya 1 .
2. Whatever Brahma told Atharvan, that know-
ledge of Brahman Atharvan formerly told to Angir; /
he told it to Satyavaha Bharadva^a, and Bharadva^a j
told it in succession to Angiras.
3. <5aunaka, the great householder, approached
Angiras respectfully and asked : ' Sir, whaX|sjtha£.
through which, if it is known, everything else becomes
known ? * ~^~^ ~~. ~~
4. He said to him : ' Two kinds of knowledg e must
be known, this is what all who know Brahman tell us,
the higher flnHjjie lower knowledge.'
5. ' The lower knowledge is the .tfzg-veda, Ya^ur-
veda, Sama-veda, Atharva-veda, .Siksha (phonetics),
Kalpa (ceremonial), Vyakarawa (grammar), Nirukta
(etymology), A^andas (metre), ^yotisha (astronomy) 2 ;
1 The change between Atharva and Atharvan, like that between
Na&ketas and Niiiketa, shows the freedom of the phraseology of
the Upanishad, and cannot be used for fixing the date of the con-
stituent elements of the Upanishad.
a Other MSS. add here ihTiasa-pura»a-nyaya-mima»Jsa-dharrna-
jastrawi.
Digitized by
Google
y
28 MUiVDAKA-UPANISHAD.
but the hi gher knowled ge is that_^_whicll_the
Ind estructible (Brahman) is apprehende d.'
6. ' That which cannot be seen, nor seized, which
has no family and no caste \ no eyes nor ears, no
hands nor feet, the eternal, the omnipresent (all-
pervading), infinitesimal, that which is imperishable,
that it is which the wise regard as the source of
all beings.'
7. 'As the spider sends forth and draws in its
thread, as plants grow on the earth, as from every
man hairs spring forth on the head and the body, thus
does everything arise here from the Indestructible.'
\ 8. ' The Brahman swells by means of brooding
1 (penance) 2 ; hence is produced matter (food) ; from
matter breath 3 , mind, the true*, the worlds (seven),
and from the works (performed by men in the
worlds), the immortal (the eternal effects, rewards,
and punishments of works).'
1 I translate varwa by caste on account of its conjunction with
gotra. The commentator translates, ' without origin and without
qualities.' We should say that which belongs to no genus or
species.
2 I have translated tapas by brooding, because this is the only
word in English which combines the two meanings of warmth and
thought. Native authorities actually admit two roots, one tap,
to burn, the other tap, to meditate; see commentary on Para-
jara-smn'tij p. 39b (MS. Bodl.), TapaA kr/£Mra£andraya«adiru-
pewaharavarg-anam. Nanu Vy£sena tapo 'nyatha smaryate, tapaA
svadharma-vartitvazn sz.uka.rn sanganibarhawam iti ; nayaw doshaA,
kn%££rader'api svadharmavueshat. Tapa sawtapa ity asmad dhator
utpannasya tapaA-fabdasya dehafoshawe vnttir mukhya. . . . Yat
tu tatraivoktaira, ko 'yam mokshaA kathaw tena sawsaram prati-
pannavan ity alo£anam arthagwas tapaA rawsanti pawrfita iti so 'nya
eva tapafaabdaA, tapa aloiana ity asmad dhator utpannaA.
3 Hira«yagarbha, the living world as a whole. Comm.
4 Satya, if we compare Ka/ft. VI, 7 and III, 10, seems to mean
buddhi. Here it is explained by the five elements.
Digitized by
Google
I MUiVDAKA, I KHAJVDA, 9. 29
9. ' From him who perceives all and who knows
all, whose brooding (penance) consists of knowledge,
from him (the highest Brahman) is born that Brah-
man 1 , name, form 2 , and matter (food).'
1 Hira»yagarbha. Comm.
2 Namarupam, a very frequent concept in Buddhistic literature.
Digitized by
Google
30 MUJV.DAKA-UPANISHAD.
Second Khanda.
i. This is the truth x : the sa crificial work s which
they (the poets) saw in the hymns (of the Veda)
have been performed in many ways in the Treta
age 2 . Practise 3 them diligently, ye lovers of tr uth,
this is your pa th that leads to the world of g ood
works 4 !
2. When the fire is lighted and the flame flickers,
let a man offer his oblations between the two por-
tions of melted butter, as an offering with faith.
3. If a man's Agnihotra sacrifice 6 is not followed
1 In the beginning of the second Khwda the lower knowledge
is first described, referring to the performance of sacrifices and
other good deeds. The reward of them is perishable, and therefore
a desire is awakened after the higher knowledge.
* The Tret& age is frequently mentioned as the age of sacrifices.
I should prefer, however, to take treta" in the sense of trayi
vidyi, and santata as developed, because the idea that the Treta"
age was distinguished by its sacrifices, seems to me of later origin.
Even the theory of the four ages or yugas, though known in the Ait.
BrShmawa, is not frequently alluded to in' the older Upanishads.
See Weber, Ind. Stud. I, p. 283.
8 The termination tha for ta looks suspiciously Buddhistic ; see
' Sanskrit Texts discovered in Japan,' J. R. A. S. 1880, p. 180.
4 Svaknla and sukn'ta are constantly interchanged. They mean
the same, good deeds, or deeds performed by oneself and believed
to be good.
B At the Agnihotra, the first of all sacrifices, and the type of
many others, two portions of Sgya are sacrificed on the right and
left side of the Ahavanfya altar. The place between the two is
called the Av&pasth&na, and here the oblations to the gods are to
be offered. There are two oblations in the morning to Surya and
Pra^tpati, two in the evening to Agni and Pr^pati. Other sacri-
fices, such as the Dar^a and Purwamisa, and those mentioned in
verse 3, are connected with the Agnihotra.
Digitized by
Google
( I MUiW>AKA, 2 KHANDA, 7 A
by the new-moon and full-moon sacrifices, by the
four-months' sacrifices, and by the harvest sacrifice,
if it is unattended by guests, not offered at all, or
without the Valrvadeva ceremony, or not offered
according to rule, then it destroys his seven worlds K
4. Kali (black), Karall (terrific), Mano^ava (swift
as thought), Sulohita (very red), Sudh<imravar»a
(purple), Sphulinginl (sparkling), and the brilliant
VLsvarupi 2 (having all forms), all these playing about
are called the seven tongues (of fire).
5. If a man performs his sacred works when these
flames are shining, and the oblations follow at the
right time, then they lead him as sun-rays to where
the one Lord of the Devas dwells.
6. Come hither, come hither ! the brilliant obla-
tions say to him, and carry the sacrificer on the rays
of the sun, while they utter pleasant speech and
praise him, saying : ' Tins is thy holy B rahma-world
(Svarga), ga ined by thy go od, wor ks.'
7. But frail, in truth, are those boats, the sacri^
fjces^ the eighteen, in which this lower ceremonial
has been told 3 . Fools who praise this as the highes t
good , a re subject again a nd again t o old ag e and
death.
1 The seven worlds form the rewards of a pious sacrificer, the
fii'st is BhuA, the last Satya. The seven worlds may also be ex-
plained as the worlds of the father, grandfather, and great-grand-
father, of the son, 'the grandson, and great-grandson, and of the
sacrificer himself.
* Or Vijvaru^, if there is any authority for this reading in Mahi-
dhara's commentary to the Va^as. Sa«hM XVII, 79. The Rajah
of Besmah's edition has vuvaruki, which is also the reading adopted
by Rammohun Roy, see Complete Works, vol. i, p. 579.
8 The commentator takes the eighteen for the sixteen priests,
the sacrificer, and his wife. But such an explanation hardly yields
a satisfactory meaning, nor does plava mean perishable.
Digitized by
Google
32 MUJVBAKA-UPANISHAD.
8. Fools dwelling in darkness, wise in their own
conceit, and puffed up with vain knowledge, go round
and round staggering to and fro, like blind men led
by the blind \
9. Children, when they have long lived in igno-
rance, consider themselves happy. Because those
who depend on their good works are, owing to their
passions, improvident, they fall and become miserable
when their life (in the world which they had gained
by their good works) is finished.
10. Considering sacrifice and good works as the
best, th ese fools know no higher good, and having
enjoyed (their reward) on the height of heaven,
gained by good works, they enter again t^fa wr*r 1rl
or a lower one.
11. But those 2 who practise- penance and faith
in the forest, tranquil, wise, and living on alms,
depart free fr om pas sion through the sun to where
that immortal Person dwells whose nature fs impe-
rishable 8 .
12. Let-a— Bx4hma»a, after he has examined all
these worlds which are gained by works, acq uire
freed om fr om all desires. Nothing that is eternal
(not made) can be gained by what is not eternal
(made). Let him, in order to understand this, take
1 Cf. KaJA. Up. II, 5.
* According to the commentator, t his ve r se refers to those who
know the nselessness of sacrifices and have at tained to a knowledge
of the qualifie d Brahman. They live in the forest as Vanaprasthas
and Sawnyisins, practising tapas, i.e. whatever is proper for their
state, and jraddM, i.e. a knowledge of Hirawyagarbha. The wise
are the learned GrAasthas, while those who live on alms are those
who have forsaken their family.
8 That person is Hirawyagarbha. His immortality is relative
only, it lasts no longer than the world (sarasara).
Digitized by
Google
I UVNDAKA, 2 KHAJVDA, 1 3. 33
fuel in his hand and approach a Guru who is learned
and dwells entirely in Brahman.
13. Toth at pupil who has approached him re-
spectfully, w hose thoughts are not troubled by any
d esires, and who has obtained perfect peace, the
wise teacher truly told that knowledge of Brah-
man through which he knows the eternal and true ,
Person.
[15] D
Google
Digitized by '
34 MUWDAKA-UPANISHAD.
SECOND MUiVZ>AKA.
First Khajvda.
i. This is the truth. As from a blazing fire sparks,
being like unto fire 1 , fly forth a thousandfold, thus are
various beings brought forth from the Imperishable,
my friend, and return thither also.
2. That heavenly Person is without body, he is
both without and within, not produced, without
breath and without mind, pure, higher than the high
Imperishable 2 .
3. From him (when entering on creation) is born
breath, mind, and all organs of sense, ether, air, light,
water, and the earth, the support of all.
4. Fire (the sky) is his head, his eyes the sun and
the moon, the quarters his ears, his speech the Vedas
disclosed, the wind his breath, his heart the universe;
from his feet came the earth ; he is indeed the inner
Se]fofaU_things s . ' ^
^Tromhim comes Agni (fire) 4 , the sun being the
fuel ; from the moon (Soma) comes rain (Par^anya) ;
from the earth herbs ; and man gives seed unto the
woman. Thus manybeui gs are begotten jrom the
Person (purusha).
6. From him come the Rik, the Saman, the
1 Cf. Brih. At. II, 1, 20.
2 The high Imperishable is here the creative, the higher the non-
creative Brahman.
' Called Vishwu and Vira£ by the commentators.
4 There are five fires, those of heaven, rain, earth, man, and
woman. Comm.
Digitized by
Google
II MVNDAKA, I KHANDA, IO. 35
Yafush, the Dlksha (initiatory rites), all sacrifices
and offerings of animals, and the fees bestowed on
priests, the year too, the sacrificer, and the worlds,
in which the moon shines brightly and the sun. '
7. From him the many Devas too are begotten,
the Sadhyas (genii), men, cattle, birds, the up and
down breathings, rice and corn (for sacrifices), penance,
faith, truth, abstinence, and law.
8. The seven senses (prawa) also spring from him,
the seven lights (acts of sensation), the seven kinds
of fuel (objects by which the senses are lighted), the
seven sacrifices (results of sensation), these seven
worlds (the places of the senses, the worlds deter-
mined by the senses) in which the senses move,
which rest in the cave (of the heart), and are placed
there seven and seven.
9. Hence come the seas and all the mountains,
from him flow the rivers of every kind ; hence come
all herbs and the juice through which the inner Self
subsists with the elements.
10. The Person is all this, sacrifice, penance, Brah-
man, the highest immortal ; he who knows this hidden
in the cave (of the heart), he, O friend, scatters the
knot of ignorance here on earth.
D 2
Digitized by
Google
36 MIWOAKA-UPANISHAD.
Second Khanda.
i. Manifest, near, moving in the cave (of the heart)
is the great Being. In it everything is centred which
ye know as moving, breathing, and blinking, as being
and not-being, as adorable, as the best, that is beyond
the linrWg t^nrling- of creatures .
^ 2. That which is brilliant, smaller than small, that
on which the worlds are founded and their inhabit-
ants, that is the indestructible Brahman, that is the
breath, speech, mind; that is the true, that is the
immortal. That is to be hit Hit it, O friend !
3. Having taken the Upanishad as the bow, as
the great weapon, let him place on it the arrow,
sharpened by devotion ! Then having drawn it with
a thought directed to that which is, hit the mark, O
friend, viz. that which is the Indestructible!
4. Om |s_th£_hcw, the Sel f is the arrow . Brahjnan_
is call ed its a im. It is to be hit by a man who is
iotth"oughtless ; and then, as the arrow (becomes one
irith the target), he will become one with Brahman.
^5. In him_ the heaven, the earth, and the sky are
w oven, the mj nd_also ^ withjiHj jie senses . Know
him alone as thLfe_SeIf, and leave off other words !
He is the bridge of the Immortal.
6. He moves about becoming manifold within
the heart where the arteries meet, like spokes
fastened to the nave. Meditate on the Self as
Om ! Hail to you, that you may cross beyond (the
sea of) darkness !
■o 7. He who understands all and who knows all, he
to whom all this glory in the world belongs, the
Digitized by
Google
II MUiVDAKA, 2 KHAJVDA, II. 37
Self, is placed in the ether, in the heavenly city of
Brahman (the heart). He assumes the nature of
mind; and becomes the guide of the body of the
senses. He subsists in food, in close proximity to
the heart. The wise who understand this, bphold
the Immortal which shines forth full of bliss.
8. The fetter of the heart is broken, all doubts
are solved, all his works (and their effects) perish
when He has been beheld who is high and low (cause
and effect) \
9. In the highest golden sheath there is the
Br ahman without pa ssio ns and without pa rts. That
is pure, that is the li gEt"of lights, that is it which they
kno w~who know the Sel f.
10. The 2 sun does not shine there, nor the moon
and the stars, nor these lightnings, and much less
this fire. When he shines, everything shines after
him ; by his light all this is lighted 3 .
11. That immortal Brahman is before, that Brah-
man is behind, that Brahman is right and left. It
has gone forth below and above ; Brahman alone is
all this, it is the best.
1 Cf. Ka/fl. Up. VI, 15. 2 Katf . Up. V, 15.
• 5vet.Up.VI, 14; Bhag. GMIX, 15, 6.
Digitized by
Google
38 MUJVDAKA-UPANISHAD.
THIRD MVNDAKA.
. First Khanda.
c h
1 ' ? J f) i. Two birds, inseparable friends, cling to the same
^ t,f tree One of them eats the sweet fruit, the other 1
looks on without eating K
2. On the same tree man sits grieving, immersed,
bewildered by his own impotence (an-lsa). But when
he sees the other lord (tra) contented and knows his
glory, then his grief passes away 2 .
3. When the seer sees the brilliant maker and
lord (of the world) as the Person who has his source
in Brahman, then he is wise, and shaking off good
and evil, he reaches the highest oneness, free from
passions ;
4. For he is the Breath shining forth in all beings,
and he who understands this becomes truly wise,
not a talker only. He revels in the Self, he delights
in the Self, and having performed his works (truth-
fulness, penance, meditation, &c.) he rests, firmly
established in Brahman, the best of those who know
Brahman 8 .
1 Cf. Rv. 1, 164, 20; Nir. XIV, 30; SvetUp. IV, 6; Rati. Up.
Ill, 1.
2 Cf. Svet. Up. IV, 7.
8 The commentator states that, besides atmaratiA kriyavin, there
was another reading, viz. atmaratikriyavan. This probably owed
its origin to a difficulty felt in reconciling kriyav&n, performing
acts, with the brahmavidaw varish/5a5, the best of those who know
Brahman, works being utterly incompatible with a true knowledge
of Brahman. Kriyavan, however, as Aankara points out, may
mean here simply, having performed meditation and other acts
conducive to a knowledge of Brahman. Probably truthfulness,
Digitized by
Google
Ill MVNDAKA, I KHAiVDA, IO. 39
fcO. />.-.-? •
5. By truthfulness, indeed, by penance, right know- y ' ! '^ '•■ 3°
ledge, and abstinence must that Self be gained ; the ( ** ~f
Self whom spotless anchorites gain is pure, and like ;|
a light within the body.
6. The true prevails, not the untrue ; by the true
the path is laid out, the way of the gods (devayana^),
on which the old sages, satisfied in their desires,
proceed to where there is that highest place of the
True One.
7. That (true Brahman) shines forth grand, divine,
inconceivable, smaller than small ; it is far beyond
what is far and yet near here, it is hidden in the
cave (of the heart) among those who see it even
here.
8. He is not apprehended by the eye, nor by\
speech, nor by the other senses, not by penance or
good works 1 . When a man's nature has become
purified by the serene light ot know ledge, then he '
sees him, meditating on him as without part s.
9. That subtle Self is to be known by thought
(ietas) there where breath has entered fivefold;
for every thought of men is interwoven with the
senses, and when thought is purified, then the Self
arises.
10. Whatever state a man whose nature is puri-
fied imagines, and whatever desires he desires (for
himself or for others) 5 , that state he conquers and
penance, &c, mentioned in the next following verse, are the kriyas
or works intended. For grammatical reasons also this reading is
preferable. But the last foot esha brahmavidSw varish/^aA is
clearly defective. If we examine the commentary, we see that
.Sahkara read brahmanish/Aa^, and that he did not read esha, which
would give us the correct metre, brahmanish/Ao brahmavidS/w
varish/AaA.
1 Cf. Kzfi. Up. VI, 12. a Cf. Brih. Ar. I, 4, 15.
Digitized by
Google
4Q
MUtfflAKA-UPANISHAD.
those desires he obtains. Therefore let ■ every rnaji
wh o desires h appiness-worship the man who knows
the Self 1 . " "
Second Khanda.
i. He (the knower of the Self) knows that high-
est home of Brahman 2 , in which all is contained and
shines brightly. The wise who, without desiring
happiness, worship that Person 3 , transcend this seed,
(they are not born again.)
2. He who forms desires in his mind, is born again
through his desires here and there. But to him
whose desires are fulfilled and who is conscious of
the true Self (within himself) all desires vanish, even
here on earth.
3. That Self* cannot be gained by the Veda, nor
by understanding, nor by much learning. He whom
the Self chooses, by him the Self can be gained.
The Self chooses him (his body) as his own.
/ 4. Nor is that Self to be gained by one who is
( i destitute of strength, or without earnestness, or
Y without right meditation. But if a wise man strives
J after it by those means (by strength, earnestness,
\ and right meditation), then his Self enters the home
\>f Brahman.
5. When they have reached him (the Self), the
sages become satisfied through knowledge, they are
conscious of their Self, their passions have passed
1 All this is said by the commentator to refer to a knowledge of
the conditioned Brahman only.
2 See verse 4.
" The commentator refers purusha to the knower of the Self.
4 Ka/i*. Up. II, 23.
Digitized by
Google
Ill MUJVDAKA, 2 KHANDA, IO. 41
away, and they are tranquil. The wise, having
reached Him who is omnipresent everywhere, de-
voted to the Self, enter into him wholly.
6. Having well ascertained the object of the know- \
ledge oftheVed anta 1 . and having p urified their natu re \
by the Yoga 2 of renunciation , al l anchorites, enjoy ing /
th e highest im mortality, become fre e at the time of
the great end (deatlj) in the worlds of Brahma.
7. Their fifteen parts 3 enter into their elements,
their Devas (the senses) into their (corresponding)
Devas 4 . Their deeds and their Self with all h is
kno wledge become all one in the highest Imp erish-
able.
8. As the flowing rivers disappear in the sea 5 ,
losing their name and their form, thus a wise man,
freed from name and form, goes to the divine Person,
who is greater than the great 6 .
9. He who knows that highest Brahman, becomes
even Brahman. In his race no one is born ignorant
of Brahman. He overcomes grief, he overcomes
evil ; free from the fetters of the heart, he becomes
immortal.
10. And this is declared by the following Re-
verse : ' Let a man tell this science of Brahman tov^
those only who have performed all (necessary) acts, I y
who are versed in the Vedas, and firmly established \J\
in (the lower) Brahman, who themselves offer as A/
1 Cf. Taitt. Ar. X, 12, 3; .SVet. Up. VI, 22 ; Kaiv. Up. 3; see
Weber, Ind. Stud. I, p. 288.
2 By the Yoga system, which, through restraint (yoga), leads a
man to true knowledge.
8 Cf. Prajna Up. VI, 4. * The eye into the sun, &c.
5 Cf. PraraaUp.VI, 5.
6 Greater than the conditioned Brahman. Comm.
Digitized by
Google
MUATBAKA-UPAN ISHAD.
an oblation the one ^/shi (Agni), full of faith, and
[by whom the rite of (carrying fire on) the head
lhas been performed, according to the rule (of the
Atharva«as).'
n. The Rishi Angiras formerly told this true
(science 1 ); a man w_hn h^ c not performed the
(proper) rites , does not read it. Adoration to the
highest ,/?zshis ! Adoration to the highest ^z'shis !
1 To Saunaka, cf. I, i, 3.
f>
Digitized by
Google
TAITTIRfYAKA-
UPANISHAD.
Digitized by
Google
Digitized by
Google
9*
TAITTIRIYAKA-UPANISHAD.
FIRST VALLt,
Or, the Chapter on 5^kshA (pronunciation).
First Anuvaka 1 .
i. HARiff, Om! M ay Mitra be propitious to us,
and V aruga JL Aryaman also, Indira/ Brzhaspati. and
the wide-striding Vishmi *.f?efr
Adoration to Brahman ! Adoration to thee, O
Vayu (air)! Thou indeed art the visible Brahman.
I shall proclaim thee alone as the visible Brahman.
I shall proclaim the right. I shall proclaim the true
(scil. Brahman).
(1-5) 3 May it protect me! May it protect the
teacher ! yes, may it protect me, and may it protect
the teacher ! Om ! Peace ! peace ! peace !
1 This invocation is here counted as an Anuv&ka; see Taitt.
Ar., ed. Rajendralal Mitra, p. 725.
2 This verse is taken from Rig-veda-saz»hit£ 1, 90, 9. The deities
are variously explained by the commentators : Mitra as god of the
Pra«a (forth-breathing) and of the day ; Varu«a as god of the
Apana (off-breathing) and of the night. Aryaman is supposed to
represent the eye or the sun ; Indra, strength ; Brihaspati, speech
or intellect ; Vish«u, the feet. Their favour is invoked, because
it is only if they grant health that the study of the highest wisdom
can proceed without fail.
3 Five short sentences, in addition to the one paragraph. Such
sentences occur at the end of other Anuvakas also, and are counted
separately.
Digitized by
Google
46 taittiriyaka-upanishad.
Second AnuvAka.
i. Om 1 ! Let us explain .Siksha, the doctrine of
pronunciation, viz. letter, accent, quantity, effort (in
the formation of letters), modulation, and union of
letters (sandhi). This is the lecture on .SIksha.
Third AnuvAka.
i. May glory come to both of us (teacher and pupil)
together ! May Vedic light belong to both of us !
Now let us explain the Upanishadj^the, secret
meani ng) of the union (sawhita) 2 , under five heads,
with regard to the wo rlds, the heavenly l ights, know-
ledge, o ffspring , and self (body). People call these
the great Sawhitas.
/ First, with regard to the worlds. The e arth is
/yie_jorp«f-^lejnenl > _l ieay en the latter, ether their
Vunion ;
2. That union takes place through Vayu (air). So
much with regard to the worlds. ^ ~~~
Next, with regard to the heavenly lights. Agn i
( fire) is the former ^ element, Aditya (the sun) the
latter, water their m iion. That union takes place
through lightning. So much with regard to the
heavenly lights.
j Next, with regard to knowledge. T he teache r is
I the former element,
3. The pupil the la tter, knowledge __th£JE-ttnion.
That union takes place through the recitation of the
Veda. So much with regard to knowledge.
Next, with regard to offspring. The mother is
1 Cf. Rig-veda-prStuakhya, ed. M. M., p. iv seq.
s Cf. Aitareya-drawyaka III, 1, 1 (Sacred Books, vol. i, p. 247).
Digitized by
Google
i vAixi, 4 anuvAka, 2. 47
the former elem ent, t he father the latter, offspring
their union. That union takes place through pro-
creation. Sojnuch_with regard to offspring.
4. Next, with regard to the self (body). The
lower j aw is the former elem ent, the upper jaw the
latter, speech their unio n. "That union takes place
through speech^ So much with regard to the Self.
These are the great Sa*#hitas. He who knows
these Sawhitas ( unions), as here explained, becomes
united with offspring, cattle, Vedic light, food, and
with the heavenly world.
Fourth Anuvaka.
1. May he 1 who is the strong bull of the Vedas,
assuming all forms, who has risen from the Vedas,
from the Immortal, may that Indra (lord) strengthen
me with wisdom ! May 1,0 God, become an upholder
of the Immortal !
May my body he able, my to"^"^ swppt, may
I hear much with my ears! Thou (Om) art the
shrft rt: ( u f Brahm an), covered by wisdom. Guard
what I have learnt 2 .
She (Sri, happiness) brings near and spreads,
2. And makes, without delay, garments for herself,
cows, food, and drink at all times; therefore bring
that Sri (happiness) hither to me, the woolly, with
1 The next verses form the prayer and oblation of those who
wish for wisdom and happiness. In the first verse it is supposed
that the Om is invoked, the most powerful syllable of the Vedas,
the essence extracted from all the Vedas, and in the end a name
of Brahman. See .ffMnd. Up. p. 1 seq.
a Here end the prayers for the attainment of wisdom, to be fol-
lowed by oblations for the attainment of happiness.
Digitized by
Google
48 TAITTIRiYAKA-UPANISHAD.
her cattle * ! Svaha 2 ! May the Brahman-students
come to me, Svaha! May they come from all
sides, Svaha ! May they come forth to me, Svaha !
May they practise restraint, Svaha ! May they enjoy
peace, S_v4ha !
3. May I be a glory among men, Svaha! May
I be better than the richest, Svaha! May I enter
into thee, O treasure (Om), Svaha! Thou, O
treasur e 3 . enter^into me, Svaha! In thee, con-
sisting of a thousand branches, in thee, O treasure,
I am cleansed,, Svaha ! As water runs downward, as
the months go to the year, so, O preserver of the
world, may Brahma n-stud ents always come to me
from all sidesTSvaha !
(1) Thou ar t a refuge ! Enli ghte n me ! Take pos-
session of me !
Fifth Anuvaka.
1. Bhu, Bhuvas, Suvas*, these are the three sacred
i nterjectio ns (vyahWti). MahcL£amasya taught a
fourth, viz. Ma has, w t"fh ,,c R ra,k ™an, which is th e
Self. The others (devatas) are its members.
BTiu_is_lhia_3sa3rld > Bhuvas is the sky, Suvas is
th e other j ^prld.
2. Mahas is the sun. All the worlds are increased
by the sun. Bhu is Agni (fire), Bhuvas is Vayu
(air), Suvas is Aditya (sun). Mahas is the moon. All
the heavenly lights are increased by the moon.
1 The construction is not right. Woolly, lomasi, is explained
as ' possessed of woolly sheep.'
s With the interjection Sv&ha - each oblation is offered.
* Bhaga, here explained as bhagavat.
4 The text varies between Bhu, Bhuvas, Suvas, Mahas, and Bhu,
Bhuvar, Suvar, Mahar.
Digitized by
Google
i vallI, 6 anuvaka, 2. 49
Bhu is the i&'i-verses, Bhuvas is the Saman-verses,
Suvas is the Ya^ms-verses.
3. Mahas is Brah man. All the Vedas are increased
by the Brahman.
(1-2) Bhu is Pra«a (up-breathing), Bhuvas is
Apana (down-breathing), Suvas is Vyana (back-
breathing). Mahas is food. All breathings are
increased by food.
Thus there are these four times four, the four and
four sacred interjections. He who knows these,
(i-2)_Kqqws the Brahman. All Devas bring
offerings to him.
Sixth Anuvaka.
1. There is the eth er within the heart, and in it
there is the Person (purusha) consisting of mind,
immortaCgolden.
Between the two palates there hangs the uvula,
like a nipple — that is the starting-point of Indra (the
lord) 1 . Where the root of the hair divides, there
he opens the two sides of the head, and saying Bhu,
he enters Agni (the fire); saying Bhuvas, he enters
Vayu (air) ;
2. Saying Suvas, he enters Aditya (sun) ; saying
Mahas, he enters Brahman. He there obtains lord-
ship, he reaches the lord of the mind. He becomes
lord of speech, lord of sight, lord of hearing, lord of
knowledge. Nay, more than this. There is the
Brahman whose body is ether, whose nature is true,
rejoicing in the senses (pra»a), delighted in the mind,
perfect in peace, and immortal.
(1) Worship thus, O Prailnayogya !
1 Cf. I, 4, 1.
[15] E
Digitized by
Google
5<D TAITTIRtYAKA-UPANISHAD.
Seventh AnuvAka.
i. ' The eg r 1 ^, thfi g Ky. heaven, the four quarters,
and the intermed iate qua rters/ — ' Agni (fire), Vayu
(air), Aditya (sun), -ffandramas (moon), and the
stars,' — 'Water, herbs, trees, ether, the universal Self
(vir&f),' — so much with reference to material objects
(bhuta).
Now with reference to the self (the body) : ' Pra«a
(up-breathing), Apina (down-breathing), Vyana (back-
breathing), Udana (out-breathing), and Sama#a (on-
breathing),' — 'The eye, the ear, mind, speech, and
touch,' — ' The skin, flesh, muscle, bone, and marrow.'
Having dwelt on this (fivefold arrangement of the
worlds, the_goda^_beings, breathings, senses, and
elements__o£_the body), a Rishi said: 'Whatever
exists is fivef old (pankt a) 1 .'
(i) By means of the one fivefold set (that referring
to the body) he completes the other fivefold set.
Eighth Anuvaka.
i. Om means Brahman. 2. Om means all this.
3. Om means obedience. When they have been
told, ' Om, speak,' they speak. 4. After Om they
sing Samans. 5. After Om they recite ' hymns.
6. After Om the Adhvaryu gives the response.
7. After Om the Brahman-priest gives orders.
8. After Om he (the sacrificer) allows the perform-
ance of the Agnihotra. 9. When a Brahma#a is
going to begin his lecture, he says, 10. ' O m. may
I acquire Brahman^the^Vfida).' He thus acquires
the Veda:
1 Cf.Br/Ti.Ar. Up. I, 4, 17.
Digitized by LaOOQ lC
I VALLf, 10 ANUVAKA, 3. 51
Ninth AnuvAka 1 .
1. (What is necessary ?) The right, and learning
and practising the Veda. The true^a nd learni ng and
practising the Veda. Penanrp, and learning a nd prac-
tising the Veda, Re straint, and learning and prac tising
t he Veda . Tra nquillity, an djearning and practising
the Veda. T he fire s (to be consecrated), and learning
and practising the Veda. The A gnihotra sacrifice,
and learning and practising the Veda. Gijests (to
be entertained), and learning and practising the Veda.
Man's duty, and learning and practising the Veda,
Children, and learning and practising the Veda.
"^(1-6) Marriage, and learning and practising the
Veda. Children's children, and learning and prac-
tising the Veda,
Satyava^as Rfithitara thinks that the true only
is necessary. Taponitya Paurarishrt thinks that
penance only is necessary. Naka Maudgalya thinks
that learning and practising the Veda only are neces-
sary, — for that is penance, that is penance.
Tenth AnuvAka.
1. ' I am he who shakes the tree (i.e. the tree of
the world, which has to be cut down by knowledge).
2. My glory is like the top of a mountain. 3. I, whose
pure light (of knowledge) has risen high, am that
which is truly immortal, as it resides in the sun.
1 This chapter is meant to show that knowledge alone, though
it secures the highest object, is not sufficient by itself, but must be
preceded by works. The learning of the Veda by heart and the
practising of it so as not to forget it again, these two must always
have been previously performed.
E 2
Digitized by
Google
52 taittirIyaka-upanishad.
4. I am the brightest treasure. 5. I amjyise, im-
mortal, imperishable 1 .' 6. Thi s, is \ hp teaching of
rhp Vpda hy f-Vip poet Tri.ra iiku.
Eleventh AnuvAka.
1. After having taught the Veda, the teacher in-
^ structs the pupil : ' Say what is true ! Do thy duty !
Do not neglect the study of the Veda! After
having brought to thy teacher his proper reward,
do not cut off the line of children ! Do not swerve
from the truth ! Do not swerve from duty! Do not
neglect what is useful! Do not neglect greatness!
Do not neglect the learning and teaching of the
Veda!
2. ' Do not neglect the (sacrificial) works due to the
Gods and Fathers !( Let thy mother be to thee like
unto a god ! Let thy father be to thee like unto a
— god! Let thy teacher be to thee like unto a god!
Let thy guest be to thee like unto a god!
Whatever_jacti©ns__are blamel ess, th ose-- gh ould. be
regarded, notpjhers. Whate ver goo d works have
been perform ed by us. those should be, phgfjryprl by
3. ' Not others. And there are some Brahma«as
better than we. They should be comforted by thee by
giving them a seat. Whatever is given should be
given with faith, not without faith, — with joy, with
modesty, with fear, with kindness. If there should
1 This verse has been translated as the commentator wishes it
to be understood, in praise of that knowledge of Self which is only
to be obtained after all other duties, and, more particularly, the
study of the Veda, have been performed. The text is probably
corrupt, and the interpretation fanciful.
Digitized by
Google
I VALLi, 12 ANUVAKA, 5. 53
be any doubt in thy mind with regard to any sacred
act or with regard to conduct, —
4. 'In that case conduct thyself as Brahma«as who
possess good judgment conduct themselves therein,
whether they be appointed or not 1 , as long as they
are not too severe, but devoted to duty. And with
regard to things that have been spoken against,
as Brahma»as who possess good judgment conduct
themselvestherein, whether they be appointed or
not, as longas they are num ioJseXtere, buE devoted
to duty .
(1-7) Thus co nduct thyse lf. 'This is the rule.
This is the teaching! This is the true__purport
(Upanishad) oilthe Veda^ This is the command.
Thus should you observe. Thus should this be
observed.'
Twelfth AnuvAka.
1. May Mitra be propitious to us, and Varu«a,
Aryaman also, Indra, Brzhaspati, and the wide-
striding Vishmi! Adoration to Brahman! Adora-
tion to thee, O Vayu ! Thou indeed art the visible
Brahman. I proclaimed thee alone as the visible
Brahman.
(1-5) I proclaimed the right. I proclaimed the
true. It protected me. It protected the teacher.
Yes, it protected me, it protected the teacher. Om !
Peace! peace! peace!
1 AparaprayuktS iti svatantrdA. For other renderings, see Weber,
Ind. Stud. II, p. 2 1 6.
Digitized by
Google
54 taittirIyaka-upanishad.
SECOND VALLl,
Or, the Chapter on Ananda (bliss).
Hari^, Om! May it (the Brahman) protect us
both (teacher and pupil)! May it enjoy us both!
May we acquire strength together ! May our know-
ledge become bright! May we never quarrel! Peace!
peace! peace 1 !
First AnuvAka.
He who knows the Brahman attains the highest
(Brahman). On this the following verse is recorded :
'He who knows Brahman, which is (i.e. cause,
not effect), which is conscious, which is without
end, as h jdden in the depth (of the heart), in the
highest ether, he enjoy s all blessings, at one with
the omnisc ient Bra hman.'
^ From that Self 2 (Brahman) c pr an g ether (alcana,
that through which we hear); f rom ether_ air (that
through which we hear and feel); from air fire (that
through which we hear, feel, and see); from fire water
(that through which we hear, feel, see, and taste);
from water earth (that through which we hear, feel,
see, taste, and smell). From earth herbs, from herbs
food, from food seed, from seed man. Man thus
consists of the essence of food. This is his head,
1 Not counted here as an Anuvdka. The other Anuv&kas are
divided into a number of small sentences.
* Compare with this sn'sh/ikrama, ATMnd. Up. VI, 2 j Ait. Ar.
II, 4, i.
Digitized by
Google
II VALli, 2 ANUVAKA. 55
this his right arm, this his left arm, this his trunk
(atman), this the seat (the support) \
On this there is also the following .Sloka :
Second Anuvaka,
* ' From fo o d 2 * nrf* produced nil rrpa rurf". which
dwell on earth. Then they live by foo d, and in the
end they return to food. For food is the oldest of
all beings, and therefore it is called panacea (sar-
vaushadha, i.e. consisting of all herbs, or quieting
the heat of the body of all beings).'
\ They who worship food as Brahman 3 , obtain all
food! J? or foo d is il io . u Tdest of all beings, and
the refore it is called panac ea. From food all crea-
tures are produced ; by food, when born, they grow.
Because it is fed on, or because it feeds on beings,
therefore it is called food (anna).
^ Different from this, which consists of the essence
of food, is t he other, t he inner Self, which consists
of breath. The former is niled by this. It also
has the shape of man. Like the human shape
of the former is the human shape of the latter.
Pra#a (up-breathing) is its head. Vyana (back-
breathing) is its right arm. Apana (down-breathing)
is its left arm. Ether is its trunk. The earth
the seat (the support).
■^ On this there is also the following .Sloka :
1 The text has ' the tail, which is his support.' But pratishM
seems to have been added, the Anuvdka ending originally with
puktfia, which is explained by n£bher adhastdd yad angam. In the
Persian translation the different members are taken for members
of a bird, which is not unlikely.
2 Anna is sometimes used in the more general sense of matter.
8 Worship consisting in the knowledge that they are born of
food, live by food, and end in food, which food is Brahman.
Digitized by
Google
56 taittir!yaka-upanishad.
Third Anuvaka.
'The Devas breathe after breath (pra»a), so do
men and cattle. B reath is the life of b eings, there-
fore it is called sarviyusha (alFenlivening).'
^ They who worship br eath ju^jjahjnan, obtain
the lull lite, b or breatlLJ g'EheKfe of^ alLbeings, and
therefore it is called sarv&yusha. The embodied
Self of this (consisting of breath) is the same as that
of the former (consisting of food).
^ Differen t from this, which consists of breath, is the
other, the~inner^Se lf which c oasists^of^mind. The
former is filled by this. It also has the shape of
man. Like the human shape of the former is the
human shape of the latter. Ya^us is its head. Rik
is its right arm. Saman is its left arm. The doctrine
(adera, i.e. the Brahma^a) is its trunk. The Athar-
vangiras (Atharva-hymns) the seat (the support).
On this there is also the following 61oka :
Fourth Anuvaka 1 .
^' He who knows the bliss of that Brahman, from
whence all speech, with th e mind , turns away unable
to reach it, he never feajsi. Th e emb odied Self of
this (consisting of min d) is t he same as that of the
former (consisting ofT5reath)T
\ Different from this, which consists of mind, is the
other, the inner S elf, whic h consists of understanding.
The former is filled_by_ihis. It also has the shape
of man. Like the human shape of the former is the
human shape of the latter. Faith is its head. What
is right is its right arm. What is true is its left arm.
1 Cf. II, 9.
Digitized by LaOOQ lC
ii VAixi, 6 anuvAka. 57
Absorption (yoga) is its trunk. The great (intellect?)
is the seat (the support).
On this there is also the following Sloka :
Fifth AnuvAka.
' Understanding performs the sacrifice, it performs
all sacred acts. AH Devas worship unders tanding
_as Brahman, as the old est. If a man knows
understanding as Brahman, and if he does not
swerve from it. he leaves all p vflg K»hinri in tno
body, and attains all his wishes.' The embodied Self
of this (consisting of understanding) is the same as
that of the former (consisting of mind).
^ Different from this, which consists of understand-
ing, is the other inner Self, which consists of bliss.
The former is filled by this. It also has the shape
of man. Like the human shape of the former is the
human shape of the latter. Joy is its head. Satisfac-
tion its right arm. Great satisfaction is its left arm.
Bliss is its trunk. Brahman is the seat (the support).
On this there is also the following .Sloka :
Sixth AnuvAka.
' He who knows the Brahman a s non-evicting
becomes h imself non-existing. He who knows the
Brahman as existin g, h'™ we Vnnw himself as exist-
ing.'- The embodied Self of this (bliss) is the same
as that of the former (understanding).
Thereupon follow the questions of the pupil :
' Does any one who knows not, after he has departed
this life, ever go to that world ? Or does he who
knows, after he has departed, go to that world 1 ?'
1 As he who knows and he who knows not, are both sprung
from Brahman, the question is supposed to be asked by the pupil,
whether both will equally attain Brahman.
Digitized by
Google
58 TAITTIRtYAKA-UPANISHAD.
The answer is : He wished, may I be many 1 ,
may I grow forth. He brooded over himself (like
a man performing penance). After he had thus
brooded, he sent forth (created) all, whatever there
is. Having sent forth, he entered into it. Having
entered it, he became sat (what is manifest) and
tyat (what is not manifest), denned and undefined,
supported and not supported, (endowed with) know-
ledge and without knowledge (as stones), real and
unreal 2 . The Sattya (true) became all this what-
soever, and therefore the wise call it (the Brahman)
Sat-tya (the true).
On this there is also this .Sloka :
Seventh Anuvaka.
' In the beginning this was non-existent (not yet
defined by form and name). From it was born what
exists. That made itself its Self, therefore it is
called th e Self-ma de V That which is Self-made is
a flavour 4 (can be tasted), for only after perceiving a
flavour can any one perceive pleasure. Who could
breathe, who could breathe forth, if that bliss (Brah-
1 In the .ffMndogya-upanishadVT, 2, 1, where a similar account
of the creation is given, the subject is spoken of as tad, neuter. It
is said there : 'In the beginning there was that only which is, one
only, without a second. It willed, may I be many,' &c. (Cf. Brih.
Ar. Up. vol. ii, p. 52.)
2 What appears as real and unreal to the senses, not the really
real and unreal.
* 8 Cf. Ait. Up. I, 2, 3.
* As flavour is the cause of pleasure, so Brahman is the cause
of all things. The wise taste the flavour of existence, and know
that it proceeds from Brahman, the Self-made. See Kaushitaki-
upanishad I, 5 ; Sacred Books, vol. i, p. 277.
Digitized by
Google
II VAIxi, 8 ANUVAKA, 2. 59
man) existed not in the ether (in the heart) ? For
he alone causes blessedness.
When he finds freedom from fear and rest in that
which is invisible, incorporeal, undefined, unsup-
ported, then he has obtained the fearless. For if
he makes but the smallest distinction in it, there
is fear for him 1 . But that fear exists only for
one who thinks himself wise 2 , (not for the true
sage.)
On this there is also this .Sloka :
Eighth AnuvAka.
(1) ' From terror of it (Brahman) the wind blows,
from terror the sun rises ; from terror of it Agni
and Indra, yea Death runs as the fifth 3 .'
Now this is a n examination of (what is meant by )
BitssJ^nanda) : ~"
Let there be a noble young man, who is well
read (in the Veda), very swift, firm, and strong, and
let the whole world be full of wealth for him, that is
one measure of human bliss.
pOne hundred times that human bliss (2) is one
measure of the bliss of human Gandharvas (genii),
1 Fear arises only from what is not ourselves. Therefore, as
soon as there is even the smallest distinction made between our Self
and the real Self, there is a possibility of fear. The explanation
ud=api, aram=alpam is very doubtful, but recognised in the
schools. It could hardly be a proverbial expression, ' if he makes
another stomach* meaning as much as, 'if he admits another person.'
According to the commentator, we should translate, ' for one who
knows (a difference), and does not know the oneness.'
2 I read manvanasya, the commentator amanv£nasya. a
8 Ka//5. Up. VI, 3.
Digitized by
Google
60 TAITTIRiYAKA-UPANISHAD.
and likewise of a great sage (learned in the Vedas)
who is free from desires.
t One hundred times that bliss of human Gan-
dharvas is one measure of the bliss of divine
Gandharvas (genii), and likewise of a great sage
who is free from desires.
\| One hundred times that bliss of divine Gandharvas
is one measure of the bliss of the Fathers, enjoying
their long estate, and likewise of a great sage who is
free from desires.
$ One hundred times that bliss of the Fathers is
one measure of the bliss of the Devas, born in the
A^ina heaven (through the merit of their lawful
works), (3) and likewise of a great sage who is free
from desires.
^ One hundred times that bliss of the Devas born
in the A^ana heaven is one measure of the bliss of
the sacrificial Devas, who go to the Devas by means
of their Vaidik sacrifices, and likewise of a great
sage who is free from desires.
\One hundred times that bliss of the sacrificial
Devas is one measure of the bliss of the (thirty-three)
Devas, and likewise of a great sage who is free from
desires.
•One hundred times that bliss of the (thirty-three)
Devas is one measure of the bliss of Indra, (4) and
likewise of a great sage who is free from desires.
^One hundred times that bliss of Indra is one
measure of the bliss of BHhaspati, and likewise of
a great sage who is free from desires.
*One hundred times that bliss of IWhaspati is one
measure of the bliss of Pra^apati, and likewise of
a great sage who is free from desires.
< One hundred times that bliss of Pra^ipati is one
Digitized by
Google
ii vall!, 8 anuvAka, 5.
61
measure of the bliss of Brahman, and likewise of
a great sage who is free from desires.
\ (5) He 1 who is this (Brahman) in man, and he who
is that (Brahman) in the sun, both are one 2 .
i
1 Cf. Ill, 10, 4.
8 In giving the various degrees of happiness, the author of the
Upanishad gives us at the same time the various classes of human
and divine beings which we must suppose were recognised in his
time. We have Men, hunjaji Gan dharvas^ div ine Gandjiarvas,
Fathers (pitaraj £iralokaloka^), b orn Gods (a^ana^a" dev&A), Gods
by merit. (karmadeva>4) , Gods, Indra, Br?haspati, Pra^lpati, Brah-
man. Such a list would seem to be the invention of an individual
rather than the result of an old tradition, if it did not occur in a very
similar form in the «Satapatha-br£hma»a, MSdhyandina-f akM XIV,
7, 1,31, K£«va-.rakha(Br»h. Ar.Up. IV, 3,32). Here, too, the highest
measure of happiness is asrriheri to the ' R rt i h r nnl"kn ) nnd ptr i °r
beings are supposed to share a certain measure only of its sup reme
ha ppiness. The scale begins in the M&dhyandina-.rakha' with men,
who are followed by the Fathers (pitaro ^italoka^), the Gods by
merit (karmadeva^), the Gods by birth (a^SnadevSA, with whom
the .Srotriya is joined), the world of Gods, the world of Gandharvas,
the world of Pra^&pati, the world of Brahman. In the Bnhad-
£ra»yaka-upanishad we have Men, Fathers, Gandharvas, Gods by
merit, Gods by birth, Pra^&pati, and Brahman. If we place the
three lists side by side, we find —
TAITTIRlYA-UPAN.
5ATAPATHA-BRAH.
B/JJHADARAAT.-UPAN.
Men
Men
Men
Human Gandharvas
(and .Srotriya)
Divine Gandharvas
Fathers (£iraloka)
Fathers (gitaloka)
Fathers (^italoka)
Gandharvas
Gods by birth
Gods by merit
Gods by merit
Gods by merit
Gods
Gods by birth
(and .Srotriya)
Gods
Gods by birth
(and .Srotriya)
Indra
Gandharvas
—
Briliaspati
Pra^dpati
Brahman
Pra^ipati
Brahman
Pra^&pati
Brahman.
The commentators do not help us much. *$ankara on the Taitti-
Digitized by
Google
62 TAlTTIRiYAKA-UPANISHAD.
He who knows this, when he has departed this
world, reaches and comprehends the Self which con-
sists of food, the Self which consists of breath, the
Self which consists of mind, the Self which consists
of understanding, the Self which consists of bliss.
On this there is also this .Sloka :
riyaka-upanishad explains the human Gandharvas as men who
have become Gandharvas, a kind of fairies ; divine Gandharvas, as
Gandharvas by birth. The Fathers or Manes are called ^"iraloka,
because they remain long, though not for ever, in their world. The
a^ana^-a Gods are explained as born in the world of the Devas
through their good works (smarta), while the Karmadevas are ex-
plained as born there through their sacred works (vaidika). The
Gods are the thirty-three, whose lord is Indra, and whose teacher
Bnhaspati. Pra^&pati is Vira#, Brahman Hirawyagarbha. Dyive
dagahga, in his commentary on the Satapatha-brahmawa, ex
the Fathers as those who, proceeding on the Southern path,
conquered their world, more particularly by having themselves
offered in their life sacrifices to their Fathers. The Karmadevas,
according to him, are those who have become Devas by sacred
works (jrauta), the A^dnadevas those who were gods before there
were men. The Gods are Indra and the rest, while the Gandharvas
are not explained. Pra^apati is Vira#, Brahman is Hirawyagarbha.
Lastly, .Sankara, in his commentary on the B«hadara»yaka-
upanishad, gives nearly the same explanation as before; only that
he makes a^&nadevaA still clearer, by explaining them as gods
a^anataA, i. e. utpattitaA, from their birth.
The arrangement of these beings and their worlds, one rising
above the other, reminds us of the cosmography of the Buddhists,
but the elements, though in a less systematic form, existed evidently
before. Thus we find in the so-called Gargt-brahma«a (Satapatha-
brShmawa XIV, 6, 6, i) the following succession : Water, air, ether a ,
the worlds of the sky b , heaven, sun, moon, stars, gods, Gandharvas ,
Pra^ipati, Brahman. In the Kaushltaki-upanishad I, 3 (Sacred
Books of the East, vol. i, p. 275) there is another series, the worlds
of Agni, Vayu,Varu«a, Indra, Prag-apati, and Brahman. See Weber,
Ind. Stud. II, p. 224.
» Deest in Ka«va-sakha.
* Between sky and sun, the KSava-salcha' places the Gandharvaloka (Bnh. Ar.
Up. Ill, 6, 1, p. 609).
• Instead of Gandharvas, the Brih. Ar. Up. places Indra. «
Dvive-
selves ^^t
rl At ro e ^
Digitized by
Google
II VALLi, 9 ANUVAKA. 63
Ninth Anuvaka 1 .
' He who knows the bliss of that Brahman, from
whence all speech, with the mind, turns away unable
to reach it, he fears nothing V
He does not distress himself with the thought,
Why did I not do what is good ? Why did I do
what is bad ? He who thu s knows these two (good
and bad), freesjjjmself. He w ho knows both, frees
himself 3 . This is the Upanishad 4 .
2 E
ofjej
^^^PJmiss:
fF added
Cf. II, 4.
2 Even if there is no fear from anything else, after the knowledge
of^elf and Brahman has been obtained, it might be thought that
might still arise from the commission of evil deeds, and the
mission of good works. Therefore the next paragraphs have been
added.
The construction of these two sentences is not clear to me.
4 Here follows the Anukramawi, and in some MSS. the same
invocation with which the next Vallt begins.
Digitized by
Google
64 TaittirIyaka-upanishad.
THIRD VALLl,
Or, the Chapter of Bhrigv.
HariA, Om ! May it (the Brahman) protect us
both ! May it enjoy us both ! May we acquire strength
together ! May our knowledge become bright t May
we never quarrel ! Peace ! peace ! peace 1 !
First AnuvAka.
BhgTgu y &mni went to his father Varu^a, saying:
' Sir, teach me Brahman.' He told him this, viz.
Flood, br eath, the .eye^jhe earjcnind^speech.
TKen he said again to him : ' Th^jJJcojnjwhence
i the je bei ngs, are born, that-by which, when born,
they live, that into which they enter at their death,
try to know that. That is Brahman.'
He performer penance. Having performed
penance — ,
Second AnuvAka.
He perceived that food is Brahman, for from food
these beings are produced ; by food, when born, they
live ; and into food they enter at their death.
Having perceived this, he went again to his father
Varu«a, saying : ' Sir, teach me Brahman.' He said
to him: 'Try to know Brahman by penance, for
penance is (the means of knowing) Brahman.'
He performed penance. Having performed
penance —
1 The same paragraph, as before (II, i), occurs at the end of the
Ka/4a-upanishad, and elsewhere.
Digitized by
Google
in vallI, 5 anuvAka. 65
Third AnuvAka.
He perceived that b reath, * is Brahman, for from
breath thesebeingsTare born ; by breath, when born,
they live ; into brea jhj jiey enter at their dea th.
Having perceived this, he went again to his father
Varu»a, saying : ' Sir, teach me Brahman.' He said
to him : ' Try to know Brahman by penance, for
penance is (the means of knowing) Brahman.'
He performed penance. Having performed
penance —
Fourth AnuvAka.
He perceived that mind (ma^ia^) is B rahma n, for
from mind these beings are born ; by mind, when
born, they live ; into mind the y enter at their death._
Having perceivecTthis, he went again to his father
Varu»a, saying : ' Sir, teach me Brahman.' He said
to him : ' Try to know Brahman by penance, for
penance is (the means of knowing) Brahman.'
He performed penance. Having performed
penance —
Fifth AnuvAka.
He perceived that understanding (vif«ana) was
BxaE55aH7 JoF from understanding these beings are
born ; by understanding, when born, they live ; into
understanding they enter at their death.
Having perceived this, he went again to his father
Vanwa, saying : ' Sir, teach me Brahman.' He said
to him : ' Try to know Brahman by penance, for
penance is (the means of knowing) Brahman.'
1 Or life j see Brth. kr. Up. IV, 1, 3.
[15] r
Digitized by
Google
66 taittirSyaka-upanishad.
He performed penance. Having performed
penance — " " '
Sixth AnuvAka.
^He perceived that bliss is Bra hman , for from bliss
these beings~are born"T"by bliss, when born, they
live ; into bliss they enter at their death.
This is the knowledge of Bhrzgu and Varurca 1 ,
exalted in the highest heaven (in the heart). He
who knows this becomes exalted, becomes rich in
food, and able to eat food (healthy), becomes great
by offspring, cattle, and the splendour of his know-
ledge (of Brahman), great by fame.
Seventh AnuvAka.
Let hi m never abuse fo od, that is the rule.
Breaj^is_j&Qd 2 , the body eats the food. The
body rests on breath, breath rests on the body. This
is the food resting on food. He who knows this
food resting on food 3 , rests exalted, becomes rich
in food, and able to eat food (healthy), becomes
great by offspring, cattle, and the splendour of his
knowledge (of Brahman), great by fame.
Eighth AnuvAka.
• Let himjieyer shun food, that is the rule. Water
is food, the light~eats the food. The light rests on
water, water rests on light. This is the food resting
1 Taught by Varuwa, learnt by Bhrc'gu Varu«i.
2 Because, like food, it is inside the body.
3 The interdependence of food and breath. The object of this
discussion is to show (see .Sahkara's commentary, p. 135) that the
world owes its origin to there being an enjoyer (subject) and what is
enjoyed (object), but that this distinction does not exist in the Self.
Digitized by
Google
Ill VALLi, IO ANUVAKA, 2. 67
on food x . He who knows this food resting on food,
rests exalted, becomes rich in food, and able to eat
food (healthy), becomes great by offspring, cattle, and
the splendour of his knowledge (of Brahman), great
by fame.
Ninth Anuvaka.
Let him acquire much food, that is the rule. Earth
is food, the ether eats th~e tood. The ether rests
on the earth, the earth rests on the ether. /This is
the food resting on food. He who knows this food
resting on food, rests exalted, becomes rich in food,
and able to eat food (healthy), becomes great by
offspring, cattle, and the splendour of his knowledge
(of Brahman), great by fame. %
Tenth Anuvaka.
1. Let him never turn away (a stranger) from his
Ji guse, th~at~ is the rule. Therefore a man should
by all means acquire much food, for (good) people
say (to the stranger) : ' There is food ready for him.'
If he gives food amply, food is given to him amply.
If he gives food fairly, food is given to him fairly.
If he gives food meanly, food is given to him
meanly.
2. He who knows this, (recognises and worships
Brahman 2 ) as possession in speech, as acquisition
and possession in up-breathing (pra«a) and down-
breathing (apana) ; as action in the hands ; as walking
in the feet ; as voiding in the anus. These are the
human recognitions (of Brahman as manifested in
human actions). Next follow the recognitions (of
1 The interdependence of water and light.
2 Brahma«a updsanaprakara/^.
F 2
Digitized by
Google
68 taittirIyaka-upanishad.
Brahman) with reference to the Devas, viz. as satis-
faction in rain ; as power in lightning ;
3. As glory in cattle ; as light in the stars ; as
procreation, immortality, and bliss in the member ;
as everything in the ether. Let him worship that
(Brahman) as support, and he becomes supported.
Let him worship that (Brahman) as greatness (maha^),
and he becomes great. Let him worship that (Brah-
man) as mind, and he becomes endowed with mind.
4. Let him wors hjpj& at (Brah m an) as adoratio n,
and all desires ™N djiwn^fjnrf him in nrlnrntinn
Let him WOTSh~ip that (Brahma n ) as JEkahman, and
he will become~"poss^sed of Br? hrnan Let him
worship lfris~as~The~ absorption of the gods 1 in Brah-
man, and the enemies who hate him will die all
around him, all around him will die the foes whom
he does not love.
He 2 who is this j[Brahman^in man, and he who is
that (Brahman) in the sun, both are one.
5. He who knows this, when he has departedjhis
world, after reaching and co mprehending the Self
which consists of food, the -Seh°"which consists of
breath, the Self which consists of mind, the Self
which consists of understanding, the Self which con-
sists of bliss, enters and takes possession of these
worlds, and having as much food as he likes, and
assuming as many forms as he likes, he sits down
singing this Saman (of Brahman) : ' Havu, havu,
havu!
1 Cf. Kaush. Up. II, 1 2. Here the absorption of the gods of fire,
sun, moon, and lightning in the god of the air (v&yu) is described.
£ankara adds the god of rain, and shows that air is identical with
ether.
2 Cf. II, 8.
Digitized by
Google
Ill VALLi, IO ANUVAKA, 6. 69
6. ' I am food (object), I am food, I am food ! I am
the eater of food (subject), I am the eater of food,
I am the eater of food ! I am the poet (who joins
the two together), I am the poet, I am the poet!
I am the first-born of the Right (rz'ta). Before the
Devas I was in the centre of all that is immortal.
He who gives me away, he alone preserves me: him
who eats food, I eat as food.
' I overcome the whole world, I, endowed with
golden light 1 . He who knows this, (attains all this).'
This is the Upanishad 2 .
1 If we read suvan/a^yoti^. The commentator reads suvar »a
^yoti^, i. e. the light is like the sun.
2 After the Anukrama«i follows the same invocation as in the
beginning of the third Valli, ' May it protect us both,' &c.
Digitized by
Google
Digitized by
Google
Bi?/HADARAiVYAKA-
UPANISHAD.
Digitized by
Google
Digitized by
Google
B/?/HADARAA^YAKA-
UPANISHAD.
FIRST ADHYAYA 1 .
First BrAhmaata.
i. Verily 2 the dawn is the head of the horse which
is fit for sacrifice, the sun its eye, the wind its breath,
the mouth the Vaisvanara 3 fire, the year the body
of the sacrificial horse. Heaven is the back, the sky
the belly, the earth the chest 4 , the quarters the two
sides, the intermediate quarters the ribs, the members
the seasons, the joints the months and half-months,
the feet days and nights, the bones the stars, the
1 It is the third Adhyaya of the A^ra«yaka, but the first of the
Upanishad.
a This Brahmawa is found in the Madhyandina text of the Sata-
patha, ed. Weber, X, 6, 4. Its object is there explained by the
commentary to be the meditative worship of V ira^, as represente d
metaphorically in the members nf thp Vi nrsp Saya«a dispenses with
its explanation, because, as part of the Bnhadarawyaka-upanishad,
according to the Ka»va-.rakha, it had been enlarged on by the
Varttikakara and explained.
8 Agni or fire, as pervading everything, as universally present
in nature.
* Pa^asya is doubtful. The commentator suggests pad-asya, the
place of the feet, i. e. the hoof The Greek Pegasos, or Wot jnryof,
throws no light on the word. The meaning of hoof would hardly
be appropriate here, and I prefer chest on account of uras in
I, 2, 3. Deussen (Vedanta, p. 8) translates, die Erde seiner Fttsse
Schemel ; but we want some part of the horse.
Digitized by
Google
74 BR/HADARAiVYAKA-UPANISHAD.
flesh the clouds. The half-digested food is the sand,
the rivers the bowels 1 , the liver and the lungs 2 the
mountains, the hairs the herbs and trees. As the
sun rises, it is the forepart, as it sets, the hindpart of
the horse. When the horse shakes itself 3 , then it
lightens ; when it kicks, it thunders ; when it makes
water, it rains ; voice* is its voice.
2. Verily Day arose after the horse as the (golden)
vessel 5 , called Mahiman (greatness), which (at the
sacrifice) is placed before the horse. Its place is in
the Eastern sea. The Night arose after the horse
as the (silver) vessel, called Mahiman, which (at the
sacrifice) is placed behind the horse. Its place is in
the Western sea. Verily, these two vessels (or great-
nesses) arose to be on each side of the horse.
As a racer he carried the Devas, as a stallion the
Gandharvas, as a runner the Asuras, as a horse men.
The sea is its kin, the sea is its birthplace.
Second BrAhma^a*.
i. In the beginning„there was nothing (to be per-
1 Guda, being in the plural, is explained by n&di, channel, and
siraA; for we ought to read siri or hirSgrahawe for siri, p. 22, 1. 16.
2 KlomSnaA is explained as a plurale tantum (nityam bahuva-
£anam ekasmin), and being described as a lump below the heart,
on the opposite side of the liver, it is supposed to be the lungs.
s ' When it yawns.' Anandagiri.
4 Voice is sometimes used as a personified power of thunder
and other aerial sounds, and this is identified with the voice of the
horse.
s Two vessels, to hold the sacrificial libations, are placed at the
Afvamedha before and behind the horse, the former made of gold,
the latter made of silver. They are called Mahiman in the technical
language of the ceremonial. The place in which these vessels are
set, is called their yoni. Cf. V&gas. Szmhh& XXIII, 2.
8 Called the Agni-brahmawa, and intended to teach the origin of
Digitized by
Google
I ADHYAYA, 2 BRAHMAJVA, 3. 75
ceived) here whatsoever. By Death indeed all this
was concealed, — by hunger; for death is hunger.
Death (the first being) thought, ' Let me have a
body.' Then he moved about, worshipping. From
him thus worshipping water was produced. And he
said : ' Verily, there appeared to me, while I wor-
shipped (ar£ate), water (ka).' This is why water is
called ar-ka 1 . Surely there is water (or pleasure)
for him who thus knows the reason why water is
called arka.
2. Verily water is arka. And what was there as
the froth of the water, that was hardened, and became
the earth. On that earth he (Death) rested, and from
him, thus resting and heated, Agni (Vira/) proceeded,
full of light.
3. That being divided itself threefold, Aditya (the
sun) as the third, and Vayu (the air) as the third 2 .
That spirit (pra«a) 3 became threefold. The head was
the Eastern quarter, and the arms this and that quarter
Agni, the fire, which is here used for the Horse-sacrifice. It is
found in the .Satapatha-brahmawa, Madhyandina-jakha X, 6, 5, and
there explained as a description of Hirawyagarbha.
1 We ought to read arkasyarkatvam, as in Poley's edition, or
ark-kasyarkkatvam, to make the etymology still clearer. The com-
mentator takes arka in the sense of fire, more especially the sacri-
ficial fire employed at the Horse-sacrifice. It may be so, but the
more natural interpretation seems to me to take arka here as water,
from which indirectly fire is produced. From water springs the
earth; on that earth he (MWtyu or Pra^ipati) rested, and from
him, while resting there, fire (Vira^) was produced. That fire
assumed three forms, fire, sun, and air, and in that threefold form
it is called prawa, spirit.
2 As Agni, Vayu, and Aditya.
8 Here Agni (Vira^-) is taken as representing the fire of the altar
at the Horse-sacrifice, which is called Arka. The object of the
whole Brahmawa was to show the origin and true character of that
fire (arka).
Digitized by
Google
j6 br/hadAraatvaka-upanishad.
(i.e. the N. E. and S. E., on the left and right sides).
Then the tail was the Western quarter, and the two
legs this and that quarter (i.e. the N.W. and S.W.)
The sides were the Southern and Northern quarters,
the back heaven, the belly the sky, the dust the
earth. Thus he (Mn'tyu, as arka) stands firm in
the water, and he who knows this stands firm wher-
ever he goes.
4. He desired 1 , ' Let a second body be born of
me,' and he (Death or Hunger), embraced Speech
in his mind. Then the seed became the year. '
Before that time there was no year. Speech 2 bore
him so long as a year, and after that time sent
him forth. Then when he was born, he (Death)
opened his mouth, as if to swallow him. He cried
Bha#! and that became speech 3 .
5. He thought, ' If I kill him, I shall have but little
food.' He therefore brought forth by that speech
and by that body (the year) all whatsoever exists,
the Rik, the Ya^us, the Saman, the metres, the
sacrifices, men, and animals.
And whatever he (Death) brought forth, that
he resolved to eat (ad). Verily because he eats
everything, therefore is Aditi (Death) called Aditi.
He who thus knows why Aditi is called Aditi,
becomes an eater of everything, and everything
becomes his food*.
1 He is the same as what was before called mntyu, death, who,
after becoming self-conscious, produced water, earth, fire, &c. He
now wishes for a second body, which is the year, or the annual
sacrifice, the year being dependent on the sun (Aditya).
a The commentator understands the father, instead of Speech, the
mother.
3 The interjectional theory.
4 All these are merely fanciful etymologies of awamedha and arka.
Digitized by
Google
I ADHYAYA, 2 BRAHMAYA, 7. 77
6. He desired to sacrifice again with a greater
sacrifice. He toiled and performed penance. And
while he toiled and performed penance, glorious
power 1 went out of him. Verily glorious power
means the senses (pra«a). Then when the senses
had gone out, the body took to swelling (.rva-yitum),
and mind was in the body.
7. He desired that this body should be fit for sacri-
fice (medhya), and that he should be embodied by it.
Then he became a horse (asva), because it swelled
(asvat), and was fit for sacrifice (medhya) ; and this
is why the horse-sacrifice is called Asva-medha.
Verily he who knows him thus, knows the Asva-
medha. Then, letting the horse free, he thought 2 ,
and at the end of a year he offered it up for himself,
while he gave up the (other) animals to the deities.
Therefore the sacrificers offered up the purified
horse belonging to Pra^apati, (as dedicated) to all
the deities.
Verily the shining sun is the A^vamedha-sacri-
fice, and his body is the year ; Agni is the sacrificial
fire (arka), and these worlds are his bodies. These
two are the sacrificial fire and the Asvamedha-sacri-
fice, and they are again one deity, viz. Death. He
(who knows this) overcomes another death, death
does not reach him, death is his Self, he becomes
one of those deities.
1 Or glory (senses) and power. Comm.
* He considered himself as the horse. Roer.
Digitized by
Google
78 B.R/HADARAiVYAKA-UPANISHAD.
Third BrAhmaata 1 .
1. There were two kinds of descendants of Pra^i-
pati, the Devas and the Asuras 2 . Now the Devas
were indeed the younger, the Asuras the elder ones 3 .
The Devas, who were struggling in these worlds,
said : 'Well, let us overcome the Asuras at the sacri-
fices (the Gyotish/oma) by means of the udgltha.'
2. They said to speech (Va£) : ' Do thou sing out
for us (the udgltha).' ' Yes,' said speech, and sang
(the udgltha). Whatever delight there is in speech,
that she obtained for the Devas by singing (the three
pavamanas) ; but that she pronounced well (in the
other nine pavamanas), that was for herself. The
Asuras knew: 'Verily, through this singer they will
overcome us.' They therefore rushed at the singer
and pierced her with evil. That evil which consists
in saying what is bad, that is that evil.
3. Then they (the Devas) said to breath (scent) :
' Do thou sing out for us.' ' Yes,' said breath, and
sang. Whatever delight there is in breath (smell),
that he obtained for the Devas by singing ; but that
he smelled well, that was for himself. The Asuras
knew : ' Verily, through this singer they will over-
come us.' They therefore rushed at the singer, and
1 Called the Udgitha-brahma«a. In the Madhyandina-.rakh£,
the Upanishad, which consists of six adhyayas, begins with this
Brahma»a (cf. Weber's edition, p. 1047 ; Commentary, p. 1109).
2 The Devas and Asuras are explained by the commentator
as the senses, inclining either to sacred or to worldly objects, to
good or evil.
8 According to the commentator, the Devas were the less
numerous and less strong, the Asuras the more numerous and
more powerful.
Digitized by
Google
I ADHYAYA, 3 BRAHMAtfA, 7. 79
pierced him with evil. That evil which consists in
smelling what is bad, that is that evil.
4. Then they said to the eye : ' Do thou sing out
for us.' ' Yes,' said the eye, and sang. Whatever
delight there is in the eye, that he obtained for the
Devas by singing ; but that he saw well, that was
for himself. The Asuras knew : ' Verily, through this
singer they will overcome us.' They therefore rushed
at the singer, and pierced him with evil. That evil
which consists in seeing what is bad, that is that evil.
5. Then they said to the ear : ' Do thou sing out
for us.' ' Yes,' said the ear, and sang. Whatever
delight there is in the ear, that he obtained for the
Devas by singing ; but that he heard well, that was
for himself. The Asuras knew : 'Verily, through this
singer they will overcome us.' They therefore rushed
at the singer, and pierced him with evil. That evil
which consists in hearing what is bad, that is that evil.
6. Then they said to the mind : ' Do thou sing out
for us.' ' Yes,' said the mind, and sang. Whatever
delight there is in the mind, that he obtained for the
Devas by singing; but that he thought well, that
was for himself. The Asuras knew : ' Verily, through
this singer they will overcome us.' They therefore
rushed at the singer, and pierced him with evil. That
evil which consists in thinking what is bad, that is
that evil.
Thus they overwhelmed these deities with evils,
thus they pierced them with evil.
7. Then they said to the breath in the mouth 1 :
' Do thou sing for us.' ' Yes,' said the breath, and
sang. The Asuras knew : 'Verily, through this singer
1 This is the chief or vital breath, sometimes called mukhya.
Digitized by
Google
80 BR/HADARANYAKA-UPANISHAD.
they will overcome us.' They therefore rushed at
him and pierced him with evil. Now as a ball of
earth will be scattered when hitting a stone, thus
they perished, scattered in all directions. Hence
the Devas rose, the Asuras fell. He who knows
this, rises by his self, and the enemy who hates
him falls.
8. Then they (the Devas) said : ' Where was he
then who thus stuck to us 1 ?' It was (the breath)
within the mouth (asye 'ntar 2 ), and therefore called
Ayasya; he was the sap (rasa) of the limbs (anga),
and therefore called Angirasa.
9. That deity was called Dur, because Death was
far (duran) from it. From him who knows this,
Death is far off.
10. That deity, after having taken away the evil
of those deities, viz. death, sent it to where the
end of the quarters of the earth is. There he
deposited their sins. Therefore let no one go to
a man, let no one go to the end (of the quarters
of the earth 3 ), that he may not meet there with
evil, with death.
11. That deity, after having taken away the evil of
those deities, viz. death, carried them beyond death.
12. He carried speech across first. When speech
had become freed from death, it became (what it
had been before) Agni (fire). That Agni, after
having stepped beyond death, shines.
13. Then he carried breath (scent) across. When
breath had become freed from death, it became
1 Asakta from sa.rig, to embrace ; cf. Rig-veda I, 33, 3. Here
it corresponds to the German anhanglich.
2 See Deussen, Vedanta, p. 359.
* To distant people.
Digitized by
Google
i adhyAya, 3 brAhmajva, 18. 8i
Vayu (air). That Vayu, after having stepped beyond
death, blows.
14. Then he carried the eye across. When the
eye had become freed from death, it became Aditya
(the sun). That Aditya, after having stepped beyond
death, burns.
15. Then he carried the ear across. When the
ear had become freed from death, it became the
quarters (space). These are our quarters (space),
which have stepped beyond death.
16. Then he carried the mind across. When the
mind had become freed from death, it became the
moon (Aandramas). That moon, after having stepped
beyond death, shines. Thus does that deity carry
him, who knows this, across death.
17. Then breath (vital), by singing, obtained for
himself eatable food. For whatever food is eaten,
is eaten by breath alone, and in it breath rests 1 .
The Devas said : ' Verily, thus far, whatever food
there is, thou hast by singing acquired it for thyself.
Now therefore give us a share in that food.' He
said : ' You there, enter into me.' They said Yes, and
entered all into him. Therefore whatever food is
eaten by breath, by it the other senses are satisfied.
18. If a man knows this, then his own relations
come to him in the same manner ; he becomes their
supporter, their chief leader, their strong ruler 2 . And
if ever any one tries to oppose 3 one who is possessed
of such knowledge among his own relatives, then he
1 This is done by the last nine Pavam&nas, while the first three
were used for obtaining the reward common to all the prd«as.
a Here ann&da is well explained by anamaySvin, and vy&dhirahita,
free from sickness, strong.
8 Read pratipratLi ; see Poley, and Weber, p. n 80.
[i5] G
Digitized by
Google
82 Bii/HADARAJVYAKA-UPANISHAD.
will not be able to support his own belongings. But
he who follows the man who is possessed of such
knowledge, and who with his permission wishes to
support those whom he has to support, he indeed
will be able to support his own belongings.
19. He was called Ayasya Angirasa, for he is the
sap (rasa) of the limbs (anga). Verily, breath is
the sap of the limbs. Yes, breath is the sap of the
limbs. Therefore from whatever limb breath goes
away, that limb withers, for breath verily is the sap
of the limbs.
20. He (breath) is* also Brzhaspati, for speech is
BWhati (Rig-veda), and he is her lord; therefore he
is BWhaspati.
21. He (breath) is also Brahma«aspati, for speech
is Brahman (Ya^ur-veda), and he is her lord ; there-
fore he is Brahma#aspati.
He (breath) is also Saman (the Udgitha), for
speech, is Saman (Sama-veda), and that is both
speech (sa) and breath (ama) 1 . This is why Saman
is called Saman.
22. Or because he is equal (sama) to a grub, equal
to a gnat, equal to an elephant, equal to these three
worlds, nay, equal to this universe, therefore he is
Saman. He who thus knows this Saman, obtains
union and oneness with Saman.
23. He (breath) is Udgitha 2 . Breath verily is Ut,
for by breath this universe is upheld (uttabdha) ; and
speech is Githa, song. And because he is ut and
gltha, therefore he (breath) is Udgitha.
1 Cf.^Mnd. Up.V, 2,6.
* Not used here in the sense of song or hymn, but as an act of
worship connected with the S&tnan. Comm.
Digitized by
Google
I ADHYAYA, 3 BRAHMAiVA, 2 J. 83
24. And thus Brahmadatta ^Taikitaneya (the
grandson of Alkitana), while taking Soma (rifan),
said : ' May this Soma strike my head off, if Ayasya
Arigirasa sang another Udgitha than this. He sang
it indeed as speech and breath.'
25. He who knows what is the property of this
Saman, obtains property. Now verily its property
is tone only. Therefore let a priest, who is going to
perform the sacrificial work of a Sama-singer, desire
that his voice may have a good tone, and let him
perform the sacrifice with a voice that is in good
tone. Therefore people (who want a priest) for a
sacrifice, look out for one who possesses a good
voice, as for one who possesses property. He who
thus knows what is the property of that Saman,
obtains property.
26. He who knows what is the gold of that
Saman, obtains gold. Now verily its gold is tone
only. He who thus knows what is the gold of that
Saman, obtains gold.
27. He who knows what is the support of that
Saman, he is supported. Now verily its support
is speech only. For, as supported in speech, that
breath is sung as that Saman. Some say the
support is in food.
Next follows the Abhyaroha x (the ascension) of
the Pavamana verses. Verily the Prastotre begins
to sing the Saman, and when he begins, then let him
(the sacrificer) recite these (three Ya^us- verses) :
' Lead me from the unreal to the real ! Lead me
1 The ascension is a ceremony by which the performer reaches
the gods, or becomes a god. It consists in the recitation of three
Ya^Tis, and is here enjoined to take place when the Prastotr* priest
begins to sing his hymn.
G 2
Digitized by
Google
84 BK/HADARAyYAKA-UPANISHAD.
from darkness to light! Lead me from death to
immortality!'
Now when he says, ' Lead me from the unreal to
the real,' the unreal is verily death, the real immor-
tality. He therefore says, ' Lead me from death to
immortality, make me immortal.'
When he says, ' Lead me from darkness to light,'
darkness is verily death, light immortality. He
therefore says, 'Lead me from death to immortality,
make me immortal.'
When he says, ' Lead me from death to immor-
tality/ there is nothing there, as it were, hidden
(obscure, requiring explanation) 1 .
28. Next come the other Stotras with which the
priest may obtain food for himself by singing them.
Therefore let the sacrificer, while these Stotras are
being sung, ask for a boon, whatever desire he may
desire. An UdgatW priest who knows this obtains
by his singing whatever desire he may desire either
for himself or for the sacrificer. This (knowledge) in-
deed is called the conqueror of the worlds. He who
thus knows this Siman 2 , for him- there is no fear of
his pot being admitted to the worlds 3 .
1 See Deussen, Ved&nta, p. 86.
. s He knows that he is the Prawa, which Pra«a is the Saman.
That Pra«a cannot be defeated by the Asuras, i. e. by the senses
which are addicted to evil ; it is pure, and the five senses finding
refuge hi him, recover there their original nature, fire, &c. The
Prd«a is the Self of all things, also of speech (i?«g-ya,fuA-s4modgftha),
and of the Saman that has to be sung and well sung. The Pra«a
pervades all creatures, and he who identifies himself with that
Pra»a, obtains the rewards mentioned in the Brahmawa. Corrim.
3 In connection with loka^it, lokyata is here explained, and
may probably have been intended, as worthiness to be admitted to
the highest world. Originally lokyata and alokyata meant right
and wrong. See also I, 5, 17.
Digitized by
Google
I ADHYAYA, 4 BRAHMAJVA, 3. 85
Fourth BrAhmam. 1 .
1 . In the beginning this was Self alone, in the shape
of a person (purusha). He looking round saw nothing
but his Self. He first said, 'This is I;' therefore
he became I by name. Therefore even now, if a
man is asked, he first says, ' This is I,' and then
pronounces the other name which he may have. And
because before (purva) all this, he (the Self) burnt
down (ush) all evils, therefore he was a person
(pur-usha). Verily he who knows this, burns down
every one who tries to be before him.
2. He feared, and therefore any one who is lonely
fears. He thought, 'As there is nothing but myself,
why should I fear?' Thence his fear passed away.
For what should he have feared ? Verily fear arises
from a second only.
3. But he felt no delight. Therefore a man who
is lonely feels no delight. He wished for a second.
He was so large as man and wife together. He then
made this his Self to fall in two (pat), and thence
arose husband (pati) and wife (patni). Therefore
Yi^wavalkya said: 'We two 2 are thus (each of us)
like half a shell V Therefore the void which was
1 Called Purushavidhabrahma«a (Madhyandina-jakhl, p. 1050).
See Muir, Original Sanskrit Texts, vol. i, p. 24.
2 The Comm. explains svaA by atmana^, of himself. But see
Boehtlingk, Sanskrit Chrestomathie, p. 357.
3 Roer translates : ' Therefore was this only one half of himself, as
a split pea is of a whole.' Bn'gala is a half of anything. Muir
(Orig. Sansk. Texts, vol. i, p. 25) translates : ' Ya^wavalkya has said
that this one's self is like the half of a split pea.' I have translated
the sentence according to Professor Boehtlingk's conjecture (Chres-
tomathie, 2nd ed. p. 357), though the. singular after the dual (svaA)
is irregular.
Digitized by
Google
86 bk/hadArajvyaka-upanishad.
there, is filled by the wife. He embraced her, and
men were born.
4. She thought, ' How can he embrace me, after
having produced me from himself? I shall hide
myself.'
She then became a cow, the other became a
bull and embraced her, and hence cows were born.
The one became a mare, the other a stallion ; the
one a male ass, the other a female ass. He em-
braced her, and hence one-hoofed animals were born.
The one became a she-goat, the other a he-goat ;
the one became a ewe 1 , the other a ram. He em-
braced her, and hence goats and sheep were born.
And thus he created everything that exists in pairs,
down to the ants.
5. He knew, ' I indeed am this creation, for I
created all this.' Hence he became the creation,
and he who knows this lives in this his creation.
6. Next he thus produced fire by rubbing. From
the mouth, as from the fire-hole, and from the hands
he created fire 2 . Therefore both the mouth and the
hands are inside without hair, for the fire-hole is
inside without hair.
And when they say, 'Sacrifice to this or sacrifice to
that god,' each god is but his manifestation, for he
is all gods.
Now, whatever there is moist, that he created
from seed ; this is Soma. So far verily is this uni-
verse either food or eater. Soma indeed is food,
Agni eater. This is the highest creation of Brah-
1 The reading avir itaro, i. e. itara u, is not found in the Ka«va
text. See Boehtlingk, Chrestomathie, p. 357.
a He blew with the mouth while he rubbed with the hands.
Digitized by
Google
I ADHYAYA, 4 BRAIIMA2VA, 7. 87
man, when he created the gods from his better part 1 ,
and when he, who was (then) mortal 2 , created the im-
mortals. Therefore it was the highest creation. And
he who knows this, lives in this his highest creation.
7. Now all this was then undeveloped. It became
developed by form and name, so that one could say,
' He, called so and so, is such a one 3 .' Therefore at
present also all this is developed by name and form, so
that one can say, ' He, called so and so, is such a one.'
He (Brahman or the Self) entered thither, to the
very tips of the finger-nails, as a razor might be
fitted in a razor-case, or as fire in a fire-place *.
He cannot be seen, for, in part only, when breath-
ing, he is breath by name; when speaking, speech
by name ; when seeing, eye by name ; when hearing,
ear by name ; when thinking, mind by name. All
these are but the names of his acts. And he who
worships (regards) him as the one or the other, does
not know him, for he is apart from this (when quali-
fied) by the one or the other (predicate). Let men
worship him as Self, for in the Self all these are one.
T his Self is the footstep of everything, for through
i t one knows everythin g 5 . And as one can find
again by footsteps what was lost, thus he who knows
this finds glory and praise.
1 Or, when he created the best gods.
4 As man and sacrificer. Comm.
8 The Comm. takes asau-nama as a compound, instead of idaz«-
nama. I read asau nama, he is this by name, viz. Devadatta, &c.
Dr. Boehtlingk, who in his Chrestomathie (2nd ed. p. 31) had
accepted the views of the Commentator, informs me that he has
changed his view, and thinks that we should read asati nama.
4 Cf. Kaush. Br. Up. VI, 19.
6 'As one finds lost cattle again by following their footsteps, thus
one finds everything, if one has found out the Self.' Comm.
Digitized by
Google
88 BWHADARAAYAKA-UPANISHAD.
8. This, which is nearer to us than anything, this
Self, is dearer than a son, dearer than wealth, dearer
than all else.
And if one were to say to one who declares an-
other than the Self dear, that he will lose what is dear
to him, very likely it would be so. Let him worship
the Self alone as dear. He who worships the Self
alone as dear, the object of his love will never perish 1 .
9. Here they say: 'If men think that by know-
ledge of Brahman they will become everything, what
then did that Brahman know, from whence all this
sprang ? '
10. Verily in the beginning this was Brahman, that
Brahman knew (its) Self only, saying, ' I am Brah-
man.' From it all this sprang. Thus, whatever
Deva was awakened (so as to know Brahman), he
indeed became that (Brahman) ; and the same with
./fr'shis and men. The i?z'shi Vimadeva saw and
understood it, singing, ' I was Manu (moon), I was the
sun.' Therefore now also he who thus knows that
he is Brahman, becomes all this, and even the Devas
cannot prevent it, for he himself is their Self.
Now if a man worships another deity, thinking
the deity is one and he another, he does not know.
He is like a beast for the Devas. For verily, as
many beasts nourish a man, thus does every man
nourish the Devas. If only one beast is taken
away, it is not pleasant ; how much more when many
are taken! Therefore it is not pleasant to the
Devas that men should know this.
1 1. Verily in the beginning this was Brahman, one
1 On rudh, to lose, see Taitt. Sawn. II, 6, 8, 5, pp. 765, 771, as
pointed out by Dr. Boehtlingk. On favaro (yat) tathaiva syat, see
Boehtlingk, s.v.
Digitized by
Google
I ADHYAYA, 4 BRAHMAJVA, 1 4. 89
only. That being one, was not strong enough. It
created still further the most excellent Kshatra
(power), viz. those Kshatras (powers) among the
Devas, — Indra, Varuwa, Soma, Rudra, Par^anya,
Yama, Mrztyu, Isana. Therefore there is nothing
beyond the Kshatra, and therefore at the Ra^asuya
sacrifice theBrahma«a sits down below the Kshatriya.
He confers that glory on the Kshatra alone. But Brah-
man is (nevertheless) the birth-place of the Kshatra.
Therefore though a king is exalted, he sits down at
the end (of the sacrifice) below the Brahman, as his
birth-place. He who injures him, injures his own
birth-place. He becomes worse, because he has
injured one better than himself.
12. He 1 was not strong enough. He created the
Vis (people), the classes of Devas which in their
different orders are called Vasus, Rudras, Adityas,
Vi^ve Devas, Maruts.
13. He was not strong enough. He created the
.Sudra colour (caste), as Pushan (as nourisher). This
earth verily is Pushan (the nourisher) ; for the earth
nourishes all this whatsoever.
14. He was not strong enough. He created still
further the most excellent Law (dharma). Law is
the Kshatra (power) of the Kshatra 2 , therefore there
is nothing higher than the Law. Thenceforth even
a weak man rules a stronger with the help of the
Law, as with the help of a king. Thus the Law is
what is called the true. And if a man declares what
is true, they say he declares the Law; and if he
declares the Law, they say he declares what is true.
Thus both are the same.
1 Observe the change from tad, it, to sa, he.
2 More powerful than the Kshatra or warrior, caste. Comm.
Digitized by
Google
90 Bi?/HADARA2VYAKA-UPANISHAD.
15. There are then this Brahman, Kshatra, Vis,
and .Sudra. Among the Devas that Brahman existed
as Agni (fire) only, among men as Brahma#a, as
Kshatriya through the (divine) Kshatriya, as Vaisya
through the (divine) Vaisya, as .Sudra through the
(divine) Sudra. Therefore people wish for their
future state among the Devas through Agni (the
sacrificial fire) only; and among men through the
Brahma»a, for in these two forms did Brahman
exist.
Now if a man departs this life without having
seen his true future life (in the Self), then that
Self, not being known, does not receive and bless
him, as if the Veda had not been read, or as if a
good work had not been done. Nay, even if one
who does not know that (Self), should perform here
on earth some great holy work, it will perish for
him in the end. Let a man worship the Self only
as his true state. _If a man worships the Self only a s
his true state, his work does not perish, for whatever
he desires that he ffets from I* 13 * ^If
16. Now verily this Self (of the ignorant man) is
the world 1 of all creatures. In so far as man sacri-
fices and pours out libations, he is the world of the
Devas ; in so far as he repeats the hymns, &c, he is
the world of the .tfzshis ; in so far as he offers cakes
to the Fathers and tries to obtain offspring, he is the
world of the Fathers ; in so far as he gives shelter and
food to men, he is the world of men ; in so far as he
finds fodder and water for the animals, he is the world
of the animals ; in so far as quadrupeds, birds, and
even ants live in his houses, he is their world. And
as every one wishes his own world not to be injured,
1 Is enjoyed by them all. Comm.
Digitized by LaOOQ lC
I ADHYAYA, 5 BRAHMAiVA, I. 9 1
thus all beings wish that he who knows this should
not be injured. Verily this is known and has been
well reasoned.
1 7. In the beginning this was Self alone, one only.
He desired, ' Let there be a wife for me that I may
have offspring, and let there be wealth for me that I
may offer sacrifices.' Verily this is the whole desire,
and, even if wishing for more, he would not find it.
Therefore now also a lonely person desires, 'Let
there be a wife for me that I may have offspring, and
let there be wealth for me that I may offer sacrifices.'
And so long as he does not obtain either of these
things, he thinks he is incomplete. Now his com-
pleteness (is made up as follows): mind is his self
(husband); speech the wife ; breath the child ; the
eye all worldly wealth, for he finds it with the eye ;
the ear his divine wealth, for he hears it with the
ear. The body (atman) is his work, for with the
body he works. This is the fivefold 1 sacrifice, for
fivefold is the animal, fivefold man, fivefold all this
whatsoever. He who knows this, obtains all this.
Fifth BrAhmaya 2 .
1. 'When the father (of creation) had produced by
knowledge and penance (work) the seven kinds of
food, one of his (foods) was common to all beings,
two he assigned to the Devas, (i)
' Three he made for himself, one he gave to the
animals. In it all rests, whatsoever breathes and
breathes not. (2)
1 Fivefold, as consisting of mind, speech, breath, eye, and ear.
See Taitt. Up. I, 7, 1.
* M&dhyandina text, p. 1054.
Digitized by
Google
92 B-R/HADARAJVYAKA-UPANISHAD.
' Why then do these not perish, though they are
always eaten ? He who knows this imperishable
one, he eats food with his face. (3)
' He goes even to the Devas, he lives on
strength.' (4)
2. When it is said, that ' the father produced by
knowledge and penance the seven kinds of food,' it
is clear that (it was he who) did so. When it is
said, that ' one of his (foods) was common,' then that
is that common food of his which is eaten. He who
worships (eats) that (common food), is not removed
from evil, for verily that food is mixed (property) 1 .
When it is- said, that 'two he assigned to the Devas,'
that is the hut a, which is sacrificed in fire, and the
prahuta, which is given away at a sacrifice. But
they also say, the new-moon and full-moon sacrifices
are here intended, and therefore one should not offer
them as an ish/i or with a wish.
When it is said, that 'one he gave to animals,'
that is milk. For in the beginning (in their infancy)
both men and animals live on milk. And therefore
they either make a, new-born child lick ghrtta.
(butter), or they make it take the breast And
they call a new-born creature 'arrmada,' i. e. not
eating herbs. When it is said, that 'in it all rests,
whatsoever breathes and breathes not,' we see that
all this, whatsoever breathes and breathes not, rests
and depends on milk.
And when it is said (in another Brahmarca), that
a man who sacrifices with milk a whole year 2 , over-
comes death again, let him not think so. No, on
1 It belongs to all beings.
2 This would imply 360 sacrificial days, each with two oblations,
i.e. 720 oblations.
Digitized by
Google
I ADHYAYA, 5 BRAHMAtfA, 3. 93
the very day on which he sacrifices, on that day he
overcomes death again; for he who knows this,
offers to the gods the entire food (viz. milk).
When it is said, ' Why do these not perish, though
they are always eaten,' we answer, Verily, the Person
is the imperishable, and he produces that food again
and again 1 .
When it is said, 'He who knows this imperishable
one/ then, verily, the Person is the imperishable
one, for he produces this food by repeated thought,
and whatever he does not work by his works, that
perishes.
When it is said, that ' he eats food with his face,'
then face means the mouth, he eats it with his
mouth.
When it is said, that 'he goes even to the Devas,
he lives on strength,' that is meant as praise.
3. When it is said, that 'he made three for him-
self,' that means that he made mind, speech, and
breath for himself. As people say, ' My mind was
elsewhere, I did not see ; my mind was elsewhere,
I did not hear,' it is clear that a man sees with his
mind and hears with his mind 2 . Desire, representa-
tion, doubt, faith, want of faith, memory 3 , forgetful-
ness, shame, reflexion, fear, all this is mind. There-
fore even if a man is touched on the back, he knows
it through the mind.
Whatever sound there is, that is speech. Speech
indeed is intended for an end or object, it is nothing
by itself.
1 Those who enjoy the food, become themselves creators. Comm.
8 See Deussen, Ved£nta, p. 358.
3 Firmness, strength. Comm.
Digitized by
Google
94 BK7HADARAZVYAKA-UPANISHAD.
-* The up-breathing, the down-breathing, the back-
breathing, the out-breathing, the on-breathing, all
that is breathing is breath (pra«a) only. Verily
that Self consists of it ; that Self consists of speech,
mind, and breath.
4. These are the three worlds : earth is speech,
sky mind, heaven breath.
5. These are the three Vedas : the Rig-veda is
speech, the Ya^ur-veda mind, the Sama-veda breath.
6. These are the Devas, Fathers, and men : the
Devas are speech, the Fathers mind, men breath.
7. These are father, mother, and child : the father
is mind, the mother speech, the child breath.
8. These are what is known, what is to be known,
and what is unknown.
What is known, has the form of speech, for speech
is known. Speech, having become this, protects
man 1 .
9. What is to be known, has the form of mind,
for mind is what is to be known. Mind, having
become this, protects man.
10. What is unknown, has the form of breath, for
breath is unknown. Breath, having become this,
protects man 2 .
11. Of that speech (which is the food of Pra^a-
pati) earth is the body, light the form, viz. this fire.
And so far as speech extends, so far extends the
earth, so far extends fire.
12. Next, of this mind heaven is the body, light
the form, viz. this sun. And so far as this mind
1 ' The food (speech), having become known, can be consumed.'
Comm.
8 This was adhibhautika, with reference to bhutas, beings. Next
follows the adhidaivika,with reference to the devas, gods. Comm.
Digitized by
Google
i adhyAya, 5 brAhma^a, 16. 95
extends, so far extends heaven, so far extends the
sun. If they (fire and sun) embrace each other, then
wind is born, and that is Indra, and he is without a
rival. Verily a second is a rival, and he who knows
this, has no rival.
13. Next, of this breath water is the body, light
the form, viz. this moon. And so far as this breath
extends, so far extends water, so far extends the
moon.
These are all alike, all endless. And he who wor-
ships them as finite, obtains a finite world, but he who
worships them as infinite, obtains an infinite world.
14. That Pra££pati is the year, and he consists of
sixteen digits. The nights 1 indeed are his fifteen
digits, the fixed point 2 his sixteenth digit. He is
increased and decreased by the nights. Having on
the new-moon night entered with the sixteenth part
into everything that has life, he is thence born again
in the morning. Therefore let no one cut off the life
of any living thing on that night, not even of a lizard,
in honour (ptifartham) of that deity.
15. Now verily that Pra^apati, consisting of six-
teen digits, who is the year, is the same as a man
who knows this. His wealth constitutes the fifteen
digits, his Self the sixteenth digit. He is increased
and decreased by that wealth. His Self is the nave,
his wealth the felly. Therefore even if he loses
everything, if he lives but with his Self, people say,
he lost the felly (which can be restored again).
16. Next there are verily three worlds, the world
of men, the world of the Fathers, the world of the
Devas. The world of men can be gained by a son
1 Meant for nychthemera.
2 When he is just invisible at the new moon.
Digitized by
Google
96 bk/hadArajvyaka-upanishad.
only, not by any other work. By sacrifice the world
of the Fathers, by knowledge the world of the Devas
is gained. The world of the Devas is the best of
worlds, therefore they praise knowledge.
1 7. Next follows the handing over. When a man
thinks he is going to depart, he says to his son :
' Thou art Brahman (the Veda, so far as acquired by
the father); thou art the sacrifice (so far as performed
by the father); thou art the world.' The son answers:
' I am Brahman, I am the sacrifice, I am the world.'
Whatever has been learnt (by the father) that, taken
as one, is Brahman. Whatever sacrifices there are,
they, taken as one, are the sacrifice. Whatever
worlds there are, they, taken as one, are the world.
Verily here ends this (what has to be done by a
father, viz. study, sacrifice, &c.) * He (the son), being
all this, preserved me from this world 1 ,' thus he
thinks. Therefore they call a son who is instructed
(to do all this), a world-son (lokya), and therefore
they instruct him.
When a father who knows this, departs this world,
then he enters into his son together with his own
spirits (with speech, mind, and breath). If there is
anything done amiss by the father, of all that the son
delivers him, and therefore he is called Putra, son 2 .
By help of his son the father stands firm in this
world 3 . Then these divine immortal spirits (speech,
mind, and breath) enter into him.
1 Roer seems to have read sa»maya, ' all this multitude.' I read,
etan mi sarvawz sann ayam ito 'bhuna^ad iti.
s The Comm. derives putra from pu (pur), to fill, and tra (tr£), to
deliver, a deliverer who fills the holes left by the father, a stop-
gap. Others derive it from put, a hell, and tr&, to protect; cf.
Manu IX, 138.
* ' The manushya-loka, not the pitn-loka and deva-loka.' Comm.
Digitized by
Google
I ADHYAYA, 5 BRAHMAtfA, 21. 97
18. From the earth and from fire, divine speech
enters into him. And verily that is divine speech
whereby, whatever he says, comes to be.
19. From heaven and the sun, divine mind enters
into him. And verily that is divine mind whereby
he becomes joyful, and grieves no more.
20. From water and the moon, divine breath
(spirit) enters into him. And verily that is divine
breath which, whether moving or not moving, does
not tire, and therefore does not perish. He who
knows this, becomes the Self of all beings. As that
deity (Hira#yagarbha) is, so does he become. And
as all beings honour that deity (with sacrifice, &c),
so do all beings honour him who knows this.
Whatever grief these creatures suffer, that is
all one 1 (and therefore disappears). Only what is
good approaches him ; verily, evil does not approach
the Devas.
21. Next follows the consideration of the observ-
ances 2 (acts). Pra^apati created the actions (active
senses). When they had been created, they strove
among themselves. Voice held, I shall speak ; the
eye held, I shall see; the ear held, I shall hear;
and thus the other actions too, each according to its
own act. Death, having become weariness, took
them and seized them. Having seized them, death
held them back (from their work). Therefore
speech grows weary, the eye grows weary, the ear
grows weary. But death did not seize the central
breath. Then the others tried to know him, and
1 ' Individuals suffer, because one causes grief to another. But
in the universal soul, where all individuals are one, their sufferings
are neutralised.' Comm.
* The upasana or meditative worship.
[15] H
Digitized by
Google
98 br/hadArajvyaka-upanishad.
said : ' Verily, he is the best of us, he who, whether
moving or not, does not tire and does not perish.
Well, let all of us assume his form.' Thereupon
they all assumed his form, and therefore they are
called after him ' breaths ' (spirits).
In whatever family there is a man who knows
this, they call that family after his name. And he
who strives with one who knows this, withers away
and finally dies. So far with regard to the body.
22. Now with regard to the deities.
Agni (fire) held, I shall burn ; Aditya (the sun)
held, I shall warm; Aandramas (the moon) held,
I shall shine ; and thus also the other deities, each
according to the deity. And as it was with the
central breath among the breaths, so it was. with
Vayu, the wind among those deities. The other
deities fade, not Vayu. Vayu is the deity that
never sets.
23. And here there is this 6"loka :
' He from whom the sun rises, and into whom it
sets' (he verily rises from the breath, and sets in
the breath)
' Him the Devas made the law, he only is to-day,
and he to-morrow also' (whatever these Devas de-
termined then, that they perform to-day also 1 ).
Therefore let a man perform one. observance only,
let him breathe up and let him breathe down, that
the evil death may not reach him. And when he
performs it, let him try to finish it. Then he ob-
tains through it union and oneness with that deity
(with pra«a).
1 The pr£«a-vrata and v&yu-vrata. Comm.
Digitized by
Google
I ADHYAYA, 6 BRAHMAATA, 3. 99
Sixth Brahmana 1 .
1. Verily this is a triad, name, form, and work.
Of these names, that which is called Speech is the
Uktha (hymn, supposed to mean also origin), for
from it all names arise. It is their Saman (song,
supposed to mean also sameness), for it is the same
as all names. It is their Brahman (prayer, supposed
to mean also support), for it supports all names.
2. Next, of the forms, that which is called Eye is
the Uktha (hymn), for from it all forms arise. It is
their Saman (song), for it is the same as all forms. It
is their Brahman (prayer), for it supports all forms.
3. Next, of the works, that which is called Body is
the Uktha (hymn), for from it all works arise. It is
their Saman (song), for it is the same as all works. It
is their Brahman (prayer), for it supports all works.
That being a triad is one, viz. this Self; and the
Self, being one, is that triad. This is the immortal,
covered by the true. Verily breath is the immortal,
name and form are the true, and by them the im-
mortal is covered.
1 Madhyandina text, p. 1058.
H 2
Digitized by LaOOQ 1C
IOO BU/HADARAiVYAKA-UPANISHAD.
SECOND ADHYAYA 1 .
• First BrAhmajva 2 .
i. There 3 was formerly the proud Gargya Baliki 4 ,
a man of great reading. He said to A^ata^atru of
Klfi, 'Shall I tell you Brahman ?' A^at&ratru said:
'We give a thousand (cows) for that speech (of
yours), for verily all people run away, saying, kanaka
(the king of Mithila) is our father (patron) 6 .'
2. Gargya said : ' The person that is in the sun 6 ,
that I adore as Brahman.' A^atasatru said to him :
'No, no ! Do not speak to me on this. I adore him
1 Madhyandina text, p. 1058. ,
s Whatever has been taught to the end of the third (according
to the counting of the Upanishad, the first) Adhyaya, refers to
avidya, ignorance. Now, however, vidya, the highest knowledge,
is to be taught, and this is done, first of all, by a dialogue between
Gargya Dnptabalaki and king A^-ataratru, the former, though a
Brahmawa, representing the imperfect, the latter, though a Kshatriya,
the perfect knowledge of Brahman. While Gargya worships the
Brahman as the sun, the moon, &c, as limited, as active and passive,
A^ataratru knows the Brahman as the Self.
" Compare with this the fourth AdhySya of the Kaushttaki-
upanishad, Sacred Books of the East, vol. i, p. 300; Gough,
Philosophy of the Upanishads, p. 144.
4 Son of Balaka, of the race of the Gdrgyas.
6 Ganaka, known as a wise and liberal king. There is a play
on his name, which means father, and is understood in the sense
of patron, or of teacher of wisdom. The meaning is obscure ; and
in the Kaush. Up. IV. i, the construction is still more difficult
What is intended seems to be that A^atajatru is willing to offer
any reward to a really wise man, because all the wise men are
running after <7anaka and settling at his court.
6 The commentator expatiates on all these answers and brings
them more into harmony with Vedanta doctrines. Thus he adds
that the person in the sun is at the same time the person in the eye,
who is both active and passive in the heart, &c.
Digitized by
Google
,11 ADHYAYA, I BRAhMAJVA, 6. IOI
verily as the s upreme , the head of all beings, the
king. Whoso adores him thus, becomes supreme,
the head of all beings, a king.'
3. Gargya said : ' The person that is in the moon
(and in the mind), that I adore as Brahman.' A^a-
tayatru said to him : ' No, no ! Do not speak to me
on this. I adore him verily as t he grea t, clad in
white raiment, as Soma, the king.' Whoso adores
him thus, Soma is poured out and poured forth for
him day by day, and his food does not fail '.
4. Gargya said : ' The person that is in the light-
ning (and in the heart), that I adore as Brahman.'
A^ata^atru said to him : ' No, no ! Do not speak to
me on this. I adore him verily as the l uminou s.'
Whoso adores him thus, becomes luminous, and his
offspring becomes luminous.
5. Gargya said: 'The person that is in the ether
(and in the ether of the heart), that I adore as Brah-
man.' A^atayatru said to him : ' No, no ! Do not
speak to me on this. I adore him as w hat is__ fu_ll,
a nd quiescen t.' Whoso adores him thus, becomes
filled with offspring and cattle, and his offspring does
not cease from this world.
6. Gargya said : ' The person that is in the wind
(and in the breath), that I adore as Brahman.' hgk-
tayatru said to him : ' No, no ! Do not speak to me
on this. I adore him as Indra VaikuwMa, as $ie
unconquerable arm y (nf the M a ruts).' Whoso adores
him thus, becomes victorious, unconquerable, con-
quering his enemies.
1 We miss the annasydtma, the Self of food, mentioned in the
Kaush. Up., and evidently referred to in the last sentence of our
paragraph. Suta and prasuta, poured out and poured forth, are
explained as referring to the principal and the secondary sacrifices.
Jigittmi-U/V.
google
102 B-RfHADARAJVYAKA-UPANISHAD.
7. Gargya said : 'The person that is in the fire (and
in the heart), that I adore as Brahman.' A^atasatru
said to him : ' No, no ! Do not speak to me on this. I
adore him as powerful.' Whoso adores him thus, be-
comes powerful, and his offspring becomes powerful.
8. Gargya said ; ' The person that is in the water
(in seed, and in the heart), that I adore as Brahman.'
Afatasatru said to him : ' No, no ! Do not speak
to me on this. I adore him as li kenes s.' Whoso
adores him thus, to him comes what is likely (or
proper), not what is improper; what is born from
him, is like unto him 1 .
9. Gargya said : ' The person that is in the
mirror, that I adore as Brahman.' A^atasatru said
to him : 'No, no ! Do not speak to me on this.
I adore him verily as t he brill iant.' Whoso adores
him thus, he becomes brilliant, his offspring becomes
brilliant, and with whomsoever he comes together,
he outshines them.
10. Gargya said : ' The sound that follows a man
while he moves, that I adore as Brahman.' A^uta-
^atru said to him : ' No, no ! Do not speak to me
on this. I adore him verilyasjife.' Whoso adores
him thus, he reaches his full age in this world, breath
does not leave him before the time.
11. Gargya said: 'The person that is in space,
that I adore as Brahman.' A^atasatru said to him :
' No, no ! Do not speak to me on this. I adore
him verily as the sec ond w ho rip-up r leay^ us/
1 Here the Kaush. Up. has the Self of the name, instead of
pratirupa, likeness. The commentator thinks that they both mean
the same thing, because a name is the likeness of a thing. Another
text of the Kaush. Up. gives here the Self of light. Pratirupa in
the sense of likeness comes in later in the Kaush. Up., § n.
Digitized by
Google
II ADHYAYA, I BRAHMAJVA, 1 5. I03
Whoso adores him thus, becomes possessed of a
second, his party is not cut off from him.
12. Gargya said : 'The person that consists of the
shadow, that I adore as Brahman.' A^ataratru said
to him : ' No, no ! Do not speak to me on this.
I adore him verily as death,' Whoso adores him
thus, he reaches his whole age in this world, death
does not approach him before the time.
13. Gargya said: 'The person that is in the body 1 ,
that I adore as Brahman/ A^atasatru said to him :
'No, no ! Do not speak to me on this, I adore him
verily as embodied/ Whoso adores him thus, becomes
embodied, and his offspring becomes embodied 2 .
Then Gargya became silent.
14. A^ata-satru said : 'Thus far only?' 'Thus Tar
only,' he replied. A^atayatru said : ' This does not
suffice to know it (the true Brahman).' Gargya
replied : ' Then let me come to you, as a pupil.'
15. A^atasatru said: 'Verily, it is unnatural that
a Brahma«a should come to a Kshatriya, hoping
that he should tell him the Brahman. However, I
shall make you know him clearly,' thus saying he
took him by the hand and rose.
And the two together came to a person who was
asleep. He called him by these names, ' Thou,
great one, clad in white raiment, Soma, King 3 .' He
1 ' In the Atman, in Pra^apati, in the Buddhi, and in the heart.'
Comm.
2 It is difficult to know what is meant here by Atman and atman-
vin. In the Kaush. Up. A^atasatru refers to Pragapati, and the
commentator here does the same, adding, however, buddhi and
hral. Gough translates Stmanvin by 'having peace of mind.'
Deussen, p. 195, passes it over.
8 These names are given here as they occur in the Kaushftaki-
upanishad, not. as in the Br/Tiadara«yaka-upanishad, where the
Digitized by
Google
104 BRrHADARAiVYAKA-UPANISHAD.
did not rise. Then rubbing him with his hand, he
woke him, and he arose.
1 6. A^atasatru said ; ' When this man was thus
asleep, where was then the person (purusha), the in-
telligent ? and from whence did he thus come back?'
Gargya did not know this ?
1 7. A^atasatru said : ' When this man was thus
asleep, then the intelligent person (purusha), having
through the intelligence of the senses (pri«as) ab-
sorbed within himself all intelligence, lies in the
ether, which is in the hearth, When he takes in
these different kinds of intelligence, then it is said
that the man sleeps (svapiti)& Then the breath
is kept in, speech is kept in, the ear is kept in, the
eye is kept in, the mind is kept in.
18. But when he moves about in sleep (and
dream), then these are his worlds. He is, as it were,
a great king; he is, as it were, a great Brahma«a ; he
rises, as it were, and he falls. And as a great king
might keep in his own subjects, and move about,
•according to his pleasure, within his own domain,
thus does that person (who is endowed with intel-
ligence) keep in the various senses (pra/zas) and move
about, according to his pleasure, within his own body
(while dreaming).
1 9. Next, when he is in profound sleep, and knows
first name was atish/AaA sarvesham bhMnam murdha ra^-a. This
throws an important light on the composition of the Upanishads.
1 The ether in the heart is meant for the real Self. He has
come to himself, to his Self, i.e. to the true Brahman.
1 Svapiti, he sleeps, is explained as sva, his own Self, and
apiti for apyeti, he goes towards, so that 'he sleeps' must be
interpreted as meaning ' he comes to his Self.' In another passage
it is explained by svam apito bhavati. See -Saftkara's Commentary
on the Brih. Ar. Up. vol. i, p. 372.
Digitized by
Google
II ADHYAYA, 2 BRAHMAiVA, 2. I05
nothing, there are the seventy-two thousand arteries
called Hita, which from the heart spread through
the body 1 . Through them he moves forth and rests
in the surrounding body. And as a young man, or a
great king, or a great Brahma^a, having reached the
summit of happiness, might rest, so does he then rest.
20. As the spider comes out with its thread, or as
small sparks come forth from fire, thus do all senses,
all worlds, all Devas, all beings come forth from that
Self. The Upanishad (the true name and doctrine)
of that Self is ' the True of the True.' Verily the
senses are the true, and he is the true of the true.
Second BrAhmaya 2 .
1, Verily he who knows the babe 3 with his place 4 ,
his chamber 6 , his post 6 , and his rope 7 , he keeps off
the seven relatives 8 who hate him. Verily by the
young is meant the inner life, by his place this
(body) 9 , by his chamber this (head), by his post the
vital breath, by his rope the food.
2. Then the seven imperishable ones 10 approach
him. There are the red lines in the eye, and by
them Rudra clings to him. There is the water
1 ' Not the pericardium only, but the whole body.' Comm.
2 Madhyandina text, p. 1061.
8 The lingatman, or subtle body which has entered this body in
five ways. Comm.
4 The body. 5 The head. ' • The vital breath.
7 Food, which binds the subtle to the coarse body.
8 The seven organs of the head through which man perceives
and becomes attached to the world.
9 The commentator remarks that while saying this, the body
and the head are pointed out by touching them with the hand
(pa»ipeshapratibodhanena).
10 See before, I, 5, 1, 2. They are called imperishable, because
they produce imperishableness by supplying food for the pra«a,
here called the babe.
Digitized by
Google
106 brjhadArajvyaka-upanishad.
in the eye, and by it Par^anya clings to him. There
is the pupil, and by it Aditya (sun) clings to him.
There is the dark iris, and by it Agni clings to him.
There is the white eye-ball, and by it Indra clings to
him. With the lower eye-lash the earth, with the
upper eye-lash the heaven clings to him. He who
knows this, his food does never perish.
3. On this there is this 61oka ;
' There 1 is a cup having its mouth below and its
bottom above. Manifold glory has been placed into
it. On its lip sit the seven 7?z'shis, the tongue as
the eighth communicates with Brahman.' What is
called the cup having its mouth below and its bottom
above is this head, for its mouth (the mouth) is
below, its bottom (the skull) is above. When it is
said that manifold glory has been placed into it,
the senses verily are manifold glory, and he there-
fore means the senses. When he says that the
seven ,/foshis sit on its lip, the /?zshis are verily the
(active) senses, and he means the senses. And
when he says that the tongue as the eighth com-
municates with Brahman, it is because the tongue,
as the eighth, does communicate with Brahman.
4. These two (the two ears) are the ifo'shis Gau-
tama and Bharadva^a ; the right Gautama, the left
BhaVadva^a. These two (the eyes) are the ^?z'shis
Vi^vamitra and 6amadagni ; the right Visvamitra,
the left Gamadagni. These two (the nostrils) are
the ,/?zshis Vasish^a and Kasyapa ; the right Va-
sish/^a, the left Katyapa. The tongue is Atri, for
with the tongue food is eaten, and Atri is meant for
Atti, eating. He who knows this, becomes an eater
of everything, and everything becomes his food.
1 Cf. Atharva-veda-sawh. X, 8, 9.
Digitized by
Google
n adiiyAya, 3 brAhmaya, 6. 107
Third BrAhmawa 1 .
1. There are two forms of Brahman, the material
and the immaterial, the mortal and the immortal, the
solid and the fluid, sat (being) and tya (that), (i.e.
sat-tya, true) 2 .
2. Everything except air and sky is material, is
mortal, is solid, fs definite. The essence of that
which is material, which is mortal, which is solid,
which is definite is the sun that shines, for he is the
essence of sat (the definite).
3. But air and sky are immaterial, are immortal,
are fluid, are indefinite. The essence of that which
is immaterial, which is immortal, which is fluid, which
is indefinite is the person in the disk of the sun, for
he is the essence of tyad (the indefinite). So far with
regard to the Devas.
4. Now with regard to the body. Everything
except the breath and the ether within the body is
material, is mortal, is solid, is definite. The essence
of that which is material, which is mortal, which is
solid, which is definite is the Eye, for it is the essence
of sat (the definite).
5. But breath and the ether within the body are
immaterial, are immortal, are fluid, are indefinite.
The essence of that which is immaterial, which is
immortal, which is fluid, which is indefinite is the
person in the right eye, for he is the essence of tyad
(the indefinite).
6. And what is the appearance of that person ?
Like a saffron-coloured raiment, like white wool,
1 Madhyandina text, p. 1062.
2 Sat is explained by definite, tya or tyad by indefinite.
Digitized by
Google
108 BU/HADARAiVYAKA-UPANISHAD.
like cochineal, like the flame of fire, like the white
lotus, like sudden lightning. He who knows this,
his glory is like unto sudden lightning.
Next follows the teaching (of Brahman) by No,
no 1 ! for there is nothing else higher than this (if
one says) : ' It is not so.' Then comes the name
' the True of the True,' the senses being the True,
and he (the Brahman) the True of them.
Fourth Brahmajva 2 .
i. Now when Ya^avalkya was going to enter
upon another state, he said : ' Maitreyi 3 , verily I am
going away from this my house (into the forest 4 )*
Forsooth, let me make a settlement between thee
and that Katyayani (my other wife).'
2. Maitreyi said : ' My Lord, if this whole earth,
full of wealth, belonged to me, tell me, should I be
immortal by it 5 V
1 See III, 9, 26 ; IV, 2, 4 ; IV, 4, 22 ; IV, 5, 15.
2 Madhyandina text, p. 1062. To the end of the third Br&hmawa
of the second Adhyaya, all that has been taught does not yet impart
the highest knowledge, the identity of the personal and the true Self,
the Brahman. In the fourth Bralimawa, in which the knowledge
of the true Brahman is to be set forth, the Sawmyasa, the retiring
from the world, is enjoined, when all desires cease, and no duties
are to be performed (Sawnyasa, parivra^ya). The story is told again
with slight variations in the Br?hadara«yaka-upanishad IV, 5. The
more important variations, occurring in IV, 5, are added here, marked
with B. There are besides the various readings of the Madhyandina-
jakha of the Satapatha-brahmarca. See also Deussen, Vedanta, p. 1 85.
8 In Briti. Up. IV, 5, the story begins : Ya^wavalkya had two wives,
Maitreyi and Katyayani. Of these Maitreyi was conversant with
Brahman, but K&ty&yani possessed such knowledge only as women
possess.
4 Instead of udyasyan, B. gives pravra^-ishyan, the more
technical term.
8 Should I be immortal by it, or no ? B.
Digitized by
Google
ii adhyaya, 4 brAhmajva, 5. V r , 109
'No,' replied Y^wavalkya; 'like the life of rich
people will be thy life. But there is no hope of
immortality by wealth.'
3. And Maitreyi said: 'What should I do with
that by which I do not become immortal ? What my
Lord knoweth (of immortality), tell that to me 1 .'
4. Ya^avalkya replied : ' Thou who art truly dear
to me, thou speakest dear words 2 . Come, sit down,
I will explain it to thee, and mark well what I say.'
5. And he said : 'Verily, a husband is not dear, that
you may love the husband ; but that you may love
the Self, therefore a husband is dear.
' Verily, a wife is not dear, that you may love the
wife; but that you may love the Self, therefore a
wife is dear.
'Verily, sons are not dear, that you may love
the sons ; but that you may love the Self, therefore
sons are dear.
'Verily, wealth is not dear, that you may love
wealth ; but that you may love the Self, therefore
wealth is dear 3 .
' Verily, the Brahman-class is not dear, that you
may love the Brahman-class ; but that you may love
the Self, therefore the Brahman-class is dear.
' Verily, the Kshatra-class is not dear, that you
may love the Kshatra-class ; but that you may love
the Self, therefore the Kshatra-class is dear.
' Verily, the worlds are not dear, that you may
love the worlds ; but that you may love the Self,
therefore the worlds are dear.
1 Tell that clearly to me. B.
2 Thou who art dear to me, thou hast increased what is dear (to
•me in this). B.
3 B. adds, Verily, cattle are not dear, &c.
Digitized by
Google
IIO B-R/HADARAiVYAKA-UPANISHAD.
'Verily, the Devas are not dear, that you may
love the Devas; but that you may love the Self,
therefore the Devas are dear 1 .
' Verily, creatures are not dear, that you may love
the creatures ; but that you may love the Self, there-
fore are creatures dear.
' Verily, everything is not dear that you may love
everything ; but that you may love the Self, there-
fore everything is dear.
'Verily, the Self is to be seen, to be heard, to
be perceived, to be marked, O Maitreyi! When
we see, hear, perceive, and know the Self 2 , then
all this is known.
6. 'Whosoever looks for the Brahman-class else-
where than in the Self, was 3 abandoned by the
Brahman-class. Whosoever looks for the Kshatra-
class elsewhere than in the Self, was abandoned by
the Kshatra-class. Whosoever looks for the worlds
elsewhere than in the Self, was abandoned by the
worlds. Whosoever looks for the Devas elsewhere
than in the Self, was abandoned by the Devas*.
Whosoever looks for creatures elsewhere than in the
Self, was abandoned by the creatures. Whosoever
looks for anything elsewhere than in the Self, was
abandoned by everything. This Brahman-class, this
Kshatra-class, these worlds, these Devas 6 , these 6
creatures, this everything, all is that Self.
7. ' Now as 7 the sounds of a drum, when beaten,
1 B. inserts, Verily, the Vedas are not dear, &c.
2 When the Self has been seen, heard, perceived, and known. B.
8 The commentator translates, ' should be abandoned.'
4 B. inserts, Whosoever looks for the Vedas, &c.
6 B. adds, these Vedas. 6 B. has, all these creatures.
7 I construe sa yatha" with evam vai in § 12, looking upon
Digitized by
Google
II ADHYAYA, 4 BRAHMAtf A, 12. Ill
cannot be seized externally (by themselves), but the
sound is seized, when the drum is seized or the beater
of the drum ;
8. 'And as the sounds of a conch-shell, when
blown, cannot be seized externally (by themselves),
but the sound is seized, when the shell is seized or
the blower of the shell ;
9. ' And as the sounds of a lute, when played,
cannot be seized externally (by themselves), but the
sound is seized, when the lute is seized or the
player of the lute ;
S 10. 'As clouds of smoke proceed by themselves
out of a lighted fire kindled with damp fuel, thus,
verily, O Maitreyl, has been breathed forth from
this great Being what we have as I&g-veda, Ya^iir^
veda, Sama-veda, Atharvangirasas, Itihasa (legends),
Purawa (cosmogonies), Vidya (knowledge), the Upa-
nishads, Slokas (verses), Sutras (prose rules), Anu-
vyakhyanas (glosses), Vyakhyanas (commentaries) 1 .
From him alone all these were breathed forth.
f 11. 'As all waters find their centre in the sea,
all touches in the skin, all tastes in the tongue, all
smells in the nose, all colours in the eye, all sounds
in the ear, all percepts in the mind, all knowledge in
the heart, all actions in the hands, all movements in
the feet, and all the Vedas in speech, —
* 12. ' As a lump of salt 2 , when thrown into water,
becomes dissolved into water, and could not be taken
§ 1 1 as probably a later insertion. The sa is not the pronoun, but
a particle, as in sa yadi, sa £et, &c,
1 B. adds, what is sacrificed, what is poured out, food, drink, this
world and the other wOrld, and all creatures.
2 SeeA r Hnd.Up.VI,i 3 .
Digitized by
Google
112 B-R/HADARAiVTAKA-UPANISHAD.
out again, but wherever we taste (the water) it is
salt, — thus verily, O Maitreyi, does this great Being,
endless, unlimited, consisting of nothing but know-
ledge 1 , rise from out these elements, and vanish again
in them. When he has departed, there is no more
knowledge (name), I say, O Maitreyi.' Thus spoke
Ya^wavalkya.
1 3. Then Maitreyi said : ' Here thou hast be-
wildered me, Sir, when thou sayest that having
departed, there is no more knowledge 2 .'
ButYa^»avalkya replied: 'O Maitreyi, I say nothing
that is bewildering. This is enough, O beloved, for
? wisdom 3 .
5 ' For when there is as it were duality, then one.
sees the other, one smells the other, one hears the
other 4 , one salutes the other 6 , one perceives the
other 6 , one knows the other; but when the Self only
is all this, how should he smell another 7 , how should
he see 8 another 9 , how should he hear 10 another, how
should he salute n another, how should he perceive
another 12 , how should he know another ? How
should he know Him by whom he knows all this ?
1 As a mass of salt has neither inside nor outside, but is altogether
a mass of taste, thus indeed has that Self neither inside nor outside,
but is altogether a mass of knowledge. B.
2 ' Here, Sir, thou hast landed me in utter bewilderment. Indeed,
I do not understand him.' B.
? 8 Verily, beloved, that Self is imperishable, and of an inde-
structible nature. B.
* B. inserts, one tastes the other.
5 B. inserts, one hears the other.
6 B. inserts, one touches the other. 7 See, B.
8 Smell, B. 9 B. inserts taste.
10 Salute, B. " Hear, B.
18 B. inserts, how should he touch another ?
Digitized by
Google
II ADHYAYA, 5 BRAHMAiVA, 2. II3
How, O beloved, should he know (himself), the
Knower 1 ?'
Fifth Brahmaiva 2 .
1. This earth is the honey 3 (madhu, the effect) of
all beings, and all beings are the honey (madhu, the
effect) of this earth. Likewise this bright, immortal
person in this earth, and that bright immortal person
incorporated in the body (both are madhu). He
indeed is the same as that Self, that Immortal, that
Brahman, that AIL
2. This water is the honey of all beings, and all
beings are the honey of this water. Likewise this
bright, immortal person in this water, and that
bright, immortal person, existing as seed in the body
(both are madhu). He indeed is the same as that
Self, that Immortal, that Brahman, that All.
■
1 Instead of the last line, B. adds (IV, 5, 15): 'That Self is to
be described by No, no ! He is incomprehensible, for he cannot
be comprehended ; he is imperishable, for he cannot perish ; he is
unattached, for he does not attach himself ; unfettered, he does
not suffer, he does not fail. How, O beloved, should he know the
Knower? Thus, O Maitreyi, thou hast been instructed. Thus
far goes immortality.' Having said so, Y&gwavalkya went away
(into the forest). 15. See also .Oand. Up. VII, 24, 1.
3 Madhyandina text, p. 1064.
s Madhu, honey, seems to be taken here as an instance of some-
thing which is both cause and effect, or rather of things which are
mutually dependent on each other, or cannot exist without one
other. As the bees make the honey, and the honey makes or
supports the bees, bees and honey are both cause and effect,
or at all events are mutually dependent on one other. In the same
way the earth and all living beings are looked upon as mutually
dependent, living beings presupposing the earth, and the earth
presupposing living beings. This at all events seems to be the
general idea of what is called the Madhuvidya, the science of honey,
which Dadhya£ communicated to the A^vins.
C'5] I
Digitized by
Google
114 BUJHADARAiVYAKA-UPANISHAD.
3. This fire is the honey of all beings, and all
beings are the honey of this fire. Likewise this
bright, immortal person in this fire, and that bright,
immortal person, existing as speech in the body (both
are madhu). He indeed is the same as that Self,
that Immortal, that Brahman, that All.
4.. This air is the honey of all beings, and all
beings are the honey of this air. Likewise this
bright, immortal person in this air, and that bright,
immortal person existing as breath in the body (both
are madhu). He indeed is the same as that Self,
that Immortal, that Brahman, that All.
5. This sun is the honey of all beings, and all
beings are the honey of this sun. Likewise this
bright, immortal person in this sun, and that bright,
immortal person existing as the eye in the body
(both are madhu). He indeed is the same as that
Self, that Immortal, that Brahman, that All.
6. This space (disafi, the quarters) is the honey of
all beings, and all beings are the honey of this
space. Likewise this bright, immortal person in this
space, and that bright, immortal person existing as
the ear in the body (both are madhu). He indeed
is the same as that Self, that Immortal, that Brah-
man, that All.
7. This moon is the honey of all beings, and all
beings are the honey of this moon. Likewise this
bright, immortal person in this moon, and that bright,
immortal person existing as mind in the body (both
are madhu). He indeed is the same as that Self,
that Immortal, that Brahman, that All.
8. This lightning is the honey of all beings, and
all beings are the honey of this lightning. Likewise
this bright, immortal person in this lightning, and
Digitized by
Google
II ADHYAYA, 5 BRAHMAiVA, 1 3. II5
that bright, immortal person existing as light in the
body (both are madhu). He indeed is the same as
that Self, that Immortal, that Brahman, that All.
9. This thunder 1 is the honey of all beings, and all
beings are the honey of this thunder. Likewise this
bright, immortal person in this thunder, and that
bright, immortal person existing as sound and voice
in the body (both are madhu). He indeed is the
same as that Self, that Immortal, that Brahman,
that All.
10. This ether is the honey of all beings, and all
beings are the honey of this ether. Likewise this
bright, immortal person in this ether, and that bright,
immortal person existing as heart-ether in the body
(both are madhu). He indeed is the same as that
Self, that Immortal, that Brahman, that All.
11. This law (dharma^) is the honey of all beings,
and all beings are the honey of this law. Likewise
this bright, immortal person in this law, and that
bright, immortal person existing as law in the body
(both are madhu). He indeed is the same as that
Self, that Immortal, that Brahman, that All.
12. This true 2 (satyam) is the honey of all beings,
and all beings are the honey of this true. Likewise
this bright, immortal person in what is true, and that
bright, immortal person existing as the true in the
body (both are madhu). He indeed is the same as
that Self, that Immortal, that Brahman, that All.
1 3. This mankind is the honey of all beings, and
all beings are the honey of this mankind. Likewise
1 Stanayitnu, thunder, is explained by the commentator as
Par^anya.
* Satyam, the true, the real, not, as it is generally translated, the
truth.
I 2
s
Digitized by
Google
Il6 BKJHADARAiVYAKA-UPANISHAD.
this bright, immortal person in mankind, and that
bright, immortal person existing as man in the body
(both are madhu). He indeed is the same as that
Self, that Immortal, that Brahman, that All.
14. This Self is the honey of all beings, and all
beings are the honey of this Self. Likewise this
bright, immortal person in this Self, and that bright,
immortal person, the Self (both are madhu). He
indeed is the same as that Self, that Immortal, that
Brahman, that All.
15. And verily this Self is the lord of all beings,
the king of all beings. And as all spokes are con-
tained in the axle and in the felly of a wheel, all
beings, and all those selfs (of the earth, water, &c.)
are contained in that Self.
16. Verily Dadhya^ Atharvawa proclaimed this
honey (the madhu-vidya) to the two Asvins, and a
Rishi, seeing this, said (Rv. 1, 116, 12) :
' O ye two heroes ( Asvins), I make manifest that
fearful deed of yours (which you performed) for the
sake of gain \ like as thunder 2 makes manifest the
rain. The honey (madhu-vidya) which Dadhya£
Atharvawa proclaimed to you through the head of
a horse,' ...
17. Verily Dadhya^ Atharva«a 3 proclaimed this
honey to the two Axvins, and a Rishi, seeing this,
said (Rv. 1, 117, 22);
' O A.svins, you fixed a horse's head on Atharva»a
Dadhyai, and he, wishing to be true (to his promise),
1 The translation here follows the commentary.
9 Tanyatu, here explained as Par^anya.
s .Sankara distinguishes here between Atharvawa and Atharvawa,
if the text is correct.
Digitized by
Google
II ADHYAYA, 5 BRAHMAJVA, 1 9. 117
proclaimed to you the honey, both that of Tvashtri 1
and that which is to be your secret, O ye strong
ones.'
18. Verily Dadhya^ Atharva«a proclaimed this
honey to the two A^vins, and a ./frshi, seeing this,
said:
'He (the Lord) made bodies with two feet, he
made bodies with four feet. Having first become
a bird, he entered the bodies as purusha (as the
person).' This Very purusha is in all bodies the puri-
.raya, i. e. he who lies in the body (and is therefore
called purusha). There is nothing that is not
covered by him, nothing that is not filled by him.
19. Verily Dadhya^ Atharva#a proclaimed this
honey to the two Asvins, and a ^?2shi, seeing this,
said (Rv. VI, 47, 18):
' He (the Lord) became like unto every form 2 , and
this is meant to reveal the (true) form of him (the
Atman). Indra (the Lord) appears multiform through
the Mayas (appearances), for his horses (senses) are
yoked, hundreds and ten.'
This (Atman) is the horses, this (Atman) is the
ten, and the thousands, many and endless. This is
the Brahman, without cause and without effect, with-
out anything inside or outside ; this Self is Brahman,
omnipresent and omniscient. This is the teaching
(of the Upanishads).
1 .Sahkara explains Tvash/n as the sun, and the sun as the head
of the sacrifice which, having been cut off, was to be replaced by
the pravargya rite. The knowledge of this rite forms the honey
of Tvash/n". The other honey which is to be kept secret is the
knowledge of the Self, as taught before in the Madhu-brahma«a.
' He assumed all forms, and such forms, as two-footed or four-
footed animals, remained permanent. Comm.
Digitized by
Google
Il8 BR/HADARAiVYAKA-UPANISHAD.
Sixth BrAhmaata.
i. Now follows the stem l :
i . Pautimashya from Gaupavana,
2. Gaupavana from Pautimashya,
3. Pautimashya from Gaupavana,
4. Gaupavana from Kausika,
5. Kaurika from Kau#dfinya,
6. Kau#afinya from SkncHlya,
7. SAndilya from Kaurika and Gautama,
8. Gautama
. 2. from Agniverya,
9. Agniveyya from .Sa/zdfilya and Anabhimlata,
10. S&ndilya. and Anabhimlata from Anabhimlata,
11. Anabhimlata from Anabhimlata,
12. Anabhimlata from Gautama,
13. Gautama from Saitava and Praiinayogya,
14. Saitava and Pra^fnayogya from Parararya,
1 5. Parasarya from Bharadva^a,
16. Bharadva^a from Bharadva^a and Gautama,
1 7. Gautama from Bharadva^a,
1 The line of teachers and pupils by whom the MadhukS«&
(the fourth Brahmawa) was handed down. The Madhyandina-.?&kh£
begins with ourselves, then 1. SaurpaHayya, 2. Gautama, 3. Vitsya,
4. V&tsya and PSr^Uarya, 5. Siftkrrtya and Bharadva^-a, 6. Auda-
vahi and S&ndilya, 7. Vai^avSpa and Gautama, 8. Vaigavapayana
and Vaish/apureya, 9. «S"&H</ilya andRauhi«ayana, 10. Saunaka,
Atreya, and Raibhya, 11. Pautimashyaya«a and Kau««?iny &yana,
12. KauWinya, 13. Kau/afinya, 14. Kau«rfinya and Agnivesya,
15. Saitava, 16. P£rlrarya, 17. Gatukarwya, 18. Bharadva^a, 19. Bh£-
radva^a, Asuraya«a, and Gautama, 20. Bh&radva^a, 2i.Vai^avapa-
yana. Then the same as the Kawvas to G&tukarwya, who leams
from Bharadva^a, who learns from Bh&radva^a, Asur&ya«a, and
Yaska. Then Traivawi &c. as in the K&»va-vara.ra.
Digitized by
Google
ii adhyaya/6 brAhmajva, 3. 119
18. Bharadva^a from Parlsarya,
19. Parasarya from Vaifavapayana,
20. Vai/avapayana from Kausikayani,
2 1 1 . Kaoyikayani
3. from Ghmakaurika,
12. Ghntakaimka from Par&saryaya«a,
23. Parararyayawa from Parasarya,
24. Parasarya from Catukaraya 2 ,
25. Gatukaraya from Asurayawa and Yaska 3 ,
26. Asuraya«a and Yaska from Traiva^i,
27. Traivawi from Aupa^andhani,
28. Aupa^andhani from Asuri,
29. Asuri from Bharadva^a,
30. Bharadva/a from Atreya,
31. Atreya from Ma#/i,
32. Ma»/i from Gautama,
33. Gautama from Gautama,
34. Gautama from Vatsya,
35. Vatsya from StLndilya,
36. S&ndilya. from Kaisorya Kapya,
37. Kairorya Kapya from Kumaraharita,
38. Kumaraharita from Galava,
39. Galava from Vidarbhl-kau»</inya,
40. Vidarbh! - kauwrfinya from Vatsanapat Ba-
bhrava,
41. Vatsanapat Babhrava from Pathi Saubhara,
42. Pathi Saubhara from Ayasya Angirasa,
43. Ayasya Angirasa from Abhuti Tvash/ra,
44. Abhuti Tvash/ra from VLrvarupa Tvash/ra,
45. Visvarupa Tvash/ra from Asvinau,
1 From here the Vama agrees with the Vamsa at the end of
IV, 6.
2 BMradva^a, in M&dhyandina text.
3 Bharadv%a, Asuraya»a, and Yaska, in M&dhyandina text.
Digitized by
Google
1 20 BK/HADARAYYAKA-UPANISHAD.
46. A.rvinau from Dadhya^ Atharva«a,
47. Dadhya£ Atharvawa from Atharvan Daiva,
48. Atharvan Daiva from Mn'tyu Pradhva#zsana,
49. Mr/tyu Pradhvawsana from Pradhvaflssana,
50. Pradhvawsana from Ekarshi,
51. Ekarshi from Vipraiitti 1 ,
52. Vipraiitti from Vyash/i,
53. Vyash/i from Sanaru,
54. Sanaru from Sanatana,
55. Sanatana from Sanaga,
56. Sanaga from Paramesh/^in,
57. Paramesh/^in from Brahman,
58. Brahman is Svayambhu, self-existent.
Adoration to Brahman 2 .
1 Vipra^itti, in Mstdhyandina text.
* Similar genealogies are found BrA. Ar. Up. IV, 6, and VI, 5.
Digitized by
Google
Ill ADHYAYA, I BRAHMAJVA, 2. 121
THIRD ADHYAYA,
First BrAhma#a *.
Adoration to the Highest Self (Paramatman) !
i. kanaka Vaideha (the king of the Videhas) sacri-
ficed with a sacrifice at which many presents were |
offered to the priests of (the Arvamedha). Brahma»as 1
of the Kurus and the PM^alas had come thither,
and (Janaka Vaideha wished to know, which of those
Brahma«as was the best read. So he enclosed a
thousand cows, and ten padas (of gold) 2 were fastened
to each pair of horns.
2. And Ganaka spoke to them : ' Ye venerable
Brahma#as, he who among you is the wisest, let
him drive away these cows.'
Then those Brahma«as durst not, but Ya^«avalkya
said to his pupil : ' Drive them away, my dear.'
He replied : ' O glory of the Saman V and drove
them away.
The Brahmawas became angry and said : ' How
could he call himself the wisest among us ?'
Now there was A^vala, the Hotrt priest of kanaka
Vaideha. He asked him : ' Are you indeed the
1 Madhyandina text, p. 1067.
2 Pala^aturbhagaA padaA suvarwasya. Comm.
8 One expects iti after uda^a, but Sanmravas is applied to
Ya^wavalkya, and not to the pupil. Yi^wavalkya, as the com-
mentator observes, was properly a teacher of the Ya^ur-veda, but
as the pupil calls him Samarravas, he shows that Ya^iavalkya
knew all the four Vedas, because the Samans are taken from the
Rig-veda, and the Atharva-veda is contained in the other three
Vedas. Regnaud, however, refers it to the pupil, and translates,
' 6 toi qui apprends le Sama-veda.'
Digitized by
Google
122 BR/HADARAtfYAKA-UPANISHAD.
wisest among us, O Yi^»avalkya ?' He replied : ' I
bow before the wisest (the best knower of Brahman),
but I wish indeed to have these cows.'
Then A-rvala, the Hotri priest, undertook to
question him.
3. ' Ya^wavalkya,' he said, ' everything here (con-
nected with the sacrifice) is reached by death, every-
thing is overcome by death. By what means then
is the sacrificer freed beyond the reach of death ?'
Ya^avalkya said : ' By the Hotri priest, who is
. v Agni (fire), who is speech. For speech is the Hotri
^ of the sacrifice (or the sacrificer), and speech is
Agni, and he is the Hotri. This constitutes free-
dom, and perfect freedom (from death).'
4. ' Ya^avalkya,' he said, ' everything here is
reached by day and night, everything is overcome by
day and night. By what means then is the sacrificer
freed beyond the reach of day and night ?'
Ya/«avalkya said : ' By the Adhvaryu priest, who
£■ is the eye, who is Aditya (the sun) 1 . For the eye is
c£ the Adhvaryu of the sacrifice, and the eye is the sun,
and he is the Adhvaryu. This constitutes freedom,
and perfect freedom.'
5. ' Ydf^avalkya/ he said, ' everything here is
reached by the waxing and waning of the moon,
everything is overcome by the waxing and waning
of the moon. By what means then is the sacrificer
freed beyond the reach of the waxing and waning
of the moon?'
z x Ya^wavalkya said ; ' By the Udgatri priest, who
is Vayu (the wind), who is the breath. For the
1 One expects adityena £akshusha, instead of ^akshushadityena,
but see § 6.
Digitized by
Google
m adhyaya, i brAhmajva, 8. 123
breath is the Udgiitri of the sacrifice, and the breath
is the wind, and he is the UdgatW. This constitutes
freedom, and perfect freedom/
6. ' Ya^wavalkya,' he said, ' this sky is, as it were,
without an ascent (staircase.) By what approach
does the sacrificer approach the Svarga world ? '
Ya^wavalkya said : ' By the Brahman priest, who ' u, v f /■ V^
is the mind (manas), who is the moon. For the
mind is the Brahman of the sacrifice, and the mind
is the moon, and he is the Brahman. This consti-
tutes freedom, and perfect freedom. These are the
complete deliverances (from death).'
Next follow the achievements.
7. ' Ya^avalkya,' he said, ' how many Rik verses
will the HotW priest employ to-day at this sacrifice?'
' Three/ replied Ya^»avalkya.
' And what are these three?'
' Those which are called Puronuvakya, Ya^ya, and,
thirdly, .Sasya V
' What does he gain by them ?'
' All whatsoever has breath.'
8. ' Ya^wavalkya,' he said, ' how many oblations
(ahuti) will the Adhvaryu priest employ to-day at
this sacrifice?'
' Three,' replied Ydf»avalkya.
' And what are these three ? '
'Those which, when offered, flame up ; those which,
when offered, make an excessive noise ; and those
which, when offered, sink down 2 /
1 The Puronuv&kyas are hymns employed before the actual
sacrifice, the Y&gyas accompany the sacrifice, the Sasy&s are used
for the Sastra. All three are called StotriySs.
8 These oblations are explained as consisting of wood and oil,
of flesh, and of milk and Soma. The first, when thrown on the
Digitized by
Google
124 BR/HADARAiVYAKA-UPANISHAD.
' What does he gain by them ?'
' By those which, when offered, flame up, he gains
the Deva (god) world, for the Deva world flames
up, as it were. By those which, when offered, make
an excessive noise, he gains the Fitrt (father) world,
for the Fitri world is excessively (noisy) 1 . By those
which, when offered, sink down, he gains the Manu-
shya (man) world, for the Manushya world is, as it
were, down below.'
9. ' Y&g- wavalkya,' he said, ' with how many deities
does the Brahman priest on the right protect to-day
this sacrifice ? '
' By one,' replied Ya^avalkya.
'And which is it?'
' The mind alone ; for the mind is endless, and the
Visvedevas are endless, and he thereby gains the
endless world.'
10. ' YcLf?£avalkya,' he said, 'how many Stotriya
hymns will the Udgatr? priest employ to-day at this
sacrifice ? '
' Three,' replied Ya^avalkya.
' And what are these three ?'
' Those which are called Puronuvakya, Ya^ya, and,
thirdly, •Sasya.'
'And what are these with regard to the body
(adhyatmam) ?'
' The Puronuvakya is Pri#a (up-breathing), the
Ya^ya the Apana (down-breathing), the .Sasya the
Vyana (back-breathing)/
fire, flame up. The second, when thrown on the fire, make a
loud hissing noise. The third, consisting of milk, Soma, &c, sink
down into the earth.
1 On account of the cries of those who wish to be delivered out
of it. Comm.
Digitized by
Google
in adhyAya, 2 brAhmajva, 7. 125
' What does he gain by them ?'
' He gains the earth by the Puronuvaky&, the sky
by the Ya^ya, heaven by the 6asya.'
After that Asvala held his peace.
Second BrAhmajva 1 .
/ i. Then 6&ratkarava Artabhaga 2 asked. 'Ya^'^a-
valkya,' he said, ' how many Grahas are there, and
how many Atigrahas 3 ? '
' Eight Grahas,' he replied, ' and eight Atigrahas.'
'And what are these eight Grahas and eight
Atigrahas ? '
2. ' Pra«a (breath) is one Graha, and that is seized *•
by Apana (down-breathing) as the Atigraha 4 , for one
smells with the Apana.'
3. ' Speech (va£) is one Graha, and that is seized -^
by name (naman) as the Atigraha, for with speech
one pronounces names.'
4. ' The tongue is one Graha, and that is seized 3
by taste as the Atigraha, for with the tongue one
perceives tastes.'
5. ' The eye is one Graha, and that is seized by form i\
as the Atigraha, for with the eye one sees forms.'
6. 'The ear is one Graha, and that is seized by sound
as the Atigraha, for with the ear one hears sounds.'
7. ' The mind is one Graha, and that is seized by r
1 Madhyandina text, p. 1069.
8 A descendant of i?*tabhaga of the family of (raratkaru.
' Graha is probably meant originally in its usual sacrificial sense,
as a vessel for offering oblations. But its secondary meaning,
in which it is here taken, is a taker, a grasper, i. e. an organ of
sense, while atigraha is intended for that which is grasped, i. e. an
object of sense.
4 Here the a is long, £Mndasatvat.
f
Digitized by
Google
126 BK/HADARAiVYAKA-UPANISHAD.
desire as the Atigraha, for with the mind one desires
desires.'
*7 8. ' The arms are one Graha, and these are seized
by work as the Atigraha, for with the arms one
works work.'
V 9. ' The skin is one Graha, and that is seized by_
touch as the Atigraha, for with the skin one per-
ceives touch. These are the eight Grahas and the
eight Atigrahas.'
10. ' Ya^wavalkya,' he said, ' everything is the food
of death. What then is the deity to whom death is
food ?'
' Fire (agni) is death, and that is the food of water.
Death is conquered again.'
11. ' Ydf #avalkya,' he said, 'when such a person
(a sage) dies, do the vital breaths (pra«as) move out
of him or no ?'
' No,' replied Ya^vfevalkya ; ' they are gathered up
in him, he swells, he is inflated, and thus inflated the
dead lies at rest.'
12. ' Ya^vSfavalkya,' he said, 'when such a man
dies, what does not leave him ?'
^ ' The name,' he replied ; ' for the name is endless,
the Virvedevas are endless, and by it he gains the
endless world.'
1 3. ' Ya^wavalkya,' he said, ' when the speech of
this dead person enters into the fire 1 , breath into the
air, the eye into the sun, the mind into the moon,
the hearing into space, into the earth the body, into
the ether the self, into the shrubs the hairs of the
body, into the trees the hairs of the head, when the
1 The commentator explains purusha here by asamyagdawin,
one who does not know the whole truth. See also Deussen,
Vedanta, p. 405, and p. 399, note.
Digitized by
Google
Ill ADHYAYA, 3 BRAHMAtfA, 2. 1 27
blood and the seed are deposited in the water, where
is then that person ?'
Ya^avalkya said : ' Take my hand, my friend.
We two alone shall know of this ; let this question
of ours not be (discussed) in public' Then these
two went out and argued, and what they said was
karman (work), what they praised was karman 1 ,
viz. that a man becomes good by good work, and
bad by bad work. After that Garatkarava Arta-
bhaga held his peace.
Third BrAhmawa 2 .
1. Then Bhu^yu Lahyayani asked. ' Ya^wavalkya,'
he said, 'we wandered about as students 3 , and came to
the house of Pata«^ala Kapya. He had a daughter
who was possessed by a Gandharva. We asked
him, 'Who art thou ?' and he (the Gandharva) replied :
' I am Sudhanvan, the Angirasa.' And when we
asked him about the ends of the world, we said to
him, 'Where were the Parikshitas 4 ? Where then
were the Parikshitas, I ask thee, Ya^wavalkya, where
were the Parikshitas ?'
2. Ya^»avalkya said : ' He said to thee, I suppose,
that they went where those go who have performed
a horse-sacrifice.'
He said : 'And where do they go who have per-
formed a horse-sacrifice ?' '
1 What is intended is that the sawsara continues by means of
karman, while karman by itself never leads to moksha.
2 Madhyandina text, p.' 1070.
3 The commentator explains £arak&A as adhyayandrthaw vrata-
kzrzn&k forakaA, adhvaryavo va\ See Professor R. G. Bhandarkar,
in Indian Antiquary, 1883, p. 145.
4 An old royal race, supposed to have vanished from the earth.
Digitized by
Google
128 BKZHADARAiVYAKA-UPANISHAD.
Ya^avalkya replied : ' Thirty-two journeys of the
car of the sun is this world. The earth surrounds
it on every side, twice as large, and the ocean
surrounds this earth on every side, twice as large.
Now there is between 1 them a space as large as the
edge of a razor or the wing of a mosquito. Indra,
having become a bird, handed them (through the
space) to Vayu (the air), and Vayu (the air), holding
them within himself, conveyed them to where they
dwell who have performed a horse-sacrifice. Some-
what in this way did he praise Vayu indeed. There-
fore Vayu (air) is everything by itself, and Vayu is
all things together. He who knows this, conquers
death.' After that Bhu^yu Lahyayani held his
peace.
Fourth Brahmaata 2 .
"i. Then Ushasta isTakrayatfa asked. 'Ya^aval-
kya,' he said, ' tell me the Brahman which is visible,
not invisible 3 , the Self (atman), who is within all.'
YA^avalkya replied: 'This, thy Self, who is
within all.'
'Which Self, O Ya^avalkya, is within all ?'
Ya^«avalkya replied : ' He who breathes in the
up-breathing, he is thy Self, and within all. He who
breathes in the down-breathing, he is thy Self, and
within all. He who breathes in the on-breathing,
he is thy Self, and within all. He who breathes in
1 The commentator explains that this small space or hole is
between the two halves of the mundane egg.
2 Madhyandina text, p. 1071. It follows after what is here
the fifth Brahma«a, treating of Kaho</a Kaushitakeya.
s Deussen, Vedanta, p. 163, translates, 'das immanente, nicht
transcendente Brahman,' which is right, but too modern.
Digitized by
Google
Ill ADHYAYA, 5 BRAHMAVA, I. 12 9
the out-breathing, he is thy Self, and within all.
This is thy Self, who is within all.'
2. Ushasta isfakraya#a said : 'As one might say,
this is a cow, this is a horse, thus has this been
explained by thee. Tell me the Brahman which is
visible, not invisible, the Self, who is within all.'
Y4f»avalkya replied: 'This, thy Self, who is |
within all.'
'Which Self, O Y£f«avalkya, is within all ?'
Ya^wavalkya replied : ' Thou couldst not see the
(true) seer of sight, thou couldst not hear the (true)
hearer of hearing, nor perceive the perceiver of per-
ception, nor know the knower of knowledge. This
is thy Self, who is within all. Everything also is of '""'
evil' After that Ushasta isfakraya»a held his peace.
"Fifth BrAhmajva 1 .
l Then Kahola Kaushltakeya asked. 'Y£f«a-
valkya,' he said, 'tell me the Brahman which is visible,
not invisible, the Self (atman), who is within all.'
Ya^»avalkya replied: 'This, thy Self, who is
within all.'
' Which Self, O Ya^#avalkya, is within all ?'
Ya^»avalkya replied : ' He who overcomes hunger
and thirst, sorrow, passion, old age, and death.
When Brahmawas know that Self, and have risen
above the desire for sons 2 , wealth, and (new) worlds s ,
they wander about as mendicants. For a desire for
sons is desire for wealth, a desire for wealth is desire
for worlds. Both these are indeed desires. There-
fore let a Brahma^a, after he has done with learning,
1 Mddhyandinatext,p. 1071, standing before the fourth Brahmawa.
9 See Brih. Ar. Up. IV, 4, 22.
' Life in the world of the Fathers, or in the world of the Gods.
[15] K
Digitized by
Google
1 30 BK7HADARAJVYAKA-UPANISHAD.
wish to stand by real strength * ; after he has done
with that strength and learning, he becomes a Muni
(a Yogin) ; and after he has done with what is not
the knowledge of a Muni, and with what is the
knowledge of a Muni, he is a Brahma«a. By what-
ever means he has become a Brahma#a, he is such
indeed 2 . Everything else is of evil.' After that
Kahola Kaushitakeya held his peace.
Sixth BrAhmajva 8 .
1. Then Gargl Va^aknavl asked. ' Ya^avalkya,'
she said, ' everything here is woven, like warp and
woof, in water. What then is that in which water is
woven, like warp and woof?'
' In air, O Gargl,' he replied.
' In what then is air woven, like warp and woof?'
' In the worlds of the sky, O Gargl,' he replied.
' In what then are the worlds of the sky woven,
like warp and woof ? '
' In the worlds of the Gandharvas, O Gargl,' he
replied.
1 Knowledge of the Self, which enables us to dispense with all
other knowledge.
8 Mr. Gough proposes as an alternative rendering: 'Let a
Brahmawa renounce learning and become as a child; and after
renouncing learning and a childlike mind, let him become a
quietist; and when he has made an end of quietism and non-
quietism, he shall become a Brihmana, a Br£hma»a indeed.'
Deussen takes a similar view, but I doubt whether 'the knowledge
of babes' is not a Christian rather than an Indian idea, in spite of
•Sankara's remarks on Ved. Sfitra, III, 4, 50, which are strangely at
variance with his commentary here. Possibly the text may be cor-
rupt, for tish/Mset too is a very peculiar form. We might conjecture
balyena, as we have abalyam, in IV, 4, 1. In Kaush. Up. Ill, 3,
Sbalyam stands for abalyam, possibly for abalyam. The construc-
tion of kena syad yena syit tenedrwa eva, however, is well known.
8 M&dhyandina text, p. 1072.
Digitized by
Google
in adhyAya, 6 brAhmawa, i. 131
' In what then are the worlds of the Gandharvas
woven, like warp and woof?'
'In the worlds of Aditya (sun), O Gargt,' he replied.
'In what then are the worlds of Aditya (sun)
woven, like warp and woof?'
' In the worlds of Xandra (moon), O Gargt,' he
replied. / #£
' In what then are the worlds of Aandra (moon)
woven, like warp and woof?'
' In the worlds of the Nakshatras (stars), O Gargt,'
he replied.
' In what then are the worlds of the Nakshatras
(stars) woven, like warp and woof?' **
' In the worlds of the Devas (gods), O Gargt,' he
replied.
' In what then are the worlds of the Devas (gods)
woven, like warp and woof ? '
' In the worlds of Indra, O Gargt,' he replied.
' In what then are the worlds of Indra woven, like
warp and woof?'
' In the worlds of Pra^apati, O Gargt,' he replied.
' In what then are the worlds of Pra^apati woven,
like warp and woof?'
' In the worlds of Brahman, O Gargt,' he replied.
' In what then are the worlds of Brahman woven,
like warp and woof?'
Ya^"«avalkya said : ' O Gargt, Do not ask too
much, lest thy head should fall off. Thou askest
too much about a deity about which we are not to
ask too much \ Do not ask too much, O Gargt.'
After that Gargt Va^aknavi held her peace.
1 According to the commentator questions about Brahman are
to be answered from the Scriptures only, and not to be settled by
argument.
K 2
Digitized by
Google
1 3 2 b&/iiadArajvyaka-upanishad.
Seventh BrAhmana 1 .
i. Then Uddalaka Aru»i 2 asked. ' Ya^avalkya,'
he said, ' we dwelt among the Madras in the houses
of Pata»iala Kapya, studying the sacrifice. His
wife was possessed of a Gandharva, and we asked
him : " Who art thou ?" He answered : " I am
Kabandha Atharva^a." And he said to Pata«iala
Kapya and to (us) students : " Dost thou know, Kapya,
that thread by which this world and the other world,
and all beings are strung together?" And Pata»iala
Kapya replied : " I do not know it, Sir." He said
again to Pata»iala Kapya and to (us) students:
" Dost thou know, Kapya, that puller (ruler) within
(antaryamin), who within pulls (rules) this world and
the other world and all beings ? " And Pata&6ala
Kapya replied : " I do not know it, Sir." He said
again to Pata^ala Kapya . and to (us) students :
' " He, O Kapya, who knows that thread and him who
'^ pulls (it) within, he knows Brahman, he knows the
worlds, he knows the Devas, he knows the Vedas,
he knows the Bhutas (creatures), he knows the Self,
he knows everything"! Thus did he (the Gandharva)
say to them, and I know it. If thou, O Y4f#avalkya,
without knowing that string and the puller within,
drivest away those Brahma-cows (the cows offered
as a prize to him who best knows Brahman), thy
head will fall off.'
Ya^»avalkya said : ' O Gautama, I believe I know
that thread and the puller within.'
1 Madhyandina text, p. 1072.
* Afterwards addressed as Gautama ; see before, p. 1, note.
Digitized by
Google
IH ADHYAYA, 7 BRAHMAJVA, 7. 1 33
The other said : ' Anybody may say, I know, I
know. Tell what thou knowest'
2. Ya^Tzavalkya said : ' Vayu (air) is that thread,
O Gautama. By air, as by a thread, O Gautama,
this world and the other world, and all creatures are
strung together. Therefore, O Gautama, people say
of a dead person that his limbs have become unstrung;
for by air, as by a thread, O Gautama, they were
strung together.'
The other said : ' So it is, O Ya^wavalkya. Tell
now (who is) the puller within.'
3. Ya^avalkya said : ' He who dwells in the earth,
and within the earth \ whom the earth does not
know, whose body the earth is, and who pulls (rules)
the earth within, he is thy Self, the puller (ruler)
within, the immortal.'
4. ' He who dwells in the water, and within the
water, whom the water does not know, whose body
the water is, and who pulls (rules) the water within,
he is thy Self, the puller (ruler) within, the immortal.'
5. ' He who dwells in the fire, and within the fire,
whom the fire does not know, whose body the fire
is, and who pulls (rules) the fire within, he is thy
Self, the puller (ruler) within, the immortal.'
6. ' He who dwells in the sky, and within the
sky, whom the sky does not know, whose body the
sky is, and who pulls (rules) the sky within, he is thy
Self, the puller (ruler) within, the immortal.'
7. ' He who dwells in the air (vayu), and within the
air, whom the air does not know, whose body the
1 I translate antara by 'within,' according to the commentator,
who explains it by abhyantara, but I must confess that I should
prefer to translate it by ' different from,' as Deussen does, 1. c. p. 160,
particularly as it governs an ablative.
Digitized by
Google
134 BK/HADARA2VYAKA-UPANISHAD.
air is, and who pulls (rules) the air within, he is thy
Self, the puller (ruler) within, the immortal.'
8. ' He who dwells in the heaven (dyu), and within
the heaven, whom the heaven does not know, whose
body the heaven is, and who pulls (rules) the heaven
within, he is thy Self, the puller (ruler) within, the
immortal.'
9. ' He who dwells in the sun (aditya), and within
the sun, whom the sun does not know, whose body
the sun is, and who pulls (rules) the sun within, he
is thy Self, the puller (ruler) within, the immortal.'
10. 'He who dwells in the space (di$a^), and
within the space, whom the space does not know,
whose body the space is, and who pulls (rules) the
space within, he is thy Self, the puller (ruler) within,
the immortal.'
11. 'He who dwells in the moon and stars (£an-
dra-tarakam), and within the moon and stars, whom
the moon and stars do not know, whose body the
moon and stars are, and who pulls (rules) the moon
and stars within, he is thy Self, the puller (ruler)
within, the immortal.'
12. 'He who dwells in the ether (ak&ya), and
within the ether, whom the ether does riot know,
whose body the ether is, .and who pulls (rules) the
ether within, he is thy Self, the puller (ruler) within,
the immortal.'
13. 'He who dwells in the darkness (tamas), and
within the darkness, whom the darkness does not
know, whose body the darkness is, and who pulls
(rules) the darkness within, he is thy Self, the puller
(ruler) within, the immortal.'
14. ' He who dwells in the light (te^as), and within
the light, whom the light does not know, whose
Digitized by
Google
Ill ADHYAYA, 7 BRAhMAWA, 21. 1 35
body the light is, and who pulls (rules) the light
within, he is thy Self, the puller (ruler) within, the
immortal.'
So far with respect to the gods (adhidaivatam) ;
now with respect to beings (adhibhutam).
15. Y&f»avalkya said: 'He who dwells in all
beings, and within all beings, whom all beings do
not know, whose body all beings are, and who pulls
(rules) all beings within, he is thy Self, the puller
(ruler) within, the immortal.'
16. 'He who dwells in the breath (pra«a), and
within the breath, whom the breath does not know,
whose body the breath is, and who pulls (rules) the
breath within, he is thy Self, the puller (ruler) within,
the immortal.'
17. 'He who dwells in the tongue (va£), and
within the tongue, whom the tongue does not know,
whose body the tongue is, and who pulls (rules) the
tongue within, he is thy Self, the puller (ruler) within,
the immortal.'
18. 'He who dwells in the eye, and within the
eye, whom the eye does not know, whose body the
eye is, and who pulls (rules) the eye within, he is thy
Self, the puller (ruler) within, the immortal.'
19. 'He who dwells in the ear, and within the
ear, whom the ear does not know, whose body the
ear is, and who pulls (rules) the ear within, he is thy
Self, the puller (ruler) within, the immortal.'
20. 'He who dwells in the mind, and within the
mind, whom the mind does not know, whose body
the mind is, and who pulls (rules) the mind within,
he is thy Self, the puller (ruler) within, the immortal.'
2i. ' He who dwells in the skin, and within the
skin, whom the skin does not know, whose body the
Digitized by
Google
136 bkthadAraatyaka-upanishad.
skin is, and who pulls (rules) the skin within, he is
thy Self, the puller (ruler) within, the immortal.'
22. 'He who dwells in knowledge 1 , and within
knowledge, whom knowledge does not know, whose
body knowledge is, and who pulls (rules) knowledge
within, he is thy Self, the puller (ruler) within, the
immortal.'
23. ■ He who dwells in the seed, and within
the seed, whom the seed does not know, whose
body the seed is, and who pulls (rules) the seed
within, he is thy Self, the puller (ruler) within,
the immortal ; unseen, but seeing ; unheard, but
hearing ; unperceived, but perceiving ; unknown, but
knowing. There is no other seer but he, there
is no other hearer but he, there is no other per-
ceiver but he, there is no other knower but he.
This is thy Self, the ruler within, the immortal.
Everything else is of evil.' After that Uddalaka
Arum held his peace.
Eighth BrAhmajva 2 .
1. Then Vaiaknav! 8 said: 'Venerable Brahmawas,
I shall ask him two questions. If he will answer
them, none of you, I think, will defeat him in any
argument concerning Brahman.'
Ya^#avalkya said : ' Ask, O Gargi.'
2. She said : ' O Ya^-»avalkya, as the son of a
warrior from the K&sls or Videhas might string his
loosened bow, take two pointed foe-piercing arrows
in his hand and rise to do battle, I have risen to
1 Self, i.e. the individual Self, according to the Madhyandina
school; see Deussen, p. 161.
* M&dhyandina text, p. 1075.
3 G&rgf, not the wife of Ya^navalkya.
Digitized by
Google
Ill ADHYAYA, 8 BRAHMAJVA, 8. 1 37
fight thee with two questions. Answer me these
questions/
Ya^avalkya said : ' Ask, O Gargl.'
3. She said : ' O Ya^wavalkya, that of which they
say that it is above the heavens, beneath the earth,
embracing heaven and earth *, past, present; and future,
tell me in what is it woven, like warp and woof ? '
4. YcLf#avalkya said : ' That of which they say
that it is above the heavens, beneath the earth,
embracing heaven and earth, past, present, and
future, that is woven, like warp and woof, in the
ether (akara).'
5. She said : ' I bow to thee, O Ya^avalkya, who
hast solved me that question. Get thee ready for
the second.'
Y&£-»avalkya said 2 : ' Ask, O Gargl.'
6. She said : ' O Ya^»avalkya, that of which they
say that it is above the heavens, beneath the earth,
embracing heaven and earth, past, present, and future,
tell me in what is it woven, like warp and woof?'
7. Ya^»avalkya said : ' That of which they say
that it is above the heavens, beneath the earth,
embracing heaven and earth, past, present, and future,
that is woven, like warp and woof, in the ether.'
Gargl said : ' In what then is the ether woven, like
warp and woof?'
8. He said : ' O Gargl, the Brahma»as call this
the Akshara (the imperishable). It is neither coarse
nor fine, neither short nor long, neither red (like fire)
nor fluid (like water) ; it is without shadow, with-
out darkness, without air, without ether, without
1 Deussen, p. 143, translates, ' between heaven and earth,' but
that would be the antariksha.
8 This repetition does not occur in the Madhyandina text.
Digitized by
Google
138 brthadAraa'Yaka-upanishad.
attachment 1 , without taste, without smell, without
eyes, without ears, without speech, without mind,
without light (vigour), without breath, without a
mouth (or door), without measure, having no within
and no without, it devours nothing, and no one
devours it.'
9. ' By the command of that Akshara (the im-
perishable), O Gargi, sun and moon stand apart 2 .
By the command of that Akshara, O Gargi,
heaven and earth stand apart. By the command of
that Akshara, O Gargi, what are called moments
(nimesha), hours (muhurta), days and nights, half-
months, months, seasons, years, all stand apart.
By the command of that Akshara, O Gargi, some
rivers flow to the East from the white mountains,
others to the West, or to any other quarter. By
the command of that Akshara, O Gargi, men praise
those who give, the gods follow the sacrificer, the
fathers the Darvi-offering.'
10. 'Whosoever, O Gargi, without knowing that
Akshara (the imperishable), offers oblations in this
world, sacrifices, and performs penance for a thou-
sand years, his work will have an end. Whosoever,
O Gargi, without knowing this Akshara, departs this
world, he is miserable (like a slave) 3 . But he, O
Gargi, who departs this world, knowing this Akshara,
he is a Brahma«a.'
11. 'That Brahman,' O Gargi, 'is unseen, but
seeing ; unheard, but hearing ; unperceived, but per-
ceiving ; unknown, but knowing. There is nothing
1 Not adhering to anything, like lac or gum.
* Each follows its own course.
8 ' He stores up the effects from work, like a miser his riches/
Roer. ' He is helpless,' Gough.
Digitized by
Google
Ill ADHYAYA, 9 BRAHMA7VA, I. 1 39
that sees but it, nothing that hears but it, nothing
that perceives but it, nothing that knows but it. In
that Akshara then, O Gargl, the ether is woven,
like warp and woof.'
1 2. Then said Garg! : ' Venerable Brahmans, you
may consider it a great thing, if you get off by bowing
before him. No one, I believe, will defeat him in
any argument concerning Brahman.' After that
Vaiaknavl held her peace.
Ninth BrAhmaata 1 .
1 . Then Vidagdha .Sakalya asked him 2 : ' How many
gods are there, O Ya^avalkya ?' He replied with
this very Nivid 3 : 'As many as are mentioned in the
Nivid of the hymn of praise addressed to the Vw-
vedevas, viz. three and three hundred, three and
three thousand 4 .'
' Yes,' he said, and asked again : ' How many gods
are there really, O Ya^»avalkya ?'
' Thirty-three,' he said.
1 Madhyandina text, p. 1076.
* This disputation between Ya^-wavalkya and Vidagdha Sakalya
occurs in a simpler form in the 5atapatha-brahma«a, XI, p. 873.
He is here represented as the first who defies Ya^-wavalkya, and
whom Ya^wavalkya asks at once, whether the other Brahmans
had made him the ulmuk&vakshayana, the cat's paw, literally one
who has to take a burning piece of wood out of the fire (ardha-
dagdhakash//4am ulmukam; tasya vahirnirasanam avakshaya»a»*
vinasaA). The end, however, is different, for on asking the nature
of the one god, the PrS«a, he is told by Ya^wavalkya that he has
asked for what he ought not to ask, and that therefore he will die
and thieves will carry away his bones.
' Nivid, old and short invocations of the gods ; devatasankhyt-
v&fcakani mantrapadani kanL&d valr vadeve $ astre jasyante. Sankara
and Dvivedaganga.
4 This would make 3306 devatas.
Digitized by
Google
I40 B/i/HADARAiVYAKA-UPANISHAD.
' Yes,' he said, and asked again : ' How many gods
are there really, O Ya^avalkya?'
' Six,' he said.
' Yes,' he said, and asked again : ' How many gods
are there really, O Ya^wavalkya?'
' Three,' he said.
' Yes,' he said, and asked again : ' How many gods
are there really, O Ya^»avalkya?'
' Two,' he said.
' Yes,' he said, and asked again : ' How many gods
are there really, O Ya^avalkya?'
' One and a half (adhyardha),' he said.
'Yes,' he said, and asked again : 'How many gods
are there really, O Ya^avalkya?'
' One,' he said.
'Yes,' he said, and asked: 'Who are these three
and three hundred, three and three thousand?'
2. Ya/»avalkya replied : ' They are only the
various powers of them, in reality there are only
thirty-three gods V
He asked : ' Who are those thirty-three?'
Ya^avalkya replied : 'The eight Vasus, the eleven
Rudras, the twelve Adityas. They make thirty-one,
and Indra and Pra^apati make the thirty-three V
3. He asked : ' Who are the Vasus.'
Ya^avalkya replied : ' Agni (fire), Pmhivt
(earth), Vayu (air), Antariksha (sky), Aditya (sun),
Dyu (heaven), Aandramas (moon), the Nakshatras
(stars), these are the Vasus, for in them all that
dwells (this world) 3 rests; and therefore they are
called Vasus.'
1 ' The glories of these are three and thirty.' Gough, p. 172.
4 Trayastriwwau, i. e. trayastriwataA purawau.
* The etymological explanation of Vasu is not quite clear, and
Digitized by
Google
in adhyAya, 9 brAhmawa, 8. \ ' v ' ^ 14J-
4. He asked : 'Who are the Rudras ?'
Y&f»avalkya replied: 'These ten vital breaths
(prawas, the senses, i. e. the five ^wanendriyas, and
the five karmendriyas), and Atman 1 , as the eleventh.
When they depart from this mortal body, they make
us cry (rodayanti), and because they make us cry,
they are called Rudras.'
5. He asked : ' Who are the Adityas ?'
Ya^»avalkya replied : ' The twelve months of the
year, and they are Adityas, because they move along
(yanti), taking up everything 2 (adadana^). Because
they move along, taking up everything, therefore
they are called Adityas.'
6. He asked: 'And who is Indra, and who is
Pra^apati?'
Ya^^Eavalkya replied : ' Indra is thunder, Pra^apati
is the sacrifice.'
He asked : 'And what is the thunder?'
Ya^wavalkya replied : 'The thunderbolt.'
He asked : 'And what is the sacrifice?'
Ya^wavalkya replied : ' The (sacrificial) animals.'
7. He asked : 'Who are the six ?'
Ya^avalkya replied : ' Agni (fire), Prithivt (earth),
Vayu (air), Antariksha (sky), Aditya (sun), Dyu
(heaven), they are the six, for they are all 8 this,
the six.'
8. He asked : 'Who are the three gods?'
the commentator hardly explains our text. Perhaps vasu is meant
for the world or the dwellers therein. The more usual explanation
occurs in the jatap. Brali. p. 1077, ete hida*» sarvawz v&sayante
tadyad ida« sarvaw vasayante tasmad vasava iti; or on p. 874,
where we read te yad idaw sarvam &c.
1 Atman is here explained as manas, the common sensory.
a The life of men, and the fruits of their work.
* They are the thirty-three gods..
'I V
Digitized by
Google
142 BK/HADARA2VYAKA-UPANISHAD.
Ya^rcavalkya replied : ' These three worlds, for in
them all these gods exist.'
He asked : 'Who are the two gods?'
Ya^#avalkya replied : ' Food and breath.'
He asked : 'Who is the one god and a half?'
Ya^»avalkya replied : ' He that blows.'
9. Here they say : ' How is it that he who blows
like one only, should be called one and a half (adhyar-
dha)?' And the answer is : 'Because, when the wind
was blowing, everything grew (adhyardhnot).'
- He asked : 'Who is the one god ?'
Ya/»avalkya replied: 'Breath (prawa), and he is
Brahman (the Sutra tman), and they call him That
(tyad).'
10. .Sakalya said 1 : 'Whosoever knows that person
(or god) whose dwelling (body) is the earth, whose
sight (world) is fire 2 , whose mind is light, — the prin-
1 I prefer to attribute this to .Sakalya, who is still the questioner,
and not Ya^wavalkya ; but I am not quite satisfied that I am right
in this, or in the subsequent distribution of the parts, assigned to
each speaker. If .Sakalya is the questioner, then the sentence, veda
vS ah&m tam purusha« sarvasyatmana^ paraya«awz yam attha, must
belong to Ya^iiavalkya, because he refers to the words of another
speaker. Lastly, the sentence vadaiva has to be taken as addressed
to .SUkalya. The commentator remarks that, he being the ques-
tioner, one expects prikkAa. instead of vada. But Yi^wavalkya
may also be supposed to turn round on iSUkalya and ask him a
question in turn, more difficult than the question addressed- by
.Sakalya to Ya^wavalkya, and in that case the last sentence must
be taken as an answer, though an imperfect one, of .SUkalya's.
The commentator seems to think that after Ya^wavalkya told
SSkalya to ask this question, .Sakalya was frightened and asked
it, and that then Ya^wavalkya answered in turn.
2 The Madhyandina text varies considerably. It has the first
time, foshur lokaA for agnir loka^. I keep to the same construc-
tion throughout, taking mano gyotih, not as a compound, but like
agnir loko yasya, as a sentence, i. e. mano ^yotir yasya.
Digitized by
Google
in adhyAya, g brAHmAjva, 1 3. 143
ciple of every (living) self, he indeed is a teacher,
O Ya^avalkya.'
Ya^avalkya said : ' I know that person, the prin-
ciple of every self, of whom thou speakest. This
corporeal (material, earthy) person, " he is he." But
tell me 1 , Sakalya, who is his devata* (deity)?'
.Sakalya replied : 'The Immortal 3 .'
1 1. .Sakalya said : 'Whosoever knows that person
whose dwelling is love (a body capable of sensual
love), whose sight is the heart, whose mind is light, —
the principle of every self, he indeed is a teacher,
O Ya^wavalkya.'
Ya^»avalkya replied : ' I know that person, the
principle of every self, of whom thou speakest. This
love-made (loving) person, " he is he." But tell me,
.Sakalya, who is his devata ? '
.Sakalya replied : ' The women *.'
1 2. .Sakalya said : ' Whosoever knows that person
whose dwelling are the colours, whose sight is the
eye, whose mind is light, — the principle of every self,
he indeed is a teacher, O Y&^avalkya.'
Y£f#avalkya replied : ' I know that person, the
principle of every self, of whom thou speakest. That
person in the sun, " he is he." But tell me, .Sakalya,
who is his devata ?'
•Sakalya replied : ' The True s .'
13. Sakalya said : 'Whosoever knows that person
1 Ask me. Comm.
* That from which he is produced, that is his devati. Comm.
3 According to the commentator, the essence of food, which
produces blood, from which the germ receives life and becomes an
embryo and a living being.
4 Because they excite the fire of love. Comm.
6 The commentator explains satya, the true, by the eye, because
the sun owes its origin to the eye.
Digitized by
Google
144 BltfHADARAiVYAKA-UPANISHAD.
whose dwelling is ether, whose sight is the ear, whose
mind is light, — the principle of every self, he indeed
is a teacher, O Ya^avalkya.'
Y^fwavalkya replied : ' I know that person, the
principle of every self, of whom thou speakest. The
person who hears * and answers, " he is he." But
tell me, .Sakalya, who is his devata?'
.Sakalya replied : 'Space.'
14. .Sakalya said : ' Whosoever knows that person
whose dwelling is darkness, whose sight is the heart,
whose mind is light, — the principle of every self, he
indeed is a teacher, O Ya^avalkya.'
Ya^avalkya replied: 'I know that person, the
principle of every self, of whom thou speakest The
shadowy 2 person, " he is he." But tell me, .Sakalya,
who is his devata ? '
•Sakalya replied : ' Death.'
15. Sakalya said : ' Whosoever knows that person
whose dwelling are (bright) colours, whose sight is
the eye, whose mind is light, — the principle of every
self, he indeed is a teacher, O Yi^«avalkya.'
Ya^avalkya replied : ' I know that person, the
principle of every self, of whom thou speakest The
person in the looking-glass, "he is he." But tell
me, .Sakalya, who is his devata?'
.Sakalya replied : 'Vital breath' (asu).
16. .Sakalya said: 'Whosoever knows that person
whose dwelling is water, whose sight is the heart
whose mind is light, — the principle of every self, he
indeed is a teacher, O Ya^wavalkya/
1 Read frautra instead of jrotra ; see Brih. Ar. Up. II, 5, 6.
2 Shadow, £Mya, is explained here by a^wana, ignorance, not
by gMna., knowledge.
Digitized by
Google
Ill ADHVAYA, 9 BRAHMAJVA, 1 9. 1 45
Y&f»avalkya replied : ' I know that person, the
principle of every self, of whom thou speakest. The
person in the water, " he is he." But tell me, .Sakalya,
who is his devata?'
.Sakalya replied : ' Varuwa.'
17. .Sakalya said : 'Whosoever knows that person
whose dwelling is seed, whose sight is the heart,
whose mind is light, — the principle of every self, he
indeed is a teacher, O Ya^wavalkya.'
Y£f»avalkya replied ; ' I know that person, the
principle of every self, of whom thou speakest. The
filial person, "he is he." But tell me, .Sakalya, who
is his devata?'
•Sakalya replied : ' Pra^apati.'
18. Ya^»avalkya said: '.Sakalya, did those Brah-
ma»as (who themselves shrank from the contest)
make thee the victim 1 ?'
•Sakalya said : ' Ya^avalkya, because thou hast
decried the Brahma»as of the Kuru-Pa»/£alas, what 2
Brahman dost thou know?'
19. Yif»avalkya said : ' I know the quarters with
their deities and their abodes.'
1 AngSiivakshayawa is explained as a vessel in which coals are
extinguished, and Anandagiri adds that Yif wavalkya, in saying that
.SSkalya was made an ahgSrSvakshaya«a by his fellow Brihmans,
meant that he was given up by them as a victim, in' fact that
he was being burnt or consumed by Ya^wavalkya. I should prefer
to take angaravakshaya/za in the sense of ulmukavakshayawa, an
instrument with which one takes burning coals from the fire to
extinguish them, a pair of tongs. Read saxidamsa, instead of sandesa.
Kshi with ava means to remove, to take away. We should call
an ahgar&vakshayawa a cat's paw. The Brahmanas used .Sakalya
as a cat's paw.
* It seems better to take kim as the interrogative pronoun than
as an interrogative particle.
['51 L
Digitized by
Google
146 biuhadArajwaka-upanishad.
•Sakalya said : ' If thou knowest the quarters with
their deities and their abodes,
20. 'Which is thy deity in the Eastern quarter?'
Ya£-»avalkya said : ' Aditya (the sun).'
.Sakalya said : ' In what does that Aditya abide?'
YcLf #avalkya said : ' In the eye.'
•Sakalya said : ' In what does the eye abide?'
Ya^wavalkya said: 'In the colours, for with the
eye he sees the colours.'
.Sakalya said: 'And in what then do the colours
abide?'
Ya^wavalkya said: 'In the heart 1 , for we know
colours by the heart, for colours abide in the heart 2 .'
•Sakalya said : ' So it is indeed, O Ya^avalkya.'
21. .Sakalya said: 'Which is thy deity in the
Southern quarter ?'
Ya^asavalkya said : ' Yama.'
.Sakalya said: ' In what does that Yama abide?'
Y4f»avalkya said : ' In the sacrifice.'
■Sakalya said : ' In what does the sacrifice abide?'
Ya^rcavalkya said: 'In the Dakshiwa (the gifts to
be given to the priests).'
■Sakalya said : ' In what does the Dakshi»a abide ?'
Y&£-«avalkya said : 'In .Sraddha (faith), for if a
man believes, then he gives Dakshi»a, and Dakshirca
truly abides in faith.'
•Sakalya said : 'And in what then does faith abide?'
Y4f«avalkya said: 'In the heart, for by the heart
faith knows, and therefore faith abides in the heart.'
•Sakalya said : 'So it is indeed, O Ya^"«avalkya.'
1 Heart stands here for buddhi and manas together. Comm.
2 In the text, published by Dr. Roer in the Bibliotheca Indica, a
sentence is left out, viz. hrtdaya ity uva£a, hn'dayena hi rupa»i
^anati, hrtdaye hy eva rupawi pratish/ftit&ni bhavantlty.
Digitized by
Google
Ill ADHYAYA, 9 BRAHMAiVA, 24. 1 47
22. Sakalya said: 'Which is thy deity in the
Western quarter ?'
Y&f»avalkya said : ' Varu»a.'
.Sakalya said : ' In what does that Vanma abide?'
Yif»avalkya said : ' In the water.'
.Sakalya said : ' In what does the water abide ?'
Y&f»avalkya said : ' In the seed.'
Sakalya said: 'And in what does the seed abide?'
Ya^avalkya said : ' In the heart And therefore
also they say of a son who is like his father, that he
seems as if slipt from his heart, or made from his
heart ; for the seed abides in the heart.'
Sakalya said : ' So it is indeed, O Ya^-»avalkya.'
23. .Sakalya said: 'Which is thy deity in the
Northern quarter?'
Yi^wavalkya said : ' Soma.'
Sakalya said : ' In what does that Soma abide?'
Ya^avalkya said : ' In the Dlksha V
.Sakalya said : 'In what does the Dlksha abide?'
Y&f»avalkya said: 'In the True; and therefore
they say to one who has performed the Dlksha,
Speak what is true, for in the True indeed the
Dlksha abides.'
Sakalya said : 'And in what does the True abide?'
Ya^-»avalkya said : ' In the heart, for with the heart
do we know what is true, and in the heart indeed
the True abides.'
.Sakalya said : 'So it is indeed, O Ya^avalkya.'
24. Sakalya said: 'Which is thy deity in the
zenith?'
1 Dlksha is the initiatory rite for the Soma sacrifice. Having
sacrificed with Soma which has to be bought, the sacrificer becomes
endowed with wisdom, and wanders to the North, which is the
quarter of Soma.
L 2
Digitized by
Google
148 bk/hadArayyaka-upanishad.
Y&f#avalkya said: 'Agni.'
.Sakalya said : 'In what does that Agni abide.'
Yif#avalkya said : 'In speech.'
.Sakalya said : 'And in what does speech abide ?'
Ya^avalkya said : ' In the heart.'
.Sakalya said : 'And in what does the heart abide?'
25. Ya^»avalkya said: 'O Ahallika 1 , when you
think the heart could be anywhere else away from
us, if it were away from us, the dogs might eat it,
or the birds tear it.'
2$. .Sakalya said : 'And in what dost thou (thy
body) and the Self (thy heart) abide?'
Ya^-wavalkya said : ' In the Pra/za (breath).'
.Sakalya said : ' In what does the Pra#a abide ?'
Ya^avalkya said : 'In the Apana (down-
breathing) 2 .'
.Sakalya said : 'In what does the Apina abide?'
Ya^avalkya said: ' In theVyana (back-breathing) 3 .'
•Sakalya said: 'In what does the Vyana abide ?'
Ya^wavalkya said: ' In the Udana (the out-breath-
ing)V
.Sakalya said : 'In what does the Udana abide ?'
Ya^rcavalkya said : ' In the Samana 6 . That Self
1 A term of reproach, it may be a ghost or preta, because ahani
liyate, it disappears by day.
8 Because the pra»a would run away, if it were not held back by
the apana.
8 Because the apana would run down, and the prd«a up, if they
were not held back by the vy&na.
4 Because all three, the pra«a, apana, and vyana, would run
away in all directions, if they were not fastened to the udana.
6 The Samana can hardly be meant here for one of the five
pra^ias, generally mentioned before the udana, but, as explained by
Dvivedagahga, stands for the Sutrdtman. This Sutritman abides
in the Antaryamin, and this in the Brahman (Ku/astha), which is
Digitized by
Google
Ill ADHYAYA, 9 BRAHMAtfA, 28. 1 49
(atman) is to be described by No, no * ! He is in-
comprehensible, for he cannot be (is not) compre-
hended ; he is imperishable, for he cannot perish ; he
is unattached, for he does not attach himself; unfet-
tered, he does not suffer, he does not fail.'
' These are the ei ght abode s (th e ear th, &c), the
eight worlds (fire, &c), the eight gods (the immortal
food, &c), the eight persons (the corporeal, &c.)
He who after dividing and uniting these persons 2 ,
went beyond (the Samana), that person, taught in
the Upanishads, I now ask thee (to teach me).
If thou shalt not explain him to me, thy head
will fall.'
.Sakalya did not know him, and his head fell, nay,
thieves took away his bones, mistaking them for
something else.
27. Then Ya^»avalkya said: 'Reverend Brah-
mawas, whosoever among you desires to do so, may
now question me. Or question me, all of you. Or
whosoever among you desires it, I shall question
him, or I shall question all of you.
But those Brahma«as durst not (say anything).
28. Then Ya^wavalkya questioned them with
these .Slokas:
1. 'Aj_a_jmighty_Jree_jn_the_for£s^ so in truth is
man, his hairs are the leaves, his outer skin is
the bark.
2. ' From his skin flows forth blood, sap from
the skin (of the tree) ; and thus from the wounded
therefore described next. Could Samdna be here the same as in
IV, 3, 7?
1 See before, II, 3, 6 ; also IV, 2, 4 ; IV, 4, 22 ; IV, 5, 15.
2 Dividing them according to the different abodes, worlds, and
persons, and uniting them at last in the heart.
Digitized by
Google
1 50 • BJVHADARAJVYAKA-UPANISHAD.
man 1 comes forth blood, as from a tree that is
struck.
3. ' The lumps of his flesh are (in the tree) the
layers of wood, the fibre is strong like the ten-
dons 2 . The bones are the (hard) wood within, the
marrow is made like the marrow of the tree.
4. ' But, while the tree, when felled, grows up
again more young from the root, from what root,
tell me, does a mortal grow up, after he has been
felled by death ?
5. ' Do not say, "from seed," for seed is produced
from the living 8 ; but a tree, springing from a grain,
clearly 4 rises again after death s .
6. ' If a tree is pulled up with the root, it will not
grow again ; from what root then, tell me, does a
mortal grow up, after he has been felled by death ?
7. ' Once born, he is not born (again) ; for who
should create him again 8 ?'
1 In the Madhyandina-.sakha, p. 1080, tasmat tadatunnat, instead
of tasmat tadatrz'wzat.
2 .Sankara seems to have read snavavat, instead of sndva tat
sthiram, as we read in both Sakhas.
* Here the Madhyandinas (p. 1080) add, g&ta. eva na^&yate, ko
nv enaw ^anayet punaA, which the Kib*vas place later.
4 Instead of ar^asi, the M&dhyandinas have ariyata^.
5 The Madhyandinas have dh&n&ruha u vai, which is better than
iva vai, the iva being, according to .Sankara's own confession, use-
less. The thread of the argument does not seem to have been
clearly perceived by the commentators. What the poet wants to
say is, that a man, struck down by death, does not come to life
again from seed, because human seed comes from the living only,
while trees, springing from grain, are seen to come to life after the
tree (which yielded the grain or the seed) is dead. Pretya-sam-
bhava, like pretya-bhiva, means life after death, and pretyasam-
bhava, as an adjective, means coming to life after death.
• This line too is taken in a different sense by the commentator.
According to him, it would mean : * If you say, He has been born
Digitized by
Google
in adhyAya, 9 brAhmajva, 28. 151
-■ ' ■ 1 1 1 i.
'Brahman, who is knowledge and bliss, he is the
principle, both to him who gives gifts 1 , and also to
him who stands firm, and knows.'
(and there is an end of all questioning), I say, No; he is born
again, and the question is, How ? ' This is much too artificial. The
order of the verses in the M&dhyandina-.rtkha' is better on the
whole, leading up more naturally to the question, ' From what root
then does a mortal grow up, after he has been felled by death ?'
When the Br&hmans cannot answer, Ya^navalkya answers, or the
•Sruti declares, that the root from whence a mortal springs again,
after death, is Brahman.
1 .Sankara explains ratir d&tuA as r&ter datuA, a reading adopted
by the Midhyandinas. He then arrives at the statement that
Brahman is the principle or the last source, also the root of a new
life, both for those who practise works and for those who, having
relinquished works, stand firm in knowledge. Regnaud (II, p. 138)
translates: 'C'est Brahma (qui est) l'intelligence, le bonheur, la
richesse, le but supreme de celui qui offre (des sacrifices), et de
celui qui reside (en lui), de celui qui connait.'
Digitized by
Google
152 BK/HADARAiVYAKA-UPANISHAD.
FOURTH ADHYAYA.
First Brahmaya.
1. When (kanaka Vaideha was sitting (to give
audience), Ya^wavalkya approached, and Ganaka
Vaideha said : ' Ya^favalkya, for what object did
you come, wishing for cattle, or for subtle ques-
tions 1 ?'
Ya^avalkya replied : ' For both, Your Majesty ;
2. 'Let us hear what anybody may have told you.'
Canaka Vaideha replied : ' (Pitvan .Sailini told me
that speech (va/§) is Brahman.'
Ya^wavalkya said : 'As one who had (the benefit
of a good) father, mother, and teacher might tell, so
did .Sailini 2 tell you, that speech is Brahman; for
what is the use of a dumb person ? But did he tell
you the body (ayatana) and the resting-place (pra-
tishMa) of that Brahman ?'
kanaka Vaideha said : ' He did not tell me.'
Y%$avalkya said : ' Your Majesty, this (Brahman)
stands on one leg only 3 .'
Ganaka Vaideha said: 'Then tell me, Ya^avalkya.'
1 A»v-anta, formed like Sutranta, Siddhanta, and probably Ve-
danta, means subtle questions.
4 Roer and Poley give here .Sailina ; Weber also (pp. 1080 and
1 081) has twice Sailina (.Silinasyapatyam).
* This seems to mean that Gitvan's explanation of Brahman is
lame or imperfect, because there are four padas of that Brahman,
and he taught one only. The other three are its body, its place,
and its form of worship (pra^wetiyam upanishad brahma»ar £atur-
thaA padaA). See also Maitr. Up. VII, p. 22 1.
Digitized by
Google
IV ADHYAYA, I BRAHMAtfA, 3. 1 53
Y4^#avalkya said: ' The tongue is its body, ether
its place, and one should worship it as knowledge/ I
(kanaka Vaideha said: ' What is the nature of that
knowledge?'
Y&f#avalkya replied: 'Your Majesty, speech itself—
(is knowledge). For through speech, Your Majesty,
a friend is known (to be a friend), and likewise the
J&g-veda., Ya^ur-veda, Sama-veda, the Atharvangi-
rasas, the Itihasa (tradition), Purawa-vidya (know-
ledge of the past), the Upanishads, .Slokas (verses),
Sutras (rules), Anuvyakhyanas and Vyakhyanas'
(commentaries 1 , &c); what is sacrificed, what is
poured out, what is (to be) eaten and drunk, this
world and the other world, and all creatures. By
speech alone,Your Majesty, Brahman is known, speech
indeed, O King, is the Highest Brahman. Speech
does not desert him who worships that (Brahman)
with such knowledge, all creatures approach him,
and having become a god, he goes to the gods.'
(kanaka Vaideha said : ' I shall give you (for
this) a thousand cows with a bull as big as an
elephant.'
Ydf»avalkya said : ' My father was of opinion that
one should not accept a reward without having fully
instructed a pupil.'
3. Ya^wavalkya said : ' Let us hear what anybody
may have told you.'
6anaka Vaideha replied : ' Udanka .Saulbayana
told me that life (pra«a) 2 is Brahman.' —
Ya^wavalkya said: 'As one who had (the benefit of
a good) father, mother, and teacher might tell, so did
1 See before, II, 4, 10; and afterwards, IV, 5, 11.
s See Taitt. Up. Ill, 3.
Digitized by
Google
»p
154 brih adArajvyak a-upanishad.
Udanka £aulbayana tell you that life is Brahman ;
for what is the use of a person without life ? But
did he tell you the body and the resting-place of
that Brahman?'
Ganaka Vaideha said : ' He did not tell me.'
Y£f#avalkya said : ' Your Majesty, this (Brahman)
stands on one leg only.'
Ganaka Vaideha said; 'Then tell me, Y&f»a-
valkya.'
Y£f«avalkya said : ' Breath is its body, ether its
lace, and one should worship it as what is dear.'
Ganaka Vaideha said: 'What is the nature of that
which is dear ? '
Ya^^avalkya replied : ' Your Majesty, life itself
(is that which is dear);' because for the sake of life,
Your Majesty, a man sacrifices even for him who is
unworthy of sacrifice, he accepts presents from him
who is not worthy to bestow presents, nay, he goes
to a country, even when there is fear of being hurt 1 ,
for the sake of life. Life, O King, is the Highest
Brahman. Life does not desert him who worships
that (Brahman) with such knowledge, all creatures
approach him, and having become a god, he goes to
the gods.'
Ganaka Vaideha said : ' I shall give you (for this)
a thousand cows with a bull as big as an elephant'
Ya^wavalkya said : ' My father was of opinion that
one should not accept a reward without having fully
instructed a pupil.'
4. Ya^avalkya said : ' Let us hear what anybody
may have told you.'
1 Or it may mean, he is afraid of being hurt, to whatever country
he goes, for the sake of a livelihood.
Digitized by
Google
IV ADHYAYA, I BRAHMAJVA, 5. I 55
Ganaka Vaideha replied : ' Barku V4rsh»a told me
that sight (iakshus) is Brahman.'
Y£f ^avalkya said : ' As one who had (the benefit
of a good) father, mother, and teacher might tell, so
did Barku V4rsh«a tell you that sight is Brahman ;
for what is the use of a person who cannot see ?
But did he tell you the body and the resting-place
of that Brahman ? '
(kanaka Vaideha said : ' He did not tell me.'
Ya^wavalkya said : ' Your Majesty, this (Brahman)
stands on one leg only.'
kanaka Vaideha said : ' Then tell me, Y&gna.-
valkya.'
Ya^wavalkya said : ' The eye is its body, ether its
place, and one should worship it as what is true.'
kanaka Vaideha said: ' What is the nature of that
which is true ? '
Ya^»avalkya replied : ' Your Majesty, sight itself
(is that which is true) ; for if they say to a man who
sees with his eye, " Didst thou see ?" and he says, " I
saw," then it is true. Sight, O King, is the Highest
Brahman. Sight does not desert him who worships
that (Brahman) with such knowledge, all creatures
approach him, and having become a god, he goes to
the gods.'
(kanaka Vaideha said : ' I shall give you (for this)
a thousand cows with a bull as big as an elephant.'
Ya£-»avalkya said : 'My father was of opinion that
one should not accept a reward without having fully
instructed a pupil.'
5. Y&f #avalkya said : ' Let us hear what anybody
may have told you.'
kanaka Vaideha replied : ' Gardabhtvibhita Bha-
radva^a told me that hearing (srotra) is Brahman.'
Digitized by
Google
156 bjwhadArajvyaka-upanishad.
Y£f»avalkya said : ' As one who had (the benefit
of a good) father, mother, and teacher might tell, so
did Gardabhtvibhita Bharadvi^a tell you that hear-
ing i s Brahman; for what is the use of a person who
cannot hear ? But did he tell you the body and the
resting-place of that Brahman?'
Ganaka Vaideha said : ' He did not tell me.'
Ya^iwavalkya said : ' Your Majesty, this (Brahman)
stands on one leg only.'
kanaka Vaideha said: 'Then tell me, Yi^»a-
valkya.'
• Ya/wavalkya said : ' The ear is its body, ether its
place, and we should worship it as what is endless.'
6anaka Vaideha said : 'What is the nature of that
which is endless ?'
Ya^vzavalkya replied : ' Your Majesty, space
(disak) itself (is that which is endless), and therefore
to whatever space (quarter) he goes, he never comes
to the end of it. For space is endless. Space indeed,
O King, is hearing \ and hearing indeed, O King, is
the Highest Brahman. Hearing does not desert
him who worships that (Brahman) with such know-
ledge, all creatures approach him, and having become
a god, he goes to the gods.'
kanaka Vaideha said : ' I shall give you (for this)
a thousand cows with a bull as big as an elephant'
Y&g «avalkya said : ' My father was of opinion that
one should not accept a reward without having fully
instructed a pupil.'
6. Ya^»avalkya said : ' Let us hear what anybody
may have told you.'
1 Dvivedagahga states, digbh&go hi p&thiv&dhish/ftSnivaiMin-
na£ frotram ity ufyate, atas tayor ekatvam.
Digitized by
Google
IV ADHYAYA, I BRAHMAtfA, 7. 157
kanaka Vaideha replied : ' Satyakama GSbala told
me that mind * (manas) is Brahman.'
Y&£$avalkya said : ' As one who had (the benefit
of a good) father, mother, and teacher might tell, so
did Satyakama 6&bala tell you that mind is Brah-
man ; for what is the use of a person without mind ?
But did he tell you the body and the resting-place of
that Brahman ?'
(kanaka Vaideha said : ' He did not tell me/
Ya^avalkya said : 'Your Majesty, this (Brahman)
stands on one leg only.'
kanaka Vaideha said: 'Then tell me, Ya^-^avalkya.'
Ya^avalkya said : ' Mind itself is its body, ether
its place, and we should worship it as bliss.'
kanaka Vaideha said : 'What is the nature of bliss ?'
Ya^^avalkya replied: ' Your Majesty, mind itself;
for with the mind does a man desire a woman, and
a like son is born of her, and he is bliss. Mind
indeed, O King, is the Highest Brahman. Mind
does not desert him who worships that (Brahman)
with such knowledge, all creatures approach him, and
having become a god, he goes to the gods.'
kanaka Vaideha said : ' I shall give you (for this)
a thousand cows with a bull as big as an elephant.'
Y&£$avalkya said: 'My father was of opinion that
one should not accept a reward without having fully
instructed a pupil.'
7. Ya^wavalkya said : ' Let us hear what anybody
may have told you.'
(kanaka Vaideha replied: 'Vidagdha .Sakalya told
me that the heart (hrzdaya) is Brahman.'
Ya^wavalkya said : ' As one who had (the benefit
1 See also Taitt. Up. Ill, 4.
Digitized by LaOOQlC
•
1 58 bk/hadArajvyaka-upanishad.
of a good) father, mother, and teacher might tell, so
did Vidagdha .Sakalya tell you that the heart is
Brahman ; for what is the use of a person without a
heart ? But did he tell you the body and the resting-
place of that Brahman ?'
kanaka Vaideha said : ' He did not tell me/
Ya^wavalkya said : ' Your Majesty, this (Brahman)
stands on one leg only.'
(kanaka Vaideha said : ' Then tell me, Ya^wavalkya.'
Ya < f «avalkya said : ' The heart itself is its body,
ether its place, and we should worship it as certainty
(sthiti).'
6anaka Vaideha said : ' What is the nature of
certainty ? '
Ya^»avalkya replied : ' Your Majesty, the heart
itself; for the heart indeed, O King, is the body of
all things, the heart is the resting-place of all things,
for in the heart, O King, all things rest The heart
indeed, O King, is the Highest Brahman. The
heart does not desert him who worships that (Brah-
man) with such knowledge, all creatures approach
him, and having become a god, he goes to the gods.'
(kanaka Vaideha said : ' I shall give you (for this)
a thousand cows with a bull as big as an elephant.'
Ya^wavalkya said: 'My father was of opinion
that one should not accept a reward without having
fully instructed a pupil.'
Second BrAhmaata.
1. Ganaka Vaideha, descending from his throne,
said: ' I bow to you, O Ya^^avalkya, teach me.'
Ya^"»avalkya said : ' Your Majesty, as a man who
wishes to make a long journey, would furnish him-
self with a chariot or a ship, thus is your mind well
Digitized by
Google
IV ADHYAYA, 2 BrAhMAJVA, 3. 1 59
furnished by these Upanishads 1 . You are honour-
able, and wealthy, you have learnt the Vedas and
been told the Upanishads. Whither then will you
go when departing hence ?'
(kanaka Vaideha said: 'Sir, I do not know whither
I shall go/
Y&fwavalkya said: 'Then I shall tell you this,
whither you will go.'
kanaka Vaideha said : ' Tell it, Sir.'
2. Ya^»avalkya said : ' That person who is in the
right eye 2 , he is called Indha, and him who is Indha
they call indeed 3 Indra mysteriously, for the gods love
what is mysterious, and dislike what is evident.
3. ' Now that which in the shape of a person is in
the right eye, is his wife, Vir&f *. Their meeting-
place 6 is the ether within the heart, and their food
the red lump within the heart. Again, their
covering 8 is that which is like net-work within the
heart, and the road on which they move (from sleep
to waking) is the artery that rises upwards from the
heart. Like a hair divided into a thousand parts, so
are the veins of it, which are called Hita 7 , placed
1 This refers to the preceding doctrines which had been commu-
nicated to Ganaka by other teachers, and particularly to the up&sanas
of Brahman as knowledge, dear, true, endless, bliss, and certainty.
* See also Maitr. Up. VII, p. 216.
* The M&dhyandinas read paroksheweva, but the commentator
explains iva by eva. See also Ait. Up. I, 3, 14.
4 Indra is called by the commentator Vau vanara, and his wife
Vira^\ This couple, in a waking state, is Vuva ; in sleep, Ta^asa.
* Sawstava, lit. the place where they sing praises together, that
is, where they meet. »
* Pravarawa may also mean hiding-place, retreat.
T Hita, a name frequently given to these na<fis ; see IV, 3, 20 ;
iSTMnd. Up. VI, 5, 3, comm.; Kaush. Up. IV, 20. See also Ka/<4a
Up. VI, 16.
Digitized by
Google
160 bk/hadArajvyaka-upanishad.
firmly within the heart. Through these indeed that
(food) flows on flowing, and he (the Tai^asa) receives
as it were purer food 1 than the corporeal Self (the
VaLrvanara).
4. 'His (the Tai^asa's) Eastern quarter are the
pra#as (breath) which go to the East;
' His Southern quarter are the pra#as which go
to the South ;
' His Western quarter are the pra»as which go to
the West ;
' His Northern quarter are the pra»as which go to
the North ;
' His Upper (Zenith) quarter are the pra#as which
go upward;
' His Lower (Nadir) quarter are the pra#as which
go downward ;
' All the quarters are all the prawas. And he (the
Atman in that state) can only be described by No 2 ,
no ! He is incomprehensible, for he cannot be com-
prehended ; he is undecaying, for he cannot decay ;
he is not attached, for he does not attach himself;
he is unbound, he does not suffer, he does not perish.
O Ganaka, you have indeed reached fearlessness,' —
thus said Ya^wavalkya.
Then kanaka said : ' May that fearlessness come
to you also who teachest us fearlessness. I bow to
you. Here are the Videhas, and here am I (thy
slave).'
1 Dvivedaganga explains that food, when it is eaten, is first of
all changed inio the coarse food, which goes away downward, and
into the subtler food. This subtler food is again divided into the
middle juice that feeds the body, and the finest, which is called
the red lump.
2 See Br/h. Up. II, 3, 6; IV, 9, 26.
Digitized by
Google
IV ADHYAYA, 3 BRAHMAiVA, I
Third BrAhma^a. °^
1. Ya^rcavalkya came to Ganaka Vaideha, and he
did not mean to speak with him 1 . But when formerly
1 The introduction to this Brahmawa has a very peculiar interest,
as showing the close coherence of the different portions which
together form the historical groundwork of the Upanishads. Ganaka
Vaideha and Yi^navalkya are leading characters in the BrtTiadi-
ra»yaka-upanishad, and whenever they meet they seem to converse
quite freely, though each retains his own character, and Ya^wa-
valkya honours Canaka as king quite as much as Ganaka honours
Y£§"wavalkya as a BrShmawa. Now in our chapter we read that
Y^-navalkya did not wish to enter on a discussion, but that kanaka
was the first to address him (purvam papraH^a). This was evi-
dently considered not quite correct, and an explanation is given,
that Ganaka took this liberty because on a former occasion Ya^wa-
valkya had granted him permission to address questions to him,
whenever he liked. It might be objected that such an explanation
looks very much like an after-thought, and we find indeed that in
India itself some of the later commentators tried to avoid the diffi-
culty by dividing the words sa mene na vadishya iti, into sam enena
vadishya iti, so that we should have to translate, ' Ya^wavalkya came
to Ganaka intending to speak with him.' (See Dvivedaganga's
Comm. p. 1 141.) This is, no doubt, a very ingenious conjecture,
which might well rouse the envy of European scholars. But it is
no more. The accents decide nothing, because they are changed
by different writers, according to their different views of what the
Pada text ought to be. What made me prefer the reading which
is supported by .Sankara and Dvivedaganga, though the latter
alludes to the other pada££Aeda, is that the tmesis, sam enena
vadishye, does not occur again, while sa mene is a common phrase.
But the most interesting point, as I remarked before, is that this
former disputation between (kanaka and Ya^wavalkya and the per-
mission granted to the King to ask any question he liked, is not a
mere invention to account for the apparent rudeness by which
Ya^jtavalkya is forced to enter on a discussion against his will,
but actually occurs in a former chapter. In .Satap. Br. XI, 6, 2, 10,
we read : tasmai ha Ya^ilavalkyo vara»» dadau; sa hova/ta, kama-
[iS] M
Digitized by
Google
1 62 bk/hadArajvyaka-upanishad.
Ganaka Vaideha and Ya^avalkya had a disputation
on the Agnihotra, YcLfwavalkya had granted him a
boon, and he chose (for a boon) that he might be
free to ask him any question he liked. Ya^wa-
valkya granted it, and thus the King was the first to
ask him a question.
2. ' Y4f«avalkya,' he said, 'what is the light of
man 1 ?'
Ya^avalkya replied : ' The sun, O King ; for,
having the sun alone for his light, man sits, moves
about, does his work, and returns.'
(kanaka Vaideha said : ' So indeed it is, O Ya^wa-
valkya.'
3. (kanaka Vaideha said : ' When the sun has set,
O Yif^avalkya, what is then the light of man?'
Y£f#avalkya replied : ' The moon indeed is his
light ; for, having the moon alone for his light, man
sits, moves about, does his work, and returns.'
(kanaka Vaideha said : ' So indeed it is, O Y&gna.-
valkya.'
4. kanaka Vaideha said : ' When the sun has set,
Ya^»avalkya, and the moon has set, what is the
light of man ?'
Y&^avalkya replied : ' Fire indeed is his light ;
praj-wa eva me tvayi Ya^navalkydsad iti, tato brahma (kanaka dsa.
This would show that kanaka was considered almost like a Brah-
mawa, or at all events enjoyed certain privileges which were sup-
posed to belong to the first caste only. See, for a different view,
Deussen, VedSnta, p. 203 ; Regnaud (Materiaux pour servir a l'his-
toire de la philosophic de l'lnde), Errata; and Sacred Books of
the East, vol. i, p. lxxiii.
1 Read ki/agyotir as a Bahuvrfhi. Purusha is difficult to trans-
late. It means man, but also the true essence of man, the soul,
as we should say, or something more abstract still, the person, as
1 generally translate it, though a person beyond the Ego.
Digitized by
Google
iv adhyAya, 3 brShmaata, 8. 163
for, having fire alone for his light, man sits, moves
about, does his work, and returns.'
5. <7anaka Vaideha said : ' When the sun has set,
O Ya^wavalkya, and the moon has set, and the fire
is gone out, what is then the light of man?'
Ya^»avalkya replied : ' Sound indeed is his light ;
for, having sound alone for his light, man sits, moves
about, does his work, and returns. Therefore, O
King, when one cannot see even one's own hand,
yet when a sound is raised, one goes towards it.'
kanaka Vaideha said : ' So indeed it is, O Ya^»a-
valkya.'
6. (kanaka Vaideha said : ' When the sun has set,
O Ya^avalkya, and the moon has set, and the fire
is gone out, and the sound hushed, what is then the
light of man ?'
Ya^wavalkya said : ' The Self indeed is his light;
for, having the Self alone as his light, man sits,
moves about, does his work, and returns.'
7. (kanaka Vaideha said : ' Who is that Self?'
Ya£$avalkya replied : 'He who is within the
heart, surrounded by the Pra»as x (senses), the person
of light, consisting of knowledge. He, remaining the \ )S
same, wanders along the two worlds 2 , as if 3 thinking,
as if moving. During sleep (in dream) he tran-
scends this world and all the forms of death (all that
falls under the sway of death, all that is perishable).
8. ' On being born that person, assuming his body,
1 Samipyalaksha»a saptami, Dvivedaganga. See Brih. Up. IV,
4, 22.
* In this world, while awake or dreaming; in the other wo Id,
while in deep sleep.
* The world thinks that he thinks, but in reality he does not, he
only witnesses the acts of buddhi, or thought
M 2
Digitized by
Google
A
164 BK/HADARA1VYAKA-UPANISHAD.
becomes united with all evils ; when he departs and
dies, he leaves all evils behind.
9. ' And there are two states for that person, the
, one here in this world, the other in the other world,
/ and as a third ' an intermediate state, the state of
sleep. When in that intermediate state, he sees
both those states together, the one here in this
>.' world, and the other in the other world. Now what-
*~> ever his admission to the other world may be,
having gained that admission, he sees both the evils
and the blessings 2 .
i 'And when he falls asleep, then after having
taken away with him the material from the whole
world, destroying 3 and building it up again, he
sleeps (dreams) by his own light In that state the
person is self-illuminated.
10. ' There are no (real) chariots in that state, no
horses, no roads, but he himself sends forth (creates)
chariots, horses, and roads. There are no blessings
there, no happiness, no joys, but he himself sends
forth (creates) blessings, happiness, and joys. There
1 There are really two sthanas or states only ; the place where
they meet, like the place where two villages meet, belongs to both,
but it may be distinguished as a third. Dvivedagahga (p. 1141)
uses a curious argument in support of the existence of another
world. In early childhood, he says, our dreams consist of the
impressions of a former world, later on they are filled with the
impressions of our senses, and in old age they contain visions of a
world to come.
s By works, by knowledge, and by remembrance of former
things ; see Brih. Up. IV, 4, 2.
* Dividing and separating the material, i. e. the impressions
received from this world. The commentator explains mStrS as a
portion of the impressions which are taken away into sleep.
' Destroying ' he refers to the body, which in sleep becomes sense-
less, and ' building up ' to the imaginations of dreams.
Digitized by
Google
IV ADHYAYA, 3 BRAHMAA'A, 1 4. 1 65
are no tanks there, no lakes, no rivers, but he him-
self sends forth (creates) tanks, lakes, and rivers.
He indeed is the maker.
11. ' On this there are these verses :
'After having subdued by sleep all that belongs
to the body, he, not asleep himself, looks down
upon the sleeping (senses). Having assumed light,
he goes again to his place, the golden person 1 , the
lonely bird, (i)
12. 'Guarding with the breath (pra«a, life) the
lower nest, the immortal moves away from the nest ;
that immortal one goes wherever he likes, the golden
person, the lonely bird. (2)
1 3. ' Going up and down in his dream, the god
makes manifold shapes for himself, either rejoicing
together with women, or laughing (with his friends),
or seeing terrible sights. (3)
14. ' People may see his playground 2 , but himself
no one ever sees. Therefore they say, " Let no one
wake a man suddenly, for it is not easy to remedy,
if he does not get back (rightly to his body)."
' Here some people (object and) say : " No, this
(sleep) is the same as the place of waking, for what
he sees while awake, that only he sees when asleep 3 ."
1 The Madhyandinas read paurusha, as an adjective to ekahawsa,
but Dvivedagahga explains paurusha as a synonym of purusha,
which is the reading of the Ka«vas.
2 Cf. Sufrutalll, 7,1.
3 I have translated this according to the commentator, who says :
* Therefore the Self is self-illuminated during sleep. But others
say the state of waking is indeed the same for him as sleep ; there
is no other intermediate place, different from this and from the
other world. . . . And if sleep is the same as the state of waking,
then is this Self not separate, not cause and effect, but mixed with
them, and the Self therefore not self-illuminated. What he means
Digitized by
Google
1 66 bu/hadArajvyaka-upanishad.
No, here (in sleep) the person is self-illuminated (as
we explained before).'
kanaka Vaideha said : 'I give you, Sir, a thousand.
Speak on for the sake of (my) emancipation.'
15. Ya^»avalkya said : ' That (person) having en-
joyed himself in that state of bliss (samprasada, deep
sleep), having moved about and seen both good and
evil, hastens back again as he came, to the place
from which he started (the place of sleep), to dream l .
And whatever he may have seen there, he is not
followed (affected) by it, for that person is not
attached to anything.'
kanaka Vaideha said : ' So it is indeed, Ya^«a-
is that others, in order to disprove the self-illumination, say that this
sleep is the same as the state of waking, giving as their reason that
we see in sleep or in dreams exactly what we see in waking. But
this is wrong, because the senses have stopped, and only when the
senses have stopped does one see dreams. Therefore there is no
necessity for admitting another light in sleep, but only the light
inherent in the Self. This has been proved by all that went before.'
Dr. Roer takes the same view in his translation, but Deussen (Ve-
dSnta, p. 205) takes an independent view, and translates : 'There-
fore it is said : It (sleep) is to him a place of waking only, for
what he sees waking, the same he sees in sleep. Thus this spirit
serves there for his own light.' Though the interpretations of
.Sankara and Dvivedaganga sound artificial, still Dr. Deussen's
version does not remove all difficulties. If the purusha saw in
sleep no more than what he had seen before in waking, then the
whole argument in favour of the independent action, or the inde-
pendent light of the purusha, would go ; anyhow it would be no
argument on Ya^wavalkya's side. See also note to paragraph 9,
before.
1 The M&dhyandinas speak only of his return from svapnanta
to buddhanta, from sleep to waking, instead of his going from
samprasada (deep sleep) to svapna (dream), from svapna to bud-
dhanta, and from buddhanta again to svapnanta, as- the Ka«vas
have it. In § 1 8 the Kawvas also mention svapnanta and buddhanta
only, but the next paragraph refers to sushupti.
Digitized by
Google
IV ADHYAYA, 3 BRAhMAJVA, 20. 1 67
valkya. I give you, Sir, a thousand. Speak on for
the sake of emancipation.'
16. Yct^avalkya said : ' That (person) having en-
joyed himself in that sleep (dream), having moved
about and seen both good and evil, hastens back
again as he came, to the place from which he started,
to be awake. And whatever he may have seen/
there, he is not followed (affected) by it, for that
person is not attached to anything.'
kanaka Vaideha said : 'So it is indeed, Y£f»a-
valkya. I give you, Sir, a thousand. Speak on for
the sake of emancipation.'
17. Y&f»avalkya said: 'That (person) having en-
joyed himself in that state of waking, having moved
about and seen both good and evil, hastens back
again as he came, to the place from which he started,
to the state of sleeping (dream).
18. 'In fact, as a large fish moves along the two
banks of a river, the right and the left, so does that
person move along these two states, the state of
sleeping and the state of waking.
19. 'And as a falcon, or any other (swift) bird,
after he has roamed about here in the air, becomes
tired, and folding his wings is carried to his nest, so
does that person hasten to that state where, when
asleep, he desires no more desires, and dreams no
more dreams.
20. ' There are in his body the veins called Hita,
which are as small as a hair divided a thousandfold,
full of white, blue, yellow, green, and red 1 . Now
1 Dvivedaganga explains that if phlegm predominates, qualified
by wind and bile, the juice in the veins is white ; if wind predomi-
nates, qualified by phlegm and bile, it is blue ; if bile predominates,
qualified by wind and phlegm, it is yellow ; if wind and phlegm
Digitized by
Google
1 68 b/uhadArajvyaka-upanishad.
when, as it were, they kill him, when, as it were,
they overcome him, when, as it were, an elephant
chases him, when, as it were, he falls into a well,
he fancies, through ignorance, that danger which he
(commonly) sees in waking. But when he fancies
that he is, as it were, a god, or that he is, as it
were, a king 1 , or " I am this altogether," that is his
highest world 2 .
21. 'This indeed is his (true) form, free from
desires, free from evil, free from fear 3 . Now as a
man, when embraced by a beloved wife, knows
nothing that is without, nothing that is within, thus
this person, when embraced by the intelligent (pra^wa)
Self, knows nothing that is without, nothing that is
within. This indeed is his (true) form, in which
his wishes are fulfilled, in which the Self (only) is
predominate, with little bile only, it is green ; and if the three ele-
ments are equal, it is red. See also Anandagiri's gloss, where
Surruta is quoted. Why this should be inserted here, is not quite
clear, except that in sleep the purusha is supposed to move about
in the veins.
1 Here, again, the commentator seems to be right, but his inter-
pretation does violence to the context. The dangers which a man
sees in his sleep are represented as mere imaginations, so is his
idea of being of god or a king, while the idea that he is all this
(aham eveda»« sarvaA, i. e. idaz» sarvam, see •Sahkara, p. 873, 1. 11)
is represented as the highest and real state. But it is impossible to
begin a new sentence with aham evedaw sarvam, and though it is
true that all the preceding fancies are qualified by iva, I prefer to
take deva and rag-an as steps leading to the sarv&tmatva.
2 The Madhyandinas repeat here the sentence from yatra supto
to pa^yati, from the end of § 19.
s The KS«va text reads ati^Manda apahatapapml .Sankara
explains atii^anda by ati^andam, and excuses it as svidhyaya-
dharmaA v&thzh. The Midhyandinas read ati&fcfondo, but place
the whole sentence where the Kawvas put aptak&mam &c, at the
end of § 21.
Digitized by
Google
IV ADHYAYA, 3 BRAHMAiVA, 23. 169
his wish, in which no wish is left, — free from any
sorrow x .
22. ' Then a father is not a father, a mother not
a mother, the worlds not worlds, the gods not gods,
the Vedas not Vedas. Then a thief is not a thief, a
murderer not a murderer 2 , a Jffandiila. 3 not a JCarca&la,
a Paulkasa* not a Paulkasa, a .Sramawa 6 not a Sra.-
ma«a, a Tapasa 6 not a Tapasa. He is not followed
by good, not followed by evil, for he has then over-
come all the sorrows of the heart 7 .
23. 'And when (it is said that) there (in the
Sushupti) he does not see, yet he is seeing, though
he does not see 8 . For sight is inseparable from the
1 The Ka«vas read fokantaram, the Madhyandinas arokantaram,
but the commentators arrive at the same result, namely, that it
means fokarunyam, free from grief. •Sahkara says: rokantaraw
soba&Midram rokarunyam ityeta£, ^okamadhyaman iti va; sar-
vathapy arokam. Dvivedaganga says : na vidyate joko 'ntare
madhye yasya tad arokantaraw (ra, Weber) fokarunyam.
2 Bhruwahan, varish/tfabrahmahanta.
8 The son of a Sudra father and a Brahmawa mother.
4 The son of a .Sudra father and a Kshatriya mother.
6 A mendicant.
6 A Vanaprastha, who performs penances.
7 I have translated as if the text were ananvSgataA pu»yena
ananvlgataA papena. We find anvagata used in a similar way in
§§ 15, 1 6, &c. But the KSravas read ananvagatam pu»yena anan-
vagatam papena, and .Sankara explains the neuter by referring it
to rupam (rupaparatvan napuwsakalihgam). The Madhyandinas, if
we may trust Weber's edition, read ananvagataA puwyenanvaga-
taA pipena. The second anvagata^ may be a mere misprint, but
Dvivedaganga seems to have read ananvagatam, like the Kdnvas,
for he says : ananvagatam iti rupavishayo napuwsakanirdera^.
8 This is the old Upanishad argument that the true sense is the
Self, and not the eye. Although therefore in the state of profound
sleep, where the eye and the other senses rest, it might be said
that the purusha does not see, yet he is a seer all the time, though
he does not see with the eye. The seer cannot lose his character
Digitized by
Google
1 70 BK/HADARAiVYAKA-UPANISHAD.
seer, because it cannot perish. But there is then
no second, nothing else different from him that he
could see.
24. 'And when (it is said that) there (in the
Sushupti) he does not smell, yet he is smelling, though
he does not smell. For smelling is inseparable from
the smeller, because it cannot perish. But there is
then no second, nothing else different from him that
he could smell.
25. 'And when (it is said that) there (in the
Sushupti) he does not taste, yet he is tasting, though
he does not taste. For tasting is inseparable from
the taster, because it cannot perish. But there is
then no second, nothing else different from him that
he could taste.
26. 'And when (it is said that) there (in the
Sushupti) he does not speak, yet he is speaking,
though he does not speak. For speaking is inse-
parable from the speaker, because it cannot perish.
But there is then no second, nothing else different
from him that he could speak.
27. 'And when (it is said that) there (in the
Sushupti) he does not hear, yet he is hearing, though
he does not hear. For hearing is inseparable from
the hearer, because it cannot perish. But there is
then no second, nothing else different from him that
he could hear.
28. 'And when (it is said that) there (in the
Sushupti) he does not think, yet he is thinking,
though he does not think. For thinking is inse-
parable from the thinker, because it cannot perish.
of seeing, as little as the fire can lose its character of burning, so
long as it is fire. The Self sees by its own light, like the sun, even
where there is no second, no object but the Self, that could be seen.
Digitized by
Google
IV ADHYAYA, 3 BRAHMAJVA, 3$. 171
But there is then no second, nothing else different
from him that he could think.
29. 'And when (it is said that) there (in the
Sushupti) he does not touch, yet he is touching,
though he does not touch. For touching is inse-
parable from the toucher, because it cannot perish.
But there is then no second, nothing else different
from him that he could think.
30. 'And when (it is said that) there (in the
Sushupti) he does not know, yet he is knowing,
though he does not know. For knowing is inse-
parable from the knower, because it cannot perish.
But there is then no second, nothing else different
from him that he could know.
31. 'When (in waking and dreaming) there is, as
it were, another, then can one see the other, then
can one smell the other, then can one speak to the
other, then can one hear the other, then can one
think the other, then can one touch the other, then
can one know the other. -»
32. 'An ocean 1 is that one seer, without any
duality ; this is the Brahma-world 2 , O King.' Thus
did Ya^-^avalkya teach him. This is his highest
goal, this is his highest success, this is his highest
world, this is his highest bliss. All other creatures
live on a small portion of that bliss.
SS' 'If a man is healthy, wealthy, and lord of
others, surrounded by all human enjoyments, that
1 Salila is explained as salilavat, like the ocean, the seer being
one like the ocean, which is one only. Dr. Deussen takes salila as
a locative, and translates it ' In dem Gewoge,' referring to Sveti-
jvatara-upanishad VI, 15.
2 Or this seer is the Brahma-world, dwells in Brahman, or is
Brahman.
Digitized by
Google
172 BR/HADARAJVTAKA-UPANISHAD.
is the highest blessing of men. Now a hundred
of these human blessings make one blessing of the
fathers who have conquered the world (of the fathers).
A hundred blessings of the fathers who have con-
quered this world make one blessing in the Gan-
dharva world. A hundred blessings in the Gandharva
world make one blessing of the Devas by merit
(work, sacrifice), who obtain their godhead by merit.
A hundred blessings of the Devas by merit make
one blessing of the Devas by birth, also (of) a
.Srotriya 1 who is without sin, and not overcome by
desire. A hundred blessings of the Devas by birth
make one blessing in the world of Pra^apati, also
(of) a .Srotriya who is without sin, and not overcome
by desire. A hundred blessings in the world of
Pra^apati make one blessing in the world of Brah-
man, also (of) a Srotriya who is without sin, and
not overcome by desire. And this is the highest
blessing 2 .
' This is the Brahma-world, O king,' thus spake
Y&fttavalkya.
kanaka Vaideha said : ' I give you, Sir, a thousand.
Speak on for the sake of (my) emancipation.'
Then Ya^avalkya was afraid lest the King,
having become full of understanding, should drive
him from all his positions 3 .
34. And Ya^ wavalkya said : ' That (person), having
enjoyed himself in that state of sleeping (dream),
1 An accomplished student of the Veda.
2 See Taitt. Up. II, 8, p. 59; Kh&nA. Up. VIII, 2, 1-10 ; Kaush.
Up. I, 3-5 ; Regnaud, II, p. 33 seq.
3 .Sankara explains that Ya^wavalkya was not afraid that his
own knowledge might prove imperfect, but that the king, having
the right to ask him any question he liked, might get all his know-
ledge from him.
Digitized by
Google
IV ADHYAYA, 4 BRAHMAiVA, I. I 73
having moved about and seen both good and bad,
hastens back again as he came, to the place from
which he started, to the state of waking \
35. ' Now as a heavy-laden carriage moves along
groaning, thus does this corporeal Self, mounted by
the intelligent , Self, move along groaning, when a
man is thus going to expire 2 .
36. 'And when (the body) grows weak through
old age, or becomes weak through illness, at that
time that person, after separating himself from his
members, as an Amra (mango), or Udumbara (fig),
or Pippala-fruit is separated from the stalk, hastens
back again as he came, to the place from which he
started, to (new) life.
37. 'And as policemen, magistrates, equerries,
and governors wait for a king who is coming back,
with food and drink, saying, " He comes back, he
approaches," thus do all the elements wait on him
who knows this, saying, " That Brahman comes, that
Brahman approaches."
38. 'And as policemen, magistrates, equerries, and
governors gather round a king who is departing,
thus do all the senses (pra#as) gather round the Self
at the time of death, when a man is thus going to
expire.'
(/'•• > J-" Fourth Brahma^a.
1. Ya/»avalkya continued : ' Now when that Self,
having sunk into weakness 8 , sinks, as it were, into
1 See § 17, before.
8 5ahkara seems to take ukk/ivisi as a noun. He writes:
yatraitad bhavati; etad iti kriyavLreshawam urdhv6£jWv£st yatror-
dhvoAWvasitvam asya bhavatttyarthaA.
8 In the Kaush. Up. Ill, 3, we read yatraitat purusha arto
Digitized by
Google
174 BR/HADARAtfYAKA-UPANISHAD.
unconsciousness, then gather those senses (pra#as)
around him, and he, taking with him those elements
of light, descends into the heart When that person
in the eye ' turns away, then he ceases to know any
forms.
2. '" He has become one," they say, " he does not
see 2 ." " He has become one," they say, "he does
not smell." " He has become one," they say, " he
does not taste." "He has become one," they say,
" he does not speak." "He has become one," they
say, " he does not hear." "He has become one," they
say, " he does not think." " He has become one,"
they say, " he does not touch." " He has become
one," they say, " he does not know." The point of his
heart 3 becomes lighted up, and by that light the Self
^ departs, either through the eye 4 , or through the
skull 6 , or through other places of the body. And
when he thus departs, life (the chief prawa) departs
after him, and when life thus departs, all the other
marishyan Sbalyam etya sammohati. Here SMlyam should cer-
tainly be dbalyam, as in the commentary; but should it not be
abalyam, as here. See also Brih. Up. Ill, 5, 1, note.
1 Alkshusha purusha is explained as that portion of the sun
which is in the eye, while it is active, but which, at the time of
death, returns to the sun.
2 Ekibhavati is probably a familiar expression for dying, but it
is here explained by .Sankara, and probably was so intended, as
meaning that the organs of the body have become one" with the
Self (lingStman). The same thoughts are found in the Kaush. Up.
Ill, 3, pra«a ekadhd bhavati.
* The point where the narfis or veins go out from the heart.
4 When his knowledge and deeds qualify him to proceed to the
sun. .Sankara.
6 When his knowledge and deeds qualify him to proceed to the
Brahma-world.
Digitized by
Google
IV ADHYAYA, 4 BRAHMA7VA, 4- 175
vital spirits (pra»as) depart after it. He is conscious,
and being conscious he follows 1 and departs.
' Then both his knowledge and his work take hold
of him, and his acquaintance with former things V
3. 'And as a caterpillar, after having reached the
end of a blade of grass, and after having made another
approach (to another blade) s , draws itself together
towards it, thus does this Self, after having thrown
off this body 4 and dispelled all ignorance, and after
making another approach (to another body), draw
himself together towards it.
4. 'And as a goldsmith, taking a piece of gold,
turns it into another, newer and more beautiful shape,
so does this Self, after having thrown off this body
1 This is an obscure passage, and the different text of the
Madhyandinas shows that the obscurity was felt at an early time.
The M&dhyandinas read : Szmgnimm anvavakr&mati sa esha gniJi
sxvignino bhavati. This would mean, 'Consciousness departs
after. He the knowing (Self) is self-conscious.' The Kdwvas read :
Savi^w&no bhavati, savi^wanam ev&nvavakr&mati. Roer translates :
'It is endowed with knowledge, endowed with knowledge it departs ;'
and he explains, with .Sankara, that the knowledge here intended is
such knowledge as one has in a dream, a knowledge of impressions
referring to their respective objects, a knowledge which is the
effect of actions, and not inherent in the self. Deussen translates :
'Sie (die Seele) ist von Erkenntnissart, und was von Erkenntnissart
ist, ziehet ihr nach.' The Persian translator evidently thought that
self-consciousness was implied, for he writes : ' Cum quovis corpore
addictionem sumat .... in illo corpore a ham est, id est, ego sum.'
2 This acquaintance with former things is necessary to explain
the peculiar talents or deficiencies which we observe in children.
The three words vidyi, karman, and purvapra^-M often go toge-
ther (see .Sankara on Brth. Up. IV, 3, 9). Deussen's conjecture,
apurvapra^wi, is not called for.
8 See Brih. Up. IV, 3, 9, a passage which shows how, difficult
it would be always to translate the same Sanskrit words by the
same words in English ; see also Brahmopanishad, p. 245.
* See Brih. Up. IV, 3, 9, and IV, 3, 13.
Digitized by
Google
1 76 bij/hadArajvyaka-upanishad.
and dispelled all ignorance, make unto himself an-
other, newer and more beautiful shape, whether it be
like the Fathers, or like the Gandharvas, or like the
Devas, or like Pra^apati, or like Brahman, or like
other beings.
5. ' That Self is indeed Brahman, consisting of
knowledge, mind, life, sight, hearing, earth, water,
wind, ether, light and no light, desire and no desire,
anger and no anger, right or wrong, and all things.
Now as a man is like this or like that 1 , according as
he acts and according as he behaves, so will he be : —
a man of good acts will become good, a man of bad
acts, bad. He becomes pure by pure deeds, bad by
bad deeds.
' And here they say that a person consists of
desires. And as is his desire, so is his will ; and as is
his will, so is his deed ; and whatever deed he does,
that he will reap.
6. 'And here there is this verse: "To whatever
object a man's own mind is attached, to that he goes
strenuously together with his deed ; and having
obtained the end (the last results) of whatever deed
he does here on earth, he returns again from that
world (which is the temporary reward of his deed) to
this world of action."
' So much for the man who desires. But as to
the man who does not desire, who, not desiring,
freed from desires, is satisfied in his desires, or
desires the Self only, his vital spirits do not depart
elsewhere, — being Brahman, he goes to Brahman.
7. ' On this there is this verse : " When all desires
1 The iti after adomaya is not clear to me, but it is quite clear
that a new sentence begins with tadyadetat, which Regnaud, II,
p. 101 and p. 139, has not observed.
Digitized by
Google
IV ADHYAYA, \ BRAHMAtfA, II. 1 77
which once entered his heart are undone, then does
the mortal become immortal, then he obtains Brah-
man."
' And as the slough of a snake lies on an ant-hill,
dead and cast away, thus lies this body ; but that dis-
embodied immortal spirit (pra«a, life) is Brahman
only, is only light'
Ganaka Vaideha said: 'Sir, I give you a thousand.'
8 \ ' On this there are these verses :
'The small, old path stretching far away 2 has been
found by me. On it sages who know Brahman move
on to the Svarga-loka (heaven), and thence higher
on, as entirely free 3 .
9. ' On that path they say that there is white, or
blue, or yellow, or green, or red * ; that path was found
by Brahman, and on it goes whoever knows Brahman,
and who has done good, and obtained splendour.
10. 'AH who worship what is not knowledge
(avidyS.) enter into blind darkness : those who delight
in knowledge, enter, as it were, into greater darkness 6 .
11. 'There are 6 indeed those unblessed worlds,
1 This may be independent matter, or may be placed again into
the mouth of Ya^wavalkya.
a Instead of vitata^, which perhaps seemed to be in contradiction
with a«u, there is a MSdhyandina reading vitara, probably intended
originally to mean leading across. The other adjective m&m-
spn'sh/a I cannot explain. Sahkara explains it by mim sprishtafi,
maya labdha^.
8 That this is the true meaning, is indicated by the various
readings of the Mddhyandinas, tena dhM apiyanti brahmavida
utkramya svargaw lokam ito vimukt&A. The road is not to lead
to Svarga only, but beyond.
4 See the colours of the veins as given before, IV, 3, 20.
6 See Va£\ Up. 9. .Sahkara in our place explains avidyd by
works, and vidyd by the Veda, excepting the Upanishads.
• See V&#. Up. 3 ; Ka/fla Up. I, 3.
[•53 N
Digitized by
Google
178 bk/hadAraatyaka-upanishad.
covered with blind darkness. Men who are ignorant
and not enlightened go after death to those worlds.
12. ' If a man understands the Self, saying, " I am
He," what could he wish or desire that he should
pine after the body 1 .
13. 'Whoever has found and understood the Self
that has entered into this patched-together hiding-
place 2 , he indeed is the creator, for he is the maker
of everything, his is the world, and he is the world
itself 3 .
14. ' While we are here, we may know this ; if not,
I am ignorant 4 , and there is great destruction. Those
who know it, become immortal, but others suffer pain
indeed.
15. ' If a man clearly beholds this Self as God,
and as the lord of all that is and will be, then he is
no more afraid.
16. ' He behind whom the year revolves with the
days, him the gods worship as the light of lights, as
immortal time.
1 7. ' He in whom the five beings 6 and the ether
rest, him alone I believe to be the Self, — I who
1 That he should be willing to suffer once more the pains
inherent in the body. The M&dhyandinas read jarrram anu
saw^aret, instead of sa%varet.
2 The body is meant, and is called deha from the root dih, to
knead together. Roer gives sawdehye gahane, which Sahkara
explains by sazsdehe. Poley has sa*sdeghe, which is the right
Ka«va reading. The Midhyandinas read sawdehe. Gahane might
be taken as an adjective also, referring to sawdehe.
8 .Sankara takes loka, world, for atma, self.
* I have followed Sankara in translating avediA by ignorant, but
the text seems corrupt.
* The five ^anas, i. e. the Gandharvas, Pitr*'s, Devas, Asuras, and
Rakshas; or the four castes with the Nish£das; or breath, eye,
ear, food, and mind.
Digitized by
Google
IV ADHYAYA, 4 BRAHMA2VA, 22. I 79
know, believe him to be Brahman ; I who am im-
mortal, believe him to be immortal.
18. 'They who know the life of life, the eye of the
eye, the ear of the ear, the mind of the mind, they
have comprehended the ancient, primeval Brahman 1 .
19. 'By the mind alone it is to be perceived 2 ,
there is in it no diversity. He who perceives therein
any diversity, goes from death to death.
20. ' This eternal being that can never be proved,
is to be perceived in one way only ; it is spotless,
beyond the ether, the unborn Self, great and eternal.
21.' Let a wise Brahmarca, after he has discovered
him, practise wisdom 3 . Let him not seek after many
words, for that is mere weariness of the tongue.
22. 'And he is that great unborn Self, who consists
of knowledge, is surrounded by the Pr4»as, the ether
within the heart*. In it there reposes the ruler of all,
the lord of all, the king of all. He does not become
greater by good works, nor smaller by evil works.
He is the lord of all, the king of all things, the pro-
tector of all things. He is a bank 6 and a boundary,
so that these worlds may not be confounded. Brah-
ma«as seek to know him by the study of the Veda, by
sacrifice, by gifts, by penance, by fasting, and he who
knows him, becomes a Muni. Wishing for that
world (for Brahman) only, mendicants leave their
homes.
' Knowing this, the people of old did not wish for
offspring. What shall we do with offspring, they said,
1 See Talavak. Up. I, 2.
* See Ka/fla Up. IV, 10-n.
* Let him practise abstinence, patience, &c, which are the means
of knowledge.
4 See Br/n. Up. IV, 3, 7. • See ATMnd. Up. VIII, 4.
N 2
Digitized by
Google
l80 B/i/HADARA2VYAKA-UPANISHAD.
we who have this Self and this world (of Brahman) 1 ?
And they, having risen above the desire for sons,
wealth, and new worlds, wander about as mendicants.
For desire for sons is desire for wealth, and desire
for wealth is desire for worlds. Both these are indeed
desires only. He, the Self, is to be described by No,
no 2 ! He is incomprehensible, for he cannot be com-
prehended; he is imperishable, for he cannot perish ;
he is unattached, for he does not attach himself;
unfettered, he does not suffer, he does not fail. Him
(who knows), these two do not overcome, whether
he says that for some reason he has done evil, or for
some reason he has done good — he overcomes both,
and neither what he has done, nor what he has
omitted to do, burns (affects) him.
23. ' This has been told by a verse (Rik) : " This
eternal greatness of the Brahma#a does not grow
larger by work, nor does it grow smaller. Let man
try to find (know) its trace, for having found (known)
it, he is not sullied by any evil deed."
' He therefore that knows it, after having become
quiet, subdued, satisfied, patient, and collected 8 , sees
self in Self, sees all as Self. Evil does not overcome
him, he overcomes all evil. Evil does not burn him,
he burns all evil. Free from evil, free from spots,
free from doubt, he becomes a (true) Brahma»a ; this
is the Brahma-world, O King,' — thus spoke Y£f»a-
valkya.
Ganaka Vaideha said : ' Sir, I give you the Videhas,
and also myself, to be together your slaves.'
24. This * indeed is the great, the unborn Self, the
1 Cf. Brih. Up. Ill, 5,1. "See Brih. Up. Ill, 9, 26 ; IV, 2, 4.
3 See Deussen, Vedanta, p. 85.
4 As described in the dialogue between (?anaka and Ya£»avalkya.
Digitized by
Google
iv adhyAya, 5 brAhmaya, 5. 181
strong 1 , the giver of wealth. He who knows this
obtains wealth.
25. This great, unborn Self, undecaying, undying,
immortal, fearless, is indeed Brahman. Fearless is
Brahman, and he who knows this becomes verily the
fearless Brahman.
Fifth BrAhmajva 2 .
1. Ya^-»avalkya had two wives, Mai trey 1 and ,
Kityayani. Of these Maitreyl was conversant with v 'i^X '
Brahman, but Katyiyanl possessed such knowledge Se.#4- >
only as women possess. And Ya^»avalkya, when f.tf '••> v
he wished to get ready for another state of life (when
he wished to give up the state of a householder, and
retire into the forest),
2. Said, 'Maitreyl, verily I am going away from
this my house (into the forest). Forsooth, let me
make a settlement between thee and that Katyayani.'
3. Maitreyl said : ' My Lord, if this whole earth,
full of wealth, belonged to me, tell me, should I be
immortal by it, or no ?'
' No,' replied Ya^«avalkya, ' like the life of rich
people will be thy life. But there is no hope of
immortal ity by wealth.'
4. And Maitreyl said: 'What should I do with
that by which I do not become immortal? What
my Lord knoweth 3 (of immortality), tell that clearly
to me.'
5. Y&^wavalkya replied: 'Thou who art truly dear
to me, thou hast increased what is dear (to me in
1 Annada is here explained as ' dwelling in all beings, and eating
all food which they eat.'
2 See before, II, 4.
3 The Kawva text has vettha instead of veda.
Digitized by
Google
1 82 BK/HADARAiVYAKA-UPANISHAD.
thee) 1 . Therefore, if you like, Lady, I will explain it
to thee, and mark well what I say.'
6. And he said : ' Verily, a husband is not dear,
that you may love the husband ; but that you may
love the Self, therefore a husband is dear.
' Verily, a wife is not dear, that you may love the
wife; but that you may love the Self, therefore a
wife is dear.
' Verily, sons are not dear, that you may love the
sons; but that you may love the Self, therefore sons
are dear.
'Verily, wealth is not dear, that you may love
wealth ; but that you may love the Self, therefore
wealth is dear.
' Verily, cattle 2 are not dear, that you may love
cattle; but that you may love the Self, therefore
cattle are dear.
' Verily, the Brahman-class is not dear, that you
may love the Brahman-class ; but that you may love
the Self, therefore the Brahman-class is dear.
'Verily, the Kshatra-class is not dear, that you
may love the Kshatra-class ; but that you may love
the Self, therefore the Kshatra-class is dear.
'Verily, the worlds are not dear, that you may
love the worlds; but that you may love the Self,
therefore the worlds are dear.
'Verily, the Devas are not dear, that you may
love the Devas; but that you may love the Self,
therefore the Devas are dear.
1 The Ka«va text has avn'dhat, which Sankara explains by
vardhitavati nirdhiritavaty asi. The Madhyandinas read avritat,
which the commentator explains by avartayat, vartitavaty asi.
9 Though this is added here, it is not included in the summing
up in § 6.
Digitized by
Google
IV ADHYAYA, 5 BRAhMAJVA, 8. 1 83
' Verily, the Vedas are not dear, that you may /
love the Vedas ; but that you may love the Self,
therefore the Vedas are dear.
' Verily, creatures are not dear, that you may love
the creatures ; but that you may love the Self, there-
fore are creatures dear.
' Verily, everything is not dear, that you may love
everything ; but that you may love the Self, there-
fore everything is dear.
' Verily, the Self is to be seen, to be heard, to be
perceived, to be marked, O Maitreyi ! When the
Self has been seen, heard, perceived, and known,
then all this is known.'
7. ' Whosoever looks for the Brahman-class else-
where than in the Self, was abandoned by the
Brahman-class. Whosoever looks for the Kshatra-
class elsewhere than in the Self, was abandoned by
the Kshatra-class. Whosoever looks for the worlds
elsewhere than in the Self, was abandoned by the
worlds. Whosoever looks for the Devas elsewhere
than in the Self, was abandoned by the Devas.
Whosoever looks for the Vedas elsewhere than in
the Self, was abandoned by the Vedas. Whosoever
looks for the creatures elsewhere than in the Self,
was abandoned by the creatures. Whosoever looks
for anything elsewhere than in the Self, was aban-
doned by anything.
' This Brahman-class, this Kshatra-class, these
worlds, these Devas, these Vedas, all these beings,
this everything, all is that Self.
8. ' Now as the sounds of a drum, when beaten,
cannot be seized externally (by themselves), but the
sound is seized, when the drum is seized, or the
beater of the drum ;
<w <-■
Digitized by
Google
184 BK/HADARAtfYAKA-UPANISHAD.
9. 'And as the sounds of a conch-shell, when blown,
cannot be seized externally (by themselves), but the
sound is seized, when the shell is seized, or the blower
of the shell ;
10. 'And as the sounds of a lute, when played,
cannot be seized externally (by themselves), but the
sound is seized, when the lute is seized, or the player
of the lute ;
11. 'As clouds of smoke proceed by themselves
out of lighted fire kindled with damp fuel, thus
verily, O Maitreyl, has been breathed forth from
this great Being what we have as Rig-veda., Ya^nr-
veda, Sama-veda, Atharvingirasas, Itihasa, Pura«a,
Vidya, the Upanishads, Slokas, Sutras, Anuvya-
khyanas, Vyakhyanas, what is sacrificed, what is
poured out, food, drink 1 , this world and the other
world, and all creatures. From him alone all these
were breathed forth.
12. 'As all waters find their centre in the sea,
all touches in the skin, all tastes in the tongue, all
smells in the nose, all colours in the eye, all sounds
in the ear, all percepts in the mind, all knowledge in
the heart, all actions in the hands, all movements in
the feet, and all the Vedas in speech, —
13. 'As a mass of salt has neither inside nor
outside, but is altogether a mass of taste, thus indeed
has that Self neither inside nor outside, but is alto-
gether a mass of knowledge ; and having risen from
out these elements, vanishes again in them. When
he has departed, there is no more knowledge (name),
I say, O Maitreyl,' — thus spoke Ya^»avalkya.
1 Explained by annadananimittam and peyadananimittaw dhar-
magitam. See before, IV, 1, 2.
Digitized by
Google
IV ADHYAYA, 6 BRAHMAYA, I. 1 85
14. Then Maitrey! said: 'Here, Sir, thou hast
landed me in utter bewilderment. Indeed, I do not
understand him.'
But he replied : ' O Maitrey!, I say nothing that is
bewildering. Verily, beloved, that Self is imperish-
able, and of an indestructible nature.
15. 'For when there is as it were duality, then
one sees the other, one smells the other, one tastes
the other, one salutes the other, one hears the other,
one perceives the other, one touches the other, one
knows the other ; but when the Self only is all this,
how should he see another, how should he smell
another, how should he taste another, how should
he salute another, how should he hear another, how
should he touch another, how should he know
another ? How should he know Him by whom he
knows all this ? That Self is to be described by No,
no 1 ! He is incomprehensible, for he cannot be
comprehended; he is imperishable, for he cannot
perish ; he is unattached, for he does not attach
himself; unfettered, he does not suffer, he does not
fail. How, O beloved, should he know the Knower ?
Thus, O Maitreyl, thou hast been instructed. Thus
far goes immortality.' Having said so, Ya^wavalkya
went away (into the forest).
Sixth Brahmaya.
1. Now follows the stem 2 :
1. (We) from Pautimashya,
2. Pautimashya from Gaupavana,
3. Gaupavana from Pautimashya,
1 See Brih. Up. Ill, 9, 26; IV, 2, 4 ; IV, 4, 22.
* The line of teachers and pupils by whom the Ya^wavalkya-
Digitized by
Google
1 86 B/t/HADARAtfYAKA-UPANISHAD.
4. Pautimashya from Gaupavana,
5. Gaupavana from Kausika,
6. Kaurika from Kau/wTinya,
7. Kau«dfinya from 5a«afilya,
8. S&ndi\ya. from Kaurika and Gautama,
9. Gautama
2. from Agniverya,
10. Agniveyya from Gargya,
11. Gargya from Gargya,
12. Gargya from Gautama,
13. Gautama from Saitava,
14. Saitava from Para^aryaya»a,
15. Para.raryaya#a from Gargyaya#a,
16. Gargyaya#a from Uddalakayana,
17. Uddalakayana from G&balayana,
18. (S&bilayana from Madhyandinayana,
19. Madhyandinayana from Saukarayawa,
20. Saukarayawa from Kashaya#a,
21. Kashiya»a from S&yakayana,
22. Sayakayana from Kaurikayani l ,
23. Kaurikayani
3. from Ghr/takaurika,
24. GhWtakau.rika from Parasaryaya#a,
ka«<fe was handed down. From 1-10 the Vzmsa, agrees with the
Va«fa at the end of II, 6.
The Madhyandina text begins with vayam, we, and proceeds to
1. 5"aurpa«ayya, 2. Gautama, 3. Vdtsya, 4. Pshurarya, &c, as in the
Madhukawrfa, p. 118, except in ro, where it gives (Jaivantayana for
Atreya. Then after 13. KauWinyayana, it gives 13. 14. the two
Kau«</inyas, 15. the Aur«avabhas, 16. Kaundinya, 17. Kauwiinya,
18. Kau«<finya and Agnivcrya, 19. Saitava, 20. Parifarya, 21. Gita-
karwya, 22. Bh&radva^a, 23. Bharadv&^a, Asurayawa, and Gautama,
24. Bharadva^a, 25. Valakakaiwika, 26. Kashayawa, 27. Saukara-
ya«a, 28. Traiva/ri, 29. Aupa^-andhani, 30. SayakSyana, 31. Kau«-
kayani, &c, as in the Ka»va text, from No. 22 to Brahman.
1 From here the Va»m agrees again with that given at the end
of II, 6.
Digitized by
Google
iv adhyAya, 6 brAhmajva, 3. 187
25. Parasaryayarca from Para^arya,
26. Parararya from <7atukaraya,
27. £atukar»ya from Asuraya#a and Yaska 1 ,
28. Asuraya»a from Trava#i,
29. Trava»i from Aupa^andhani,
30. Aupa^andhani from Asuri,
31. Asuri from Bharadvi^a,
32. Bharadva^a from Atreya,
33. Atreya from M&nti,
34. Ma#tf from Gautama,
35. Gautama from Gautama,
36. Gautama from Vatsya,
37. Vatsya from SkndMya.,
38. SiLndilya. from Kauorya Kapya,
39. Kaisorya Kapya from Kumaraharita,
40. Kumaraharita from Galava,
41. Galava from Vidarbht-kau^dfinya,
42. Vidarbhl - kau«<aTinya from Vatsanapat Ba-
bhrava,
43. Vatsanapit Babhrava from Pathi Saubhara,
44. Pathi Saubhara from Ayasya Angirasa,
45. Ayasya Angirasa from Abhuti Tvashfra,
46. Abhuti Tvash/ra from Vi^varupa Tvash/ra,
47. Visvarupa Tvashfra from Asvinau,
48. Arvinau from Dadhya^ Atharva«a,
49. Dadhya^ Atharvawa from Atharvan Daiva,
50. Atharvan Daiva from Mn'tyu Pradhvawsana,
51. Mrz'tyu Pradhva/#sana from Pradhvawsana,
52. Pradhva*»sana from Ekarshi,
53. Ekarshi from Vipra&tti 2 ,
54. Vipraiitti from Vyashtf,
1 The Mddhyandina text has, 1. Bharadva^a, 2. Bharadva^-a,
Asuraya«a, and Yaska.
* Vipragitti, M&dhyandina text.
Digitized by
Google
1 88 BK/HADARAtfYAKA-UPANISHAD.
55. Vyash/i from Sanaru,
56. Sanaru from Sanatana,
57. Sanatana from Sanaga,
58. Sanaga from Paramesh^in,
59. Paramesh/^in from Brahman,
60. Brahman is Svayambhu, self-existent.
Adoration to Brahman.
Digitized by
Google
V ADHYAYA, 2 BRAHMANA, 2. 1 89
FIFTH ADHYAYA.
First BrAhmaya 1 .
1. That (the invisible Brahman) is full, this (the
visible Brahman) is full 2 . This full (visible Brah-
man) proceeds from that full (invisible Brahman).
On grasping the fulness of this full (visible Brah-
man) there is left that full (invisible Brahman) 3 .
Om (is) ether, (is) Brahman *. ' There is the old
ether (the invisible), and the (visible) ether of the
atmosphere,' thus said Kauravyaya»lputra. This
(the Om) is the Veda (the means of knowledge),
thus the Brahma«as know. One knows through it
all that has to be known.
Second BrAhmawa.
1. The threefold descendants of Pra^apati, gods,
men, and Asuras (evil spirits), dwelt as Brahma^a-
rins (students) with their father Pra^apati. Having
finished their studentship the gods said: 'Tell us
(something), Sir.' He told them the syllable Da.
Then he said : ' Did you understand ?' They said :
' We did understand. You told us " Damyata," Be
subdued.' ' Yes,' he said, 'you have understood.'
2. Then the men said to him : 'Tell us something,
w
1 This is called a Khila, or supplementary chapter, treating of
various auxiliary means of arriving at a knowledge of Brahman.
2 Full and filling, infinite.
8 On perceiving the true nature of the visible world, there remains,
i.e. there is perceived at once, as underlying it, or as being it, the
invisible world or Brahman. This and the following paragraph
are called Mantras.
* This is explained by Sankara as meaning, Brahman is Kha, the
ether, and called Om, i.e. Om and Kha are predicates of Brahman.
Digitized by
Google
1 90 B.R7HADARAtfYAKA-UPAN ISHAD.
Sir.' He told them the same syllable Da. Then he
said : 'Did you understand ?' They said : 'We did
understand. You told us, " Datta," Give/ ' Yes/ he
said, ' you have understood/
3. Then the Asuras said to him : ' Tell us some-
thing, Sir/ He told them the same syllable Da.
Then he said : ' Did you understand ?' They said :
'We did understand. You told us, "Dayadham," Be
merciful/ ' Yes/ he said, ' you have understood.'
The divine voice of thunder repeats the same,
Da Da Da, that is, Be subdued, Give, Be merciful.
Therefore let that triad be taught, Subduing, Giving,
and Mercy.
Third BrAhma^a.
1. Pra^apati is the heart, is this Brahman, is all this.
The heart, hrt'daya, consists of three syllables. One
syllable is hrt, and to him who knows this, his own
people and others bring offerings 1 . One syllable is
da, and to him who knows this, his own people and
others bring gifts. One syllable is yam, and he who
knows this, goes to heaven (svarga) as his world.
Fourth BrAhmajva.
1. This (heart) indeed is even that, it was indeed
the true 2 (Brahman). And whosoever knows this
great glorious first-born as the true Brahman, he
conquers these worlds, and conquered likewise may
that (enemy) be 3 ! yes, whosoever knows this great
1 «S"ahkara explains that with regard to the heart, i.e. buddhi, the
senses are 'its own people,' and the objects of the senses 'the others.'
2 The true, not the truth ; the truly existing. The commentator
explains it as it was explained in II, 3, 1, as sat and tya, containing
both sides of the Brahman.
8 An elliptical expression, as explained by the commentator:
'May that one (his enemy) be conquered, just as that one was
Digitized by
Google
V ADHYAYA, 5 BRAHMAJVA, 2. 191
glorious first-born as the true Brahman; for Brahman
is the true.
Fifth BrAhmajva.
1. In the beginning this (world) was water.
Water produced the true \ and the true is Brah man.
'^Brahman produced Pra^apati 2 , Pra^apati the Devas
(gods). The Devas adore the true (satyam) alone.
This satyam consists of three syllables. One syl-
lable is sa, another t(i), the third 3 yam. The first
and last syllables are true, in the middle there is the
untrue *. This untrue is on both sides enclosed by
the true, and thus the true preponderates. The
untrue does not hurt him who knows this.
2. Now what is the true, that is the Aditya (the
sun), the person that dwells in yonder orb, and the
person in the right eye. These two rest on each
other, the former resting with his rays in the latter,
the latter with his pra«as (senses) in the former.
When the latter is on the point of departing this life,
he sees that orb as white only, and those rays (of the
sun) do not return to him.
conquered by Brahman. If he conquers the world, how much
more his enemy I' It would be better, however, if we could take
gita. in the sense of vadkn'ta or danta, because we could then go
on with ya evaw veda.
1 Here explained by the commentator asPutr&tmaka Hirawyagarbha.
* Here explained as Virag'.
s Satyam is often pronounced satiam, as trisyllabic. iSankara, how-
ever, takes the second syllable as t only, and explains the i after it as
an anubandha. The Ka»va text gives the three syllables as sa, ti, am,
which seems preferable; cf.^TAand. Up.VIII, 3, 5; Taitt. Up. II, 6.
4 This is explained by a mere play on the letters, sa and ya
having nothing in common with mntyu, death, whereas t occurs in
mn'tyu and annlta. Dvivedaganga takes sa and am as true, be-
cause they occur in satya and amn'ta, and not in mn'tyu, while ti
is untrue, because the t occurs in mntyu and anrrta.
Digitized by
Google
1 92 B/J/HADARAivTAKA-UPANISHAD.
3. Now of the person in that (solar) orb BhM is
the head, for the head is one, and that syllable is
one; Bhuva^ the two arms, for the arms are two,
and these syllables are two ; Svar the foot, for the
feet are two, and these syllables are two 1 . Its
secret name is Ahar (day), and he who knows this,
destroys (hanti) evil and leaves (^ahati) it.
4. Of the person in the right eye BhM is the head,
for the head is one, and that syllable is one; Bhuva^
the two arms, for the arms are two, and these sylla-
bles are two; Svar the foot, for the feet are two, and
these syllables are two. Its secret name is Aham
(ego), and he who knows this, destroys (hanti) evil
and leaves (^ahati) it.
Sixth Brahmajva.
1. That person, under the form of mind (manas),
being light indeed 2 , is within the heart, small like a
grain of rice or barley. He is the ruler of all, the
lord of all — he rules all this, whatsoever exists.
Seventh BrAhmaya.
1. They say that lightning is Brahman, because
lightning (vidyut) is called so from cutting off
(vidanat) 3 . Whosoever knows this, that lightning
is Brahman, him (that Brahman) cuts off from evil,
for lightning indeed is Brahman.
1 Svar has to be pronounced suvar.
2 Bh&featya must be taken as one word, as the commentator
says, bha eva satyaw sadbhava/4 svarupaw yasya so 'yam bhi^satyo
bhasvara^.
3 From do, avakhawdane, to cut ; the lightning cutting through the
darkness of the clouds, as Brahman, when known, cuts through
the darkness of ignorance.
Digitized by
Google
V ADHYAYA, IO BRAHMAivA, I. 1 93
Eighth BrAhmawa.
1. Let him meditate on speech as a cow. Her
four udders are the words Svahi, Vasha/, Hanta,
and Svadha \ The gods live on two of her udders,
the Svaha and the Vasha/, men on the Hanta, the
fathers on the Svadha. The bull of that cow is
breath (pra«a), the calf the mind.
Ninth BrAhmajva.
1. Agni Vai.rvanara is the fire within man by
which the food that is eaten is cooked, i.e. digested.
Its noise is that which one hears, if one covers one's
ears. When he is on the point of departing this
life, he does not hear that noise.
Tenth Brahmaata.
1. When the person goes away from this world,
he comes to the wind. Then the wind makes room
for him, like the hole of a carriage wheel, and
through it he mounts higher. He comes to the sun.
Then the sun makes room for him, like the hole
of a Lambara 2 , and through it he mounts higher.
He comes to the moon. Then the moon makes
room for him, like the hole of a drum, and through
it he mounts higher, and arrives at the world where
there is no sorrow, no snow 8 . There he dwells
eternal years.
1 There are two udders, the Svaha and Vasha/, on which the
gods feed, i. e. words with which oblations are given to the gods.
With Hanta they are given to men, with Svadha to the fathers.
8 A musical instrument.
* The commentator explains hima by bodily pain, but snow is
much more characteristic.
[15] O
Digitized by
Google
194 b-r/hadAranyaka-upanishad.
Eleventh BrAhmana.
i. This is indeed the highest penance, if a man,
laid up with sickness, suffers pain 1 . He who knows
this, conquers the highest world.
This is indeed the highest penance, if they carry
a dead person into the forest 2 . He who knows this,
conquers the highest world.
This is indeed the highest penance, if they place a
dead person on the fire 3 . He who knows this, con-
quers the highest world.
Twelfth BrAhmaata.
i. Some say that food is Brahman, but this is not
so, for food decays without life (pra#a). Others say
that life (pra«a) is Brahman, but this is not so, for life
dries up without food. Then these two deities (food
and life), when they have become one, reach that
highest state (i.e. are Brahman). Thereupon Pra-
trtda. said to his father : ' Shall I be able to do any
good to one who knows this, or shall I be able to do
him any harm 4 ?' The father said to him, beckoning
with his hand : ' Not so, O Pratrzda ; for who could
reach the highest state, if he has only got to the
oneness of these two ?' He then said to him : ' Vi ;
1 The meaning is that, while he is suffering pain from illness, he
should think that he was performing penance. If he does that,
he obtains the same reward for his sickness which he would have
obtained for similar pain inflicted on himself for the sake of per-
forming penance.
2 This is like the penance of leaving the village and living in
the forest.
8 This is like the penance of entering into the fire.
* That is, is he not so perfect in knowledge that nothing can
harm him?
Digitized by
Google
V ADHYAYA, 1 3 BRAHMAJVA, 4. 195
verily, food is Vi, for all these beings rest (vish^ani)
on food.' He then said : ' Ram ; verily, life is Ram,
for all these beings delight (ramante) in life. All
beings rest on him, all beings delight in him wh o
knows this.'
Thirteenth Brahma^a.
1 . Next follows the Uktha 1 . Verily, breatt
is Uktha, for breath raises up (utthapayati) all this.
From him who knows this, there is raised a wise son,
knowing the Uktha ; he obtains union and oneness
with the Uktha.
2. Next follows the Ya^us. Verily, breath is
Ya^ois, for all these beings are joined in breath 2 .
For him who knows this, all beings are joined to
procure his excellence; he obtains union and one-
ness with the Ya^Tis.
3. Next follows the Saman. Verily, breath is the
Saman, for all these beings meet in breath. For him
who knows this, all beings meet to procure his excel-
lence ; he obtains union and oneness with the Saman.
4. Next follows the Kshatra. Verily, breath is
the Kshatra, for breath is Kshatra, i.e. breath pro-
tects (trayate) him from being hurt (kshawito^).
He who knows this, obtains Kshatra (power), which
requires no protection ; he obtains union and one-
ness with Kshatra 3 .
1 Meditation on the hymn called uktha. On the uktha, as the
principal part in the Mahavrata, see Kaush.Up. Ill, 3 ; Ait. Ar. II, 1, 2.
The uktha, yajns, sanian, &c. are here represented as forms under
which pra«a or life, and indirectly Brahman, is to be meditated on.
4 Without life or breath nothing can join anything else ; there-
fore life is called ya^us, as it were yugns.
8 Instead of Kshatram atram, another -Sakha, i. e. the Madhyan-
dina, reads Kshatramatram, which Dvivedaganga explains as, he
O 2
Digitized by
Google
I96 B/i/HADARAiVYAKA-UPANISHAD.
Fourteenth Brahmajva.
1. The words Bhumi (earth), Antariksha (sky), and
Dyu 1 (heaven) form eight syllables. One foot of the
Gayatri consists of eight syllables. This (one foot)
of it is that (i. e. the three worlds). And he who thus
knows that foot of it, conquers as far as the three
worlds extend.
2. The JZtkas, the Ya^uwshi, and the Samani form
eight syllables. One foot (the second) of the Gayatri
consists of eight syllables. This (one foot) of it is
that (i. e. the three Vedas, the ./v%-veda, Ya^tir-veda,
and Sama-veda). And he who thus knows that foot
of it, conquers as far as that threefold knowledge
extends.
3. The Pra«a (the up-breathing), the Apana (the
down-breathing), and the Vyina (the back-breathing)
form eight syllables. One foot (the third) of the
Gayatri consists of eight syllables. This (one foot)
of it is that (i.e. the three vital breaths). And he who
thus knows that foot of it, conquers as far as there
is anything that breathes. And of that (Gayatri,
or speech) this indeed is the fourth (turiya), the
bright (darcata) foot, shining high above the skies 2 .
What is here called turiya (the fourth) is meant for
^aturtha (the fourth); what is called darsatam
pad am (the bright foot) is meant for him who is
as it were seen (the person in the sun) ; and what
is called parora/as (he who shines high above the
obtains the nature of the Kshatra, or he obtains the Kshatra which
protects (Kshatram Strain).
1 Dyu, nom. Dyaus, must be pronounced Diyaus.
a Parora^as, masc, should be taken as one word, like paroksha,
viz. he who is beyond all ra^as, all visible skies.
<^
Digitized by LjOOQ lC
V ADHYAYA, 1 4 BRAHMAJVA, 5. 1 97
skies) is meant for him who shines higher and higher
above every sky. And he who thus knows that foot
of the Gayatrl, shines thus himself also with hap-
piness and glory.
4. That Gayatrl (as described before with its three
feet) rests on that fourth foot, the bright one, high
above the sky. And that again rests on the True (sa-
tyam), and the True is the eye, for the eye is (known
to be) true. And therefore even now, if two persons
come disputing, the one saying, I saw, the other,
I heard, then we should trust the one who says, I
saw. And the True again rests on force (balam),
and force is life (pra#a), and that (the True) rests on
life 1 . Therefore they say, force is stronger than the
True. Thus does that Gayatrl rest with respect to
the self (as life). That Gayatrl protects (tatre) the
vital breaths (gayas) ; the gayas are the pra«as
(vital breaths), and it protects them. And because
it protects (tatre) the vital breaths (gayas), therefore
it is called Gayatrl. And that Savitrl verse which
the teacher teaches 2 , that is it (the life, the priwa, and
indirectly the Gayatrl) ; and whomsoever he teaches,
he protects his vital breaths.
5. Some teach that Savitrl as an Anush/ubh 8 verse,
saying that speech is Anush/ubh, and that we teach
. ' Sankara understood the True (satyam) by tad, not the balam,
the force.
2 The teacher teaches his pupil, who is brought to him when
eight years old, the Sdvitrl verse, making him repeat each word,
and each half verse, till he knows the whole, and by teaching him
that Savitri, he is supposed to teach him really the prd«a, the life,
as the self of the world.
8 The verse would be, Rig-veda V, 82, 1 :
Tat savitur vrmimahe vaya« devasya bhqganam
Sitsh/Aam sarvadhitamaw turam bhagasya dhfmahi.
Digitized by
Google
198 bk/hadArayyaka-upanishad:
that speech. Let no one do this, but let him teach
the Gayatri as Savitrl 1 . And even if one who knows
this receives what seems to be much as his reward
(as a teacher), yet this is not equal to one foot of the
Gayatri.
6. If a man (a teacher) were to receive as his fee
these three worlds full of all things, he would obtain
that first foot of the Gayatri. And if a man were to
receive as his fee everything as far as this threefold
knowledge extends, he would obtain that second
foot of the Gayatri. And if a man were to receive
as his fee everything whatsoever breathes, he would
obtain that third foot of the Gayatri. But 'that fourth
bright foot, shining high above the skies 2 ', cannot
be obtained by anybody — whence then could one
receive such a fee ?
7. The adoration 3 of that (Gayatri) :
' O Gayatri, thou hast one foot, two feet, three
feet, four feet 4 . Thou art footless, for thou art not
known. Worship to thy fourth bright foot above
the skies.' If 6 one (who knows this) hates some
1 Because Gayatri represents life, and the pupil receives life when
he learns the Gayatri.
2 See before, § 2.
* Upasthana is the act of approaching the gods, irpo<rKvvt)<ns,
Angehen.withaview of obtaining a request. Here the application
is of two kinds, abhi&irika, imprecatory against another, and.
abhyudayika, auspicious for oneself. The former has two formulas,
the latter one. An upasthana is here represented as effective, if
connected with the G&yatri.
4 Consisting of the three worlds, the threefold knowledge, the
threefold vital breaths, and the fourth foot, as described before.
5 I have translated this paragraph very freely, and differently
from »Sahkara. The question is, whether dvishy&t with iti can be
used in the sense of abhiHra, or imprecation. If not, I do not see
how the words should be construed. The expression yasmS upa-
Digitized by
Google
V ADHYAYA, 1 5 BRAHMAiVA, 2. 199
one and says, ' May he not obtain this,' or ' May this
wish not be accomplished to him,' then that wish is
not accomplished to him against whom he thus prays,
or if he says, ' May I obtain this.'
8. And thus Ganaka Vaideha spoke on this point
to Buafila A.rvatara.rvi l : 'How is it that thou who
spokest thus as knowing the Gayatrf, hast become
an elephant and earnest me ?' He answered : 'Your
Majesty, I did not know its mouth. Agni, fire, is
indeed its mouth ; and if people pile even what seems
much (wood) on the fire, it consumes it all. And
thus a man who knows this, even if he commits what
seems much evil, consumes it all and becomes pure,
clean, and free from decay and death.'
Fifteenth Brahmajva.
1. 2 The face of the True (the Brahman) is covered
with a golden disk 3 . Open that, O Pushan 4 , that we
may see the nature of the True 6 .
2. O Pushan, only seer, Yama (judge), Surya (sun),
son of Pra^apati 6 , spread thy rays and gather them !
tish/Aate is rightly explained by Dvivedagahga, yadartham evam
upatish/iate.
1 AjvatarasySfvasytpatyam, -Sankara.
2 These verses, which are omitted here in the Madhyandina
text, are found at the end of the Va^asaneyi-upanishad 15-18.
They are supposed to be a prayer addressed to Aditya by a dying
person.
8 Mahtdhara on verse 17 : 'The face of the true (purusha in the
sun) is covered by a golden disk.' .Sankara explains here mukha,
face, by mukhyaw svarupam, the principal form or nature.
4 Pushan is here explained as a name of Savitr;', the sun ; like-
wise all the names in the next verse.
• Cf. Maitr. Up. VI, 35.
• Of Ifvara or Hirawyagarbha.
Digitized by
Google
200 Bil/HADARAJVYAKA-UPANISHAD.
The light which is thy fairest form, I see it. I am
what he is (viz. the person in the sun).
3. Breath to air and to the immortal ! Then this
my body ends in ashes. Om ! Mind, remember !
Remember thy deeds ! Mind, remember ! Remem-
ber thy deeds x !
4. Agni, lead us on to wealth (beatitude) by a good
path 2 , thou, O God, who knowest all things! Keep
far from us crooked evil, and we shall offer thee the
fullest praise ! (Rv. I, 189, 1.)
1 The Vi^asaneyi-sawhita' reads : Om, krato smara, k/*be smara,
kr*taw smara. Uva/a holds that Agni, fire, who has been wor-
shipped in youth and manhood, is here invoked in the form of
mind, or that kratu is meant for sacrifice. 'Agni, remember me!
Think of the world! Remember my deeds!' K/»be is explained
by Mahfdhara as a dative of k/t'p, k/z'p meaning loka, world, what
is made to be enjoyed (kalpyate bhogiya).
2 Not by the Southern path, the dark, from which there is a
fresh return to life.
Digitized by
Google
VI ADHYAYA, I BRAHMAATA, 5. 201
SIXTH ADHYAYA.
First BrAhmajva 1 .
1. Hari^, Om. He who knows the first and
the best, becomes himself the first and the best
among his people. Breath is indeed the first and
the best. He who knows this, becomes the first
and the best among his people, and among whom-
soever he wishes to be so.
2. He who knows the richest 2 , becomes himself
the richest among his people. Speech is the richest.
He who knows this, becomes the richest among his
people, and among whomsoever he wishes to be so.
3. He who knows the firm rest, becomes himself
firm on even and uneven ground. The eye indeed
is the firm rest, for by means of the eye a man
stands firm on even and uneven ground. He who
knows this, stands firm on even and uneven ground.
4. He who knows success, whatever desire he
desires, it succeeds to him. The ear indeed is suc-
cess. For in the ear are all these Vedas successful.
He who knows this, whatever desire he desires, it
succeeds to him.
5. He who knows the home, becomes a home
of his own people, a home of all men. The mind
1 This Brahma«a, also called a Khila (p. 10 10, 1. 8 ; p. 1029,
1. 8), occurs in the M&dhyandina-.rakha XIV, 9, 2. It should be
compared with the A'Mndogya-upanishad V, 1 (Sacred Books of
the East, vol. i, p. 72) ; also with the Ait. Ar. II, 4 ; Kaush. Up.
Ill, 3 ; and the Pr&rwa Up. II, 3.
* Here used as a feminine, while in the Khini. Up. V, 1, it is
vasish/Aa.
Digitized by
Google
202 BK/HADARAJvYAKA-UPANISHAD.
indeed is the home. He who knows this, becomes
a home of his own people and a home of all men.
6. He who knows generation 1 , becomes rich in
offspring and cattle. Seed indeed is generation. He
who knows this, becomes rich in offspring and cattle.
7. These Pra#as (senses), when quarrelling toge-
ther as to who was the best, went to Brahman 2
and said : ' Who is the richest of us ?' He replied :
' He by whose departure this body seems worst, he
is the richest.'
8. The tongue (speech) departed, and having
been absent for a year, it came back and said :
' How have you been able to live without me ?'
They replied : ' Like, unto people, not speaking with
the tongue, but breathing with breath, seeing with
the eye, hearing with the ear, knowing with the
mind, generating with seed. Thus we have lived.'
Then speech entered in.
9. The eye (sight) departed, and having been
absent for a year, it came back and said : ' How
have you been able to live without me ?' They re-
plied : ' Like blind people, not seeing with the eye,
but breathing with the breath, speaking with the
tongue, hearing with the ear, knowing with the
mind, generating with seed. Thus we have lived.'
Then the eye entered in.
10. The ear (hearing) departed, and having been
absent for a year, it came back and said : ' How
have you been able to live without me ? ' They re-
plied : ' Like deaf people, not hearing with the ear,
1 This is wanting in thcATMnd. Up. Roer and Poley read Prag-apati
for pra^ati. MS. 1. 0. 375 has pra^ati.MS. 1. 0. 1973 pra^apati.
8 Here we have Pra^apati, instead of Brahman, in the KAiad.
Up. ; also wesh/Aa instead of vasish/>ia.
Digitized by
Google
VI ADHYAYA, I BRAHMAJVA, 1 4. 203
but breathing with the breath, speaking with the
tongue, seeing with the eye, knowing with the mind,
generating with seed. Thus we have lived.' Then
the ear entered in.
11. The mind departed, and having been absent
for a year, it came back and said : ' How have you
been able to live without me ?' They replied : 'Like
fools, not knowing with their mind, but breathing
with the breath, seeing with the eye, hearing with
the ear, generating with seed. Thus we have lived.'
Then the mind entered in.
12. The seed departed, and having been absent
for a year, it came back and said : ' How have you
been able to live without me ? ' They replied :
'Like impotent people, not generating with seed,
but breathing with the breath, seeing with the eye,
hearing with the ear, knowing with the mind. Thus
we have lived.' Then the seed entered in.
13. The (vital) breath, when on the point of de-
parting, tore up these senses, as a great, excellent
horse of the Sindhu country might tare up the pegs
to which he is tethered. They said to him : ' Sir,
do not depart. We shall not be able to live without
thee.' He said : ' Then make me an offering/
They said : ' Let it be so.'
14. Then the tongue said : ' If I am the richest,
then thou art the richest by it.' The eye said :
' If I am the firm rest, then thou art possessed of
firm rest by it.' The ear said : ' If I am success,
then thou art possessed of success by it.' The mind
said : ' If I am the home, thou art the home by
it.' The seed said : ' If I am generation, thou art
possessed of generation by it.' He said : ' What shall
be food, what shall be dress for me ?'
Digitized by
Google
204 BK/HADARAiVYAKA-UPANISHAD.
They replied: ' Whatever there is, even unto dogs,
worms, insects, and birds 1 , that is thy food, and water
thy dress. He who thus knows the food of Ana (the
breath) 2 , by him nothing is eaten that is not (proper)
food, nothing is received that is not (proper) food.
•Srotriyas (Vedic theologians) who know this, rinse
the mouth with water when they are going to eat, and
rinse the mouth with water after they have eaten,
thinking that thereby they make the breath dressed
(with water).'
Second BrAhmajva 8 .
i. .Svetaketu Aru«eya went to the settlement of
the Pa#£alas. He came near to Pravaha«a Cai-
vali *, who was walking about (surrounded by his
men). As soon as he (the king) saw him, he said :
' My boy !' Svetaketu replied : ' Sir !'
Then the king said : ' Have you been taught by
your father ! ' ' Yes,' he replied.
2. The king said : ' Do you know how men, when
they depart from here, separate from each other?'
' No,' he replied.
' Do you know how they come back to this
world?' ' No,' he replied 6 .
1 It may mean, every kind of food, such as is eaten by dogs,
worms, insects, and birds.
2 We must read, with MS. I.0. 375, anasyannam, not annasyan-
nam, as MS. I.0. 1973, Roer, and Poley read Weber has the right
reading, which is clearly suggested by .Oand. Up. V, 2, 1.
* See JOand. Up.V, 3 ; Muir, Original Sanskrit Texts, I, 433;
Deussen,Vedanta, p. 390. The commentator treats this chapter as
a supplement, to explain the ways that lead to the pitr«loka and
the devaloka.
4 The MSS. I. O. 375 and 1973 give Gaivali, others (raibali.
He is a Kshatriya sage, who appears also in iTMnd. Up. I, 8, 1, as
silencing Brahma«as.
6 The same question is repeated in Roer's edition, only substi-
Digitized by
Google
VI ADHYAYA, 2 BRAHMAiVA, 4. 205
' Do you know how that world does never become
full with the many who again and again depart
thither ?' ' No,' he replied.
' Do you know at the offering of which libation
the waters become endowed with a human voice
and rise and speak ?' ' No,' he replied.
' Do you know the access to the path leading to
the Devas and to the path leading to the Fathers,
i. e. by what deeds men gain access to the path lead-
ing to the Devas or to that leading to the Fathers ?
For we have heard even the saying of a ifo'shi : " I
heard of two paths for men, one leading to the
Fathers, the other leading to the Devas. On those
paths all that lives moves on, whatever there is be-
tween father (sky) and mother (earth)." '
►SVetaketu said : ' I do not know even one of all
these questions.'
3. Then the king invited him to stay and accept
his hospitality. But the boy, not caring for hospi-
tality, ran away, went back to his father, and said :
' Thus then you called me formerly well-instructed !'
The father said : ' What then, you sage ?' The son
replied : ' That fellow of a Ra^anya asked me five
questions, and I did not know one of them.'
' What were they ? ' said the father.
' These were they,' the son replied, mentioning
the different heads.
4. The father said : ' You know me, child, that
whatever I know, I told you. But come, we shall
go thither, and dwell there as students.'
' You may go, Sir,' the son replied.
tuting sampadyante for Spadyante. The MSS. I. O. 375 and 1973
do not support this.
Digitized by
Google
206 bk/hadArajvyaka-upanishad.
Then Gautama went where (the place of) Prava-
ha#a Gaivali was, and the king offered him a seat,
ordered water for him, and gave him the proper
offerings. Then he said to him : ' Sir, we offer a
boon to Gautama.'
5. Gautama said : ' That boon is promised to
me; tell me the same speech which you made in
the presence of my boy.'
6. He said : 'That belongs to divine boons, name
one of the human boons.'
7. He said : ' You know well that I have plenty of
gold, plenty of cows, horses, slaves, attendants, and
apparel ; do not heap on me 1 what I have already in
plenty, in abundance, and superabundance.'
The king said : ' Gautama, do you wish (for in-
struction from me) in the proper way ? '
Gautama replied : ' I come to you as a pupil.'
In word only have former sages (though Brah-
mans) come as pupils (to people of lower rank), but
Gautama actually dwelt as a pupil (of Praviha«a,
who was a Ra^anya) in order to obtain the fame of
having respectfully served his master 2 .
1 Abhyavadanya is explained as niggardly, or unwilling to give,
and derived from vadanya, liberal, a-vadanya, illiberal, and abhi,
towards. This, however, is an impossible form in Sanskrit
VadSnya means liberal, and stands for avadanya, this being
derived from avadina, lit. what is cut off, then a morsel, a gift. In
abhyavadanya the original a reappears, so that abhyavadanya
means, not niggardly, but on the contrary, liberal, i. e. giving more
than is required. Avadinya has never been met with in the sense
of niggardly, and though a rule of Pawini sanctions the formation of
a-vad&nya, it does not say in what sense. Abhyavada in the sense
of cutting off in addition occurs in Satap. Br. II, 5, 2, 40 ; avadanaw
karoti, in the sense of making a present, occurs Maitr. Up.VI, 33.
2 The commentator takes the opposite view. In times of
distress, he says, former sages, belonging to a higher caste, have
Digitized by
Google
VI ADHYAYA, 2 BRAHMAATA, II. 207
8. The king said : ' Do not be offended with us,
neither you nor your forefathers, because this know-
ledge has before now never dwelt with any Brah-
ma«a'. But I shall tell it to you, for who could
refuse you when you speak thus ?
9. ' The altar (fire), O Gautama, is that world
(heaven) 2 ; the fuel is the sun itself, the smoke his
rays, the light the day, the coals the quarters, the
sparks the intermediate quarters. On that altar
the Devas offer the .sraddha libation (consisting of
water 3 ). From that oblation rises Soma, the king
(the moon).
10. ' The altar, O Gautama, is Par^anya (the god
of rain) ; the fuel is the year itself, the smoke the
clouds, the light the lightning, the coals the thunder-
bolt, the sparks the thunderings. On that altar the
Devas offer Soma, the king (the moon). From that
oblation rises rain.
1 1. ' The altar, O Gautama, is this world 4 ; the
fuel is the earth itself, the smoke the fire, the light
the night, the coals the moon, the sparks the stars.
On that altar the Devas offer rain. From that
oblation rises food.
submitted to become pupils to teachers of a lower caste, not, how-
ever, in order to learn, but simply in order to live. Therefore
Gautama also becomes a pupil in name only, for it would be
against all law to act otherwise. See Gautama, Dharma-sutras
VII, 1, ed. Stenzler; translated by Btthler, p. 209.
1 Here, too, my. translation is hypothetical, and differs widely
from .Sankara.
2 Cf. Z/iand. Up.V, 4.
8 Deussen translates : ' In diesem Feuer opfern die Gotter den
Glauben.'
4 Here a distinction is made between aya*» loka, this world, and
pn'thivt, earth, while in the Kh&nA. Up. aya** loka is the earth,
asau loka the heaven.
Digitized by
Google
208 b«/hadAraayaka-upanishad.
12. 'The altar, O Gautama, is man; the fuel the
opened mouth, the smoke the breath, the light the
tongue, the coals the eye, the sparks the ear. On
that altar the Devas offer food. From that oblation
rises seed.
13. ' The altar, O Gautama, is woman 1 . On that
altar the Devas offer seed. From that oblation
rises man. He lives so long as he lives, and then
when he dies,
14. ' They take him to the fire (the funeral pile),
and then the altar-fire is indeed fire, the fuel fuel,
the smoke smoke, the light light, the coals coals, the
sparks sparks. In that very altar-fire the Devas
offer man, and from that oblation man rises, brilliant
in colour.
1 5. ' Those who thus know this (even GWhasthas),
and those who in the forest worship faith and the
True 2 (Brahman Hira«yagarbha), go to light (ar-
i£is), from light to day, from day to the increasing
half, from the increasing half to the six months
when the sun goes to the north, from those six
months to the world of the Devas (Devaloka), from
the world of the Devas to the sun, from the sun to the
place of lightning. When they have thus reached the
place of lightning a spirit 8 comes near them, and leads
them to the worlds of the (conditioned) Brahman.
In these worlds of Brahman they dwell exalted for
ages. There is no returning for them.
1 Tasyd upastha eva samil, lomani dhumo, yonir ar£ir, yad
anta^karoti te 'ngara, abhinancUl visphulihga^.
2 Sahkara translates, ' those who with faith worship the True,'
and this seems better.
3 ' A person living in the Brahma-world, sent forth, i. e. created,
by Brahman, by the mind,' Ankara. 'Der ist nicht wie ein
Mensch,' Deussen, p. 392.
Digitized by
Google
VI ADHYAYA, 3 BRAHMAiVA, I. 209
1 6. ' But they who conquer the worlds (future ^
states) by means of sacrifice, charity, and austerity,
go to smoke, from smoke to night, from night to the
decreasing half of the moon, from the decreasing
half of the moon to the six months when the sun
goes to the south, from these months to the world
of the fathers, from the world of the fathers to the
moon. Having reached the moon, they become food,
and then the Devas feed on them there, as sacrificers
feed on Soma, as it increases and decreases 1 . But
when this (the result of their good works on earth)
ceases, they return again to that ether, from ether
to the air, from the air to rain, from rain to the
earth. And when they have reached the earth, they
become food, they are offered again in the altar-fire,
which is man (see \ 1 1), and thence are born in the
fire of woman. Thus they rise up towards the worlds,
and go the same round as before.
' Those, however, who know neither of these two
paths, become worms, birds, and creeping things.'
Third BrAhmajva 2 .
1. If a man wishes to reach greatness (wealth for
performing sacrifices), he performs the upasad rule
during twelve days 3 (i. e. he lives on small quantities
of milk), beginning on an auspicious day of the light
half of the moon during the northern progress of the
sun, collecting at the same time in a cup or a dish
1 See note 4 on .ffMnd. Up.V, 10, andDeussen,Vedanta,p. 393.
.Sahkara guards against taking apyayasv£pakshfyasva as a Mantra.
A similar construction is^iyasva mr/yasva, see ATMnd. Up. V, io, 8.
2 Madhyandina text, p. 1 103 ; cf. KhinA. Up.V, 2, 4-8 ; Kaush.
Up. II, 3.
3 Yasmin pu«ye 'nukufe 'hni karma £ikirshati tata/4 prak puwya-
ham evarabhya dvad&raham upasadvratt.
[i5] P
Digitized by
Google
r
2 1 BK/HADARAiVYAKA-UPANISHAD.
made of Udumbara wood all sorts of herbs, includ-
ing fruits. He sweeps the floor (near the house-
altar, avasathya), sprinkles it, lays the fire, spreads
grass round it according to rule \ prepares the clari-
fied butter (a^ya), and on a day, presided over by a
male star (nakshatra), after having properly mixed
the Mantha 2 (the herbs, fruits, milk, honey, &c),
he sacrifices (he pours a^ya into the fire), saying 3 :
' O <7atavedas, whatever adverse gods there are in
thee, who defeat the desires of men, to them I offer
this portion ; may they, being pleased, please me
with all desires.' Svaha !
' That cross deity who lies down 4 , thinking that
all things are kept asunder by her, I worship thee
as propitious with this stream of ghee.' Svaha !
2. He then says, Svaha to the First, Svaha to
the Best, pours ghee into the fire, and, throws what
remains into the Mantha (mortar).
He then says, Svaha to Breath, Svaha to her who
is the richest, pours ghee into the fire, and throws
what remains into the Mantha (mortar).
He then says, Svaha to Speech, Svaha to the
Support, pours ghee into the fire, and throws what
remains into the Mantha (mortar).
He then says, Svaha to the Eye, Svaha to Success,
pours ghee into the fire, and throws what remains
into the Mantha (mortar).
He then says, Svaha to the Ear, Svaha to the
1 As the whole act is considered sm&rta, not jrauta, the order to
be observed (ivrit) is that of the sthalfpdka.
2 Dravadravye prakshipta mathitSA saktava^ is the explanation
of Mantha, given in Gaimin. N. M.V. p. 406.
3 These verses are not explained by .Sahkara, and they are
absent in the -fiTMnd. Up. V, 2, 6, 4.
4 The Madhyandinas read nipadyase.
Digitized by
Google
VI ADHYAYA, 3 BRAHMANA, 3. 211
Home, pours ghee into the fire, and throws what
remains into the Mantha (mortar).
He then says, Svaha to the Mind, Svaha to Off-
spring, pours ghee into the fire, and throws what
remains into the Mantha (mortar).
He then says, Svaha to Seed, pours ghee into the fire,
and throws what remains into the Mantha (mortar).
3. He then says, Svaha to Agni (fire), pours ghee
into the fire, and throws what remains into the
Mantha (mortar).
He then says, Svaha to Soma, pours ghee into
the fire, and throws what remains into the Mantha
(mortar).
He then says, BhM (earth), Svaha, pours ghee
into the fire, and throws what remains into the
Mantha (mortar).
He then says, Bhuva^ (sky), Svaha, pours ghee
into the fire, and throws what remains into the
Mantha (mortar).
He then says, Sva^ (heaven), Svaha, pours ghee
into the fire, and throws what remains into the
Mantha (mortar).
He then says, Bhur, Bhuva^, Sva^, Svaha, pours
ghee into the fire, and throws what remains into the
Mantha (mortar).
He then says, Svaha to Brahman (the priesthood),
pours ghee into the fire, and throws what remains
into the Mantha (mortar).
He then says, Svaha to Kshatra (the knighthood),
pours ghee into the fire, and throws what remains
into the Mantha (mortar).
He then says, Svaha to the Past, pours ghee into
the fire, and throws what remains into the Mantha
(mortar).
p 2
Digitized by
Google
2 I 2 B-R/IIADARAJVYAKA-UPANISHAD.
He then says, Svaha to the Future, pours ghee
into the fire, and throws what remains into the
Mantha (mortar).
He then says, Svahi to the Universe, pours ghee
into the fire, and throws what remains into the
Mantha (mortar).
He then says, Svaha to all things, pours ghee into
the fire, and throws what remains into the Mantha
(mortar).
He then says, Svaha to Prafipati, pours ghee
into the fire, and throws what remains into the
Mantha (mortar).
4. Then he touches it (the Mantha, which is dedi-
cated to Pra«a, breath), saying : ' Thou art fleet (as
breath). Thou art burning (as fire). Thou art full
(as Brahman). Thou art firm (as the sky). Thou
art the abode of all (as the earth). Thou hast been
saluted with Hin (at the beginning of the sacrifice
by the prastotrz). Thou art saluted with Hih (in
the middle of the sacrifice by the prastotrz). Thou
hast been sung (by the udgatrz at the beginning of
the sacrifice). Thou art sung (by the udgatrz in the
middle of the sacrifice). Thou hast been celebrated
(by the adhvaryu at the beginning of the sacrifice).
Thou art celebrated again (by the agnldhra in the
middle of the sacrifice). Thou art bright in the wet
(cloud). Thou art great. Thou art powerful. Thou
art food (as Soma). Thou art light (as Agni, fire,
the eater). Thou art the end. Thou art the ab-
sorption (of all things).'
5. Then he holds it (the Mantha) forth, saying :
' Thou 1 knowest all, we know thy greatness. He is
1 These curious words a - marasi a" mawhi te mahi are not
explained by Sankara. Anandagiri explains them as I have trans-
Digitized by
Google
VI ADHYAYA, 3 BRAHMAtfA, 7. 213
indeed a king, a ruler, the highest lord. May that
king, that ruler make me the highest lord.'
6. Then he eats it, saying: 'Tat savitur vare-
wyam 1 (We meditate on that adorable light) — The
winds drop honey for the righteous, the rivers drop
honey, may our plants be sweet as honey! BhM
(earth) Svaha !
' Bhargo devasya dhimahi (of the divine
Savitrz) — May the night be honey in the morning,
may the air above the earth, may heaven, our father,
be honey ! Bhuva^ (sky) Svaha !
'Dhiyo yo naA pro^odayat (who should rouse
our thoughts) — May the tree be full of honey, may
the sun be full of honey, may our cows be sweet like
honey ! Sva^ (heaven) Svaha ! '
He repeats the whole Savitri verse, and all the
verses about the honey, thinking, May I be all this !
Bhur, Bhuva^, Sva^, Svaha ! Having thus swal-
lowed all, he washes his hands, and sits down behind
the altar, turning his head to the East. In the
morning he worships Aditya (the sun), with the
hymn, ' Thou art the best lotus of the four quarters,
may I become the best lotus among men.' Then
returning as he came, he sits down behind the altar
and recites the genealogical list 2 .
7. Uddalaka Aru«i told this (Mantha-doctrine) to
his pupil VcLfasaneya Ya^wavalkya, and said : ' If
a man were to pour it on a dry stick, branches would
grow, and leaves spring forth.'
lated them. They correspond to ' amo namasy ami hi te sarvam
idam' in the KhinA. Up. V, 2, 6, 6. The Madhyandinas read :
£mo 'sy imaw hi te mayi, sa hi ra^-d, &c. Dvivedagahga translates :
' thou art the knower, thy knowledge extends to me.'
1 Rv. Ill, 62, 10.
8 This probably refers to the list immediately following.
Digitized by
Google
2 1 4 B/tfHADAR AATY AK A-U PANISH AD.
8. Va/asaneya Y&^wavalkya told the same to his
pupil Madhuka Paingya, and said : ' If a man were to
pour it on a dry stick, branches would grow, and
leaves spring forth.'
9. Madhuka Paingya told the same to his pupil
A'ula Bhagavitti, and said: 'If a man were to pour
it on a dry stick, branches would grow, and leaves
spring forth.'
10. ./Tula Bhagavitti told the same to his pupil
Canaki Ayasthu#a, and said : ' If a man were to
pour it on a dry stick, branches would grow, and
leaves spring forth.'
11. Canaki Ayasthu«a told the same to his pupil
Satyakama (Cabala, and said : ' If a man were to
pour it on a dry stick, branches would grow, and
leaves spring forth.'
1 2. Satyakama Cabala told the same to his pupils,
and said : ' If a man were to pour it on a dry stick,
branches would grow, and leaves spring forth.'
Let no one tell this * to any one, except to a son
or to a pupil 2 .
13. Four things are made of the wood of the
Udumbara tree, the sacrificial ladle (sruva), the cup
(^amasa), the fuel, and the two churning sticks.
There are ten kinds of village (cultivated) seeds,
viz. rice and barley (brihiyavas), sesamum and kidney-
beans (tilamashas), millet and panic seed (a^upriyan-
gavas), wheat (godhumas), lentils (masuras), pulse
(khalvas), and vetches (khalakulas 3 ). After having
1 The Mantha-doctrine with the prawadanrana. Comm.
2 It probably means to no one except to one's own son and
to one's own disciple. Cf. .Svet. Up. VI, 22.
8 I have given the English names after Roer, who, living in India,
had the best opportunity of identifying the various kinds of plants
here mentioned. The commentators do not help us much. .Sankara
Digitized by
Google
VI ADHYAYA, \ BRAHMAiVA, 2. 2 1 5
ground these he sprinkles them with curds (dadhi),
honey, and ghee, and then offers (the proper por-
tions) of clarified butter x (&£ya).
Fourth Brahma^a*.
i. The earth is the essence of all these things,
water is the essence of the earth, plants of water,
flowers of plants, fruits of flowers, man of fruits,
seed of man.
2. And Pra^apati thought, let me make an abode
for him, and he created a woman (.Satarupa).
Ta#z 3 snshAradha upista, tasmat striyam adha
upaslta. Sa etam pra«^aw grava^am atmana eva
samudaparayat, tenainim abhyasre^at
says that in some places Priyangu (panic seed or millet) is called
Kaftgu ; that Khalva, pulse, is also called Nishpava and Valla, and
Khalakula, vetches, commonly Kulattha. Dvivedagahga adds that
A«u is called in Guzerat Moriya, Priyangu Kahgu, Khalva, as
nishpava, Valla, and Khalakula Kulattha.
1 According to the rules laid down in the proper Gn'hya-sutras.
2 This Brahma»a is inserted here because there is supposed
to be some similarity between the preparation of the .Srrmantha
and the Putramantha, or because a person who has performed the
•SWmantha is fit to perform the Putramantha. Thus .Sankara
says: Pr&wadawinaA jrimanthaw karma kn'tavataA putramanthe
'dhikaraA. Yada putramanthaw £ikirshati tada" .rrimanthaOT kr/'tva
r/tukalaw? patnya^ (brahmaiaryewa) pratikshata iti.
3 I have given those portions of the text which did not admit of
translation into English, in Sanskrit. It was not easy, however, to
determine always the text of the Ka«va-s&kM. Poley's text is not
always correct, and Roer seems simply to repeat it. -Sankara's com-
mentary, which is meant for the Ka«va text, becomes very short
towards the end of the Upanishad. It is quite sufficient for the pur-
pose of a translation, but by no means always for restoring a correct
text. MS. Wilson 369, which has been assigned to theKawva-jakha,
and which our Catalogue attributes to the same school, gives the
MSdhyandina text, and so does MS. Mill 108. I have therefore col-
lated two MSS. of the India Office, which Dr. Rost had the kindness
to select for me, MS. 375 and MS. 1973, which I call A. and B.
Digitized by
Google
2 1 6 b-r/hadArajvyaka-upanishad;
3. Tasya vedir upastho, lomani barlm, £arm&-
dhishavawe, samiddho 1 madhyatas, tau mushkau.
Sa yavan ha vai va^apeyena ya^amanasya loko
bhavati tavan asya loko bhavati ya eva#z vidvan
adhopahasaw iaraty a sa 2 strln&m sukrzta#z vrmkte
'tha ya idam avidvan adhopahasa#z iaraty asya
striya^ sukrz'taw vringate.
4. Etad dha sma vai tadvidvan Uddalaka Aruwir
ahaitad dha sma vai tadvidvan Nako Maudgalya ahai-
tad dha sma vai tadvidvan Kumaraharita aha, bahavo
marya brahma«ayana 3 nirindriya visukfz'to'smal lokat
prayanti 4 ya idam avidvawzso 'dhopahasaw ^arantiti.
Bahu va 5 idam suptasya va^agrato va reta^ skandati,
5. Tad abhimrzVed anu va mantrayeta yan me
'dya reta^ przthivim askantsld yad oshadhir apy
asarad yad apa^, idam aham tad reta adade punar
mam aitv indriyam punas te^a^ punar bhaga^, punar
agnayo 6 dhishwya yathasthanaw kalpantam, ity
anamikangushAfcabhyam adayantarewa stanau v&
bhruvau va nimrm^yat 7 .
6. If a man see himself in the water 8 , he should
1 Roer reads samidho, but -Sankara and Dvivedagahga clearly
presuppose samiddho, which is in A. and B.
2 Roer has &sim sa stri«Sm, Poley, A. and B. have asiw strtwSm.
•Sahkara (MS. Mill 64) read £ sa stri«am, and later on asya striyaA,
though both Roer and Poley leave out the a here too (a asyeti Medzh).
3 Brahma«ayanaA, the same as brahmabandhavaA, i. e. Brahmans
by descent only, not by knowledge.
4 Narakaw ga^MantityarthaA. Dvivedagahga.
6 Bahu va svalpaw va.
6 The Madhyandina text has agnayo, and Dvivedagahga explains
it by dhishwyi agnayaA .rarlrasthita^. Poley and Roer have punar
agnir dhishwya, and so have A. and B.
7 Nirmrzgyat, A. ; mmringy&t, B.
8 Dvivedagahga adds, retoyonav udake reta^si^as tatra svaMAi-
yidarrane prayaj&ttam aha.
Digitized by
Google
VI ADHYAYA, 4 BRAHMAiVA, IO. 1TJ
recite the following verse : ' May there be in me
splendour, strength, glory, wealth, virtue.'
She is the best of women whose garments are
pure \ Therefore let him approach a woman whose
garments are pure, and whose fame is pure, and
address her.
7. If she do not give in 2 , let him, as he likes, bribe
her (with presents). And if she then do not give in,
let him, as he likes, beat her with a stick or with his
hand, and overcome her 8 , saying: 'With manly
strength and glory I take away thy glory,' — and
thus she becomes unglorious *.
8. If she give in, he says : ' With manly strength
and glory I give thee glory,' — and thus they both
become glorious.
9. Sa yam i&Met kamayeta meti tasyam arthaw
nish/aya 5 mukhena mukhaw sandhayopastham asya
abhimrwya ^aped angadangat sambhavasi hrzdayad
adhi ^yase, sa tvam angakashayo 6 'si digdhavid-
dham 7 iva madayemam amum maylti 8 .
10. Atha yam i/&6^en na garbha^ dadhtteti 9 tas-
yam arthaw nish&ya mukhena mukhaw sandhaya-
bhiprawyapanyad indriye«a te retasa reta adada ity
areta 10 eva bhavati.
1 Triratravrata/» kr/tva £aturtha 'hni snatam.
2 Instead of connecting kamam with dady&t, Dvivedaganga
explains it by yath&sakti.
3 Atikram, scil. maithunaya. * BandhyS durbhaga\
8 Nish/aya, A. B.; nish/Mya, Roer, Poley; the same in § 10.
8 Sa tvam angana/ra kashayo raso 'si.
7 Vishaliptataraviddham mr/'glm iva.
8 Madayeti is the reading of the Mddhyandina text. Poley, Roer,
A. and B. read midayem&m amum mayiti. Anandagiri has mrz'gim
ivamum m&diy&m striyam me madaya madvaja/H kurv ityarthaA.
Dvivedaganga explains madayeti.
Rupabhraawayauvanahanibhayat. J0 Agarbhiwi.
9
Digitized by
Google
2 i 8 b/s/hadarawyaka-upanishad.
ii. Atha yam \&Med garbha#* dadhlteti tasyam
arthaw nish/aya mukhena mukha/# sandhayapa-
nyabhipra#yad indriye#a te retasa reta adadhamlti
garbhi«y eva bhavati.
12. Now again, if a man's wife has a lover and
the husband hates 'him, let him (according to rule) 1
place fire by an unbaked jar, spread a layer of arrows
in inverse order 2 , anoint these three arrow-heads 3
with butter in inverse order, and sacrifice, saying :
' Thou hast sacrificed in my fire, I take away thy up
and down breathing, I here *.'
' Thou hast sacrificed in my fire, I take away thy
sons and cattle, I here.'
' Thou hast sacrificed in my fire, I take away thy
sacred and thy good works, I here.'
' Thou hast sacrificed in my fire, I take away thy
hope and expectation, I here.'
He whom a Brahma»a who knows this curses, de-
parts from this world without strength and without
good works. Therefore let no one wish even for
sport with the wife of a .Srotriya 6 who knows this, for
he who knows this, is a dangerous enemy.
1 3. When the monthly illness seizes his wife, she
1 AvasathySgnim eva pra^valya.
2 Yasfomigram dakshi«agra/» va yatha syat tatha.
8 Tisra^ is left out by Roer and Poley, by A. and B.
4 I have translated according to the Ka«va text, as far as it could
be made out. As there are four imprecations, it is but natural that
tisra^ should be left out in the Kl»va text. It is found in the
Madhyandina text, because there the imprecations are only three in
number, viz. the taking away of hope and expectation, of sons and
cattle, and of up and down breathing. Instead of asav iti, which is
sufficient, the Midhyandina text has as&v iti nama gr*h#ati, and both
Anandagiri and Dvivedaganga allow the alternative, atmanaA jatror
va nama grihniti, though asau can really refer to the speaker only.
5 Roer reads dvarewa * Poley, A. and B. dare«a; the Madhyan-
Digitized by
Google
VI ADHYAYA, 4 BRAHMAtfA, 1 8. 2^0.
should for three days not drink from a metal vessel,
and wear a fresh dress. Let no VWshala or VWshali
(a 6"udra man or woman) touch her. At the end of
the three days, when she has bathed, the husband
should make her pound rice \
14. And if a man wishes that a white son should
be born to him, and that he should know one Veda,
and live to his full age, then, after having prepared
boiled rice with milk and butter, they should both
eat, being fit to have offspring.
15. And if a man wishes that a reddish 2 son with
tawny eyes should be born to him, and that he
should know two Vedas, and live to his full age,
then, after having prepared boiled rice with coagu-
lated milk and butter, they should both eat, being
fit to have offspring.
16. And if a man wishes that a dark son should
be born to him with red eyes, and that he should
know three Vedas, and live to his full age, then, after
having prepared boiled rice with water and butter,
they should both eat, being fit to have offspring.
1 7. And if a man wishes that a learned daughter
should be born to him, and that she should live to
her full age, then, after having prepared boiled rice
with sesamum and butter, they should both eat,
being fit to have offspring.
18. And if a man wishes that a learned son should
be born to him, famous, a public man, a popular
speaker, that he should know all the Vedas, and that
dinas g&y&yL .Sankara, according to Roer, interprets dvarewa, but
it seems that darewa is used here in the singular, instead of the
plural. See PSraskara Gnhya-sutras I, 1 1.
1 To be used for the ceremony described in § 1 4 seq.
2 Kapilo var«ataA pihgalaA pingaksha^.
Digitized by
Google
2 20 B/JJHADARAiVYAKA-UPANISHAD.
he should live to his full age, then, after having pre-
pared boiled rice with meat and butter, they should
both eat, being fit to have offspring. The meat
should be of a young or of an old bull.
19. And then toward morning, after having, ac-
cording to the rule of the Sthalipaka (pot-boiling),
performed the preparation of the A^ya (clarified
butter 1 ), he sacrifices from the Sthalipaka bit by bit,
saying : ' This is for Agni, Svaha ! This is for Anu-
mati, Svaha ! This is for the divine Savitri, the true
creator, Svaha !' Having sacrificed, he takes out the
rest of the rice and eats it, and after having eaten,
he gives it to his wife. Then he washes his hands,
fills a water-jar, and sprinkles her thrice with it,
saying : ' Rise hence, O Visvavasu 2 , seek another
blooming girl, a wife with her husband.'
20. Then he embraces her, and says : 'I am Ama
(breath), thou art Sa (speech) 3 . Thou art Si (speech),
I am Ama (breath). I am the Saman, thou art the
Rik \ I am the sky, thou art the earth. Come, let
us strive together, that a male child may be
begotten V
1 Kaxxxm .rrapayitvi.
2 Name of a Gandharva, as god of love. See Rig-veda X, 85, 22.
Dvivedaganga explains the verse differently, so that the last words
imply, I come together with my own wife.
3 Because speech is dependent on breath, as the wife is on the
husband. See #Mnd. Up. I, 6, 1.
* Because the S&ma-veda rests on the Rig-veda.
5 This is a verse which is often quoted and explained. It occurs
in the Atharva-veda XIV, 71, as 'amo 'ham asmi si tvaw*, samd-
ham asmy rik tvam, dyaur aham pr/thivi tvam; tdv iha sam
bhaviva pra^im i ^anayivahai.'
Here we have the opposition between amaA and si, while in
the Ait. Brihmawa VIII, 27, we have amo 'ham asmi sa tvam,
giving amaA in opposition to sa. It seems not unlikely that this
Digitized by
Google
VI ADHYAYA, 4 BRAHMAiVA, 23. 221
21. Athasya tirti vihapayati, vifihithatf* dyavaprz-
thivi iti tasyam arthaw nish^aya mukhena mukhaw
sandhaya trir enam anulomam 1 anumarshri, Vishmir
yoniw kalpayatu, Tvash/a rupa#i pimsatu, asiw^atu
Pra^apatir Dhata garbhaw dadhatu te. Ga.tbb.am
dhehi Sintvali, garbhaw dhehi pmhushAike, garbhaw
te A$vinau devav adhattam pushkarasra^au.
22. Hirawmayl ara»l yabhya*# nirmanthatam 2 arvi-
nau 8 , tarn te garbha#2 havamahe* dasame masi
sutave. Yathagnigarbha pmhivi, yatha dyaur in-
dre»a garbhi«t, vayur disam yatha garbha evaw
garbhaw dadhami te 'sav iti 6 .
23. Soshyant!m 6 adbhirabhyukshati. Yatha vayu^ 7
pushkari«!w sami^ayati sarvata^, eva te garbha
e^atu sahavaitu ^arayu«4. Indrasyayaw vra^a/i
krztaA sarga/a^ 8 sapariiraya^ 9 , tarn indra nir^ahi
garbhe«a savaraw 10 saheti.
was an old proverbial formula, and that it meant originally no more
than ' I am he, and thou art she.' But this meaning was soon for-
gotten. In the A'Mnd. Up. I, 6, i, we find si explained as earth,
ama as fire (Sacred Books of the East, vol. i, p. 13). In the Ait.
Brahmawa s£ is explained as Rik, ama as Saman. I have therefore
in our passage also followed the interpretation of the commentary,
instead of rendering it, ' I am he, and thou art she ; thou art she,
and I am he.'
1 Anulomam, murdhanam arabhya pSdantam.
2 Nirmathitavantau. 8 Arvinau devau, Madhyandina text.
* Dadhamahe, Madhyandina text Instead of sutave, A. has
suyate, B. sutaye.
6 Iti nama gr«h«ati, Madhyandina text. .Sankara says, asav iti
tasya^. Anandagiri says, asav iti patyur vi nirdejaA ; tasyi nama
gn'hwatiti purve«a sambandhaA. Dvivedaganga says, ante bharta-
sav aham iti sv&tmano nima gnhwdti, bhirydyi v&.
* See Paraskara Gr»"hya-sutra 1, 16 seq. 7 V&tah, M.
8 Arga</aya nirodhena saha vartamanaA s£rga</aA, Dvivedaganga.
* SaparurayaA, parorayewa parivesh/anena ^arayuwa sahitaA,
Dvivedaganga.
10 Savaram is the reading given by Poley, Roer, A. and B.
Digitized by
Google
I
222 B/lTHADARAiVYAKA-UPANISHAD.
24 1 . When the child is born, he prepares the fire,
places the child on his lap, and having poured pn-
shada^ya, i. e. dadhi (thick milk) mixed with ghrita.
(clarified butter) into a metal jug, he sacrifices bit by
bit of that pr/shada^ya, saying : ' May I, as I in-
crease in this my house, nourish a thousand ! May
fortune never fail in his race, with offspring and
cattle, Svaha!'
' I offer to thee in my mind the vital breaths which
are in me, Svaha ! '
' Whatever 2 in my work I have done too much,
or whatever I have here done too little, may the wise
Agni Svishtakrh make this right and proper for us,
Svaha!'
25. Then putting his mouth near the child's
right ear, he says thrice, Speech, speech 3 ! After
Anandagiri explains : garbhanL$sarareanantara« yd miwzsapejt
nirga£A5ati s&vara, tint fa nirgamayety arthaA. Dvivedagaftga (ed.
Weber) writes: nirgamyamSnamSwsapejl sS-avarajabdaviiyi, turn
savaraw ka. nirgamaya.
1 These as well as the preceding rules refer to matters generally
treated in the Gr«hya-sutras ; see Arvaliyana, Gn'hya-sutras I,
13 seq.; Paraskara, Gn'hya-sutras 1, 11 seq. ; .SSnkhiyana, Gnhya-
sutras I, 19 seq. It is curious, however, that Arval&yana I, 13, 1,
refers distinctly to the Upanishad as the place where the puwsavana
and similar matters were treated. This shows that the Upanishads
were known before the composition of the Gr«hya-sutras, and
explains perhaps, at least partially, why the Upanishads were con-
sidered as rahasya. Afvalayana says, ' Conception, begetting of a
boy, and guarding the embryo are to be found in the Upanishad.
But if a man does not read the Upanishad, let him know that he
should feed his wife,' &c. N&raya«a explains that Awaldyana here
refers to an Upanishad which does not exist in his own 5dkM, but
he objects to the conclusion that therefore the garbhidh&na and
other ceremonies need not be performed, and adds that some hold
it should be performed, as prescribed by -Saunaka and others.
a Awalayana, Gr/hya-sutra 1, 10, 23.
* Trayilaksha«& vak tvayi pravwatv iti ^apato 'bhipriyaA.
Digitized by
Google
VI ADHYAYA, 4 BRAHMAJVA, 28. 223
that he pours together thick milk, honey, and clari-
fied butter, and feeds the child with (a ladle of)
pure gold 1 , saying : ' I give thee Bhfi^, I give thee
Bhuva^, I give thee Sva^ 2 . Bhur, BhuvaA, Sva^, I
give thee all V
26 4 . Then he gives him his name, saying: 'Thou
art Veda ;' but this is his secret name 8 .
27. Then he hands the boy to his mother and
gives him her breast, saying : ' O Sarasvatl, that
breast of thine which is inexhaustible, delightful,
abundant, wealthy, generous, by which thou cherish-
est all blessings, make that to flow here 6 .'
28 7 . Then he addresses the mother of the boy :
1 Cf. Paraskara Gr/hya-sfitras I, 16, 4, an&mikaya' suvarwlntar-
hitaya; Saftkhayana, Grchya-sfitras I, 24, pra^aye^ ^Starupe«a.
* Bhur bhuvaA svaA are explained by Dvivedaganga as the Hi'g-
veda, Ya^-ur-veda, and S&ma-veda. They might also be earth, air,
and heaven. See Sankhiyana, Gnhya-sfttras I, 24; Bhur r/gveda»»
tvayi dadhami, &c.
* The Madhyandinas add here another verse, which the father
recites while he strokes his boy : ' Be a stone, be an axe, be pure
gold. Thou art my Self, called my son ; live a hundred harvests.'
The same verse occurs in the Arvalayana Gr»hya-s<itras 1, 15, 3.
4 The two ceremonies, here described, are the dyushya-karman
and the medha^anana. They are here treated rather confusedly.
Piraskara (Gnhya-sutras I, 16, 3) distinguishes the medha^anana
and the Syushya. He treats the medha^anana first, which consists
in feeding the boy with honey and clarified butter, and saying to
him bhus tvayi dadhimi, &c. The ayushya consists in repeating
certain verses in the boy's ear, wishing him a long life, &c. In
Afvalayana's Gr/nya-sutras, 1, 15, 1 contains the dyushya, 1, 15, 2
the medha^-anana. .SSnkhiyana also (1, 24) treats the ayushya first,
and the medha^anana afterwards, and the same order prevails in
the Madhyandina text of the Br*hadara»yaka-upanishad.
6 In the Madhyandina text these acts are differently arranged.
* Rig-veda 1, 164, 49.
7 These verses are differently explained by various commentators.
Anandagiri explains Hi as stutyi, bhogyl He derives Maitr&vanwi
Digitized by
Google
224 B/J/HADARAJVYAKA-UPANISHAD.
' Thou art I /a Maitravariml : thou strong woman
hast born a strong boy. Be thou blessed with
strong children thou who hast blessed me with a
strong child.'
And they say of such a boy : ' Ah, thou art better
than thy father ; ah, thou art better than thy grand-
father. Truly he has reached the highest point in
happiness, praise, and Vedic glory who is born as
the son of a Brahma#a that knows this.'
Fifth BrAhmawa.
i. Now follows the stem 1 :
i. Pautimashiputra from Katyayaniputra,
from Maitrivaruwa, i. e. Vasish//4a, the son of Mitravaru»au, and
identifies her with Arundhat!. Dvivedagahga takes ida as bhogya,
or irfap&trt, or pr*"thivirup&, and admits that she may be called
Maitravaruwt, because born of Mitr&varu«au. Vfre is rightly taken
as a vocative by Dvivedagahga, while Anandagiri explains it as a
locative, mayi nimittabhute. One expects agtganah instead of
a^iganat, which is the reading of A. and B. The reading of the
Madhyandinas, a^-igunatha^, is right grammatically, but it offends
against the metre, and is a theoretical rather than a real form.
If we read a^ana^, we must also read akaraA, unless we are
prepared to follow the commentator, who supplies bhavati.
1 The Madhyandinas begin with vayam,we, then i. Bharadva^f-
putra, 2. Vatsima«</aviputra, 3. PaYarariputra, 4. Gargiputra, 5. Pd-
rirarl-kauWiniputra, 6. Gargiputra, 7.Gdrgiputra, 8. Bsufeyiputra,
9. Maushiklputra, 10. Harikar«iputra, n. Bhiradva^iputra, 12.
Paiftgiputra, 13. .Saunakiputra, 14. KSjyapf-bilakyd-ma/Aariputra,
15. Kautsiputra, 16. Baudhiputra, 1 7. Salahkayaniputra, i8.Varsha-
gamputra, 19. Gautamiputra, 20. Atreyfputra, 21. Gautamtputra,
22. VStsiputra, 23. Bharadva^iputra, 24. PadLrariputra, 25. Vdrkd-
ruwiputra ; then from No. 20 as in the Kiwva text.
This stem is called by .Sahkara, Samastaprava^anavawwa^, and
Anandagiri adds, purvau vamsan purushavLreshitau, tr/tiyas tu
striviseshitaA, stripradhanyit. Dvivedagahga writes, putramantha-
barmanah strisa/raskararthatvenoktatv&t tatsannidhanad ayam vamsah
stripWidh&nyeno^yate.
Digitized by
Google
VI ADHYAYA, 5 BRAHMAiVA, 2. 225
1* 1 1 . ■ ■ ...
2. Katyayanlputra from Gotamtputra,
3. Gotamtputra from Bharadv&fiputra,
4. Bharadva^iputra from Parasarlputra,
5. Parasarlputra from Aupasvattputra,
6. Aupasvattputra from Parasariputra,
7. Parasarlputra from Katyayanlputra,
8. Katyayanlputra from Kau.sikiputra,
9. Kau-fiklputra from Alambiputra and Vaiya-
ghrapadtputra,
10. Alambiputra and Vaiyaghrapadtputra from
Ka«viputra,
11. Ka#vlputra from Kaplputra,
12. Kaptputra
from Atreylputra,
1 3. Atreylputra from Gautamtputra,
14. Gautamtputra from Bharadv&fiputra,
15. Bharadva^lputra from Parasariputra,
16. Parasarlputra from Vatslputra,
1 7. Vatslputra from Pararariputra,
18 1 . Parasartputra from Varkaruwlputra,
19. Varkaru«iputra from Virkaruwlputra,
20. Varkaru#iputra from Artabhagiputra,
21. Artabhagiputra from 5aunglputra,
22. .Saunglputra from Sankmlputra,
23 2 . Sankrztiputra from Alambayanlputra,
24. Alambayanlputra from Alambtputra,
25. Alambiputra from <7ayantlputra,
26. ^ayantlputra from Ma»^ukayantputra,
27. Mawofakayanlputra from Ma«afaktputra,
28. Ma»^uklputra from -SaTzaTillputra,
29. -SatfrtTiliputra from Rathltarlputra,
30 3 . Rathltarlputra from Bhaluklputra,
1 M. has only one. 2 M. inverts 23 and 24.
8 Deest in M.
[15] Q
Digitized by
Google
2 26 BK/HADARAiVYAKA-UPANISHAD.
31. Bhalukiputra from Krauw&klputrau,
32. Kraiwiiktputrau from Vai//abhatlputra \
33. Vai^abhattputra from Karcakeyiputra 2 ,
34. Karrakeytputra from Pra/£inayogtputra,
35. Pra^inayoglputra from Sa#fiv!putra s ,
36. Sa«glviputra from Praj«tputra Asurivasin,
37. Praraiputra Asurivasin from Asurayawa,
38. Asuraya«a from Asuri,
39. Asuri
3. from YcL^wavalkya,
40. Ya,f»avalkya from Uddalaka,
41. Uddalaka from Anma,
42. Aruwa from Upavesi,
43. Upavesi from Karri,
44. Ku^ri from Va^a^ravas,
45. Va^asravas from Cihvavat Vadhyoga,
46. Cihvavat Vadhyoga from Asita Varshaga«a,
47. Asita Varshaga«a from Harita Kasyapa,
48. Harita Kasyapa from 6*ilpa Kasyapa,
49. .Silpa Kasyapa from Kasyapa Naidhruvi,
50. Kasyapa Naidhruvi from Vai,-
5 1 . Vai from Ambhwi,
52. Ambhi«l from Aditya, the Sun.
As coming from Aditya, the Sun, these pure*
Ya^us verses have been proclaimed by Yagtia.-
valkya Va^asaneya.
1 Vaidabhn'ttputra, M. * Bhalukiputra, M.
* K&nrakeyiputra after 35 in M.
4 They are called .ruklani, white or pure, because they are not
mixed with Brahmawas, avy&mura»i bralima«ena (doshair asankir-
wani, paurusheyatvadoshadvar£bhav&d ityarthaA). Or they are ayS-
tayamani, unimpaired. Anandagiri adds, Pra^apatim &rabhya
Saw^iviputraparyantaw (No. 36) Va£asaneyu£kh£su sarv£sv eko
vamsa. ity&ha sam&nam iti. Dvivedaganga says : Va£wakhava^//in-
Digitized by
Google
VI ADHYAYA, 5 BRAHMAWA, 4. 227
4 \ The same as far as SMfivlputra (No. 36), then
36. Sa»^iv!putra from Ma»afakayani,
37. Ma#dukayani from Ma«davya,
38. Ma#davya from Kautsa,
39. Kautsa from Mahitthi,
40. Mahitthi from Vamakakshaya#a,
41. Vamakakshaya#a from SkncTilya.,
42. S&ndilya. from Vatsya,
43. Vatsya from Kmri,
44. Ku^ri from Ya^ava/fcas Ra^astambayana,
45. Ya£$avaias Ra^astambayana from Tura
Kavasheya,
46. Tura Kavasheya from Pra^apati,
47. Pra^apati from Brahman,
48. Brahman is Svayambhu, self-existent.
Adoration to Brahman !
n&na7& yagush&m Suryewopadish/atvaw Ya^liavalkyena prSptatvam
ka. pur&weshu prasiddham.
1 This last paragraph is wanting in the M&dhyandina text, but a
very similar paragraph occurs in &tapatha-brahma»a X, 6, 5, 9,
where, however, Vatsya comes before .SaWilya.
Q 2
Google
Digitized by '
Digitized by
Google
SVETASVATARA-
UPANISHAD.
Digitized by
Google
Digitized by
Google
SVETASVATARA-
UPANISHAD.
V
FIRST ADHYAYA.
i. The Brahma-students say : Is Brahman the
cause * ? Whence are we born ? Whereby do we
live, and whither do we go ? O ye who know
Brahman, (tell us) at whose command we abide,
whether in pain or in pleasure ?
1 This translation seems the one which Sankara himself prefers,
for on p. 277, when recapitulating, he says, kirn brahma karawam
ahosvit kaladi. In comparing former translations, whether by
Weber, Roer, Gough, and others, it will be seen that my own differs
considerably from every one of them, and differs equally from
.Sankara's interpretation. It would occupy too much space to criti-
cise former translations, nor would it seem fair, considering how
long ago they were made, and how imperfect were the materials
which were then accessible. All I wish my readers to understand
is that, if I differ from my predecessors, I do so after having care-
fully examined their renderings. Unfortunately, Roer's edition of
both the text and the commentary is often far from correct.
Thus in the very first verse of the -SVetarvatara-upanishad, I think
we ought to read sampratish/£a£, instead of sampratish/Aita^. In
the commentary the reading is right. Vyavasyam is a misprint for
vyavastham. In the second verse we must separate kala/5 and
svabhavaA. YzdrikkM, no very unusual word, meaning chance,
was formerly taken for a name of the moon! Instead of na tvatma-
bhavat, both sense and metre require that we should read
anatmabhavat, though the commentators take a different view.
They say, because, there is a self, and then go on to say that even
that would not suffice. Such matters, however, belong to a critical
commentary on the Upanishads rather than to a translation, and I
can refer to them in cases of absolute necessity only, and where the
readings of the two MSS., A. and B, seem to offer some help.
Digitized by
Google
232 SVETASVATARA-UPANISHAD.
2. Should time, or nature 1 , or necessity, or chance,
or the elements be considered as the cause, or he
who is called the person (purusha, vi^wanatma) ? It
cannot be their union either, because that is not self-
dependent 2 , and the self also is powerless, because
there is (independent of him) a cause of good and
evil 3 .
3. The sages, devoted to meditation and concen-
tration, have seen the power belonging to God
himself*, hidden in its own qualities (gu«a). He,
being one, superintends all those causes, time, self,
and the rest 6 .
4 6 . We meditate on him who (like a wheel) has
one felly with three tires, sixteen ends, fifty spokes,
with twenty counter-spokes, and six sets of eight;
1 Svabhiva, their own nature or independent character.
* Union presupposes a uniter.
3 AtmS is explained by Sankara as the glv&h, the living self, and
as that living self is in his present state determined by karman,
work belonging to a former existence, it cannot be thought of as
an independent cause.
4 Devdtmarakti is a very important term, differently explained
by the commentators, but meaning a power belonging to the Deva,
the L-vara, the Lord, not independent of him, as the Sankhyas
represent Prakr/ti or nature. Herein lies the important distinction
between VedSnta and Sdnkhya.
8 K£l&tmabhy£ta» yukt&ni, kalapurushasaflzyukt&ni svabh&vSdini.
Atman is here taken as synonymous with purusha in verse 2.
6 It is difficult to say whether this verse was written as a summing
up of certain technicalities recognised in systems of philosophy exist-
ing at the time, or whether it is a mere play of fancy. I prefer the
former view, and subjoin the explanation given by .Sankara, though
it is quite possible that on certain points he may be mistaken. The
trvara or deva is represented as a wheel with one felly, which
would seem to be the phenomenal world. It is called trivri't, three-
fold, or rather having three tires, three bands or hoops to bind the
felly, these tires being intended for the three gu«as of the praknli,
the Sattva, Ra^as, and Tamas. In the Brahmopanishad (Bibl. Ind.
Digitized by
Google
I ADHYAYA, 4. 233
whose one rope is manifold, who proceeds on three
different roads, and whose illusion arises from two
causes.
p. 251) the trivr/t sutram is mentioned. Next follows shodas&atam,
ending in the sixteen. These sixteen are differently explained.
They may be meant for the five elements and the eleven indriyas
or organs (the five receptive and the five active senses, together with
manas, the common sensory) ; or for the sixteen kal&s, mentioned
in the Pramopanishad, VI, 1, p. 283. Then follows a new inter-
pretation. The one felly may be meant for the chaos, the unde-
veloped state of things, and the sixteen would then be the two
products in a general form, the Vira£ and the Sutrltman, while the
remaining fourteen would be the individual products, the bhuvanas
or worlds beginning with BhM.
Next follows jatSrdh&ram, having fifty spokes. These fifty
spokes are supposed to produce the motion of the mundane wheel,
and are explained by Sankara as follows :
1. The five Viparyayas, misconceptions, different kinds of igno-
rance or doubt, viz. Tamas, Moha, MahSmoha, TSmisra, Andhata"-
misra, or, according to Pata%ali, ignorance, self-love, love, hatred,
and fear (Yoga-sutras I, 8 ; II, 2 ; S&hkhya-sutras III, 37).
2. The twenty-eight Afaktis, disabilities, causes of misconception.
(See S&nkhya-sutras III, 38.)
3. The nine inversions of the Tush/is, satisfactions. (S&nkhya-
sutras III, 39.)
4. The eight inversions of the Siddhis, perfections. (Sdhkhya-
sutras III, 40.)
These are afterwards explained singly. There are 8 kinds of
Tamas, 8 kinds of Moha, 10 kinds of Mah&moha, 18 kinds of
Tdmisra, and 18 kinds of Andhatamisra, making 62 in all. More
information on the Araktis, the Tush/is, and Siddhis may be found
in the Sahkhya-sutras III, 37-45; Sahkhya-kdriM 47 seq.; Yoga-
sutras II, 2 seq.
Then follow the 20 pratyaras, the counter-spokes, or wedges to
strengthen the spokes, viz. the 10 senses and their 10 objects.
The six ash/akas or ogdoads are explained as the ogdoads of
Prakr*ti, of substances (dhdtu), of powers (auvarya), of states
(bh&va), of gods (deva), of virtues (&tmagu«a).
The one, though manifold cord, is love or desire, Kdma, whether
of food, children, heaven or anything else.
The three paths are explained as righteousness, unrighteousness,
Digitized by
Google
/""
234 SVETASVATARA-UPANISHAD.
5 1 . We meditate on the river whose water con-
sists of the five streams, which is wild and winding
with its five springs, whose waves are the five vital
breaths, whose fountain head is the mind, the course
of the five kinds of perceptions. It has five whirl-
pools, its rapids are the five pains ; it has fifty kinds
of suffering, and five branches.
6. In that vast Brahma-wheel, in which all things
live and rest, the bird flutters about, so long as he
thinks that the self (in him) is different from the
mover (the god, the lord). When he has been
blessed by him, then he gains immortality 2 .
7. But what is praised (in the Upanishads) is the
and knowledge, and the one deception arising from two causes is
ignorance of self, produced by good or bad works.
1 Here again, where the favara is likened to a stream, the
minute coincidences are explained by Sankara in accordance with
certain systems of philosophy. The five streams are the five recep-
tive organs, the five springs are the five elements, the five waves
are the five active organs. The head is the manas, the mind, or .
common sensory, from which the perceptions of the five senses
spring. The five whirlpools are the objects of the five senses, the
five rapids are the five pains of being in the womb, being born,
growing old, growing ill, and dying. The next adjective pam£&-
■radbhed&m is not fully explained by .Sankara. He only mentions
the five divisions of the kl&ra (see Yoga-sutras II, 2), but does not
show how their number is raised to fifty. Dr. Roer proposes to
.read paw£aklera-bhed£m, but that would not agree with the metre.
The five parvans or branches are not explained, and niay refer to
the fifty kinds of suffering (klera). The whole river, like the
wheel in the preceding verse, is meant for the Brahman askirya-
k&rawatmaka, in the form of cause and effect, as the phenomenal,
not the absolutely real world.
2 If he has been blessed by the tfvara, i. e. when he has been
accepted by the Lord, when he has discovered his own true self in
the Lord. It must be remembered, however, that both the Is vara, the
Lord, and the purusha, the individual soul, are phenomenal only,
and that the Brahma-wheel is meant for the prapa»Ua, the manifest,
but unreal world.
Digitized by
Google
I ADHYAYA, IO. 235
Highest Brahman, and in it there is the triad 1 . The
Highest Brahman is the safe support, it is imperish-
able. The Brahma-students 2 , when they have known
what is within this (world), are devoted and merged
in the Brahman, free from birth 3 .
. 8. The Lord (tsa) supports all this together, the
perishable and the imperishable, the developed and
the undeveloped. The (living) self, not being a lord,
is bound 4 , because he has to enjoy (the fruits of
works) ; but when he has known the god (deva), he
is freed from all fetters.
9. There are two, one knowing (trvara), the other
not-knowing (fiva), both unborn, one strong, the
other weak 6 ; there is she, the unborn, through
whom each man receives the recompense of his
works 6 ; and there is the infinite Self (appearing)
under all forms, but himself inactive. When a man
finds out these three, that is Brahma 7 .
10. That which is perishable 8 is the Pradh&na 9
(the first), the immortal and imperishable is Hara 10 .
1 The subject (bhoktn), the object (bhogya), and the mover
(preritr/), see verse 12.
8 B. has Vedavido, those who know the Vedas.
8 Tasmin praliyate tv atma" samSdhW sa udahn'taA.
4 Read badhyate for budhyate.
5 The form faantrau is explained as ^dndasa ; likewise brah-
mam for brahma.
• Cf. .SVet. Up. IV, 5, bhuktabhogyara.
* The three are (1) the lord, the personal god, the creator and
ruler ; (2) the individual soul or souls ; and (3) the power of creation,
the devatmarakti of verse 3. AU three are contained in Brahman ;
see verses 7, 12. So 'pi may! paramewaro mSyopidhisannidhes
tadvan iva.
8 See verse 8.
8 The recognised name for Prakrc'ti, or here Devatmarakti, in
the later S&ftkhya philosophy.
'* Hara, one of the names of .Siva or Rudra, is here explained as
Digitized by
Google
236 svetasvatara-upanishad.
The one god rules the perishable (the pradhana) and
the (living) self 1 . From meditating on him, from
joining him, from becoming one with him there is
further cessation of all illusion in the end.
1 1. When that god is known, all fetters fall off,
sufferings are destroyed, and birth and death cease.
From meditating on him there arises, on the disso-
lution of the body, the third state, that of universal
lordship 2 ; but he only who is alone, is satisfied 3 .
12. This, which rests eternally within the self,
should be known ; and beyond this not anything has
to be known. By knowing the enjoyer*, the enjoyed,
and the ruler, everything has been declared to be
threefold, and this is Brahman.
13. As the form of fire, while it exists in the
under-wood 5 , is not seen, nor is its seed destroyed,
avidyader harawat, taking away ignorance. He would seem to be
meant for the trvara or deva, the one god, though immediately after-
wards he is taken for the true Brahman, and not for its phenomenal
divine personification only.
1 The self, atman, used here, as before, for purusha, the indi-
vidual soul, or rather the individual souls.
2 A blissful state in the Brahma-world, which, however, is not
yet perfect freedom, but may lead on to it. Thus it is said in the
•Slvadharmottara :
Dhyanad awvaryam atulam auvaryat sukham uttamam,
(rwanena tat paritya^ya videho muktim Spnuyat.
8 This alone-ness, kevalatvam, is produced by the knowledge
that the individual self is one with the divine self, and that both the
individual and the divine self are only phenomenal forms of the
true Self, the Brahman.
4 BhoktS, possibly for bhoktrit, unless it is a A!Mndasa form.
It was quoted before, Bibl. Ind. p. 292, 1. 5. The enjoyer is the
purusha, the individual soul, the subject ; the enjoyed is prakre'ti,
nature, the object ; and the ruler is the fevara, that is, Brahman, as
god. I take brahmam etat in the same sense here as in verse 9.
' This metaphor, like most philosophical metaphors in Sanskrit,
Digitized by
Google
I adhyAya, i 6. 237
but it has to be seized again and again by means of
the stick and the under-wood, so it is in both cases,
and the Self has to be seized in the body by means
of the pra#ava (the syllable Om).
14. By making his body the under-wood, and the
syllable Om the upper-wood, man, after repeating
the drill of meditation, will perceive the bright god,
like the spark hidden in the wood '.
1 5. As oil in seeds, as butter in cream, as water
in (dry) river-beds 2 , as fire in wood, so is the Self
seized within the self, if man looks for him by truth-
fulness and penance 3 ;
16. (If he looks) for the Self that pervades every-
thing, as butter is contained in milk, and the roots
whereof are self-knowledge and penance- That is
the Brahman taught by the Upanishad.
is rather obscure at first sight, but very exact when once under-
stood. Fire, as produced by a fire drill, is compared to the Self.
It is not seen at first, yet it must be there all the time ; its linga
or subtle body cannot have been destroyed, because as soon as the
stick, the indhana, is drilled in the under-wood, the yoni, the fire
becomes visible. In the same way the Self, though invisible during
a state of ignorance, is there all the time, and is perceived when
the body has been drilled by the Prawava, that is, after, by a con-
stant repetition of the sacred syllable Om, the body has been sub-
dued, and the ecstatic vision of the Self has been achieved.
Indhana, the stick used for drilling, and yoni, the under-wood, in
which the stick is drilled, are the two arawis, the fire-sticks used for
kindling fire. See Tylor, Anthropology, p. 260.
1 Cf. Dhyanavindupan. verse 20; Brahmopanishad, p. 256.
2 Srotas, a stream, seems to mean here the dry bed of a stream,
which, if dug into, will yield water.
8 The construction is correct, if we remember that he who is
seized is the same as he who looks for the hidden Self. But the
metre would be much improved if we accepted the reading of the
Brahmopanishad, evam £tma dtmani gnhyate 'sau, which is con-
firmed by B. The last line would be improved by reading, satye-
nainaw ye 'nupajyanti dhiraA.
Digitized by
Google
238 SVETA.SVATARA-UPANISHAD.
SECOND ADHYAYA.
i 1 . Savhri (the sun), having first collected his
mind and expanded his thoughts, brought Agni (fire),
when he had discovered his light, above the earth.
2 2 . With collected minds we are at the command of
the divine Savitr?, that we may obtain blessedness. .
1 The seven introductory verses are taken from hymns addressed
to Savitr* as the rising sun. They have been so twisted by .Sankara,
in order to make them applicable -to the teachings of the Yoga
philosophy, as to become almost nonsensical. I have given a few
specimens of <Saftkara's renderings in the notes, but have translated
the verses, as much as possible, in their original character. As
they are merely introductory, 1 do not understand why the collector
of the Upanishad should have seen in them anything but an invo-
cation of Savitn.
These verses are taken from various Saznhitas. The first yuw^anaA
prathamam is from Taitt. Sa»m. IV, 1, r, 1, 1 ; Va^. Sawh. XI, 1;
see also Sat. Br. VI, 3, 1, 12. The Taittiriya-text agrees with the
Upanishad, the Vag'asaneyi-text has dhiyam for dhiya^, and agneA
for agnim. Both texts take tatvaya as a participle of tan, while the
Upanishad reads tattvaya, as a dative of tattva, truth. I have
translated the verse in its natural sense. .Sankara, in explaining
the Upanishad, translates : ' At the beginning of our meditation,
joining the mind with the Highest Self, also the other prawas, or
the knowledge of outward things, for the sake of truth, Savitn,
out of the knowledge of outward things, brought Agni, after
having discovered his brightness, above the earth, in this body.' He
explains it : ' May Savitri, taking our thoughts away from outward
things, in order to concentrate them on the Highest Self, produce
in our speech and in our other senses that power which can lighten
all objects, which proceeds from Agni and from the other favour-
able deities.' He adds that ' by the favour of Savitr*', Yoga may
be obtained.'
2 The second verse is from Taitt. Sawh. IV, 1,1,1,3; v ^fi , > Sa/nh.
XI, 2. TheVa^asaneyi-texthassvargyayaforsvargeyaya,andjaktya
for s aktyai. .Sankara explains : ' With a mind that has been joined
Digitized by
Google
II ADHYAYA, 4. 239
3 1 . May SavitW, after he has reached with his
mind the gods as they rise up to the sky, and with
his thoughts (has reached) heaven, grant these gods
to make a great light to shine.
4 2 . The wise sages of the great sage collect their
mind and collect their thoughts. He who alone
knows the law (Savitrz) has ordered the invocations ;
great is the praise of the divine SavitW.
by Savitr/ to the Highest Self, we, with the sanction of that Savitr? - ,
devote ourselves to the work of meditation, which leads to the
obtainment of Svarga, according to our power.' He explains
Svarga by Paramatman. Sayawa in his commentary on the Taitti-
rtya-sarahita explains svargeyaya by svargaloke gfyam&nasyagneA
sampadanaya; Sahkara, by svargapraptihetubhutaya dhyanakar-
mawe. Saktyai is explained by .Sahkara by yathasamarthyam ; by
Saya«a, by rakta bhuyasma. Mahldhara explains jaktya by svasd-
marthyena. I believe that the original reading was svargyaya
jaktyai, and that we must take jaktyai as an infinitive, like ityai,
construed with a dative, like dmaye suryaya, for the seeing of the
sun. The two attracted datives would be governed by save, 'we
are under the command of Savitn',' svargyaya saktyai, 'that we
may obtain svargya, life in Svarga or blessedness.'
1 The third verse is from Taitt. Sarah. IV, 1,1,1,2; Va^. Sarah.
XI, 3. The Taittiriyas read yuktvaya manasa ; the Vi^asaneyins,
yuktvaya savitd. .Sahkara translates : ' Again he prays that Savitre - ,
having directed the devas, i. e. the senses, which are moving towards
Brahman, and which by knowledge are going to brighten up the
heavenly light of Brahman, may order them to do so ; that is, he
prays that, by the favour of Savit/7, our senses should be turned
away from outward things to Brahman or the Self.' Taking the
hymn as addressed to Savitr/', I have translated deva by gods, not
by senses, suvaryata^ by rising to the sky, namely, in the morning.
The opposition between manasa and dhiyS is the same here as in
verse 1, and again in verse 4.
2 This verse is from Taitt. Sarah. IV, 1, 1, 1, 4; 1, 2, 13, 1, 1 ;
Va^. Sarah. V, I4 ; XI, 4; XXXVII, 2; Rig-veda V,8i, 1; Sat.
Br. Ill, 5, 3, 11; VI, 3, 1,16. Sahkara explains this verse again in
the same manner as he did the former verses, while the Satapatha-
brahmawa supplies two different ritual explanations.
Digitized by
Google
24O SVETASVATARA-UPANISHAD.
5 1 . Your old prayer has to be joined 2 with praises.
Let my song go forth like the path of the sun ! May
all the sons of the Immortal listen, they who have
reached their heavenly homes.
6. Where the fire is rubbed 3 , where the wind is
checked, where the Soma flows over, there the mind
is born.
1 For this verse, see Taitt. Sarah. IV, 1, i, 2, 1 ; VSg-. Sarah. XI, 5;
Atharva-veda XVIII, 3, 39 ; Rig-vedaX, 13, 1. The Va^asaneyins
read vi j loka etu for vi f loka yanti ; sureA for suriA ; srinvantii for
jri'«vanti ; and the Rig-veda agrees with them. The dual vam is
accounted for by the verse belonging to a hymn celebrating the
two fakatas, carts, bearing the offerings (havirdhane) ; most likely,
however, the dual referred originally to the dual deities of heaven
and earth. 1 prefer the text of the Rig-veda and the Va^asaneyins
to that of the Taittirfyas, and have translated the verse accordingly.
In the Atharva-veda XVIII, 39, if we may trust the edition, the
verse begins with svasasthe bhavatam indave naA, which is really
the end of the next verse (Rv. X, 13, 2), while the second line is,
vi floka eti pathyeva suriA srinvanta virve amr/tasa etat. I see no
sense in pathyeva suraA. Saftkara explains pathyeva by pathi san-
marge, athava pathyS kirtLfc, while his later commentary, giving
w*'«vantu and putraA suratmano hira«yagarbhasya, leads one to sup-
pose that he read sureA srinvuntu. Sayawa (Taitt. Sarah. IV, 1, 1,
2) explains pathya sura iva by gfrva»amarga antarikshe suryara-
wnayo yatha prasaranti tadvat. The same, when commenting on
the Rig-veda (X, 13, 1), says: pathya-iva sureA, yatha stotuA sva-
bhuta pathya pariwamasukhavahahutir vuvan dev&n prati vividhara
ga£Mati tadvat. Mahtdhara (V&g. Sarah. XI, 5) refers sureA
(pa»rfitasya) to slokaA, and explains pathyeva by patho 'napeta
pathya yagwamargapravn'ttahutiA.
8 Yu^e" cannot stand for yuiige, as all commentators and trans-
lators suppose, but is a datival infinitive. Neither can yu%ate in
the following verse stand for yuhkte (see Boehtlingk, s. v.), or be
explained as a subjunctive form. A. reads adhirudhyate, B. abhi-
rudhyate, with a marginal note abhinudyate. It is difficult to say
whether in lighting the fire the wind should be directed towards it,
or kept from it.
8 That is, at the Soma sacrifice, after the fire has been kindled
and stirred by the wind, the poets, on partaking of the juice, are
Digitized by
Google
II ADHYAYA, IO. 24 1
7. Let us love the old Brahman by the grace of
Savitrz ; if thou make thy dwelling there, the path
will not hurt thee \
8. If a wise man hold his body with its three erect
parts (chest, neck, and head) even 2 , and turn his
senses with the mind towards the heart, he will then
in the boat of Brahman 3 cross all the torrents which
cause fear.
9. Compressing his breathings let him, who has
subdued all motions, breathe, forth through the nose
with gentle breath * Let the wise man without fail
restrain his mind, that chariot yoked with vicious
horses 5 .
10. Let him perform his exercises in a place 6
inspirited for new songs. Sankara, however, suggests another expla-
nation as more appropriate for the Upanishad, namely, 'Where the
fire, i.e. the Highest Self, which burns all ignorance, has been kindled
(in the body, where it has been rubbed with the syllable Om), and
where the breath has acted, i. e. has made the sound peculiar to the
initial stages of Yoga, there Brahman is produced.' In fact, what
was intended to be taught was this, that we must begin with sacri-
ficial acts, then practise yoga, then reach samadhi, perfect know-
ledge, and lastly bliss.
1 We must read kr»«avase, in the sense of ' do this and nothing
will hurt thee,' or, if thou do this, thy former deeds will no longer
hurt thee.
a Cf. Bhagavadgitd VI, 13. Samaw kSyafirogrivaw dh&rayan.
Sankara says: tri«y unnat&ny urogrivafirSwsy unnatani yasmin
rarire.
8 Explained by Sankara as the syllable Om.
4 Cf. Bhagavadgfta V, 27. PfSwipdnau samau kn'tva nisibhyan-
tara £ari»au. See Telang's notes, Sacred Books of the East, vol. viii,
p. 68 seq.
6 A similar metaphor in Ka/4. Up. Ill, 4-6 ; Sacred Books of
the East, vol. xv, p. 13.
* The question is whether jabda^alifrayadibhiA should be referred
to mano 'nukule, as I have translated it, or to vivar^ite, as Sankara
seems to take it, because he renders rabda, sound, by noise, and
[15] R
Digitized by
Google
242 ■SVETA.SVATARA-UPANISHAD.
level, pure, free from pebbles, fire, and dust, delightful
by its sounds, its water, and bowers, not painful to
the eye, and full of shelters and caves.
ii. When Yoga is being performed, the forms
which come first, producing apparitions in Brahman,
are those of misty smoke, sun, fire, wind, fire-flies,
lightnings, and a crystal moon 1 .
12. When, as earth, water, light, heat, and ether
arise, the fivefold quality of Yoga takes place 2 ,
then there is no longer illness, old age, or pain 3 for
him who has obtained a body, produced by the fire
of Yoga.
1 3. The first results of Yoga they call lightness,
healthiness, steadiness, a good complexion, an easy
pronunciation, a sweet odour, and slight excretions.
14. As a metal disk (mirror), tarnished by dust,
shines bright again after it has been cleaned, so
is the one incarnate person satisfied and free from
grief, after he has seen the real nature of the
self 4 .
irraya by maWapa, a booth. See Bhagavadgfta VI, 11. In the
Maitr. Up. VI, 30, R&matirtha explains sukaa. dese by girinadl-
pulinaguMduuddhasthane. See also Afv. GnTiya-sfttras III, 2, 2.
1 Or, it may be, a crystal and the moon.
8 The Yogaguwa is described as the quality of each element,
i. e. smell of the earth, taste of water, &c. It seems that the per-
ception of these guwas is called yogapravntti. Thus by fixing the
thought on the tip of the nose, a perception of heavenly scent is
produced ; by fixing it on the tip of the tongue, a perception of
heavenly taste ; by fixing it on the point of the palate, a heavenly
colour ; by fixing it on the middle of the tongue, a heavenly touch ;
by fixing it on the roof of the tongue, a heavenly sound. By means
of these perceptions the mind is supposed to be steadied, because
it is no longer attracted by the outward objects themselves. See
Yoga-sutras I, 35.
8 Or no death, na mrityuh, B.
* Paresham pa/fe tadvat sa tattvam prasamikshya dehtti.
Digitized by
Google
II ADHYAYA, 1 7. 243
15. And when by means of the real nature of his
self he sees, as by a lamp, the real nature of Brah-
man, then having known the unborn, eternal god,
who is beyond all natures 1 , he is freed from all
fetters.
16. He indeed is the god who pervades all regions :
he is the first-born (as Hirawyagarbha), and he is in
the womb. He has been born, and he will be born 2 .
He stands behind all persons, looking everywhere.
1 7. The god s who is in the fire, the god who is
in the water, the god who has entered into the whole
world, the god who is in plants, the god who is in
trees, adoration be to that god, adoration !
x Sarvatattvair avidyatatkaryair vmiddham asa»»spnsh/am.
• This verse is found in the V&g. Sarah. XXXII, 4 ; Taitt. Ar. X,
1, 3, with slight modifications. The Va^asaneyins read esho ha (so
do A. B.) for esha hi ; sa eva gatah (A. B.) for sa vig&tah ; ganis
(A.B.) for^anaws. The Arawyaka has sa vig&ya.m&naA for sa vig&taA,
pratyanmukhas for pratyamg-anaras, and vwvatomukhaA for sarvato-
mukhaA. Colebrooke (Essays, I, 57) gives a translation of it.
If we read gan&fi, we must take it as a vocative.
8 B. (not A.) reads yo rudro yo 'gnau.
R 2
Digitized by LaOOQ 1C
244 SVETASVATARA-UPANISHAD.
THIRD ADHYAYA 1 .
i. The snarer 2 who rules alone by his powers,
who rules all the worlds by his powers, who is one
and the same, while things arise and exist 3 , — they
who know this are immortal.
2. For there is one Rudra only, they do not. allow
a second, who rules all the worlds by his powers.
He stands behind all persons*, and after having
created all worlds he, the protector, rolls it up 5 at
the end of time.
3 6 . That one god, having his eyes, his face, his
arms, and his feet in every place, when producing
heaven and earth, forges them together with his
arms and his wings 7 .
1 This Adhyaya represents the Highest Self as the personified
deity, as the lord, isa., or Rudra, under the sway of his own creative
power, prakr/'ti or maya.
2 .Sankara explains ^ala, snare, by m&ya\ The verse must be
corrected, according to Ankara's commentary:
ya eko ^alavan trata faantbhiA
sarvaS Uokan irata UanlbhiA.
8 Sambhava, in the sense of Vergehen, perishing, rests on no
authority.
4 Here again the MSS. A. B. read ^-anas, as a vocative.
6 1 prefer samiukofta. to sawz^ukopa, which gives us the meaning
that Rudra, after having created all things, draws together, i. e.
takes them all back into himself, at the end of time. I have trans-
lated szmsngya, by having created, because Boehtlingk and Roth
give other instances of samsrig with that sense. Otherwise, ' having
mixed them together again,' would seem more appropriate. A. and
B. read saw^uko^a.
• This is a very popular verse, and occurs Rig-veda X, 8i, 3;
Va£\ Sawh. XVII, 19 ; Ath.-veda XIII, 2, 26 ; Taitt. Sa**h. IV, 6,
2, 4; Taitt. Ar. X, 1, 3.
7 .Sahkara takes dhamati in the sense of sawyo^ayati, i. e. he
joins men with arms, birds with wings.
Digitized by
Google
Ill ADHYAYA, 9. 245
4. He 1 , the creator and supporter of the gods,
Rudra, the great seer, the lord of all, he who
formerly gave birth to Hira#yagarbha, may he
endow us with good thoughts.
5 2 . O Rudra, thou dweller in the mountains, look
upon us with that most blessed form of thine which
is auspicious, not terrible, and reveals no evil !
6 3 .. O lord of the mountains, make lucky that arrow
which thou, a dweller in the mountains, holdest in
thy hand to shoot. Do not hurt man or beast !
7. Those who know beyond this the High Brah-
man, the vast, hidden in the bodies of all creatures,
and alone enveloping everything, as the Lord, they
become immortal 4 .
8 5 . I know that great person (purusha) of sunlike
lustre beyond the darkness 6 . A man who knows him
truly, passes over death; there is no other path
to go 7 .
9. This whole universe is filled by this person
(purusha), to whom there is nothing superior, from
whom there is nothing different, than whom there is
1 See IV, 12.
* See Va^. Sarah. XVI, 2 ; Taitt. Sarah. IV, 5, r, 1.
s See V&g. Sarah. XVI, 3 ; Taitt. Sarah. IV, 5, 1, 1; Nilarudropan.
p. 274.
4 The knowledge consists in knowing either that Brahman is
If a or that Ira is Brahman. But in either case the gender of the
adjectives is difficult. The -SVetib vatara-upanishad seems to use bri-
hanta as an adjective, instead of bnhat. I should prefer to translate :
Beyond this is the High Brahman, the vast. Those who know Ira,
the Lord, hidden in all things and embracing all things to be this
(Brahman), become immortal. See also Muir, Metrical Transla-
tions, p. 196, whose translation of these verses I have adopted with
few exceptions.
6 Cf. V&g. Sarah. XXX, 18 ; Taitt. ir. Ill, 12, 7; III, 13, 1.
• Cf. Bhagavadgita VIII, 9. T Cf. .SVet. Up. VI, 15.
Digitized by
Google
246 JVETASVATARA-UPANISHAD.
nothing smaller or larger, who stands alone, fixed
like a tree in the sky 1 .
10. That which is beyond this world is without
form and without suffering. They who know it,
become immortal, but others suffer pain indeed 2 .
11. That Bhagavat 8 exists in the faces, the heads,
the necks of all, he dwells in the cave (of the heart)
of all beings, he is all-pervading, therefore he is the
omnipresent .Siva. .
12. That person (purusha) is the great lord; he
is the mover of existence 4 , he possesses that purest
power of reaching everything 6 , he is light, he is
undecaying.
1 3 6 . The person (purusha), not larger than a thumb,
1 Divi, the sky, is explained by Sankara as dyotanatmani sva-
mahimni.
2 The pain of sawsara, or transmigration. See Br/had. Up. IV,
3, 20 (p. 178).
s I feel doubtful whether the two names Bhagavat and Siva should
here be preserved, or whether the former should be rendered by
holy, the latter by happy. The commentator explains Bhagavat by
awvaryasya samagrasya vfryasya yasaszA jriyaA
GMnavair&gyayof £aiva sha««dm bhaga itirawS.
Wilson, in his Essay on the Religious Sects of the Hindus,
published in 1828, in the Asiatic Researches, XVI, p. n, pointed
out that this verse and another (Svet. Up. II, 2) were cited by the
Saivas as Vedic authorities for their teaching. He remarked that
these citations would scarcely have been made, if not authentic, and
that they probably did occur in the Vedas. In the new edition of
this Essay by Dr. Rost, 1862, the references should have been added.
4 Sahkara explains sattvasya by anta^karawasya.
8 I take prapti, like other terms occurring in this Upanishad, in
its technical sense. Prapti is one of the vibhutis or auvaryas, viz.
the power of touching anything at will, as touching the moon with
the tip of one's finger. See Yoga-sutras, ed. Rajendralal Mitra,
p. 121.
6 Cf. Taitt. Ar. X, 71 (Anuv. 38, p. 858). Katf. Up. IV, 12-13;
above, p. 16.
Digitized by
Google
in adhyAya, i 8. 247
dwelling within, always dwelling in the heart of man,
is perceived by the heart, the thought 1 , the mind ;
they who know it become immortal.
14 2 . The person (purusha) with a thousand heads,
a thousand eyes, a thousand feet, having compassed
the earth on every side, extends beyond it by ten
fingers' breadth.
15. That person alone (purusha) is all this, what
has been and what will be ; he is also the lord of
immortality ; he is whatever grows by food s .
16. Its 4 hands and feet are everywhere, its eyes
and head are everywhere, its ears are everywhere,
it stands encompassing all in the world 6 .
17. Separate from all the senses, yet reflecting
the qualities of all the senses, it is the lord and ruler
of all, it is the great refuge of all.
18. The embodied spirit within the town with
nine gates 6 , the bird, flutters outwards, the ruler of
1 The text has manvisa, which Sankara explains by gn&nesa.
But Weber has conjectured rightly, I believe, that the original text
must have been manishd. The difficulty is to understand how so
common a word as mantshi could have been changed into so un-
usual a word as manvua. See IV, 20.
2 This is a famous verse of the Rig-veda, X, 90, 1 ; repeated in
the Atharva-veda, XIX, 6, 1; Va£. Sa«h. XXXI, 1; Taitt. Ar. Ill,
12, 1. .Sankara explains ten fingers' breadth by endless; or, he
says, it may be meant for the heart, which is ten fingers above
the navel.
8 Saya«a, in his commentary on the Rig-veda and the Taitt. Ar.,
gives another explanation, viz. he is also the lord of all the im-
mortals, i. e. the gods, because they grow to their exceeding state
by means of food, or for the sake of food.
* The gender changes frequently, according as the author thinks
either of the Brahman, or of its impersonation as isz, Lord.
8 .Sankara explains loka by nikaya, body.
• Cf. Katf. Up. V, 1.
Digitized by
Google
248 svetasvatara-upanishad.
the whole world, of all that rests and of all that
moves.
19. Grasping without hands, hasting without feet,
he sees without eyes, he hears without ears. He
knows what can be known, but no one knows him ;
they call him the first, the great person (purusha).
20 1 . The Self, smaller than small, greater than
great, is hidden in the heart of the creature. A man
who has left all grief behind, sees the majesty, the
Lord, the passionless, by the grace of the creator
(the Lord).
2 1 2 . I know 3 this undecaying, ancient one, the self
of all things, being infinite and omnipresent. They
declare that in him all birth is stopped, for the
Brahma-students proclaim him to be eternal 4 .
1 Cf. Taitt. Ar. X, 12 (10), p. 800 ; K&ift. Up. II, 20 ; above,
p. ii. The translation had to be slightly altered, because the
•SVet&mtaras, as Taittiriyas, read akratum for akratu//, and warn
for atmana^.
2 Cf. Taitt. ir. Ill, 13, 1 ; III, 12, 7.
3 A. reads vedaru<///am, not B.
* A. and B. read brahmavadino hi pravadanti.
Digitized by
Google
IV ADHYAYA, 4. 249
FOURTH ADHYAYA.
1. He, the sun, without any colour, who with set
purpose 1 by means of his power (sakti) produces
endless colours 2 , in whom all this comes together in
the beginning, and comes asunder in the end — may
he, the god, endow us with good thoughts 3 .
2. That (Self) indeed is Agni (fire), it is Aditya
(sun), it is Vayu (wind), it is A'andramas (moon) ; the
same also is the starry firmament 4 , it is Brahman
(Hira»yagarbha), it is water, it is Pra^apati (Vira^ - ).
3. Thou art woman, thou art man; thou art youth,
thou art maiden ; thou, as an old man, totterest 5
along on thy staff; thou art born with thy face turned
everywhere.
4. Thou art the dark-blue bee, thou art the green
1 Nihitartha, explained by .Sankara as g/Thttaprayo^ana^ svartha-
nirapeksha^. This may mean with set purpose, but if we read
agr/'hitaprayqg'anaA it would mean the contrary, namely, without
any definite object, irrespective of his own objects. This is pos-
sible, and perhaps more in accordance with the idea of creation as
propounded by those to whom the devatmarakti is mayd. Nihita
would then mean hidden.
"* Colour is intended for qualities, differences, &c.
8 This verse has been translated very freely. As it stands, vi
£aiti £ante vijvam adau sa devaA, it does not construe, in spite of
all attempts to the contrary, made by .Sankara. What is intended
is yasminn idazra sazrc kz. vi £aiti sarvam (IV, 11); but how so
simple a line should have been changed into what we read now, is
difficult to say.
4 This is the explanation of Sankara, and probably that of the
Yoga schools in India at his time. But to take jukram for dip-
timan nakshatradi, brahma for Hirawyagarbha, and Pra^&pati for
Vira^- seems suggested by this verse only.
6 Va«£ayasi, an exceptional form, instead of vaw&isi (A. B.)
Digitized by
Google
25O SVETASVATARA-UPANISHAD.
parrot with red eyes, thou art the thunder-cloud, the
seasons, the seas. Thou art without beginning 1 ,
because thou art infinite, thou from whom all worlds
are born.
5 2 . There is one unborn being (female), red, white,
and black, uniform, but producing manifold offspring.
There is one unborn being (male) who loves her
and lies by her ; there is another who leaves her,
while she is eating what has to be eaten.
1 We see throughout the constant change from the masculine
to the neuter gender, in addressing either the lord or his true
essence.
3 This is again one of the famous verses of our Upanishad,
because it formed for a long time a bone of contention between
Ved&nta and Sankhya philosophers. The S&hkhyas admit two
principles, the Purusha, the absolute subject, and the Prakr/ti,
generally translated by nature. The Vedanta philosophers admit
nothing but the one absolute subject, and look upon nature as due
to a power inherent in that subject. The later S&nkhyas therefore,
who are as anxious as the Vedantins to find authoritative passages
in the Veda, confirming their opinions, appeal to this and other
passages, to show that their view of Prakn'ti, as an independent
power, is supported by the Veda. The whole question is fully
discussed in the Vedanta-sutras I, 4, 8. Here we read rohita-
k«'sh«a-juklam, which seems preferable to lohita-krz'sh»a-var«am,
at least from a Vedinta point of view, for the three colours, red,
black, and white, are explained as signifying either the three gurzas,
ra^as, sattva, and tamas, or better (ATMnd. Up. VI, 3, 1), the three
elements, te^as (fire), ap (water), and anna (earth). A. reads
rohitaraklakr/shw&m ; B. lohitaraklakrishwa" (sic). We also find
in A. and B. bhuktabhogim for bhuktabhogy&m, but the latter
seems technically the more correct reading. It would be quite
wrong to imagine that a^a and ag& are meant here for he-goat
and she-goat. These words, in the sense of unborn, are recognised
as early as the hymns of the Rig-veda, and they occurred in our
Upanishad I, 9, where the two a^as are mentioned in the same
sense as here. But there is, no doubt, a play on the words, and
the poet wished to convey the second meaning of he-goat and
she-goat, only not as the primary, but as the secondary intention.
Digitized by
Google
IV ADHYAYA, 9. 25 1
6 1 . Two birds, inseparable friends, cling to the
same tree. One of them eats the sweet fruit, the
other looks on without eating.
7. On the same tree man sits grieving, immersed,
bewildered, by his own impotence (an-isa). But
when he sees the other lord (isa) contented, and
knows his glory, then his grief passes away.
8 2 . He who does not know that indestructible
being of the iv%-veda, that highest ether-like (Self)
wherein all the gods reside, of what use is the
Rig-veda. to him? Those only who know it, rest
contented.
9. That from which the maker (mayin 3 ) sends
forth all this — the sacred verses, the offerings, the
sacrifices, the panaceas, the past, the future, and all
1 The same verses occur in the Mu»</aka Up. Ill, 1.
* It is difficult to see how this verse comes in here. In the
Taitt. Ar.II, 11, 6, it is quoted in connection with the syllable Om,
the Akshara, in which all the Vedas are comprehended. It is
similarly used in the Nrj'swma-purva-tapant, IV, 2; V, 2. In our
passage, however, akshara is referred by £ahkara to the paramat-
man, and I have translated it accordingly. Rik&h is explained as
a genitive singular, but it may also be taken as a nom. plur., and in
that case both the verses of the Veda and the gods are said to
reside in the Akshara, whether we take it for the Param&tman or
for the Om. In the latter case, parame vyoman is explained by
utkr«'sh/e and rakshake.
8 It is impossible to find terms corresponding to maya and
mayin. Maya means making, or art, but as all making or creat-
ing, so far as the Supreme Self is concerned, is phenomenal only
or mere illusion, may a conveys at the same time the sense of
illusion. In the same manner mayin is the maker, the artist, but
also the magician or juggler. What seems intended by our verse is
that from the akshara, which corresponds to brahman, all proceeds,
whatever exists or seems to exist, but that the actual creator or the
author of all emanations is Ira, the Lord, who, as creator, is acting
through mayi or devitmarakti. Possibly, however, anya, the other,
may be meant for the individual purusha.
Digitized by
Google
252 JVETASVATARA-U PANISHAD.
that the Vedas declare — in that the other is bound
up through that maya.
10. Know then Prakmi (nature) is Maya (art), and
the great Lord the Mayin (maker) ; the whole world
is filled with what are his members.
11. If a man has discerned him, who being one
only, rules over every germ (cause), in whom all
this comes together and comes asunder again, who
is the lord, the bestower of blessing, the adorable
god, then he passes for ever into that peace.
1 2 \ He, the creator and supporter of the gods,
Rudra, the great seer, the lord of all, who saw 2
Hirawyagarbha being born, may he endow us with
good thoughts.
13. He who is the sovereign of the gods, he in
whom all the worlds 3 rest, he who rules over all two-
footed and four-footed beings, to that god 4 let us
sacrifice an oblation.
14. He who has known him who is more subtile
than subtile, in the midst of chaos, creating all things,
having many forms, alone enveloping everything 5 ,
the happy one (.Siva), passes into peace for ever.
1 See before, III, 4.
2 .Sankara does not explain this verse again, though it differs
from III, 4. Vi^nSnsUman explains paryata by aparyata, and quali-
fies the Atmanepada as irregular.
8 B. reads yasmin devaA, not A.
4 I read tasmai instead of kasmai, a various reading mentioned
by Vi^wanStman. It was easy to change tasmai into kasmai,
because of the well-known line in the Rig-veda, kasmai devaya
havisha' vidhema. Those who read kasmai, explain it as a dative
of Ka, a name of Pra^apati, which in the dative should be kaya,
and not kasmai. It would be better to take kasmai as the dative
of the interrogative pronoun. See M. M., History of Ancient
Sanskrit Literature, p. 433 ; and VMna-sutras IV, 22.
6 Cf. Ill, 7.
Digitized by
Google
IV ADHYAYA, 20. 253
15. He also was in time 1 the guardian of this
world, the lord of all, hidden in all beings. In him
the Brahmarshis and the deities are united 2 , and he
who knows him cuts the fetters of death asunder.
16. He who knows .Siva (the blessed) hidden in
all beings, like the subtile film that rises from out
the clarified butter 3 , alone enveloping everything, —
he who knows the god, is freed from all fetters.
17. That god, the maker of all things, the great
Self*, always dwelling in the heart of man, is per-
ceived by the heart, the soul, the mind 6 ; — they who
know it become immortal.
18. When the light has risen 6 , there is no day, no
night, neither existence nor non-existence 7 ; Siva
(the blessed) alone is there. That is the eternal,
the adorable light of Savitrz 8 , — and the ancient
wisdom proceeded thence.
19. No one has grasped him above, or across, or
in the middle 9 . There is no image of him whose
name is Great Glory.
20. His form cannot be seen, no one perceives
him with the eye. Those 10 who through heart and
1 In former ages, 5ankara.
3 Because both the Brahmarshis, the holy seers, and the deities
find their true essence in Brahman.
* We should say, like cream from milk.
4 Or the high-minded,
8 See III, 13.
• Atamas, no darkness, i. e. light of knowledge.
7 See on the difficulty of translating sat and asat, ro Sv and rb ^
8», the remarks in the Preface.
8 Referring to the Gayatri, Rig-veda III, 62, 10 ; see also Svet
Up.V, 4 .
9 See Muir, Metrical Translations, p. 198; Maitr. Up. VI, 17.
10 B. reads hndd manisha manasabhik//pto, yat tad vidur;
A. hrzdi hridistham manasaya enam evaw? vidur.
Digitized by
Google
254 SVETASVATARA-UPANISHAD.
mind know him thus abiding in the heart, become
immortal.
21. 'Thou art unborn,' with these words some
one comes near to thee, trembling. O Rudra, let
thy gracious 1 face protect me for ever !
22 2 . O Rudra! hurt us not in our offspring and
descendants, hurt us not in our own lives, nor in our
cows, nor in our horses ! Do not slay our men in
thy wrath, for, holding oblations, we call on thee
always.
1 Dakshi«a is explained either as invigorating, exhilarating, or
turned towards the south.
4 See Colebrooke, Miscellaneous Essays, I, p. 141; Rig-veda I,
114, 8; Taitt. Samh. IV, 5, 10, 3; V&g. Samh. XVI, 16. The
various readings are curious. Ayushi in the <Svet. Up., instead of
ayau in the Rig-veda, is supported by the Taitt. Samh. and the
V&g. Samh.; but Vi^wanatman reads iyau. As to bhamito, it seems
the right reading, being supported by the Rig-veda, the Taitt. Samh.,
and the <Svet. Up., while bh&vito in Roer's edition is a misprint.
The Vag. Samh. alone reads bhdmino, which Mahidhara refers to
viran. The last verse in the Rig-veda and Va^. Sa»»h. is havishman-
taA sadam it tva havamahe ; in the Taitt. Sawn, havishmanto namasi
vidhema te. In the .Svet. Up. havishmantaA sadasi tvi hav&mahe, as
printed by Roer, seems to rest on Ankara's authority only. The
other commentators, Sankarilnanda and Vi^wanatman, read and
interpret sadam it.
Digitized by
Google
V ADHYAYA, 3. 255
FIFTH ADHYAYA.
1. In the imperishable and infinite Highest
Brahman 1 , wherein the two, knowledge and ignorance,
are hidden 2 , the one, ignorance, perishes 3 , the other,
knowledge, is immortal ; but he who controls both,
knowledge and ignorance, is another*.
2. It is he who, being one only, rules over every
germ (cause), over all forms, and over all germs ; it
is he who, in the beginning, bears 5 in his thoughts
the wise son, the fiery, whom he wishes to look on 6
while he is born 7 .
3 8 . In that field 9 in which the god, after spreading
out one net after another 10 in various ways, draws it
together again, the Lord, the great Self 11 , having
I .Sankara explains Brahmapare by brahmawo hirawyagarbh&t
pare, or by parasmin brahma«i, which comes to the same. Vigni-
ndtman adds £MndasaA paranipitaA. As the termination e may
belong to the locative singular or to the nom. dual, commentators
vary in referring some of the adjectives either to brahman or to
vidy&vidye.
a Gudie, lokair^wdtum asakye, .Sankarinanda.
8 .Sankara explains ksharam by sa»?s«°tikara«am, amr/tam by
mokshahetuA.
4 .Sankara explains that he is different from them, being only the
sakshin, or witness. .Saftkarananda seems to have read Somya,
i. e. Somavatpriyadarjana, as if .SvetiLrvatvara addressed his pupil.
' Like a mother, see I, 9. 8 Like a father.
7 See on this verse the remarks made in the Introduction.
8 The MSS. read yasmin for asmin, and patayas for yatayas,
which the commentator explains by patin.
* The world, or the mulaprakr/ti, the net being the saws&ra.
10 Sankara explains ekaikam by pratyekam, i. e. for every crea-
ture, such as gods, men, beasts, &c.
II I doubt whether mahatmd should be translated by the great
Digitized by
Google
256 SVETASVATARA-UPANISHAD.
further created the lords 1 , thus carries on his lord-
ship over all.
4. As the car (of the sun) shines, lighting up all
quarters, above, below, and across, thus does that
god, the holy, the adorable, being one, rule over all
that has the nature of a germ 2 .
5. He, being one, rules over all and everything,
so that the universal germ ripens its nature, diversi-
fies all natures that can be ripened 3 , and determines
all qualities*.
6 6 . Brahma (Hirawyagarbha) knows this, which
is hidden in the Upanishads, which are hidden in
the Vedas, as the Brahma-germ. The ancient gods
Self, or whether great would not be sufficient. The whole verse is
extremely difficult.
1 From Hirawyagarbha to insects ; or beginning with Mari^i.
2 Cf. IV, ri ; V, 2.
8 MS. B. has priiyan, and explains it by purvotpannin.
4 This is again a very difficult verse. I have taken vwvayoniA
as a name for Brahman, possessed of that devatmajakti which was
mentioned before, but I feel by no means satisfied. The com-
mentators do not help, because they do not see the difficulty of the
construction. If one might conjecture, I should prefer paiet for
pa^ati, and should write pari«Smayed yat, and viniycgayed yat,
unless we changed ya££a into yar ka..
• This verse admits of various translations, and requires also
some metrical emendations. Thus Vi^-wanitman explains vedagu-
hyopanishatsu very ingeniously by the Veda, i.e. that part of it
which teaches sacrifices and their rewards; the Guhya, i.e. the
Arawyaka, which teaches the worship of Brahman under various
legendary aspects; and theUpanishads, which teach the knowledge
of Brahman without qualities. These three divisions would corre-
spond to the karmakaWa, yogakaWa, and gnsoiak&nda. ((raimini,
Pata^ali, Badarayawa). See Deussen, Vedanta, p. 20. Mr. Gough
and Dr. Roer take Brahmayoni as ' the source of the Veda,' or as
the source of Hirawyagarbha. The irregular form vedate may be
due to a corruption of vedante.
Digitized by
Google
V ADHYAYA, II. 257
and poets who knew it, they became it and were
immortal.
7 1 . But he who is endowed with qualities, and
performs works that are to bear fruit, and enjoys
the reward of whatever he has done, migrates
through his own works, the lord of life, assuming
all forms, led by the three Gu»as, and following the
three paths 2 .
8 3 . That lower one also, not larger than a thumb,
but brilliant like the sun, who is endowed with per-
sonality and thoughts, with the quality of mind and
the quality of body, is seen small even like the point
of a goad.
9. That living soul is to be known as part of the
hundredth part of the point of a hair 4 , divided a
hundred times, and yet it is to be infinite.
10. It is not woman, it is not man, nor is it
neuter ; whatever body it takes, with that it is
joined 6 (only).
11 6 . By means of thoughts, touching, seeing, and
1 Here begins the description of what is called the tvam (thou),
as opposed to the tat (that), i. e. the living soul, as opposed to the
Highest Brahman.
2 The paths of vice, virtue, and knowledge.
8 Both MSS. (A. and B.) read aragramStro hy avaro 'pi dri-
sh/a^.
4 An expression of frequent occurrence in Buddhist literature.
6 A. and B. read yu^yate. A. explains yu^yate by sambadh-
yate. B. explains adyate bhakshyate tirobhflta^ kriyate. .Saftkara
explains rakshyate, sawrakshyate, tattaddharman atmany adhyasyd-
bhimanyate.
8 The MSS. vary considerably. Instead of mohair, A. and B.
read homair. They read gr&s&mbuvr*'sh/ya £atma. A. reads
atmavivr/ddhi^anma, B. atmanivraldha^anmS. A. has abhisam-
prapadye, B. abhisamprapadyate. My translation follows Saftkara,
who seems to have read itmavivriddhi^anma, taking the whole line
[<5] S
Digitized by
Google
258 SVETASVATARA-UPANISHAD.
passions the incarnate Self assumes successively in
various places various forms 1 , in accordance with his
deeds, just as the body grows when food and drink
are poured into it.
12. That incarnate Self, according to his own
qualities, chooses (assumes) many shapes, coarse or
subtile, and having himself caused his union with
them, he is seen as another and another 2 , through
the qualities of his acts, and through the qualities of
his body.
13 s . He who knows him who has no beginning
and no end, in the midst of chaos, creating all things,
having many forms, alone enveloping everything, is
freed from all fetters.
14. Those who know him who is to be grasped
by the mind, who is not to be called the nest (the
body*), who makes existence and non-existence, the
as a simile and in an adverbial form. Vi^n&natman, however, differs
considerably. He reads homaiA, and explains homa as the act of
throwing oblations into the fire, as in the Agnihotra. This action
of the hands, he thinks, stands for all actions of the various mem-
bers of the body. Gr&sSmbiwYsh/i he takes to mean free distri-
bution of food and drink, and then explains the whole sentence by
'he whose self is born unto some states or declines from them
again, namely, according as he has showered food and drink, and
has used his hands, eyes, feelings, and thoughts.' 5ahkarSnanda
takes a similar view, only he construes sankalpanam and spanranam
as two drishAs, te eva dr«'sh/t, tayor dtmdgnau prakshepS. hovn&A ;
and then goes on, na kevalam etaih, kim tv asmin sthine jarire
grisimbuvn'sh/yd £a. He seems to read itmavivr/ddha^anmS, bat
afterwards explains vivr/'ddhi by vividhd vnddhii.
1 Forms as high as Hira«yagarbha or as low as beasts.
* Instead of aparo, B. reads avaro, but explains aparo.
8 Cf. Ill, 7; IV, r 4 , 16.
4 NWa is explained as the body, but .SankarSnanda reads anild-
khyam, who is called the wind, as being pr&«asya prSwam, the
breath of the breath.
Digitized by
Google
V ADHYAYA, 14. 259
happy one (Siva), who also creates the elements 1 ,
they have left the body.
1 Sankara explains kalasargakaram by he who creates the sixteen
kalis, mentioned by the Atharva»ikas, beginning with prSwa, and
ending with naman ; see Prama Up. VI, 4. Vigw&natman suggests
two other explanations, 'he who creates by means of the kal&,
i. e. his inherent power; ' or ' he who creates the Vedas and other
sciences.' The sixteen kalas are, according to .Sankardnanda,
prawa, waddhd, kha, v&yu, gyo\.\h, ap, pn'thivi, indriya, mana^, anna,
virya, tapa//, mantra, karman, kala (?), naman. See also before, I, 4.
S 2
Digitized by LaOOQ lC
260 svetAsvatara-upanishad.
SIXTH ADHYAYA.
i 1 . Somewise men, deluded, speak of Nature, and
others of Time (as the cause of everything 2 ) ; but it
is the greatness of God by which this Brahma-wheel
is made to turn.
2. It is at the command of him who always
covers this world, the knower, the time of time 3 ,
who assumes qualities and all knowledge 4 , it is at
his command that this work (creation) unfolds itself,
which is called earth, water, fire, air, and ether ;
3 6 . He who, after he has done that work and
rested again, and after he has brought together one
essence (the self) with the other (matter), with one,
two, three, or eight, with time also and with the
subtile qualities of the mind, j
4. Who, after starting 6 the works endowed with
(the three) qualities, can order all things, yet when,
in the absence of all these, he has caused the de-
struction of the work, goes on, being in truth 7
different (from all he has produced) ;
1 See Muir, Metrical Translations, p. 198.
2 See before, I, 2.
' The destroyer of time. Vi^-wanatman reads kalakalo, and ex-
plains it by kalasya niyantd, upaharta. .Saftkaraiianda explains kalaA
sarvavinfuakdri, tasyapi vinirakara^. See also verse 16.
* Or sarvavid ya/4.
- * Instead of vinivartya, Vig-reimatman and .Saftkarananda read
vinivr/tya.
' Aruhya for drabhya, Sahkarananda.
7 These two verses are again extremely obscure, and the expla-
nations of the commentators throw little light on their real, original
meaning. To begin with Sankara, he assumes the subject to be the
same as he at whose command this work unfolds itself, and explains
Digitized by
Google
vi adhyAya, 5. 261
5. He is the beginning, producing the causes
which unite (the soul with the body), and, being
tattvasya tattvena sametya yogam by atmano bhumyadina yoga»»
sawgamayya. As the eight Tattvas he gives earth, water, fire, air,
ether, mind, thought, personality, while the Atmaguwas are, according
to him, the affections of the mind, love, anger, &c. In the second verse,
however, •Saftkara seems to assume a different subject. ' If a man,'
he says, ' having done works, infected by qualities, should transfer
them on Irvara, the Lord, there would be destruction of the works
formerly done by him, because there would be no more connection
with the self.' Something is left out, but that this is .Sankara's idea,
appears from the verses which he quotes in support, and which are
intended to show that Yogins, transferring all their acts, good,
bad, or indifferent, on Brahman, are no longer affected by them.
' That person,' .Sankara continues, « his works being destroyed and
his nature purified, moves on, different from all things (tattva), from
all the results of ignorance, knowing himself to be Brahman.'
' Or,' he adds, ' if we read anyad, it means, he goes to that Brahman
which is different from all things.'
.Sahkarananda takes a different view. He says : ' If a man has
performed sacrifices, and has finished them, or, has turned away
from them again as vain, and if he has obtained union with that
which is the real of the (apparently) real, &c.' The commentator
then asks what is that with which he obtains union, and replies,
' the one, i. e. ignorance ; the two, i. e. right and wrong ; the three,
i.e. the three colours, red, white, and black ; and the eight, i. e. the five
elements, with mind, thought, and personality; also with time, and
with the subtile affections of the mind.' He then goes on, ' If that
man, after having begun qualified works, should take on himself
all states (resulting from ignorance), yet, when these states cease,
there would be an end of the work, good or bad, done by him, and
when his work has come to an end, he abides in truth (according to
the Veda) ; while the other, who differs from the Veda, is wrong.'
•Sahkarananda, however, evidently feels that this is a doubtful inter-
pretation, and he suggests another, viz. ' If the Lord himself,' he says,
' determined these states (bhava), it would seem that there would
be no end of sawsara. He therefore says, that when these states,
ignorance &c, cease, the work done by man ceases ; and when the
work done ceases, the living soul gets free of sawsira, being in
truth another, i. e. different from ignorance and its products.'
Vi^nanatman says : ' If a man, having done work, turns away
Digitized by
Google
262 .SVETASVATARA-UPANISHAD.
above the three kinds of time (past, present, future),
he is seen as without parts \ after we have first wor-
shipped that adorable god, who has many forms,
and who is the true source (of all things), as dwelling
in our own mind.
6. He is beyond all the forms of the tree 2 (of the
world) and of time, he is the other, from whom this
world moves round, when 3 one has known him who
from it, and obtains union of one tattva (the tvam, or self) with the
real tattva (the tat, or the Lord) ; — and how ? By means of the one,
i.e. the teaching of the Guru ; the two, i.e. love of the Guru and of the
Lord; the three, i.e. hearing, remembering, and meditating ; the eight,
i. e. restraint, penance, postures, regulation of the breath, abstrac-
tion, devotion, contemplation, and meditation (Yoga-sutras 11,29);
by time, i. e. the right time for work ; by the qualities of the self, i. e.
pity, &c. ; by the subtile ones, i. e. the good dispositions for know-
ledge, then (we must supply) he becomes free.' And this he ex-
plains more fully in the next verse. ' If, after having done qualified
works, i. e. works to please the Lord, a Yati discards all things,
and recognises the phenomenal character of all, states, and traces
them back to their real source in Mulaprakr/ti and, in the end,
in the SaMdananda, he becomes free. If they (the states) cease,
i. e. are known in their real source, the work done ceases also in its
effects, and when the work has been annihilated, he goes to free-
dom, being another in truth ; or, if we read anyat, he goes to what
is different from all these things, namely, to the Lord ; or, he goes
to a state of perfect lordship in truth, having discovered the highest
truth, the oneness of the self with the Highest Self.'
I think that, judging from the context, the subject is really the same
in both verses, viz. the Lord, as passing through different states, and
at last knowing himself to be above them all. Yet, the other explana-
tions may be defended, and if the subject were taken to be different
in each verse, some difficulties would disappear.
1 Vi^wanatman and .Sahkar&nanda read akalo 'pi, without parts,
and .Sankara, too, presupposes that reading, though the text is
corrupt in Roer's edition.
2 Explained as sazwsSravn'ksha, the world-tree, as described in
theKa/tfaUp.VI, 1.
8 It seems possible to translate this verse in analogy with the
former, and without supplying the verb either from yati, in verse 4,
Digitized by
Google
VI ADHYAYA, II. 263
brings good and removes evil, the lord of bliss, as
dwelling within the self, the immortal, the support
of all.
7. Let us know that highest great lord of lords \
the highest deity of deities, the master of masters,
the highest above, as god, the lord of the world, the
adorable.
8. There is no effect and no cause known of him, J/'
no one is seen like unto him or better; his high
power is revealed as manifold, as inherent, acting
as force and knowledge.
9. There is no master of his in the world, no ruler
of his, not even a sign of him 2 . He is the cause, \
the lord of the lords of the organs 3 , and there is of
him neither parent nor lord.
10. That only god who spontaneously covered
himself, like a spider, with threads drawn from
the first cause (pradhana), grant us entrance into
Brahman 4 ./'
11. He is the one God, hidden in all beings, all-
or from vidama, in verse 7. The poet seems to have said, he is
that, he is seen as that, when one has worshipped him, or when
one has known him within oneself. *
1 .Sahkara thinks that the lords are Vaivasvata &c; the deities,
Indra &c. ; the masters, the Pra^apatis. Vi^wanatman explains the
lords as Brahman, Vishwu, Rudra, &c; the deities as Indra, &c. ;
the masters as Hira»yagarbha, &c. Sahkarananda sees in the lords
Hira«yagarbha &c, in the deities Agni &c, in the masters the
Pra^apatis, such as Katyapa.
2 If he could be inferred from a sign, there would be no neces-
sity for the Veda to reveal him.
8 Karawa, instrument, is explained as organ of sense. The lords
of such organs would be all living beings, and their lord the true
Lord.
4 Besides brahmapyayam, i. e. brahma«y apyayam, ektbhavam,
another reading is brahmavyayam, i. e. brahma £avyaya« ia..
Digitized by
Google
s
264 svetAsvatara-upanishad.
pervading, the self within all beings, watching over
all works, dwelling in all beings, the witness, the
perceiver *, the only one, free from qualities.
12 2 . He is the one ruler of many who (seem to
act, but really do) not act 3 ; he makes the one seed
manifold. The wise who perceive him within their
self, to them belongs eternal happiness, not to others.
13 4 . He is the eternal among eternals, the thinker
among thinkers, who, though one, fulfils the desires
of many. He who has known that cause which is
to be apprehended by .SMkhya (philosophy) and
Yoga (religious discipline), he is freed from all
fetters.
1 All the MSS. seem to read £eta, not Mt&.
2 See Ka//$a-upanishad V, 12-15.
3 Sankara explains that the acts of living beings are due to their
organs, but do not affect the Highest Self, which always remains
passive (nishkriya).
4 I have formerly translated this verse, according to the reading
nityo 'nityanaw /fetanaj <tetan^ndm, the eternal thinker of non-
eternal thoughts. This would be a true description of the Highest
Self who, though himself eternal and passive, has to think (glvat-
man) "non-eternal thoughts. I took the first £etanaA in the sense
of £ett&, the second in the sense of fotanaw. The commentators,
however, take a different, and it may be, from their point, a more
correct view. .Sankara says : ' He is the eternal of the eternals,
i. e. as he possesses eternity among living souls (^ivas), these living
souls also may claim eternity. Or the eternals may be meant for
earth, water, &c. And in the same way he is the thinker among
thinkers.'
.Sahkarananda says : 'He is eternal, imperishable, among eternal,
imperishable things, such as the ether, &c. He is thinking among
thinkers.'
Vi^raSnalman says : ' The Highest Lord is the cause of eternity
in eternal things on earth, and the cause of thought in the thinkers
on earth.' But he allows another construction, namely, that he is
the eternal thinker of those who on earth are endowed with eter-
nity and thought. In the end all these interpretations come to
Digitized by
Google
y
vi adhyAya, i 8. 265
14. The 1 sun does not shine there, nor the moon
and the stars, nor these lightnings, and much less
this fire. When he shines, everything shines after
him ; by his light all this is lightened.
15. He is the one bird 2 in the midst of the world ;
he is also (like) the fire (of the sun) that has set in
the ocean. A man who knows him truly, passes
over death 3 ; there is no other path to go.
16. He makes all, he knows all, the self-caused,
the knower*, the time of time (destroyer of time),
who assumes qualities and knows everything, the
master of nature and of man 6 , the lord of the three
qualities (guwa), the cause of the bondage, the exist-
ence, and the liberation of the world 6 .
17. He who has become that 7 , he is the immortal,
remaining the lord, the knower, the ever-present
guardian of this world, who rules this world for ever,
for no one else is able to rule it.
18. Seeking for freedom I go for refuge to that
God who is the light of his own thoughts 8 , he who
the same, viz. that there is only one eternal, and only one thinker,
from whom all that is (or seems to be) eternal and all that is
thought on earth is derived.
1 See KsJA. Up.V, 15 ; Mand. Up. II, 2, 10; Bhagavadgf ti XV, 6.
2 Hawsa, frequently used for the Highest Self, is explained here
as hanty avidySdibandhakara«am iti hawsa^.
3 Cf. Ill, 8.
4 Again the MSS. read kalakalo, as in verse 2. They also agree
in putting gnsh before k&lakalo, as in verse 2.
5 Pradhdnam avyaktam, kshetra^rao vign&n&tmL
* He binds, sustains, and dissolves worldly existence.
7 He who seems to exist for a time in the form of kshetra^wa
and pradhana.
8 The MSS. vary between dtmabuddhiprakSf am and atmabuddhi-
prasadam. The former reading is here explained by 5ahkardnanda
as svabuddhisakshiwam.
Digitized by
Google
266 svetAsvatara-upanishad.
first creates Brahman (m.) 1 and delivers the Vedas
to him ;
19. Who is without parts, without actions, tran-
quil, without fault, without taint 2 , the highest bridge
to immortality — like a fire that has consumed its
fuel.
20. Only when men shall roll up the sky like
a hide, will there be an end of misery, unless God
has first been known 3 .
21. Through the power of his penance and
through the grace of God 4 has the wise .SVetasva-
tara truly 5 proclaimed Brahman, the highest and
holiest, to the best of ascetics 6 , as approved by
the company of ^?/shis.
1 Explained as Hirawyagarbha.
2 Nira.ngana.rn nirlepam.
s .Sankarananda reads tada rivam avi^rcaya du^khasyanto bhavi-
shyati; Vi^nanatman retains devam, but mentions sivam as a various
reading. Both have anto, not antam, like Roer. .Sankara seems
to have found na before bhavishyati, or to have read duAkhanto na
bhavishyati, for he explains that there will be no end of misery,
unless God has first been known. It is possible, however, that the
same idea may be expressed in the text as we read it, so that it
should mean, Only when the impossible shall happen, such as the
sky being rolled up by men, will misery cease, unless God has been
discovered in the heart.
4 The MSS. read devaprasadat, which is more in keeping with
the character of this Upanishad.
11 Samyak may be both adverb and adjective in this sentence,
kaldkshinyayena.
• Atyajramin is explained by .Sahkara as atyantam pftgyatama-
jramibhyaA ; and he adds, /Jaturvidha bhikshava? ka bahudakaku/1-
£akau, HawsaA paramahazwsaj ka yo yah r>ask&t sa uttamaA. Weber
(Indische Studien, II, 109) has himself corrected his mistake of
reading antyawamibhya^, and translating it by neighbouring
hermits.
These four stages in the life of a Sannyasin are the same to-day as
they were in the time of the Upanishads, and Dayananda Sarasvati
Digitized by
Google
vi adhyAya, 23. 267
22. This highest mystery in the Vedanta, delivered
in a former age, should not be given to one whose <
passions have not been subdued, nor to one who is <
not a son, or who is not a pupil 1 .
23. If these truths have been told to a high-minded
man, who feels the highest devotion for God, and for
his Guru as for God, then they will shine forth, — then
they will shine forth indeed.
describes them in his autobiography, though in a different order :
1. Ku/Waka, living in a hut, or in a desolate place, and wearing a
red-ochre coloured garment, carrying a three-knotted bamboo rod,
and wearing the hair in the centre of the crown of the head, having
the sacred thread, and devoting oneself to the contemplation of
Parabrahma. 2. Bahudaka, one who lives quite apart from his family
and the world, maintains himself on alms collected at seven houses,
and wears the same kind of reddish garment. 3. Hawsa, the same
as in the preceding case, except the carrying of only a one-knotted
bamboo. 4. Paramaha/wsa, the same as the others ; but the ascetic
wears the sacred thread, and his hair and beard are quite long.
This is the highest of all orders. A Paramahawsa who shows him-
self worthy is on the very threshold of becoming a Dikshita.
1 Cf. Bnh. Up. VI, 3, 12; Maitr. Up. VI, 29.
Digitized by
Google
Digitized by
Google
PRASATV-UPANISHAD.
Digitized by
Google
Digitized by
Google
PRA579A-UPANISHAD.
First Question.
Adoration to the Highest Self! Hari^, Om !
i. Sukesas 1 Bharadva^a 2 , and .Saivya Satyakama,
and Sauryayamn 3 Gargya, and Kausalya* A^vala-
yana, and Bhargava Vaidarbhi 6 , and Kabandhin
Katyayana, these were devoted to Brahman, firm in
Brahman, seeking for the Highest Brahman. They
thought that the venerable Pippalada could tell them
all that, and they therefore took fuel in their hands
(like pupils), and approached him.
2. That i?*shi said to them: 'Stay here a year
longer, with penance, abstinence, and faith; then
you may ask questions according to your pleasure,
and if we know them, we shall tell you all.'
3. Then 6 Kabandhin Katyayana approached him
and asked : ' Sir, from whence may these creatures
be born ?'
1 Sukeras seems better than Sukcran, and he is so called in the
sixth Praw&a, in MS. Mill 74.
* Bh&radv&ga, Saivya, Girgya, Awal&yana, Bhirgava, and K&tya-
yana are, according to .Sahkara, names of gotras or families.
8 Sfiryasyipatyaflj SauryaA, tadapatyaw .Saury&yawW. DtrghaA
sulopaj ka. Mandasa iti sa eva Sauryayawi.
4 Kausalyo nSmataA, kosalayam bhavo va.
* Vaidarbhi is explained as vidarbheA prabhavaA, or Vidarbheshu
prabhavaA. Vidarbha, a country, south of the Vindhya mountains,
with Kutfrfina as its capital. Vaidarbha, a king of the Vidarbhas, is
mentioned in the Ait. Br&hm. VII, 34. Vaidarbhi is a patronymic
of Vidarbha. See B. R. s. v.
8 After the year was over.
K-> '
Digitized by
Google
272 PRASWA-UPANISHAD.
4. He replied: 'Pra^apati (the lord of creatures)
was desirous of creatures (pra^a^). He performed
penance 1 , and having performed penance, he pro-
duces a pair, matter (rayi) and spirit (pra«a), think-
ing that they together should produce creatures for
him in many ways.
5 2 . The sun is spirit, matter is the moon. All
this, what has body and what has no body, is matter,
and therefore body indeed is matter.
6. Now Aditya, the sun, when he rises, goes
toward the East, and thus receives the Eastern
spirits into his rays. And when he illuminates the
South, the West, the North, the Zenith, the Nadir,
the intermediate quarters, and everything, he thus
receives all spirits into his rays.
7. Thus he rises, as Vai^vinara, (belonging to all
men,) assuming all forms, as spirit, as fire. This
has been said in the following verse :
8 s . (They knew) him who assumes all forms, the
golden *, who knows all things, who ascends highest,
alone in his splendour, and warms us ; the thousand-
rayed, who abides in a hundred places, the spirit of
all creatures, the Sun, rises.
9. The year indeed is Pra^ipati, and there are
two paths thereof, the Southern and the Northern.
Now those who here believe in sacrifices and pious
gifts as work done, gain the moon only as their
1 Or he meditated ; see Upanishads, vol. i, p. 238, n. 3.
1 Sankara explains, or rather obscures, this by saying that the
sun is breath, or the eater, or Agni, while matter is the food,
namely, Soma.
8 Cf. Maitr. Up.VI, 8.
4 Hariwam is explained as rajmimantam, or as harati sarvesham
pr&winam ayuzwshi bhauman vi rasan iti hariwaA. I prefer to take
it in the sense of yellow, or golden.
Digitized by
Google
I QUESTION, 15. 273
(future) world, and return again. Therefore the
^?«his who desire offspring, go to the South, and
that path of the Fathers is matter (rayi).
10. But those who have sought the Self by
penance, abstinence, faith, and knowledge, gain by
the Northern path Aditya, the sun. This is the
home of the spirits, the immortal, free from danger,
the highest. From thence they do not return, for
it is the end. Thus says the .Sloka J :
11. Some call him the father with five feet (the
five seasons), and with twelve shapes (the twelve
months), the giver of rain in the highest half of
heaven ; others again say that the sage is placed in
the lower half, in the chariot 2 with seven wheels
and six spokes.
12. The month is Pra^Apati; its dark half is
matter, its bright half spirit. Therefore some ifoshis
perform sacrifice in the bright half, others in the
other half.
13. Day and Night* are Pra^apati; its day is
spirit, its night matter. Those who unite in love
by day waste their spirit, but to unite in love by
night is right.
14. Food is Pragapati. Hence proceeds seed,
and from it these creatures are born.
1 5. Those therefore who observe this rule of
Pra/apati (as laid down in § 13), produce a pair,
and to them belongs this Brahma-world here 4 . But
1 Rig-veda I, 164, 12. We ought to read upare vi£aksha»am.
8 Sapta^akre, i. e. rathe. The seven wheels are explained as the
rays or horses of the sun ; or as half-years, seasons, months, half-
months, days, nights, and muhurtas.
* Taken as one, as a Nychthemeron.
* In the moon, reached by the path of the Fathers.
['51 T
/
Digitized by
Google
2 74 PR AS#A-UPAN ISH AD.
those in whom dwell penance, abstinence, and
truth,
1 6. To them belongs that pure Brahma- world,
to them, namely, in whom there is nothing crooked,
nothing false, and no guile.'
Second Question.
i. Then Bhargava Vaidarbhi asked him: 'Sir,
How many gods 1 keep what has thus been created,
how many manifest this 2 , and who is the best of
them ? '
2. He replied : 'The ether is that god, the wind,
fire, water, earth, speech, mind, eye, and ear. These,
when they have manifested (their power), contend
and say : We (each of us) support this body and
keep it 8 .
3 4 . Then Prawa (breath, spirit, life), as the best,
said to them : Be not deceived, I alone, dividing
myself fivefold, support this body and keep it.
4. They were incredulous ; so he, from pride, did
as if he were going out from above. Thereupon,
1 DevaA, powers, organs, senses.
a Their respective power.
5 This is .Sankara's explanation, in which b£«a is taken to mean
the same as farira, body. But there seems to be no authority for
such a meaning, and Anandagiri tries in vain to find an etymological
excuse for it. B&wa or V£»a generally means an arrow, or, parti-
cularly in Brihmawa writings, a harp with many strings. I do not
see how an arrow could be used as an appropriate simile here, but
a harp might, if we take avash/abhya in the sense of holding the
frame of the instrument, and vidh&ray&maA in the sense of stretch-
ing and thereby modulating it.
4 On this dispute of the organs of sense, see Bnh. Up. VI, 1,
p. 2015 Kh&ai. Up. V, 1 (S. B. E.,vol. i, p. 72).
Digitized by
Google
'4,0,
II QUESTION, IO. \? 4 ^5^< N 1^.
X "
as he went out, all the others went out, and as he"
returned, all the others returned. As bees go out
when their queen 1 goes out, and return when she
returns, thus (did) speech, mind, eye, and ear ; and,
. being satisfied, they praise Pra#a, saying :
5. He is Agni (fire), he shines as Surya (sun),
he is Par^anya (rain), the powerful (Indra), he is
Vayu (wind), he is the earth, he is matter, he is
God — he is what is and what is not, and what
is immortal.
6. As spokes in the nave of a wheel, everything
is fixed in Pra#a, the verses of the i?zg-veda, Ya^ur-
veda, Sama-veda, the sacrifice, the Kshatriyas, and
the Brahmans.
7. As Pra^apati (lord of creatures) thou movest
about in the womb, thou indeed art born again.
To thee, the Prawa, these creatures bring offerings,
to thee who dwellest with the other prawas (the
organs of sense).
8. Thou art the best carrier for the Gods, thou
art the first offering 2 to the Fathers. Thou art the
true work of the ifo'shis 3 , of the Atharvangiras.
9. O Pra«a, thou art Indra by thy light, thou art
Rudra, as a protector ; thou movest in the sky, thou
art the sun, the lord of lights.
10. When thou showerest down rain, then,0 Pra^a,
these creatures of thine are delighted *, hoping that
there will be food, as much as they desire.
1 In Sanskrit it is madhukarar£g r a, king of the bees.
B When a irdddha is offered to the Pirn's.
8 Explained as the eye and the other organs of sense which the
chief PrS»a supports ; but it is probably an old verse, here applied
to a special purpose.
4 Another reading is pra^ate, they breathe.
T 2
■ Digitized by
Google
276 PRAStfA-UPANISHAD.
1 1. Thou art a Vr&tya \ O Pra#a, the only .foshi 2 ,
the consumer of everything, the good lord. We are
the givers of what thou hast to consume, thou, O
Mataiirva 8 , art our father.
12. Make propitious that body of thine which
dwells in speech, in the ear, in the eye, and which
pervades the mind ; do not go away !
13. All this is in the power of Pra#a, whatever
exists in the three heavens. Protect us like a
mother her sons, and give us happiness and wisdom.'
Third Question.
1. Then Kausalya A.yvalayana asked: 'Sir, whence
is that Pr&#a (spirit) born? How does it come
into this body? And how does it abide, after it
has divided itself? How does it go out? How
does it support what is without *, and how what is
within ? '
2. He replied : ' You ask questions more difficult,
but you are very fond of Brahman, therefore I shall
tell it you.
3. This Pra«a (spirit) is born of the Self. Like
the shadow thrown on a man, this (the pr&»a) is
1 A person for whom the sawsk&ras, the sacramental and initiatory
rites, have not been performed. Ankara says that, as he was the
first born, there was no one to perform them for him, and that he
is called VrStya, because he was pure by nature. This is all very
doubtful.
8 Agni is said to be the i?/shi of the Atharvawas.
* Instead of the irregular vocative M&tarLrva, there is another
reading, MdtaruvanaA, i.e. thou art the father of M&tarLsvan, the
wind, and therefore of the whole world.
* All creatures and the gods.
Digitized by
Google
Ill QUESTION, 6. 277
spread out over it (the Brahman) \ By the work of
the mind 2 does it come into this body.
4. As a king commands officials, saying to them :
Rule these villages or those, so does that Pra«a
(spirit) dispose the other pra«as, each for their
separate work.
5. The Apana (the down-breathing) in the organs
of excretion and generation; the Pra«a himself
dwells in eye and ear, passing through mouth and
nose. In the middle is the Samana 3 (the on-
breathing); it carries what has been sacrificed as
food equally (over the body), and the seven lights
proceed from it.
6. The Self 4 is in the heart. There are the 10 1
arteries, and in each of them there are a hundred
(smaller veins), and for each of these branches
there are 72,000 5 . In these theVyana(the back-
breathing) moves.
1 Over Brahman, i. e. the Self, the parama purusha, the akshara, ,
the satya. The pra»a being called a shadow, is thereby implied to
be unreal (anr/'ta). .Sankara.
3 Manokr/'ta is explained as an arsha sandhi. It means the good
or evil deeds, which are the work of the mind.
* I keep to the usual translation of Sam&na by on-breathing, though
it is here explained in a different sense. Samana is here supposed
to be between prawa and ap&na, and to distribute the food equally,
samam, over the body. The seven lights are explained as the two
eyes, the two ears, the two nostrils, and the mouth.
4 Here the Ling&tma or <ziv&tma\
6 A hundred times 101 would give us 10,100, and each multiplied
by 72,000 would give us a sum total of 727,200,000 veins, or, if we
add the principal veins, 727,210,201. Anandagiri makes the sum
total, 72 4o/is, 72 lakshas, six thousands, two hundred and one,
where the six of the thousands seems to be a mistake for dajrasa-
hasram. In the Brehadar. Upanishad II, 1, 19, we read of 72,000
arteries, likewise in Ya^navalkya III, Ite8. See also Brih. Up. IV,
Digitized by
Google
278 PRAStfA-UPANISHAD.
7. Through one of them, the Udana (the out-
breathing) leads (us) upwards to the good world by
good work, to the bad world by bad work, to the
world of men by both.
8. The sun rises as the external Prawa, for it
assists the Pra#a in the eye \ The deity that exists
in the earth, is there in support of man's Apana
(down-breathing). The ether between (sun and
earth) is the Samana (on-breathing), the air is Vyana
(back-breathing).
9. Light is the Udana (out-breathing), and there-
fore he whose light has gone out comes to a new
birth with his senses absorbed in the mind.
10. Whatever his thought (at the time of death)
with that he goes back to Pra«a, and the Prawa,
united with light 2 , together with the self (the ^Ivitmd)
leads on to the world, as deserved.
11. He who, thus knowing, knows Pra#a, his
offspring does not perish, and he becomes immortal.
Thus says the ►S'loka :
12. He who has known the origin 8 , the entry,
the place, the fivefold distribution, and the internal
state * of the Pra#a, obtains immortality, yes, obtains
immortality.'
3, 20 ; Ktend. Up. VI, 5, 3, comm. ; Kaush. Up. IV, 20 ; KaJha.
Up. VI, 16.
1 Without the sun the eye could not see.
2 With Udana, the out-breathing.
8 This refers to the questions asked in verse 1, and answered in
the verses which follow.
4 The adhyatma,as opposed to the vahya, mentioned in verse 1.
Ayati instead of ayati is explained by M&nd&sam hrasvatvam.
Digitized by
Google
IV QUESTION, 3. 279
Fourth Question.
1. Then Sauryaya#in Gargya asked :' Sir, What
are they that sleep in this man, and what are they
that are awake in him ? What power (deva) is it
that sees dreams ? Whose is the happiness ? On
what do all these depend ? '
2. He replied : ' O Gargya, As all the rays of the
sun, when it sets, are gathered up in that disc of
light, and as they, when the sun rises again and
again, come forth, so is all this (all the senses)
gathered up in the highest faculty (deva) \ the mind.
Therefore at that time that man does not hear, see,
smell, taste, touch, he does not speak, he does not
take, does not enjoy, does not evacuate, does not
move about. He sleeps, that is what people say.
__^3« The fires of the pra«as are, as it were 2 , awake
in that town (the body). The Apana is the Garha-
patya fire, the Vyana the Anvaharyapa^ana fire ; and
because it is taken out of the Garhapatya fire, which
is fire for taking out 3 , therefore the Pra»a is the
Ahavanlya fire*.
1 See note to verse 5. 2 We ought to read agnaya iva.
s Pra*ayana, prawiyate 'smSd iti pra«ayano gSrhapatyo 'gaiA.
* The comparison between the pra«as and the fires or altars is
not very clear. As to the fires or altars, there is the Garhapatya,
placed in the South-west, the household fire, which is always kept
burning, from which the fire is taken to the other altars. The
Anvdhiryapa^ana, commonly called the Dakshi«a fire, placed in
the South, used chiefly for oblations to the forefathers. The
Ahavanlya fire, placed in the East, and used for sacrifices to the
gods.
Now the Apina is identified with the GSrhapatya fire, no reason
being given except afterwards, when it is said that the Pra«a is
the Ahavaniya fire, being taken out of the Garhapatya, here called
Digitized by
Google
280 PRAStfA-UPANISHAD.
4. Because it carries equally these two oblations,
the out-breathing and the in-breathing, the Samana
is he (the Hotri priest) 1 . The mind is the sacri-
fice^ the Udana is the reward of the sacrifice, and
it leads the sacrificer every day (in deep sleep) to
Brahman.
5. There that god 2 (the mind) enjoys in sleep
greatness. What has been seen, he 2 sees again ;
what has been heard, he hears again ; what has been
enjoyed in different countries and quarters, he enjoys
again ; what has been seen and not seen, heard and
not heard, enjoyed and not enjoyed, he sees it all ;
he, being all, sees.
6. And when he is overpowered by light 3 , then
that god sees no dreams, and at that time that
happiness arises in his body.
7. And, O friend, as birds go to a tree to roost,
thus all this rests in the Highest Atman, —
8. The earth and its subtile elements, the water
and its subtile elements, the light and its subtile
elements, the air and its subtile elements, the ether
and its subtile elements ; the eye and what can be
prawayana, in the same manner as the prawa proceeds in sleep
from the apana. The Vy&na is identified with the Dakshiwagni,
the Southern fire, because it issues from the heart through an
aperture on the right.
1 The name of the Hotri priest must be supplied. He is sup-
posed to carry two oblations equally to the Ahavaniya, and in the
same way the Vyina combines the two breathings, the in and out
breathings.
* The ^iv&tman under the guise of manas. The Sanskrit word
is deva, god, used in the sense of an invisible power, but as a
masculine. The commentator uses manodevaA, p. 212, 1. 5. I
generally translate deva, if used in this sense, by faculty, but the
context required a masculine. See verse 2.
* In the state of profound sleep or sushupti.
Digitized by
Google
V QUESTION, 2. 28 1
seen, the ear and what can be heard, the nose and
what can be smelled, the taste and what can be
tasted, the skin and what can be touched, the voice
and what can be spoken, the hands and what can
be grasped, the feet and what can be walked, the
mind and what can be perceived, intellect (buddhi)
and what can be conceived, personality and what
can be personified, thought and what can be thought,
light and what can be lighted up, the Prawa and
what is to be supported by it
9. For he it is who sees, hears, smells, tastes,
perceives, conceives, acts, he whose essence is know-
ledge \ the person, and he dwells in the highest,
indestructible Self, —
10. He who knows that indestructible being, obtains
(what is) the highest and indestructible, he without
a shadow, without a body, without colour, bright, —
yes, O friend, he who knows it, becomes all-knowing,
becomes all. On this there is this .Sloka :
11. He, O friend, who knows that indestructible
being wherein the true knower, the vital spirits
(pra«as), together with all the powers (deva), and
the elements rest, he, being all-knowing, has pene-
trated all'
Fifth Question.
1. Then .Saivya Satyakama asked him : 'Sir, if some
one among men should meditate here until death
on the syllable Om, what would he obtain by it ? '
2. He replied: 'O Satyakama, the syllable Om
(AUM) is the highest and also the other Brahman ;
1 Buddhi and the rest are the instruments of knowledge, but
there is the knower, the person, in the Highest Self.
Digitized by
Google
282 PRAS#A-UPANISHAD.
therefore he who knows it arrives by the same
means 1 at one of the two.
3. If he meditate on one Matra (the A) 2 , then,
being enlightened by that only, he arrives quickly
at the earth 8 . The i?z£-verses lead him to the
world of men, and being endowed there with penance,
abstinence, and faith, he enjoys greatness.
4. If he meditate with * two Matras (A + U) he
arrives at the Manas 5 , and is led up by the Ya_fus-
verses to the sky, to the Soma-world. Having enjoyed
greatness in the Soma-world, he returns again.
5. Again, he who meditates with this syllable
AUM of three Matras, on the Highest Person, he
comes to light and to the sun. And as a snake is
freed from its skin, so is he freed from evil. He
is led up by the Saman-verses to the Brahma-
world 8 ; and from him, full of life (Hira#yagarbha,
the lord of the Satya-loka 7 ), he learns 8 to see the
all-pervading, the Highest Person. And there are
these two .Slokas :
6. The three Matras (A + U+M), if employed
separate, and only joined one to another, are mortal 9 ;
1 Ayatanena, alambanena.
2 Dipikaya»e Va£aspatinaivakaramatram ityeva vyakhyatam.
3 Sampadyate prapnoti g-anmeti jeshaA.
4 .Srutau tri'tiya dvitfyarthe.
8 Literally the mind, but here meant for the moon, as before.
It is clear that manasi belongs to sampadyate, not, as the Dtpik£
and Roer think, to dhyayita. Some take it for svapnabhimant
HirawyagarbhaA.
6 The world of HirawyagarbhaA, called the Satyaloka.
7 On a later addition, bringing in the Om as consisting of three
Matras and a half, see Weber, Ind. Stud. I, p. 453; Roer, p. 138.
8 Tadupadereneti yivat.
9 Because in their separate form, A, U, M, they do not mean
the Highest Brahman.
Digitized by
Google
VI QUESTION, 4. 283
but in acts, external, internal, or intermediate, if
well performed, the sage trembles not \
7. Through the J&k-verses he arrives at this
world, through the Ya^us-verses at the sky, through
the Saman- verses at that which the poets teach, — he
arrives at this by means of the Oiikara; the wise
arrives at that which is at rest, free from decay, from
death, from fear, — the Highest.'
Sixth Question.
1. Then Sukeras Bhlradva^a asked him, saying:
' Sir, Hira«yanabha, the prince of Kosala 2 , came to
me and asked this question : Do you know the
person of sixteen parts, O Bharadva^a ? I said to
the prince : I do not know him ; if I knew him,
how should I not tell you ? Surely, he who speaks
what is untrue withers away to the very root;
therefore I will not say what is untrue. Then he
mounted his chariot and went away silently. Now
I ask you, where is that person ?'
2. He replied : 'Friend, that person is here within
the body, he in whom these sixteen parts arise.
3. He reflected : What is it by whose departure
I shall depart, and by whose staying I shall stay ?
4. He sent forth (created) Pra«a (spirit) 3 ; from
1 The three acts are explained as waking, slumbering, and deep
sleep; or as three kinds of pronunciation, tdra-mandra-madhyama.
They are probably meant for Yoga exercises in which the three
Matris of Om are used as one word, and as an emblem of the
Highest Brahman.
2 .Sankara explains Kausalya by Kosal&y&m bhava^. Ananda-
tirtha gives the same explanation. Kosali is the capital, generally
called Ayodhya. There is no authority for the palatal s.
8 Sankara explains pr£«a by sarvapriwo Hirawyagarbha (sarva-
pra«ikara»&dh&ram antarSlmSnam).
Digitized by
Google
284 PRAStfA-UPANISHAD.
Pra#a .Sraddha (faith) 1 , ether, air, light, water, earth,
sense, mind, food ; from food came vigour, penance,
hymns, sacrifice, the worlds, and in the worlds the
name 2 also.
5. As these flowing rivers 8 that go towards the
ocean, when they have reached the ocean, sink into
it, their name and form are broken, and people speak
of the ocean only, exactly thus these sixteen parts of
the spectator that go towards the person (purusha),
when they have reached the person, sink into him,
their name and form are broken, and people speak
of the person only, and he becomes without parts
and immortal. On this there is this verse :
6. That person who is to be known, he in whom
these parts rest, like spokes in the nave of a wheel,
you know him, lest death should hurt you.'
7. Then he (Pippalada) said to them : ' So far do
I know this Highest Brahman, there is nothing
higher than it'
8. And they praising him, said : ' You, indeed, are
our father, you who carry us from our ignorance to
the other shore.'
Adoration to the highest ifoshis !
Adoration to the highest -ffz'shis !
Tat sat. Hari^, Om !
1 Faith is supposed to make all beings act rightly.
2 Nama stands here for n&marupe, name (concept) and form.
See before, p. 259.
3 Cf. Mu»«/. Up. IV, 2, 8 ; -Odnd. Up. VIII, 10.
Digitized by
Google
MAITR AYAiVA-BRAH MAJVA-
UPANISHAD.
Digitized by
Google
Digitized by
Google
MAITRAYAiVA-BRAH MANA-
UPANISHAD.
First PRAPArffAKA.
i. The laying of the formerly-described sacrificial
fires x is indeed the sacrifice of Brahman. Therefore
let the sacrificer, after he has laid those fires, medi-
tate on the Self. Thus only does the sacrificer
become complete and faultless.
But who is to be meditated on ? He who is
called Pra«a (breath). Of him there is this story :
2. A King, named Brzhadratha, having established
his son in his sovereignty 2 , went into the forest,
because he considered this body as transient, and
had obtained freedom from all desires. Having
performed the highest penance, he stands there, with
uplifted arms, looking up to the sun. At the end
of a thousand (days) 3 , the Saint .Sakayanya *, who
knew the Self, came near 6 , burning with splendour,
1 The performance of all the sacrifices, described in the MaitrS-
ya»a-brahma»a, is to lead up in the end to a knowledge of Brahman,
by rendering a man fit for receiving the highest knowledge. See
Manu VI, 82 : 'All that has been declared (above) depends on medi-
tation ; for he who is not proficient in the knowledge of the Self
reaps not the full reward of the performance of rites.'
* Instead of virigye, a doubtful word, and occurring nowhere
else, m. reads vair%ye.
* Or years, if we read sahasrasya instead of sahasr&hasya.
4 The descendant of .SSkdyana. Saint is perhaps too strong ; it
means a holy, venerable man, and is frequently applied to a Buddha.
8 Both M. and m. add muneA before antikam, whereas the com-
mentary has r&gnzh.
Digitized by
Google
288 maitrAyajva-brAhma^a-upanishad.
like a fire without smoke. He said to the King:
'Rise, rise! Choose a boon!'
The King, bowing before him, said : ' O Saint, I
know not the Self, thou knowest the essence (of the
Self). We have heard so. Teach it us.'
.Sak&yanya replied : ' This was achieved of yore ;
but what thou askest is difficult to obtain 1 . O
Aikshvaka, choose other pleasures.'
The King, touching the Saint's feet with his head,
recited this Gathi :
3. ' O Saint, What is the use of the enjoyment of
pleasures in this offensive, pithless body — a mere
mass of bones, skin, sinews, marrow a , flesh, seed,
blood, mucus, tears, phlegm, ordure, water 8 , bile,
and slime ! What is the use of the enjoyment of
pleasures in this body which is assailed by lust,
hatred, greed, delusion, fear, anguish, jealousy, sepa-
ration from what is loved, union with what is not
loved * hunger, thirst, old age, death, illness, grief,
and other evils !
4. And we see that all this is perishable, as these
flies, gnats, and other insects, as herbs and trees 6 ,
1 Though the commentator must have read etad vrAtam purastSd
du&rakyam etat pramam, yet pramam as a neuter is very strange.
M. reads etad vr/'ttam purast&t, duwakama priAMa pramam ;
m. reads etad vratam purastad arakyam ma przHa praxnam
aikshvaka, &c. This suggests the reading, etad wrttam purastad
dufoakam mi pri&kka. prawiam, i. e. this was settled formerly, do
not ask a difficult or an impossible question.
* Read maggL * M. adds vita before pitta ; not m.
4 An expression that often occurs in Buddhist literature. See
also Manu VI, 62 : 'On their separation from those whom they
love, and their union with those whom they hate ; on their strength
overpowered by old age, and their bodies racked with disease.'
• The Sandhi vanaspatayodbhuta for vanaspataya udbhuta is
anomalous. M. reads vanaspatayo bhutapradhvawsinaA.
Digitized by
Google
I PRAPArtfAKA, 4. 289
growing and decaying. And what of these ? There
are other great ones, mighty wielders of bows, rulers
of empires, Sudyumna, Bhuridyumna, Indradyumna,
Kuvalayarva, Yauvanasva, Vadhryasva, A^vapati 1 ,
.Sasabindu, HarLy^andra, Ambarlsha 2 , Nahusha,
Ananata, .Saryati, Yayati, Anara^ya 3 , Ukshasena *,
&c, and kings such as Marutta, Bharata (Daush-
yanti), and others, who before the eyes of their whole
family surrendered the greatest happiness, and
passed on from this world to that. And what of
these ? There are other great ones. We see the
destruction 5 of Gandharvas, Asuras 6 , Yakshas, Ra-
kshasas, Bhutas, Ga»as, Visik&as, snakes, and vam-
pires. And what of these ? There is the drying
up of other great oceans, the falling of mountains,
the moving of the pole-star, the cutting of the wind-
ropes (that hold the stars), the submergence of the
earth, and the departure of the gods (suras) from
their place. In such a world as this, what is the
use of the enjoyment of pleasures, if he who has
fed 7 on them is seen 8 to return (to this world) again
1 M. carries on ajvapatimabinduharu&indrSmbarisha.
2 After Ambarlsha, M. reads NabhushSnanutuf ayyatiyaydtyanara-
«ya1cshasen&dayo. Nahusha (Naghusha ?) is the father of Sary&ti ;
N&bhaga, the father of Ambartsha. These names are so care-
lessly written that even the commentator says that the text is
either Mindasa, or pr&m&dika. An&nata is a mere conjecture. It
occurs as the name of a Jiisbi in Rig-veda IX, in.
3 Anarawya, mentioned in the Mah&bh&rata, I, 230.
4 M. reads anarawyakshasena.
8 M. and m. read nirodhanam. • M. adds Apsarasas.
7 M. and m. read sUritasya, but the commentator explains ari-
tasya.
8 Here we have the Maitrdya«a Sandhi, dr/jyata" iti, instead
of dr/iyata iti ; see von Schroeder, Maitraya«f Sawhitd, p. xxviii.
M. and m. read dmyata.
' [15] V
Digitized by
Google
29O MAITRAYAiVA-BRAHMAiVA-UPANISHAD.
and again! Deign therefore to take me out! In
this world I am like a frog in a dry well. O Saint,
thou art my way, thou art my way.'
Second PRAPArffAKA.
1. Then the Saint .Sakayanya, well pleased, said
to the King: 'Great King Brz'hadratha, thou banner
of the race of Ikshvaku, quickly obtaining a know-
ledge of Self, thou art happy, and art renowned by
the name of Marut, the wind \ This indeed is thy
Self 2 .'
' Which 3 , O Saint,' said the King.
Then the Saint said to him :
2. ' He 4 who, without stopping the out-breathing 6 ,
proceeds upwards (from the sthula to the sukshma
.rarira), and who, modified (by impressions), and yet
not modified 6 , drives away the darkness (of error),
he is the Self. Thus said the Saint Maitri V And
.Sakayanya said to the King Brzhadratha : ' He who
in perfect rest, rising from this body (both from
the sthula and sukshma), and reaching the highest
1 Pn'shada^va in the Veda is another name of the Maruts, the
storm gods. Afterwards the king is called Marut, VI, 30.
2 This sentence is called a Sutra by the commentator to VI, 32.
8 M. reads Kathaya me katamo bhavan iti.
4 M. leaves out atha.
8 One might read dvish/ambhanena, in the sense of while pre-
venting the departure of the vital breath, as in the Brih. Ar. VT, 3,
priwena rakshann avaram kulayam.
e M. reads vyathamano 'vyathamSnas.
7 M. leaves out Maitri^-ity tvam hyaha. The commentator ex-
plains Maitrir by mitraya apatyam n'shir maitrir maitreya. In a later
passage (II, 3) M. reads Bhagavatd Maitrewa, likewise the Anubhuti-
prakira.
Digitized by
Google
II PRAPArffAKA, 4. 29I
light 1 , conies forth in his own form, he is the Self 2
(thus said 6akayanya); this is the immortal, the
fearless, this is Brahman.'
3. ' Now then this is the science of Brahman, and
the science of all Upanishads, O King, which was
told us by the Saint Maitri \ I shall tell it to thee :
' We hear (in the sacred records) that there were
once the Valakhilyas *, who had left off all evil, who
were vigorous and passionless. They said to the Pra-
^apati Kratu : " O Saint, this body is without intel-
ligence, like a cart. To what supernatural being
belongs this great power by which such a body has
been made intelligent ? Or who is the driver ?
What thou knowest, O Saint, tell us that 6 ." ' Pra^a-
pati answered and said :
4. ' He who in the .SVuti is called " Standing
above," like passionless ascetics 6 amidst the objects
of the world, he, indeed, the pure, clean, undeveloped,
tranquil, breathless, bodiless 7 , endless, imperishable,
firm, everlasting, unborn, independent one, stands in
his own greatness, and by him has this body been
made intelligent, and he is also the driver of it'
1 M. adds svayaw ^yotir upasampadya.
8 M. reads esha for ity esha, which seems better.
' M. reads Maitrewa vyakhyatd.
* M. M., Translation of Rig-veda, Preface, p. xxxiv.
6 M. adds : bruhfti te hoiur Bhagavan katham anena vasyaw* yat
Bhagavan vetsy etad asmakaw bruhiti tan hova&ti.
• The commentator allows urdhvaretasasaA to be taken as a
vocative also.
' Niratmi is explained by the commentator as thoughtless, with-
out volition, &c. But atma is frequently used for body also, and
this seems more appropriate here. M., however, reads anuatmS,
and this is the reading explained in the Anubhutiprakira, p. 228,
ver. 60. This might mean the Atman which has not yet assumed
the quality of a personal god. See VI, 28 ; VI, 31.
U 2
Digitized by
Google
292 maitrAyaya-brAhmazva-upanishad.
They said: 'O Saint, How has this been made
intelligent by such a being as this which has no
desires 1 , and how is he its driver?' He answered
them and said :
5. ' That Self which is very small, invisible, in-
comprehensible, called Purusha, dwells of his own
will here in part 2 ; just as a man who is fast asleep
awakes of his own will 3 . And this part (of the Self)
which is entirely intelligent, reflected in man (as the
sun in different vessels of water), knowing the body
(kshetra^wa), attested by his conceiving, willing, and
believing 4 , is Pra^apati (lord of creatures), called
Visva. By him, the intelligent, is this body made
intelligent, and he is the driver thereof.'
They said to him : ' O Saint 6 , if this has been
made intelligent by such a being as this, which has
no desires, and if he is the driver thereof, how was
it?' He answered them and said :
6. ' In the beginning Pra^ apati (the lord of
creatures) stood alone. He had no happiness, when
alone. Meditating 6 on himself, he created many
1 The reading anish/Aena is explained by the commentator as free
from any local habitation or attachment. He also mentions the
various readings anish/ena, free from wishes, and awish/ftena, the
smallest M. reads ani&Wena, and this seems better than anish/ena.
The Anubhutiprakaja reads likewise ani^^asya.
* I read buddhipurvam, and again with M. suptasyeva buddhi-
purvam. I also read aw^ena without id, as in M. The simile seems
to be that a man, if he likes, can wake himself at any time of
night, and this ' if he likes ' is expressed by buddhipurvam. See
Anubhutiprak&ra, w. 67, 68.
* M. reads vibodhayati, atha.
4 See Maitr. Up. V, 2; Cowell's Translation, pp. 246, 256;
Vedlntaparibhsbha, ed. A. Venis, in the Pandit, IV, p. no.
5 M. adds : bhagavann idmasya katham ams ena vartanam iti tan
hova/ta.
f M. reads abhidhyayan.
Digitized by
Google
II PRAPArffAKA, 6. 293
creatures. He looked on them and saw they were,
like a stone, without understanding, and standing
like a lifeless post. He had no happiness. He
thought, I shall enter 1 within, that they may awake.
Making himself like air (vayu) z he entered within.
Being one, he could not do it. Then dividing him-
self fivefold, he is called Pra«a, Apana, Samaria,
Udana, Vyana. Now that 3 air which rises up-
wards, is Pra«a. That which moves downwards,
is Apana. That by which these two are supposed
to be held, is Vyana. That 4 which carries the
grosser material of food to the Apana, and brings
the subtler material to each limb, has the name
Samana. [After these (Pra«a, Apana, Samana) comes
the work of the Vyana, and between them (the Prawa,
Apana, and Samana on one side and the Vyana on
the other) comes the rising of the Udana.] That
which brings up or carries down 6 what has been
drunk and eaten, is the Udana 6 .
Now the U pa w.m- vessel (or prawa) depends on
the A ntaryama- vessel (apana) and the Antaryama-
1 It is better to read with M. vuanid.
* M. vayum iva. 8 M. Atha yo 'yam.
4 M. reads : yo 'yaw sthavish/>$am anna»? dhatum annasyapane
sthapayaty anish/Aam kiage 'nge sawnayati esha vava sa samano
'tha yo 'yam. Leaving out annam, this seems the right reading.
The whole sentence from uttaram to udanasya is left out in M.
■ M. nigirati £aisho vava sa udano 'tha yenaitas sira anuvyapta
esha vava sa vyana^.
e The views of these five kinds of wind differ considerably.
Here the commentator explains that the prawa and apana, the up-
breathing and down-breathing, keep the bodily warmth alive, as
bellows keep up a fire. The food cooked in it is distributed by
the Samana, so that the coarse material becomes ordure, the middle
flesh, the subtle material mind (manas). The udana brings up
phlegm, &c, while the Vyana gives strength to the whole body.
Digitized by
Google
294 MAITRAYAiVA-BRAHMAJVA-UPANISHAD.
vessel (apana) on the Upa»wu-vessel 1 (prina), and
between these two the self-resplendent (Self) pro-
duced heat 8 . This heat is the purusha (person),
and this purusha is Agni VaLrvanara. And thus
it is said elsewhere 3 : " Agni Vai-rvanara is the fire
within man by which the food that is eaten is cooked,
i.e. digested. Its noise is that which one hears, if
one covers one's ears. When a man is on the point
of departing this life, he does not hear that noise."
Now he*, having divided himself fivefold, is
hidden in a secret place (buddhi), assuming the
nature of mind, having the pra«as as his body, re-
splendent, having true concepts, and free like ether 5 .
Feeling even thus that he has not attained his object,
he thinks from within the interior of the heart 6 ,
" Let me enjoy objects." Therefore, having first
broken open these five apertures (of the senses), he
enjoys the objects by means of the five reins. This
means that these perceptive organs (ear, skin,
eye, tongue, nose) are his reins ; the active organs
(tongue (for speaking), hands, feet, anus, generative
organ) his horses ; the body his chariot, the mind
the charioteer, the whip being the temperament.
Driven by that whip, this body goes round like the
1 Two sacrificial vessels (graha) placed on either side of the stone
on which the Soma is squeezed, and here compared to the Prana
and Apana, between which the Self (£aitanyatmi) assumes heat.
2 M. reads tayor antara/e £aush«yam prasuvat.
* See Br»Tiacara»yaka Up. V, 9; .ffMnd. Up. Ill, 13, 8.
4 The Vaif vanara or purusha, according to the commentator, but
originally the Pra^apati, who had made himself like air, and divided
himself into five vital airs.
6 Thus the atma, with his own qualities and those which he
assumes, becomes a living being.
6 M. reads esho 'sya hr/'dantare tish/^ann.
Digitized by
Google
Ill PRAPA7ffAKA, I. 295
wheel driven by the potter. This body is made
intelligent, and he is the driver thereof.
This * is indeed the Self, who seeming to be filled
with desires, and seeming to be overcome 2 by bright
or dark fruits of action, wanders about in every
body (himself remaining free). Because he is not
manifest, because he is infinitely small, because he
is invisible, because he cannot be grasped, because
he is attached to nothing, therefore he, seeming to
be changing, an agent in that which is not (prakr/ti),
is in reality not an agent and unchanging. He is
pure, firm, stable, undefiled 3 , unmoved, free from
desire, remaining a spectator, resting in himself.
Having concealed himself in the cloak of the three
qualities he appears as the enjoyer of rita, as the
enjoyer of rtta. (of his good works).'
Third PRAPArffAKA.
1. The Valakhilyas said to Prafapati Kratu :
' O Saint, if thou thus showest the greatness of that
Self, then who is that other different one, also called
Self 4 , who really overcome by bright and dark
fruits of action, enters on a good or bad birth ?
1 M. reads : Sa va esha atmeti hcrann iva sitasitaM. This seems
better than iwanti kavaya^, which hardly construes.
8 M. reads abhibhuyamanay iva, which again is better than ana-
bhibhuta iva, for he seems to be overcome, but is not, just as he
seems to be an agent, but is not. See also III, 1.
' M. has alepo.
4 The pure Self, called itma, brahma, £inmStram, prag-raSnagha-
nam, &c, after entering what he had himself created, and no longer
distinguishing himself from the created things (bhuta), is called
BhMtml
Digitized by
Google
296 maitrAyaya-brAhmazva-upanishad.
Downward or upward is his course 1 , and overcome
by the pairs (distinction between hot and cold, plea-
sure and pain, &c.) he roams about 2 .'
2. Pra/apati Kratu replied: 'There is indeed that
other 3 different one, called the elemental Self (Bhu-
tatma), who, overcome by bright and dark fruits of
action, enters on a good or bad birth : downward or
upward is his course, and overcome by the pairs he
roams about. And this is his explanation : The five
Tanmitras* (sound, touch, form, taste, smell) are
called Bhuta; also the five Mahabhutas (gross ele-
ments) are called Bhuta. Then the aggregate 6 of all
these is called jarlra, body 6 . And lastly he of whom
it was said that he dwelt in the body 7 , he is called
Bhutatma, the elemental Self. Thus his immortal
Self 8 is like a drop of water on a lotus leaf 9 , and
he himself is overcome by the qualities of nature.
Then 10 , because he is thus overcome, he becomes
bewildered, and because he is bewildered, he saw
not the creator, the holy Lord, abiding within
himself. Carried along by the waves of the quali-
ties u , darkened in his imaginations, unstable, fickle,
1 M. reads here and afterwards avakam urdhvaw vS gatidvandvaW.
2 M. adds at the end, paribhramatiti katama esha iti, t&n hova&ti,
and leaves it out at the end of § 2.
8 M. here reads avara. * M. reads tanm&tr£«i.
6 M. reads teshaw samudayas taAWariram.
• The commentator distinguishes between lihga-farlra, consisting
of prawas, indriyas, the anta^karawa, and the sukshmabhutas ; and
the sthula-jarfra, consisting of the five Mah&bhutas.
7 M. reads jariram ity uktam.
8 M. reads atMsti tasyaA bindur iva.
8 It sticks to it, yet it can easily run off again.
10 M. reads Ato, and the commentator explains atho by ataA
karawat, adding sandhiA £Mndasa£.
11 See VI, 30.
Digitized by
Google
Ill PRAPATflAKA, 3. 297
crippled, full of desires, vacillating, he enters into
belief, believing "I am he," "this is mine 1 ;" he binds
his Self by his Self, as a bird with a net, and over-
come afterwards by the fruits of what he has done,
he enters on a good and bad birth ; downward or
upward is his course, and overcome by the pairs he
roams about.'
They asked : ' Which is it ?' And he answered
them :
3. ' This also has elsewhere been said : He v/ho
acts, is the elemental Self; he who causes to act by
means of the organs 2 , is the inner man (anta^puru-
sha). Now as even a ball of iron, pervaded (over-
come) by fire, and hammered by smiths, becomes
manifold (assumes different forms, such as crooked,
round, large, small 3 ), thus the elemental Self, per-
vaded (overcome) by the inner man, and hammered
by the qualities, becomes manifold*. And the four
tribes (mammals, birds, &c), the fourteen worlds
(Bhur, &c), with all the number of beings, multi-
plied eighty-four times 6 , all this appears as manifold-
ness. And those multiplied things are impelled by
man (purusha) as the wheel by the potter 6 . And as
when the ball of iron is hammered, the fire is not
overcome, so the (inner) man is not overcome, but
the elemental Self is overcome, because it has united
itself (with the elements).
1 M. reads ahaw so mamedam. a M. anta^karawaiA.
3 See commentary, p. 48, 1. 7.
* M. reads upety atha triguwaw? katmgi\a.m.
6 M. reads £atura?ftilakshayonipari«atam. See also Anubhuti-
praksLta, ver. 118.
6 Mr/'tyava seems an impossible word, though the commentator
twice explains it as kulaia, potter. M. reads £akri«eti, which seems
preferable. Weber conjectures mrttpa&u
Digitized by
Google
298 maitrayawa-brAhmazva-upanishad.
4. And it has been said elsewhere 1 : This body
produced from marriage, and endowed with growth 8
in darkness, came forth by the urinary passage, was
built up with bones, bedaubed with flesh, thatched
with skin, filled with ordure, urine, bile, slime, mar-
row, fat, oil 3 , and many impurities besides, like a
treasury full of treasures 4 .
5. And it has been said elsewhere : Bewilder-
ment, fear, grief, sleep, sloth, carelessness, decay,
sorrow, hunger, thirst, niggardliness, wrath, infi-
delity, ignorance, envy, cruelty 6 , folly, shameless-
ness, meanness 6 , pride, changeability 7 , these are the
results of the quality of darkness (tama^) 8 .
1 Part of this passage has been before the mind of the author of
the Manava-dhammSstra, when writing, VI, 76, 77 : asthisthu«a«
snayuyutam mdmsaromtalepanam, /farmavanaddhaw durgandhi pur-
Mam mutrapurishayoA, ^ara^okasamavish/am rogayatanam dturam
ra^asvalam anityaw fa. bhutavasam imaw tya^et. The same verses
occur in the MahabMrata XII, 12463-4, only with tya^a at the
end, instead of tyag'et. The rendering of asthibhu &tam by asthi-
sthu«am shows that £ita was understood to mean piled or built up,
i. e. supported by bones.
a Instead of sa«v/Yddhyupetam M. reads sawviddhyapetam.
3 M. adds snayu after vasi, and instead of SmayaW reads malaW.
This reading, malaM, would seem preferable, though Manu's roga-
yatanam might be quoted in support of slmayaiA. The exact
meaning of vasS is given in the Aryavidyasudhakara, p. 82, 1. 9.
4 Therefore should wise people not identify their true Self with
the body. M. reads vasuneti.
5 M. reads vaikaruwyam.
6 Instead of nirakrrtitvam M. reads nikri'tatvam, which is de-
cidedly preferable. We may take it to mean either meanness, as
opposed to uddhatatvam, overbearing, or knavery, the usual
meaning of nikrj'ti.
7 M. reads asatvam, possibly for asattvam.
8 M. reads tamasanvitaW, and afterwards r&^asanvitaiA ; also
tr/sh»a instead of antastr/'sh«&.
Digitized by
Google
IV PRAPArffAKA, 2. 299
Inward thirst, fondness, passion, covetousness,
unkindness, love, hatred, deceit 1 , jealousy, vain rest-
lessness, fickleness 2 , unstableness, emulation, greed,
patronising of friends, family pride, aversion to dis-
agreeable objects, devotion to agreeable objects,
whispering 3 , prodigality, these are the results of the
quality of passion (ra^as).
By these he is filled, by these he is overcome,
and therefore this elemental Self assumes manifold
forms, yes, manifold forms.'
Fourth Prapathaka.
i. The Valakhilyas, whose passions were subdued,
approached him full of amazement and said : ' O
Saint, we bow before thee ; teach thou, for thou
art the way, and there is no other for us. What
process is there for the elemental Self, by which,
after leaving this (identity with the elemental body),
he obtains union 4 with the (true) Self?' Pra^apati
Kratu said to them :
2. ' It has been said elsewhere : Like the waves
in large rivers, that which has been done before, can-
not be turned back, and, like the tide of the sea, the
approach of death is hard to stem. Bound 6 by the
fetters of the fruits of good and evil, like a cripple ;
without freedom, like a man in prison ; beset by many
fears, like one standing before Yama (the judge of
1 M. reads vyavartatvam. * It should be iara^alatvam.
' M. reads mattasvaro.
4 Instead of the irregular sdycgyam, M. always reads siyugyam.
5 It is not quite clear what is the subject to which all these ad-
jectives refer. M. reads baddho for baddham, but afterwards
agrees with the text as published by Cowell.
Digitized by
Google
300 MAITRAYAJVA-BRAHMAiVA-UPANISHAD.
the dead) ; intoxicated by the wine of illusion, like
one intoxicated by wine ; rushing about, like one
possessed by an evil spirit ; bitten by the world, like
one bitten by a great serpent ; darkened by passion,
like the night; illusory, like magic; false, like a
dream ; pithless, like the inside of the Kadali ;
changing its dress in a moment, like an actor 1 ; fair
in appearance, like a painted wall, thus they call
him ; and therefore it is said :
Sound 2 , touch, and other things are like nothings;
if the elemental Self is attached to them, it will not
remember the Highest Place 3 .
3. This is indeed the remedy for the elemental
Self: Acquirement of the knowledge of the Veda,
performance of one's own duty, therefore conformity
on the part of each man to the order to which he
happens to belong. This* is indeed the rule for
one's own duty, other performances are like the
mere branches of a stem 6 . Through it one obtains
the Highest above, otherwise one falls downward 6 .
Thus is one's own duty declared, which is to be found
in the Vedas. No one belongs truly to an order (asra-
ma) who transgresses his own law 7 . And if people
say, that a man does not belong to any of the orders,
and that he is an ascetic 8 , this is wrong, though, on
1 M. reads na/avat.
8 M. reads ye 'rthS anarthS iva te sthitaA, esham.
8 M. reads na smaret paramam padam.
4 M. reads svadharma eva sarvaw dhatte, stambhajakhevetarSm.
5 The commentator considers the other sacrificial performances
as hurtful, and to be avoided.
8 M. reads anyath&dhaA pataty, esha.
' The rules of the order to which he belongs.
• A Tapasvin is free from the restrictions of the preceding a\rra-
Digitized by
Google
IV PRAPAFffAKA, 4. 30I
the other hand, no one who is not an ascetic brings
his sacrificial works to perfection or obtains know-
ledge of the Highest Self 1 . For thus it is said :
By ascetic penance goodness is obtained, from
goodness understanding is reached, from understand-
ing the Self is obtained, and he who has obtained
that, does not return 2 .
4. " Brahman is," thus said one who knew the
science of Brahman ; and this penance is the door
to Brahman, thus said one who by penance had-
cast off all sin. The syllable Om is the mani-
fest greatness of Brahman, thus said one who
well grounded (in Brahman) always meditates on
it. Therefore by knowledge, by penance, and by
meditation is Brahman gained. Thus one goes
beyond 3 Brahman (Hira#yagarbha), and to a divinity
higher than the gods ; nay, he who knows this, and
worships Brahman by these three (by knowledge,
penance, and meditation), obtains bliss imperishable,
infinite, and unchangeable. Then freed from those
things (the senses of the body, &c.) by which he
was filled and overcome, a mere charioteer 4 , he
obtains union with the Self.'
mas, but he must have obeyed them first, before he can become a
real Tapasvin.
1 M. reads a^rameshv evavasthitas tapasvt £ety u£yata ity, etad apy
uktam, &c. This would mean, ' For it is said that he only who has
dwelt in the ajramas is also called a Tapasvin, a real ascetic ; and
this also has been said, that no one obtains self-knowledge except
an ascetic' This is not impossible, but the commentator follows
the text as printed by Cowell. M. reads atma^nanenMiigama^,
karmaraddhi.
2 M. reads manasa prapyate tv itma hy atmapty& na nivartata iti.
8 M. reads pura eta, which may be right.
4 Rathita^ is a very strange word, but, like everything else, it is
Digitized by
Google
302 MAITRAYAiVA-BRAHMAiVA-UPANISHAD.
5. The Valakhilyas said : ' O Saint, thou art the
teacher, thou art the teacher \ What thou hast said,
has been properly laid up in our mind. Now answer
us a further question : Agni, Vayu, Aditya, Time
(kala) which is Breath (pra#a 2 ), Food (anna), Brahma 3 ,
Rudra, Vishau, thus do some meditate on one, some
on another. Say which of these is the best for us.'
He said to them :
6. ' These are but the chief manifestations of the
highest, the immortal, the incorporeal Brahman. He
who is devoted to one, rejoices here in his world
(presence), thus he said. Brahman indeed is all this,
and a man may meditate on, worship, or discard also
those which * are its chief manifestations. With these
(deities) he proceeds to higher and higher worlds,
and when all things perish, he becomes one with the
Purusha, yes, with the Purusha.'
explained by the commentator, viz. as ratham prapito rathitvaw ka.
prapita iti yavat. Nevertheless the reading of M. seems to me pre-
ferable, viz. atha yaxh paripur«o 'bhibhuto 'yaw tathaitaif ia., taiA
sarvair vimukta svattnany eva sayugyam upaiti. I should prefer
vimuktas tv atmany eva, and translate, 'But then, freed from all
those things by which he was filled and likewise was overcome by
them, he obtains union with the Self.'
1 M. reads the second time abhiv&dy asmiti, which is no improve-
ment. It might have been ativadyasiti.
2 M. reads YamaA pra«o.
8 This is, of course, the personal BrahmS of the Hindu triad. To
distinguish this personal Brahmd from the impersonal, I sometimes
give his name in the nom. masc, Brahma, and not the grammatical
base, Brahman.
4 M. reads ya" v& asya. The commentator explains ya vasyiA by
vasayogyaA; or yi va ysW by b&stit, admitting a Vedic irregularity
which is not quite clear.
Digitized by
Google
V PRAPATTfAKA, 2. 303
Fifth PravAth aka \
1. Next follows Kutsayana's hymn of praise :
' Thou art Brahma, and thou art Vishmi, thou
art Rudra, thou Pra^apati 2 , thou art Agni, Varu#a,
Vayu, thou art Indra, thou the Moon.
Thou art Anna 3 (the food or the eater), thou art
Yama, thou art the Earth, thou art All, thou art
the Imperishable. In thee all things exist in many
forms, whether for their natural or for their own
(higher) ends.
Lord of the Universe, glory to thee ! Thou art
the Self of All, thou art the maker of All, the
enjoyer of All ; thou art all life, and the lord of all
pleasure and joy *. Glory to thee, the tranquil, the
deeply hidden, the incomprehensible, the immeasur-
able, without beginning and without end.'
2. ' In the beginning 5 darkness (tamas) alone was
this. It was in the Highest, and, moved by the High-
est, it becomes uneven. Thus it becomes obscurity
1 At the beginning of the fifth PrapaVfoka my MS. gives the
.Slokas which in the printed edition are found in VI, 34, p. 178,
Atreme floka bhavanti, yathS nirindhano vahnir, &c, to nirvishayaw
smrztam. Then follows as § 2, Atha yathedaw Kautsy&yanistutis,
tvam, &c.
2 The commentator explains Brahma" by Hirawyagarbha and
Pra^apati by Vira£.
8 M. reads tvam Manus, tvam Yama? ia, tvam, pri'thivl tvam athS-
£yuta^, which is so clearly the right reading that it is difficult to
understand how the mistakes arose which are presupposed by the
commentary. See Taitt. Up. II, 2.
4 M. reads vuvakrtaaratiA prabhuA, which seems better.
5 M. reads tamo vi idam ekam asta tat paro sy£t tat pareweritam.
It may have been tat pare 'sthat.
Digitized by
Google
304 MAITRAYAATA-BRAHMANA-UPANISHAD.
(ra/as) 1 . Then this obscurity, being moved, becomes
uneven. Thus it becomes goodness (sattva). Then
this goodness, being moved, the essence flowed forth 2 .
This is that part (or state of Self) which is entirely
intelligent, reflected in man (as the sun is in different
vessels of water) knowing the body (kshetra/wa),
attested by his conceiving, willing, and believing, it is
Pra^apati, called VLrva. His manifestations have
been declared before 3 . Now that part of him which
belongs to darkness, that, O students *, is he who is
called Rudra. That part of him which belongs to
obscurity, that, O students, is he who is called
Brahma. That part of him which belongs to good-
ness, that, O students, is he who is called Vish«u.
He being one, becomes three, becomes eight 5 , be-
comes eleven 6 , becomes twelve, becomes infinite.
Because 7 he thus came to be, he is the Being (neut),
he moves about, having entered all beings, he has
become the Lord of all beings. He is the Self
within and without, yes, within and without.'
1 M. reads etad vai ra^aso rupam, which is better, or, at least,
more in accordance with what follows.
* M. reads sattvam everitarasas saw prfismat
3 A reference to Maitr. Up. II, 5, would have saved the com-
mentator much trouble. M. has a better text. It leaves out viweti
or vuvakhyas after pra^^pati, which may be wrong, but then goes
on : tasya proktd agryas tanavo brahmS rudro vishmir id. In enu-
merating the three agrySs tanavaA, however, M. is less consistent,
for it begins with ra^as or Brahma^ then goes on to tamas or
Rudra, and ends with sattva or Vishmi. The Anubhutipraklra,
verse 142, has the right succession.
4 This vocative, brahma^anno, is always left out in M.
B The five pr&was, the sun, moon, and asterisms.
6 The eleven organs of sense and action, which, by dividing
manas and buddhi, become twelve.
7 M. reads aparimitadhS iodbhutatvad bhuteshu £arati pravish/aA
sarvabhutanam.
Digitized by
Google
VI PRAPArffAKA, I. 305
Sixth PRAPArflAKA 1 .
1. He (the Self) bears the Self in two ways 2 , as
he who is Pra»a (breath), and as he who is Aditya
(the sun). Therefore there are two paths for him 3 ,
within and without, and they both turn back in a
day and night. The Sun is the outer Self, the inner
Self is Breath. Hence the motion of the inner Self
is inferred from the motion of the outer Self 4 . For
thus it is said :
' He who knows, and has thrown off all evil, the
overseer of the senses 6 , the pure-minded, firmly
1 The commentator describes the sixth and seventh chapters as
Khila, supplementary, and does not think that they are closely con-
nected with the chief object of the Upanishad. This chief object was
to show that there is only one thinking Self (iidatmS) to be known,
and that the same is to be meditated on as manifested in the different
forms of Rudra, Brahma, Vishmi, &c. Thus the highest object of
those who wish for final liberation has been explained before, as
well as the proper means of obtaining that liberation. What
follows are statements of the greatness of the various manifestations
of the Atman, and advice how to worship them. My MS. gives the
beginning of the sixth PrapS/^aka, but ends with the end of the
eighth paragraph. The verses in paragraph 34, as mentioned before,
are given in my MS. at the end of the fourth Prapa/Aaka. My
translation deviates considerably from the commentary. The text
is obscure and not always correct. My rule has been throughout
to begin a new sentence with eva« hy dha, ' for thus it is said,'
which introduces proofs of what has been said before. The passages
thus quoted as proofs from the Veda are often difficult to under-
stand, nor do they always consist of a complete sentence. My
translation therefore is often purely tentative.
a M. reads dvitiyi for dvidhl
s M. reads dvau va" etdv asya panfodhi n&m&ntar bahu £&hor&tre
tau vy&vartete.
4 While the sun goes round Meru in a day and a night, the
breath performs 21,000 breathings, or, more exactly, 21,600. M.
reads bahiratmagatya\
5 M. reads adhyaksha, not akshadhyaksha.
[IS] X
Digitized by
Google
306 MAITRAYAtfA-BRAHMAiVA-UPANISHAD.
grounded (in the Self) and looking away (from
all earthly objects), he is the same.' Likewise the
motion of the outer Self is inferred from the motion
of the inner Self. For thus it is said :
' He who within the sun is the golden person, who
looks upon this earth from his golden place, he is the
same who, after entering the inner lotus of the heart 1 ,
devours food (perceives sensuous objects, &c.)'
2. And he who having entered the inner lotus of
the heart, devours food, the same, having gone to
the sky as the fire of the sun, called Time, and being
invisible, devours all beings as his food.
What is that lotus and of what is it made ? (the
Valakhilyas ask 2 .)
That lotus is the same as the ether; the four
quarters, and the four intermediate points are its
leaves s .
These two, Breath and the Sun, move on near
to each other (in the heart and in the ether). Let
him worship these two, with the syllable Om, with
the Vyahmi words (bhM, bhuva^, svar), and with
the Savitri hymn.
3. There are two forms of Brahman *, the material
(effect) and the immaterial (cause). The material
is false, the immaterial is true. That which is true
is Brahman, that which is Brahman is light, and that
which is light is the Sun 6 . And this Sun became
the Self of that Om.
1 M. reads sa esho 'ntaA pushkare hrc'tpushkare v&rrito.
2 The commentator ascribes the dialogue still to the Valakhilyas
and Pra^apati Kratu.
3 M. reads dalasawsthi asur v&gniA parata etaiA pra«adityav eld.
4 See Brih. Up. II, 3, 1.
8 Professor Cowell, after giving the various readings of his MSS.,
says, ' the true reading would seem to be yat satyaw tad brahma,
Digitized by
Google
VI PRAPArffAKA, 4. 307
He divided himself threefold, for Om consists of
three letters, a + u + m. Through them all this 1 is con-
tained in him as warp and woof. For thus it is said :
'Meditate on that Sun as Om, join your Self (the
breath) with the (Self of the) Sun.'
4. And thus it has been said elsewhere : The
Udgitha (of the Sama-veda) is the Prawava 2 (of the
.tfzg-veda), and the Prawava is the Udgitha, and thus
the Sun is Udgitha, and he is Prawava or Om. For
thus it is said 3 :
'The Udgitha, called Pra«ava, the leader (in the
performance of sacrifices), the bright*, the sleepless,
free from old age and death, three-footed 6 , consisting
of three letters (a + u + m), and likewise to be known
as fivefold (five pra#as) placed in the cave.' And it
is also said :
' The three-footed Brahman has its root upward 6 ,
the branches are ether, wind, fire, water, earth, &c.
This one A^vattha 7 by name, the world, is Brahman,
and of it that is the light which is called the Sun,
and it is also the light of that syllable Om. There-
fore let him for ever worship that (breath and sun,
as manifestations of Brahman) with the syllable Om.'
He alone enlightens us. For thus it is said :
yad brahma ta,j- ^yotir, yad ^yotis sa aditya^.' This is exactly the
reading of my own MS.
1 M. reads MvSsminn ity tvam hyaha.
2 The mystic syllable Om.
5 See .ffMndogyopanishad I, 5 ; Maitr. Up. VI, 25.
4 M. reads nimarupam.
' The three feet of the pr£»a are waking, slumber, and deep
sleep ; the three feet of the sun, the three worlds, bhM, bhuvaA,
svar, as in VII, 11. See also ATA&nd. Up. Ill, 12.
6 Cf. Ka/A.Up.VI.i.
7 Afvattha, lit fig-tree, then frequently used metaphorically as a
name of the world. Here explained as 'it will not stand till to-morrow.'
X 2
Digitized by
Google
308 maitrAya^a-brahmajva-upanishad.
' This alone is the pure syllable, this alone is the
highest syllable ; he who knows that syllable only,
whatever he desires, is his 1 .'
5. And thus it has been said elsewhere : This Om 2
is the sound-endowed body of him (Pra#adityatman).
This is his gender-endowed body, viz. feminine,
masculine, neuter. This is his light-endowed body,
viz. Agni, Vayu, Aditya. This is his lord-endowed
body, viz. Brahma, Rudra, Vishmi. This is his mouth-
endowed body, viz. Garhapatya, Dakshmagni, Ahava-
nlya 3 . This is his knowledge-endowed body, viz. Rii,
Ya/us, Saman. This is his world-endowed body, viz.
BhM, Bhuva^, Svar. This is his time-endowed body,
viz. Past, Present, Future. This is his heat-endowed
body, viz. Breath, Fire, Sun. This is his growth-
endowed body, viz. Food, Water, Moon. This is
his thought-endowed body, viz. intellect, mind, per-
sonality. This is his breath-endowed body, viz. Pra»a,
Apana, Vyana. Therefore by the aforesaid syllable
Om are all these here enumerated bodies praised and
identified (with the Pra«adityatman). For thus it
is said 4 :
' O Satyakama, the syllable Om is the high and
the low Brahman.'
6. This 5 (world) was unuttered 6 . Then forsooth
Pra/apati, having brooded, uttered it in the words
BhM, Bhuva^, Svar. This is the grossest body of
that Pra^apati, consisting of the three worlds 7 . Of
that body Svar is the head, Bhuva^ the navel, BhM
1 Ka/A. Up. II, 16. 2 M. reads tanur yom iti.
s The fires on the three altars.
4 Prawa Up. V, 2. e M. reads atha vyattam.
' So far the prawava or Om has been explained; now follows
the explanation of the Vyahri'tis; cf. VI, 2. Vyahriti is derived
from vyahar, and means an utterance.
7 Cf.VI, 5.
Digitized by
Google
VI PRAPAFffAKA, 7. 309
the feet, the sun the eye. For in the eye is fixed
man's great measure, because with the eye he makes
all measurements. The eye is truth (satyam), for
the person (purusha) dwelling in the eye proceeds to
all things (knows all objects with certainty). There-
fore let a man worship with the Vyahmis, Bhu/*,
Bhuva^, Svar, for thus Pra^apati, the Self of All, is
worshipped as the (sun, the) Eye of All 1 . For
thus it is said :
' This (the sun) is Pra^apati's all-supporting body, for
in it this all 2 is hid (by the light of the sun); and in this
all it (the light) is hid. Therefore this is worshipped 3 .'
7. (The Savitri begins* :) Tat Savitur vare#yam,
i.e. ' this of Savitn, to be chosen.' Here the Aditya
(sun) is Savitrz, and the same is to be chosen by the
love(r) of Self, thus say the Brahma-teachers.
(Then follows the next foot in the Savitri) : Bhargo
devasya dhlmahi, i.e. 'the splendour of the god we
meditate on.' Here the god is Savitre, and therefore
he who is called his splendour, him I meditate on,
thus say the Brahma-teachers.
1 M. reads vuvataj^akshur.
2 Prag'apati, according to the commentator, is identified with
Satya, the true, because sat means the three worlds, and these (bhuA,
bhuvaA, svar) are said to be his body. Hence probably the inser-
tion of Satyam before Pra^-dpati at the beginning of the paragraph.
Then he argues, as the eye has been called satya, and as the eye
is Aditya, therefore Pra^dpati also, being Satya, is Aditya, the sun.
And again, if the sun is worshipped (by the vydhntis) then, like the
sun, the eye of all, Pra^Spati also, the self of all, is worshipped.
8 Eshopaslta is impossible. We must either read, with the com-
mentator, etam upisita, or with M. eshopasiteti.
* He now proceeds to explain the worship of the Savitri verse,
which had been mentioned in VI, 2, after the Om and the Vyahr/tis,
as the third mode of worshipping Pra«a (breath) and Aditya (sun),
these being two correlative embodiments of the Self. The S&vitri
is found in Rig-veda III, 62, 10, but it is here explained in a purely
philosophical sense. See also Br/h. Up. VI, 3, 6.
Digitized by
Google
3 1 MAITRAYAtf A-BRAHMAiVA-UPANISH AD.
(Then follows the last foot) : Dhiyo yo naA pra^o-
dayat, i.e. 'who should stir up our thoughts.' Here
the dhiya^ are thoughts, and he should stir these up
for us, thus say the Brahma-teachers.
(He now explains the word bhargas). Now he
who is called bhargas is he who is placed in yonder
Aditya (sun), or he who is the pupil in the eye 1 .
And he is so called, because his going (gati) is by
rays (bhabhi^) ; or because he parches (bhar^ayati)
and makes the world to shrivel up. Rudra is called
Bhargas, thus say the Brahma-teachers. Or bha
means that he lights up these worlds; ra, that he
delights these beings, ga that these creatures go to
him and come from him ; therefore being a bha-ra-ga,
he is called Bhargas.
Surya 2 (sun) is so called, because Soma is con-
tinually squeezed out (su). Savitn (sun) is so called,
because he brings forth (su). Aditya (sun) is so
called, because he takes up (ada, scil. vapour, or
the life of man). Pavana 3 is so called, because he
purines (pu). Apas, water, is so called, because it
nourishes (pya).
And it is said :
' Surely the Self (absorbed in Pra«a, breath), which
is called Immortal*, is the thinker, the perceiver, the
goer, the evacuator 6 , the delighter, the doer, the
speaker, the taster, the smeller, the seer, the hearer,
and he touches. He is Vibhu (the pervader), who
has entered into the body.' And it is said :
1 M. reads t&rake 'kshwi.
a Surya is considered as the daily performer of the PrSta^savana,
&c., the sacrifice at which Soma is squeezed out as an offering.
3 M. reads pavamSnit pavamana/J.
4 M. reads amri'tilkhya? £et£khya? £et&\
5 M. reads ganta sr*sh/a.
Digitized by
Google
VI PRAPAFffAKA, 8. 311
' When the knowledge is twofold (subjective and ob-
jective), then he hears, sees, smells, tastes, and touches
(something), for it is the Self that knows everything.'
But when the knowledge is not twofold (subjective
only), without effect, cause, and action 1 , without a
name, without a comparison, without a predicate 2 —
what is that ? It cannot be told 3 .
8. And the same Self is also called Isana (lord),
•Sambhu, Bhava, Rudra (tamasa); Pra^apati (lord
of creatures), Visvasrig (creator of all), Hira«ya-
garbha, Satyam (truth), Pra#a (breath), Hamsa.
(ra^asa); Sastri (ruler), Vish»u, Naraya«a (sat-
tvika) ; Arka, Savitrz, Dhatr? (supporter), Vidha-
tri 1 (creator), Samra^" (king), Indra, Indu (moon).
He is also he who warms, the Sun, hidden by the
thousand-eyed golden egg, as one fire by another.
He is to be thought after, he is to be sought after.
Having said farewell to all living beings, having
gone to the forest, and having renounced all sen-
suous objects, let man perceive the Self 6 from his
own body.
' (See him) 8 who assumes all forms, the golden,
who knows all things, who ascends highest, alone in
his splendour, and warms us; the thousand-rayed,
1 M. reads kaYyakarawakarmavinirmuktam.
2 Nirupakhyam, rightly translated by Cowell by 'without a
predicate,' and rendered by the commentator by apramaya, i. e. not
to be measured, not to be classed, i. e. without a predicate.
8 I have translated this in accordance with a well-known passage,
quoted by the commentator from the Bnhadarawyaka, rather than
in accordance with his own interpretation.
4 M. leaves out vidhata.
5 Instead of the peculiar Maitraya«i reading, svan s&rirad, M.
reads svif £^arirad.
• The oneness of the Sun and the Breath is proclaimed in the
following verse of the Prawia Upanishad I, 8.
Digitized by
Google
312 MAITRAYAJVA-BRAHMAJVA-UPANISHAD.
who abides in a hundred places, the spirit of all
creatures, the Sun, rises V
9. Therefore he who by knowing this has become
the Self of both Breath and Sun, meditates (while
meditating on them) on his Self, sacrifices (while sacri-
ficing to them) to his Self — this meditation, the mind
thus absorbed in these acts, is praised by the wise.
Then let him purify the contamination of the mind
by the verse U^^ish/opahatam, &c. 2 : ' Be it food
left, or food defiled by left food, be it food given by
a sinner, food coming from a dead person, or from
one impure from childbirth, may the purifying power
of Vasu, may Agni, and the rays of Savitrz, purify
it, and all my sin 3 .'
First (before eating) he surrounds (the offered
food) with water (in rincing his mouth 4 ). Then
saying, Svaha to Prawa, Svaha to Apana, Svaha
to Vyana, Svaha to Sam&na, Svaha to Udana, he
offers (the food) with five invocations (in the fire
of the mouth). What is over, he eats in silence,
and then he surrounds (the food) once more after-
wards with water (rincing the mouth after his meal).
Having washed let him, after sacrificing to himself,
meditate on his Self with these two verses, Prawo
'gni^ and Vlrvo 'si, viz. 'May the Highest Self as
breath, as fire (digestive heat), as consisting of the
1 Here ends the M. manuscript, with the following title: iti
■friyaguwakhayam Maitraya«ryabrahma»opanishadi shash/y&aA pra-
pa//4ak&6. Samdpt&.
2 In the following paragraphs the taking of food is represented
as a sacrifice offered by the Self to the Self (atmaya^anarupam
bhq^anam, p. 106, 1. 13).
8 Several words have been inserted in this verse, spoiling the
metre.
* SeeA^and. Up.V, 2.
Digitized by
Google
VI PRAPArffAKA, IO. 313
five vital airs, having entered (the body), himself
satisfied, satisfy all, he who protects all.' 'Thou
art VLrva (all), thou art Vaisvanara (fire), all that is
born is upheld by thee ; may all offerings enter into
thee ; creatures live where thou grantest immortality
to all.' He who eats according to this rule, does
not in turn become food for others.
10. There is something else to be known. There
is a further modification of this Self-sacrifice (the
eating), namely, the food and the eater thereof. This
is the explanation. The thinking Purusha (person),
when he abides within the Pradhana (nature), is the
feeder who feeds on the food supplied by Prakrzti
(nature). The elemental Self 1 is truly his food, his
maker being Pradhana (nature 2 ). Therefore what
is composed of the three qualities (gu«as) is the food,
but the person within is the feeder. And for this the
evidence is supplied by the senses. For animals
spring from seed, and as the seed is the food, there-
fore it is clear that what is food is Pradhana (the
seed or cause of everything). Therefore, as has
been said, the Purusha (person) is the eater, Pra-
kriti, the food ; and abiding within it he feeds. All
that begins with the Mahat 3 (power of intellect) and
ends with the Vireshas (elements 4 ), being developed
from the distinction of nature with its three qualities,
is the sign (that there must be a Purusha, an intel-
1 See before, III, 3.
2 This is very doubtful, in fact, unintelligible. The commentator
says, asya bhutktmanaA karta" pradhdnaA purvokta^, so 'pi bho^ya
ity artha#.
8 Technical terms, afterwards adopted by the S&okhya philo-
sophers.
4 Professor Cowell observes that the term vuesha, as here applied
to the five gross elements, occurs in the S&nkhya-kSriki, ver. 38.
Digitized by
Google
314 maitrayaata-brAhmazva-upanishad.
ligent subject). And in this manner the way with
its fourteen steps has been explained 1 . (This is
comprehended in the following verse) : ' This world
is indeed the food, called pleasure, pain, and error
(the result of the three qualities) ; there is no laying
hold of the taste of the seed (cause), so long as there
is no development (in the shape of effect).' And in
its three stages also it has the character of food, as
childhood, youth, and old age ; for, because these
are developed, therefore there is in them the cha-
racter of food 2 .
And in the following manner does the perception
of Pradhana (nature) take place, after it has become
manifest : — Intellect and the rest, such as determina-
tion, conception, consciousness, are for the tasting (of
the effects of Pradhana). Then there are the five
(perceptive organs) intended for the (five) objects of
senses, for to taste them. And thus are all acts of
the five active organs, and the acts of the five Pra«as
or vital airs (for the tasting of their corresponding
objects). Thus what is manifest (of nature) is food,
and what is not manifest is food. The enjoyer of it
is without qualities, but because he has the quality
of being an enjoyer, it follows that he possesses
intelligence.
As Agni (fire) is the food-eater among the gods,
and Soma the food, so he who knows this eats food
by Agni (is not defiled by food, as little as Agni, the
sacrificial fire). This elemental Self, called Soma
(food), is also called Agni, as having undeveloped
nature for its mouth (as enjoying through nature,
and being independent of it), because it is said, ' The
1 Five receptive, five active organs, and four kinds of consciousness.
* Its very development proves it to be food. Cowell.
Digitized by
Google
vi prapAtwaka, 13. 315
Purusha (person) enjoys nature with its three quali-
ties, by the mouth of undeveloped nature.' He who
knows this, is an ascetic, a yogin, he is a performer
of the Self-sacrifice (see before). And he who does
not touch the objects of the senses when they intrude
on him, as no one would touch women intruding into
an empty house, he is an ascetic, a yogin, a performer
of the Self-sacrifice.
11. This is the highest form of Self, viz. food, for
this Pra#a (this body) subsists on food. If it eats
not, it cannot perceive, hear, touch, see, smell, taste,
and it loses the vital airs 1 . For thus it is said :
' If it eats, then in full possession of the vital airs,
it can perceive, hear, touch, speak, taste, smell, see.'
And thus it is said :
' From food are born all creatures that live on
earth ; afterwards they live on food, and in the end
(when they die) they return to it 2 .'
1 2. And thus it is said elsewhere : Surely all these
creatures run about day and night, wishing to catch
food. The sun takes food with his rays, and by it
he shines. These vital airs digest, when sprinkled
with food. Fire flares up by food, and by Brahma
(Pra^apati), desirous of food, has all this been made.
Therefore let a man worship food as his Self. For
thus it is said :
' From food creatures are born, by food they grow
when born ; because it is eaten and because it eats
creatures, therefore it is called food (annam).'
1 3. And thus it is said elsewhere : This food is
the body of the blessed Vishmi, called Visvabhrt't
(all-sustaining). Breath is the essence of food, mind
of breath, knowledge of mind, joy of knowledge. He
1 JTMnd. Up. VII, 9, 1. * Taitt. Up. II, 2.
Digitized by LaOOQ lC
316 maitrayajva-brAhmajva-utanishad.
who knows this is possessed of food, breath, mind,
knowledge, and joy. Whatever creatures here on
earth eat food, abiding in them he, who knows this,
eats food. Food has been called undecaying, food has
been called worshipful; food is the breath of animals,
food is the oldest, food has been called the physician.
14. And thus it has been said elsewhere : Food
is the cause of all this, time of food, and the sun is
the cause of time 1 . The (visible) form of time is
the year, consisting of twelve months, made up of
Nimeshas (twinklings) and other measures. Of the
year one half (when the sun moves northward)
belongs to Agni, the other to Varuwa (when the
sun moves southward). That which belongs to
Agni begins with the asterism of Magha and ends
with half of the asterism of .SravishMa, the sun
stepping down northward. That which belongs to
Soma (instead of Varuwa) begins with the asterism
(of Adesha), sacred to the Serpents, and ends with
half of the asterism of SravishtM., the sun stepping
up southward. And then there (are the months)
one by one, belonging to the year, each consisting
of nine-fourths of asterisms (two asterisms and a
quarter being the twelfth part of the passage of the
sun through the twenty-seven Nakshatras), each
determined by the sun moving together with the
asterisms. Because time is imperceptible by sense,
therefore this (the progress of the sun, &c.) is its
evidence, and by it alone is time proved to exist
Without proof there is no apprehension of what is
to be proved ; but even what is to be proved can
become proof, for the sake of making itself known,
1 As food depends on time, therefore time is praised, which again
depends on the sun, which is a form of the Self.
Digitized by
Google
vi PRApArffAKA, 1 6. 317
if the parts (the twinklings, &c.) can be distinguished
from the whole (time 1 ). For thus it is said:
'As many portions of time as there are, through
them the sun proceeds : he who worships time as
Brahman, from him time moves away very far.' And
thus it is said :
' From time all beings flow, from time they grow ;
in time they obtain rest ; time is visible (sun) and
invisible (moments).'
15. There are two forms of Brahman, time and
non-time. That which was before the (existence of
the) sun is non-time and has no parts. That which
had its beginning "from the sun is time and has
parts. Of that which has parts, the year is the
form, and from the year are born all creatures ;
when produced by the year they grow, and go again
to rest in the year. Therefore the year is Pra^a-
pati, is time, is food, is the nest of Brahman, is Self.
Thus it is said :
' Time ripens and dissolves all beings in the great
Self, but he who knows into what time itself is dis-
solved, he is the knower of the Veda.'
16. This manifest time is the great ocean of
creatures. He who is called Savitrz (the sun, as be-
getter) dwells in it, from whence the moon, stars,
planets, the year, and the rest are begotten. From
them again comes all this, and thus, whatever of
good or evil is seen in this world, comes from them.
Therefore Brahman is the Self of the sun, and a
man should worship the sun under the name of time.
Some say the sun is Brahman, and thus it is said :
1 Thus, the commentator says, the existence of the lamp can be
proved by the light of the lamp, as the existence of time is proved
by what we see, the rising of the sun. All this is very obscure.
Digitized by
Google
318 maitrAyaya-brAhmajva-upanishad.
' The sacrificer, the deity that enjoys the sacrifice,
the oblation, the hymn, the sacrifice, Vishmi, Pra^a-
pati, all this is the Lord, the witness, that shines in
yonder orb.'
17. In the beginning Brahman was all this 1 . He
was one, and infinite ; infinite in the East, infinite in
the South, infinite in the West, infinite in the North,
above and below and everywhere infinite. East and
the other regions do not exist for him, nor across, nor
below, nor above. The Highest Self is not to be
fixed, he is unlimited, unborn, not to be reasoned
about, not to be conceived. He is like the ether
(everywhere), and at the destruction of the universe,
he alone is awake. Thus from that ether he wakes
all this world, which consists of thought only, and
by him alone is all this meditated on, and in him it
is dissolved. His is that luminous form which
shines in the sun, and the manifold light in the
smokeless fire, and the heat which in the stomach
digests the food. Thus it is said :
' He who is in the fire, and he who is in the heart,
and he who is in the sun, they are one and the
same.'
He who knows this becomes one with the one.
18. This is the rule for achieving it (viz. concen-
tration of the mind on the object of meditation):
restraint of the breath, restraint of the senses, medi-
tation, fixed attention, investigation, absorption, these
are called the sixfold Yoga 2 . When beholding by
1 Brahman used as neuter, but immediately followed by eko
'nantaA, &c.
* After having explained the form of what is to be meditated on
and the mode of meditation, the Upanishad now teaches the Yoga
which serves to keep our thoughts in subjection, and to fix our
thoughts on the object of meditation. See Yoga-Sutras II, 29.
Digitized by
Google
VI PRAPArffAKA, 20. 319
this Yoga, he beholds the gold-coloured maker, the
lord, the person, Brahman, the cause, then the sage,
leaving behind good and evil, makes everything
(breath, organs of sense, body, &c.) to be one in
the Highest Indestructible (in the pratyagatman or
Brahman). And thus it is said :
'As birds and deer do not approach a burning
mountain, so sins never approach those who know
Brahman.'
19. And thus it is said elsewhere : When he who
knows has, while he is still Pra»a (breath), restrained
his mind, and placed all objects of the senses far
away from himself, then let him remain without any
conceptions. And because the living person, called
Pra#a (breath), has been produced here on earth
from that which is not Pra«a (the thinking Self),
therefore let this Pra»a merge the Pra»a (himself)
in what is called the fourth 1 . And thus it is said :
'What is without thought, though placed in the
centre of thought, what cannot be thought, the
hidden, the highest — let a man merge his thought
there : then will this living being (linga) be without
attachment V
20. And thus it has been said elsewhere : There
is the superior fixed attention (dhara«a) for him,
viz. if he presses the tip of the tongue down the
palate and restrains voice, mind, and breath, he sees
1 The fourth stage is meant for the thinking Self, the earlier
stages being waking, slumbering, and sleep.
2 Professor Cowell offers two renderings of this difficult passage :
' This which is called prixa, i.e. the individual soul as characterised
by the subtil body, will thus no longer appear in its separate indi-
viduality from the absence of any conscious subject ; or, this subtil
body bearing the name of intellect will thus become void of all
objects.'
Digitized by
Google
320 maitrAyajva-brahmawa-upanishad.
Brahman by discrimination (tarka). And when,
after the cessation of mind 1 , he sees his own Self,
smaller than small, and shining, as the Highest Self 2 ,
then having seen his Self as the Self, he becomes
Self-less, and because he is Self-less, he is without
limit, without cause, absorbed in thought. This is
the highest mystery, viz. final liberation. And thus
it is said :
' Through the serenity of the thought he kills all
actions, good or bad ; his Self serene, abiding in the
Self, obtains imperishable bliss.'
21. And thus it has been said elsewhere : The
artery, called Sushumna, going upwards (from the
heart to the Brahmarandhra), serving as the passage
of the Pra#a, is divided within the palate. Through
that artery, when it has been joined by the breath
(held in subjection), by the sacred syllable Om, and
by the mind (absorbed in the contemplation of Brah-
man), let him proceed upwards 3 , and after turning
the tip of the tongue to the palate, without* using
any of the organs of sense, let greatness perceive
greatness 5 . From thence he goes to selflessness,
and through selflessness he ceases to be an enjoyer
of pleasure and pain, he obtains aloneness (kevalatva,
final deliverance). And thus it is said :
1 The commentator remarks that this process is called Lambikd-
yoga, and the state produced by it Unmanf or Unmanibhava ; see
amanibhava, in VI, 34, ver. 7.
2 I should have preferred to translate atmanam atmana pa^yau"
by 'he sees his Self by his Self,' but the commentator takes a slightly
different view, and says : itthambhave truiyd ; paramatmarupewa
paryati.
8 Cf. KaMa Up. VI, 16 ; Prama Up. Ill, 6 (p. 277).
4 If we read sa/raycgya we must follow the commentator in trans-
lating by ' uniting the senses with the pra«a and the manas.'
6 Let the Self perceive the Self.
Digitized by
Google
VI PRAPAFffAKA, 22. 321
' Having successively fixed the breath, after it had
been restrained, in the palate, thence having crossed
the limit (the life), let him join himself afterwards
to the limitless (Brahman) in the crown of the
head.'
22. And thus it has been said elsewhere : Two
Brahmans have to be meditated on, the word and
the non-word. By the word alone is the non-word
revealed. Now there is the word Om. Moving
upward by it (where all words and all what is meant
by them ceases), he arrives at absorption in' the
non-word (Brahman). This is the way, this is the
immortal, this is union, and this is bliss. And as
the spider, moving upward by the thread, gains free
space, thus also he who meditates, moving upward
by the syllable Om, gains independence.
Other teachers of the word (as Brahman) think
otherwise. They listen to the sound of the ether
within the heart while they stop the ears with the
thumbs. They compare it to seven noises, like
rivers, like a bell, like a brazen vessel, like the.
wheels of a carriage, like the croaking of frogs, like
rain, and as if a man speaks in a cavern. Having
passed beyond this variously apprehended sound, and
having settled in the supreme, soundless (non-word),
unmanifested Brahman, they become undistinguished
and undistinguishable, as various flavours of the
flowers are lost in the taste of honey. And thus
it is said'.
' Two Brahmans are to be known, the word- Brah-
man and the highest Brahman ; he who is perfect in
the word-Brahman attains the highest Brahman 1 .'
1 Cf. MahltMrata XII, 8540; Sarvadamna-saftgraha, p. 147;
Cowell's Translation, p. 271.
[15] Y
Digitized by
Google
r
322 MAITRAYAyA-BRAHMAtfA-UPANISHAD.
23. And thus it has been said elsewhere : The
syllable Om is what is called the word. And its end
is the silent, the soundless, fearless, sorrowless, joy-
ful, satisfied, firm, unwavering, immortal, immovable,
certain (Brahman), called Vish#u. Let him worship
these two, that he may obtain what is higher than
everything (final deliverance). For thus it is said :
'He who is the high and the highest god 1 , by
name Om-kara, he is soundless and free from all
distinctions : therefore let a man dwell on him in
the crown of his head.'
24. And thus it has been said elsewhere : The
body is the bow, the syllable Om is the arrow, its
point is the mind. Having cut through the dark-
ness, which consists of ignorance 2 , it approaches that
which is not covered by darkness 3 . Then having
cut through that which was covered (the personal
soul), he saw Brahman, flashing like a wheel on fire,
bright like the sun, vigorous, beyond all darkness,
that which shines forth in yonder sun, in the moon,
in the fire, in the lightning 4 . And having seen
him, he obtains immortality. And thus it has been
said:
' Meditation is directed to the highest Being
(Brahman) within, and (before) to the objects (body,
Om, mind) ; thence the indistinct understanding be-
comes distinct.
And when the works of the mind are dissolved,
1 The commentator takes dev& as deva^, though the accent is
against it ; see Schroeder, Uber die Maitraya«f Sa»»hM, p. 9, 1. 1 1.
8 Should it not be, ' darkness is the mark ? '
8 Atamavish/a, explained as an irregular compound, atama-Svish-
/am, tama-avcsanarahitam.
* Cf. BhagavadgM XV, 12.
Digitized by
Google
VI PRAPArffAKA, 26. 323
then that bliss which requires no other witness, that
is Brahman (Atman), the immortal, the brilliant, that
is the way, that is the (true) world.'
25. And thus it has been said elsewhere : He
who has his senses hidden as in sleep, and who,
while in the cavern of his senses (his body), but no
longer ruled by them, sees, as in a dream, with the
purest intellect, Him who is called Pra»ava (Om),
the leader J , the bright, the sleepless, free from old
age, from death, and sorrow, he is ' himself also
called Prawava, and becomes a leader, bright, sleep-
less, free from old age, from death, and sorrow.
And thus it is said :
' Because in this manner he joins the Pra«a
(breath), the Om, and this Universe in its manifold
forms, or because they join themselves (to him),
therefore this (process of meditation) is called Yoga
(joining).
The oneness of breath, mind, and senses, and
then the surrendering of all conceptions, that is
called Yoga.'
26. And thus it has also been said elsewhere :
As a sportsman, after drawing out the denizens of
the waters with a net, offers them (as a sacrifice)
in the fire of his stomach, thus are these Pra»as
(vital airs), after they have been drawn out with the
syllable Om, offered in the faultless fire (Brahman) 2 .
Hence he is like a heated vessel (full of clarified
butter); for as the clarified butter in the heated
vessel lights up, when touched with grass and sticks,
thus does this being which is called Not-breath
(Atman) light up, when touched by the Pra#as (the
-1 Cf. VI, 4. a Cf. <SVet£rvatara-upanishad III, 10.
Y 2
Digitized by
Google
324 MAITRAYAWA-BRAHMAtfA-UPANISHAD.
vital airs) 1 . And that which flares up, that is the
manifest form of Brahman, that is the highest place
of Vishmi 2 , that is the essence of Rudra. And this,
dividing his Self in endless ways, fills all these
worlds. And thus it is said :
'As the sparks from the fire, and as the rays from
the sun, thus do his Pra«as and the rest in proper order
again and again proceed from him here on earth 3 .'
27. And thus it has also been said elsewhere :
This is the heat of the highest, the immortal, the
incorporeal Brahman, viz. the warmth of the body.
And this body is the clarified butter (poured on it,
by which the heat of Brahman, otherwise invisible, is
lighted up). Then, being manifest, it is placed in
the ether (of the heart). Then by concentration they
thus remove that ether which is within the heart, so
that its light appears, as it were*. Therefore the
worshipper becomes identified with that light with-
out much delay. As a ball of iron, if placed in the
earth, becomes earth without much delay, and as,
when it has once become a clod of earth, fire and
smiths have nothing more to do with* that ball of
iron, thus does thought (without delay) disappear,
together with its support 6 . And thus ijt is said :
1 As the fire which exists invisibly in *a heated vessel becomes
visible when the heated vessel is touched with sticks dipped in
butter, thus the Atman in the body appears only when the PrSwas
are diffused in it. Or, as the clarified butter, heated together with
the vessel, lights up grass that comes in contact with it, so does this
Atman (called Not-breath), by heating its two bodies which are
pervaded by the reflections of the thinker, light up everything
brought in contact with it, viz. the world.
a See KaJJa Up. Ill, 9. * See VI, 31 ; Br/"h. Up. II, 1, 10.
4 The light was always there, but it seems then only to appear.
8 The commentator explains this differently. He says that the
Digitized by
Google
VI PRAPAFffAKA, 28. N <li^|#$ J
'The shrine which consists of the ether in the
heart, the blissful, the highest retreat, that is our
own, that is our goal, and that is the heat and bright-
ness of the fire and the sun.'
28. And thus it has been said elsewhere : After
having left behind the body, the organs of sense, and
the objects of sense (as no longer belonging to us),
and having seized the bow whose stick is fortitude
and whose string is asceticism, having struck down
also with the arrow, which consists in freedom from
egotism, the first guardian of the door of Brahman —
(for if man looks at the world egotistically, then,
taking the diadem of passion, the earrings of greed
and envy, and the staff of sloth, sleep; and sin, and
having seized the bow whose string is anger, and
whose stick is lust, he destroys with the arrow
which consists of wishes, all beings) — having there-
fore killed that guardian, he crosses by means of the
boat Om to the other side of the ether within the
heart, and when the ether becomes revealed (as
Brahman), he enters slowly, as a miner seeking
minerals in a mine, into the Hall of Brahman.
After that let him, by means of the doctrine of his
teacher, break through the shrine of Brahman, which
consists of the four nets (of food, breath, mind, know-
ledge, till he reaches the last shrine, that of blessed-
ness and identity with Brahman). Thenceforth pure,
similes are intended to show how, as soon as the impediment is
removed, the worshipper obtains his true form, i.e. becomes Brah-
man. Afterwards he explains £ittam, thought, by the individual
thinker, and declares that he vanishes together with the thought,
which forms the ajraya, the place, or the upadhi, the outward form.
Or again, he says that the iitta, the mind, vanishes with its outward
sign, viz. the thoughts and imaginations.
Digitized by
Google
326 MAITRAYAiVA-BRAHMAiVA-UPANISHAD.
clean, undeveloped, tranquil, breathless, bodiless,
endless, imperishable, firm, everlasting, unborn and
independent, he stands on his own greatness 1 , and
having seen (the Self), standing in his own greatness,
he looks on the wheel of the world as one (who has
alighted from a chariot) looks on its revolving wheel.
And thus it is said :
' If a man practises Yoga for six months and is
thoroughly free (from the outer world), then the
perfect Yoga (union), which is endless, high, and
hidden, is accomplished.
But if a man, though well enlightened (by instruc-
tion), is still pierced by (the gu«as of) passion and
darkness, and attached to his children, wife, and
house, then perfect Yoga is never accomplished 2 .'
29. After he had thus spoken (to Brzhadratha),
.Sakayanya, absorbed in thought, bowed before him,
and said : ' O King, by means of this Brahma-know-
ledge have the sons of Pra^apati (the Valakhilyas)
gone to the road of Brahman. Through the practice
of Yoga a man obtains contentment, power to endure
good and evil, and tranquillity. Let no man preach
this most secret doctrine to any one who is not his
son or his pupil 3 , and who is not of a serene mind.
To him alone who is devoted to his teacher only,
and endowed with all necessary qualities, may he
communicate it 4 .
1 See Maitr. Up. II, 4 ; VI, 31.
2 This would seem to have been the end of the dialogue between
Pra^apati and the Valakhilyas, which, as related by Sakayanya to
King Br*hadratha, began in II, 3. See, however, VII, 8.
8 .Svet. Up. VI, 22 (p. 267) ; Brrti.Up.VI, 3, 12.
4 Here may have been the end of a chapter, but the story of
•Sakayanya and Brmadratha is continued to VI, 30.
Digitized by
Google
VI PRAPArffAKA, 30. 327
30. Om ! Having settled down in a pure place
let him, being pure himself, and firm in goodness,
study the truth, speak the truth, think the truth,
and offer sacrifice to the truth 1 . Henceforth he has
become another ; by obtaining the reward of Brah-
man his fetters are cut asunder, he knows no hope,
no fear from others as little as from himself, he
knows no desires ; and having attained imperishable,
infinite happiness, he stands blessed in the true
Brahman, who longs for a true man 2 . Freedom
from desires is, as it were, the highest prize to be
taken from the best treasure (Brahman). For a
man full of all desires, being possessed of will,
imagination, and belief, is a slave ; but he who is
the opposite, is free.
Here some say, it is the Gu«a 3 (i. e. the so-called
Mahat, the principle of intellect which, according to
the Sankhyas, is the result of the Gu»as or qualities),
which, through the differences of nature (acquired in
the former states of existence), goes into bondage to
the will, and that deliverance takes place (for theGu#a)
when the fault of the will has been removed. (Butthis
is not our view), because (call it gu»a, intellect, buddhi,
manas, mind, ahankara, egotism, it is not the mind
that acts, but) he sees by the mind (as his instru-
ment), h e hears by the mind ; and all that we call
1 The truth or the true are explained by, (1) the book which
teaches the Highest Self; (2) by Brahman, who is to be spoken
about ; (3) by Brahman, who is to be meditated on ; (4) by Brah-
man, who is to be worshipped in thought.
2 I have translated this according to the commentary, but I should
prefer to read satyibhilishim.
3 The passages within brackets had to be added from the com-
mentary in order to make the text intelligible, at least according to
Rlmatirtha's views.
/
Digitized by
Google
328 maitrAyajva-brAhmajva-upanishad.
desire, imagination, doubt, belief, unbelief, certainty,
uncertainty, shame, thought, fear, all that is but
mind (manas). Carried along by the waves of die
qualities, darkened in his imaginations, unstable,
fickle, crippled, full of desires, vacillating, he enters
into belief, believing I am he, this is mine, and he
binds his Self by his Self, as a bird with a net 1 .
Therefore a man, being possessed of will, imagina-
tion, and belief, is a slave, but he who is the oppo-
site is free. For this reason let a man stand free
from will, imagination, and belief — this is the sign of
liberty, this is the path that leads to Brahman, this
is the opening of the door, and through it he will go
to the other shore of darkness. All desires are there
fulfilled. And for this they quote a verse :
" When the five instruments of knowledge stand
still together with the mind, and when the intellect
does not move, that is called the highest state 2 .'"
Having thus said, Sakayanya became absorbed in
thought. Then Marut (i.e. the King Brzhadratha) 3 ,
having bowed before him and duly worshipped him,
went full of contentment to the Northern Path 4 , for
there is no way thither by any side-road. This is
the path to Brahman. Having burst open the
solar door, he rose on high and went away. And
here they quote :
'There are endless rays (arteries) for the Self
who, like a lamp, dwells in the heart: white and
black, brown and blue, tawny and reddish 5 .
1 See III, 2. a See the same verse in Ka/Aa Up. VI, 10.
3 See before, II, 1.
4 See Yrasria, Up. 1, 10, ' But those who have sought the Self by
penance, abstinence, faith, and knowledge, gain by the Northern
Path Aditya, the sun.'
6 See .ffMnd. Up. VIII, 6,1.
Digitized by
Google
VI PRAPArJJAKA, 31. 329
One of them (the Sushumna) leads upwards,
piercing the solar orb : by it, having stepped beyond
the world of Brahman, they go to the highest path.
The other hundred rays 1 rise upwards also, and
on them the worshipper reaches the mansions be-
longing to the different bodies of gods.
But the manifest rays of dim colour which lead
downwards, by them a man travels on and on help-
lessly, to enjoy the fruits of his actions here.'
Therefore it is said that the holy Aditya (sun) is
the cause of new births (to those who do not worship
him), of heaven (to those who worship him as a god),
of liberty (to those who worship him as Brahman) 2 .
31. Some one asks: 'Of what nature are those
organs of sense that go forth (towards their ob-
jects)? Who sends them out here, or who holds
them back?'
Another answers : 'Their nature is the Self; the
Self sends them out, or holds them back ; also the
Apsaras (enticing objects of sense), and the solar
rays (and other deities presiding over the senses).'
Now the Self devours the objects by the five rays
(the organs of sense) ; then who is the Self ?
He who has been defined by the terms pure, clean,
undeveloped, tranquil 3 , &c, who is to be apprehended
independently by his own peculiar signs. That sign
of him who has no signs, is like what the pervading
1 A similar verse, but with characteristic variations, occurs in the
KhinA. Up. VIII, 6, 6, and in the Katfa Up. VI, 16.
2 Here ends the story of .SSkayanya, which began I, 2, and was
carried on through chap. VI, though that chapter and the seventh
are called Khilas, or supplements, and though the MS. M. also ends,
as we saw, with the eighth paragraph of the sixth chapter.
8 See before, II, 4 VI, 1 i
Digitized by
Google
330 MAITRAYAJVA-BRAHMAtfA-UPANISHAD.
heat is of fire, the purest taste of water ; thus say
some 1 . It is speech, hearing, sight, mind, breath ;
thus say others 2 . It is intellect, retention, remem-
bering, knowledge ; thus say others 8 . Now all these
are signs of the Self in the same sense in which here
on earth shoots are the signs of seed, or smoke, light,
and sparks of fire. And for this they quote 4 :
' As the sparks from the fire, and as the rays from
the sun, thus do his Pra«as and the rest in proper
order again and again proceed from him here on
earth.'
32. From this very Self, abiding within his Self,
come forth all Pra«as (speech, &c), all worlds, all
Vedas, all gods, and all beings ; its Upanishad (revela-
tion) 6 is that it is 'the true of the true.' Now as from a
fire of green wood, when kindled, clouds of smoke come
forth by themselves (though belonging to the fire),
thus from that great Being has been breathed forth
all this which is the Rig-veda., the Ya/ur-veda, the
Sama-veda, the Atharvangirasas (Atharva-veda), the
Itihasa (legendary stories), the Pura#a (accounts of
the creation, &c), Vidya (ceremonial doctrines), the
Upanishads, the 6"lokas (verses interspersed in the
Upanishads, &c), the Sutras (compendious state-
ments), the Anuvyakhyanas (explanatory notes), the
Vyakhyanas (elucidations) 6 — all these things are his.
1 See Svet. Up. VI, 13. a See Ken. Up. 2.
8 See Ait. Up. Ill, 2. Here we find dhn'ti (holding), smriM
(remembering), pra^w&nam (knowledge), but not buddhi. Pra-
^w&nam seems the right reading, and is supported by M.
* See before, VI, 26.
5 Revelation is here the rendering of Upanishad, upanigama-
yitr?tv&t sSkshadrahasyam, and the true (sattya) is explained first by
the five elements, and then by that which is their real essence.
6 See .ffMnd. Up. VI, 1. The explanations given of these literary
Digitized by
Google
VI PRAPArtfAKA, $3. 33I
33. This fire (the Garhapatya-fire) with five
bricks is the year. And its five bricks are spring,
summer, rainy season, autumn, winter ; and by them
the fire has a head, two sides, a centre, and a tail.
This earth (the Garhapatya-fire) here is the first
sacrificial pile for Pra^ipati, who knows the Purusha
(the Vira^). It presented the sacrificer to Vayu
(the wind) by lifting him with the hands to the sky.
That Vayu is Pra«a (Hirawyagarbha).
Pra#a is Agni (the Dakshi«agni-fire), and its bricks
are the five vital breaths, Prawa, Vy&na, Apana,
Samana, Ud&na ; and by them the fire has a head,
two sides, a centre, and a tail. This sky (the
Dakshi«agni-fire) here is the second sacrificial pile
for Pra^apati, who knows the Purusha. It pre-
sented the sacrificer to Indra, by lifting him with
the hands to heaven. That Indra is Aditya, the
sun.
That (Indra) is the Agni (the Ahavaniya-fire),
and its bricks are the Rik, the Ya^ush, the Saman,
the Atharvangirasas, the Itihasa, and the Puratfa;
and by them the fire has a head, two sides, a tail,
and a centre. This heaven (Ahavanlya-fire) is the
third sacrificial pile for Pra^apati, who knows the
titles are on the whole the same as those we had before in similar
passages. What is peculiar to Ramattrtha is that he explains
Upanishad by such passages as we had just now, viz. its Upanishad
is that it is the true of the true. The Slokas are explained as
verses like those in VI, 19, a&ttaw £ittamadhyastham. The
Sutras are explained as comprehensive sentences, such as II, 2,
ayaz» vava khalv atma te. Anuvyakhyanas are taken as explana-
tions following on the Sutra in II, 2, beginning with atha ya
esho^Mvasavish/ambhanena. The Vyakhyanas are taken as fuller
statements of the meaning contained in the Sutra, such as the
dialogue between the Valakhilyas and Kratu.
Digitized by
Google
332 MAITRAYAJVA-BRAHMAZVA-UPANISHAD.
Purusha. With the hands it makes a present of
the sacrificer to the Knower of the Self (Pra^apati) ;
then the Knower of the Self, lifting him up, pre-
sented him to Brahman. In him he becomes full
of happiness and joy.
34. The earth is the Garhapatya-fire, the sky the
Dakshwa-fire, the heaven the Ahavanlya-fire ; and
therefore they are also the Pavamana (pure), the
Pavaka (purifying), and the Su&i (bright) 1 . By this
(by the three deities, Pavamana, Pavaka, and Su&i)
the sacrifice (of the three fires, the Garhapatya,
Dakshi«a, and Ahavaniya) is manifested. And be-
cause the digestive fire also is a compound of the
Pavamana, Pavaka, and Su&i, therefore that fire is
to receive oblations, is to be laid with bricks, is to
be praised, and to be meditated on. The sacrificer,
when he has seized the oblation, wishes 2 to perform
his meditation of the deity :
' The gold-coloured bird abides in the heart, and
in the sun — a diver bird, a swan, strong in splendour ;
him we worship in the fire.'
Having recited the verse, he discovers its mean-
ing, viz. the adorable splendour of Savitm' (sun) is to
be meditated on by him who, abiding within his
mind, meditates thereon. Here he attains the place
of rest for the mind, he holds it within his own Self.
On this there are the following verses :
(1) As a fire without fuel becomes quiet in its
1 Epithets of Agni, the sacrificial-fire, pavama«a applying o
the Garhapatya-fire, pavaka to the Dakshi«a-fire, and suki to the
Ahavaniya-fire. The construction of the sentence, however, is
imperfect.
s This means, he ought to perform it.
Digitized by
Google
VI PRAPArtfAKA, 34. 333
place 1 , thus do the thoughts, when all activity ceases,
become quiet 2 in their place.
* (2) Even in a mind which loves the truth 8 and has
gone to rest in- itself there arise, when it is deluded
by the objects of sense, wrongs resulting from former
acts 4 .
(3) For thoughts alone cause the round of births 6 ;
let a man strive to purify his thoughts. What a man
thinks, that he is : this is the old secret 6 .
(4) By the serenity of his thoughts a man blots out
all actions, whether good or bad. . Dwelling within
his Self with serene thoughts, he obtains imperish-
able happiness.
(5) If the thoughts of a man were so fixed on
Brahman as they are on the things of this world,
who would not then be freed from bondage ?
(6) The mind, it is said, is of two kinds, pure or
impure; impure from the contact with lust, pure
when free from lust 7 .
(7) When a man, having freed his mind from
sloth, distraction, and vacillation, becomes as it were
delivered from his mind 8 , that is the highest point.
(8) The mind must be restrained in the heart till
it comes to an end; — that is knowledge, that is
liberty: all the rest are extensions of the ties 9 (which
bind us to this life).
1 Dies in the fireplace. * M. reads upajamyati twice.
9 M. reads satyakaminai.
4 The commentator inserts a negative.
5 M. reads sazns&raA.
* This is very like the teaching of the Dhammapada, 1, 1.
7 Cf. Ind. Stud. II, 60. Brahmavindu Up. v. 1, where we read
kamasankalpam, as in MS. M.
8 See note to VI, 20.
9 M. reads mokshar£a and jcshas tu. The commentator says that
Digitized by
Google
334 MAITRAYAtfA-BRAHMAJVA-UPANISHAD.
(9) That happiness which belongs to a mind which
by deep meditation has been washed 1 clean from all
impurity and has entered within the Self, cannot be
described here by words ; it can be felt by the inward
power only 2 .
(10) Water in water, fire in fire, ether in ether, no
one can distinguish them ; likewise a man whose
mind has entered (till it cannot be distinguished
from the Self), attains liberty.
(11) Mind alone is the cause of bondage and
liberty for men ; if attached to the world, it becomes
bound; if free from the world, that is liberty 3 .
Therefore those who do not offer the Agnihotra
(as described above), who do not lay the fires (with
the bricks, as described above), who are ignorant (of
the mind being the cause of the round of births), who
do not meditate (on the Self in the solar orb) are
debarred from remembering the ethereal place of
Brahman. Therefore that fire is to receive obla-
tions, is to be laid with bricks, is to be praised, to
be meditated on.
35*. Adoration to Agni, the dweller on earth, who
remembers his world. Grant that world to this thy
worshipper !
Adoration to Vayu, the dweller in the sky, who
remembers his world. Grant that world to this thy
worshipper !
this line is easy, but it is so by no means. Professor Cowell translates
granthavistari^ by book-prolixity, but this sounds very strange in an
Upanishad. I am not satisfied with my own translation, but it may
stand till a better one is found. M. reads grmdhavistarSA. The
granthis are mentioned in Khini. Up. VII, 26 ; KaJh. Up. VI, 15.
1 M. reads nirdhuta. * M. reads karaweti.
8 M. reads vishay&saktam muktyai.
4 Next follow invocations to be addressed to the deities.
Digitized by
Google
VI VRAVATHAKA, 35. 335
Adoration to Aditya, the dweller in heaven, who
remembers his world. Grant that world to this thy
worshipper !
Adoration to Brahman, who dwells everywhere,
who remembers all. Grant all to this thy wor-
shipper !
The mouth of the true (Brahman) is covered with
a golden lid ; open that, O Pushan (sun), that we may
go to the true one, who pervades all (Vishnu) 1 .
He who is the person in the sun, I am he 2 .
And what is meant by the true one is the essence
of the sun, that which is bright, personal, sexless 3 ;
a portion (only) of the light which pervades the
ether ; which is, as it were, in the midst of the sun,
and in the eye, and in the fire. That is Brahman,
that is immortal, that is splendour.
That is the true one, a portion (only) of the light
which pervades the ether, which is in the midst of
the sun, the immortal, of which Soma (the moon)
and the vital breaths also are offshoots : that is
Brahman, that is immortal, that is splendour.
That is the true one, a portion (only) of the light
which pervades the ether, which in the midst of the
sun shines as Ya^iis, viz. as Om, as water, light,
essence, immortal, Brahman, BhM, Bhuva^, Svar,
Om.
' The eight-footed 4 , the bright, the swan, bound
1 The verse occurs in a more original form in Tal. Up. 15.
* The commentator adds iti after aham.
' #Mnd. Up. 1,6,6; .SVet. Up. V, 10.
* The eight feet are explained as the eight regions, or iroga and
the rest. The swan is the sun. »The three threads are the three
Vedas; see ZTul. Up. 1, 1; Ind. Stud. IX, 11 — ash/apdda«? juftr
h&msam trisutram ma/rim avyayam, dvivartam£na»» ta^asaiddham
Digitized by
Google
336 maitrayajva-brAhma^a-upanishad.
with three threads, the infinitely small, the imperish-
able, blind for good and evil, kindled with light — he
who sees him, sees everything.'
A portion (only) of the light which pervades the
ether, are the two rays rising in the midst of the
sun. That is the knower 1 (the Sun), the true one.
That is the Ya^us, that is the heat, that is Agni
(fire), that is Vayu (wind), that is breath, that is
water, that is the moon, that is bright, that is im-
mortal, that is the place of Brahman, that is the ocean
of light. In that ocean the sacrificers are dissolved 2
like salt, and that is oneness with Brahman, for all
desires are there fulfilled. And here they quote :
' Like a lamp, moved by a gentle wind, he who
dwells within the gods shines forth. He who knows
this, he is the knower, he knows the difference (be-
tween the high and the highest Brahman) ; having
obtained unity, he becomes identified with it.
They who rise up in endless number, like spray
drops (from the sea), like lightnings from the light
within the clouds in the highest heaven, they, when
they have entered into the light of glory (Brahman),
appear like so many flame-crests in the track of fire.'
36. There are two manifestations of the Brahma-
light : one is tranquil, the other lively. Of that which
is tranquil, the ether is the support ; of that which is
lively, food. Therefore (to the former) sacrifice must
be offered on the house-altar with hymns, herbs,
ghee, meat, cakes, sthalipaka, and other things ; to
the latter, with meat and drinks (belonging to the
great sacrifices) thrown into the mouth, for the mouth
sarva^ paryan na paryati. Here-the eight feet are explained as the
five elements, manas, buddhi, and ahaftk&ra.
1 Savit for savitr*. * Vlfyante for vilfyante.
Digitized by
Google
VI PRAPArflAKA, Z7' 337
is the Ahavanlya-fire ; and this is done to increase
our bodily vigour, to gain the world of purity, and
for the sake of immortality. And here they quote :
'Let him who longs for heaven, offer an Agni-
hotra. By an Agnish/oma he wins the kingdom
of Yama ; by Uktha, the kingdom of Soma ; by
a Shodasin-sacrifice, the kingdom of Surya ; by an
Atiratra-sacrifice, the kingdom of Indra ; by the
sacrifices beginning with the twelve-night sacrifice
and ending with the thousand years' sacrifice, the
world of Pra^apati.
As a lamp burns so long as the vessel that holds
the wick is filled with oil, these two, the Self and the
bright Sun, remain so long as the egg (of the world)
and he who dwells within it hold together.'
37. Therefore let a man perform all these cere-
monies with the syllable Om (at the beginning). Its
splendour is endless, and it is declared to be three-
fold, in the fire (of the altar), in the sun (the deity),
in the breath (the sacrificer). Now this is the channel
to increase the food, which makes what is offered in
the fire ascend to the sun. The sap which flows
from thence, rains down as with the sound of a
hymn. By it there are vital breaths, from them
there is offspring. And here they quote :
' The offering which is offered in the fire, goes to
the sun ; the sun rains it down by his rays ; thus food
comes, and from food the birth of living beings.'
And thus he said :
' The oblation which is properly thrown on the
fire, goes toward the sun ; from the sun comes rain,
from rain food, from food living beings 1 .'
1 See Manu III, 76.
t'5] z
Digitized by
Google
$3% maitrAyajva-brahmajva-upanishad.
38. He who offers the Agnihotra breaks through the
net of desire. Then, cutting through bewilderment,
never approving of anger, meditating on one desire
(that of liberty), he breaks through the shrine of
Brahman with its four nets, and proceeds thence to
the ether. For having there broken through the
(four) spheres of the Sun, the Moon, the Fire, and
Goodness, he then, being purified himself, beholds
dwelling in goodness, immovable, immortal, inde-
structible, firm, bearing the name of Vish«u, the
highest abode, endowed with love of truth and om-
niscience, the self-dependent Intelligence (Brahman),
standing in its own greatness. And here they quote :
' In the midst of the sun stands the moon, in
the midst of the moon the fire, in the midst of fire
goodness, in the midst of goodness the Eternal.'
Having meditated on him who has the breadth
of a thumb within the span (of the heart) in the
body, who is smaller than small, he obtains the
nature of the Highest ; there all desires are fulfilled.
And on this they quote:
' Having the breadth of a thumb within the span
(of the heart) in the body, like the flame of a lamp,
burning twofold or threefold, that glorified Brahman,
the great God, has entered into all the worlds. Om !
Adoration to Brahman ! Adoration ! '
Seventh PRAPArffAKA.
1. Agni, the Giyatra (metre), the Trivrit (hymn),
the Rathantara (song), the spring, the upward breath
(pra«a), the Nakshatras, the Vasus (deities) — these
rise in the East ; they warm, they rain, they praise 1
1 Other MSS. read sruvanti, which seems better.
Digitized by LaOOQ lC
VII PRAPArffAKA, 4. 339
(the sun), they enter again into him (the sun), they
look out from him (the sun). He (the sun) is incon-
ceivable, without form, deep, covered, blameless,
solid, unfathomable, without qualities, pure, brilliant,
enjoying the play of the three qualities, awful, not
caused, a master-magician 1 , the omniscient, the
mighty, immeasurable, without beginning or end,
blissful, unborn, wise, indescribable, the creator of
all things, the self of all things, the enjoyer of all
things, the ruler of all things, the centre of the centre
of all things.
2. Indra, the TrishAibh (metre), the Pa^ada^a
(hymn), the Brthat (song), the summer, the through-
going breath (Vyana), Soma, the Rudras — these rise
in the South ; they warm, they rain, they praise, they
enter again into him, they look out from him. He
(the sun) is without end or beginning, unmeasured,
unlimited, not to be moved by another, self-depend-
ent, without sign, without form, of endless power,
the creator, the maker of light. •
3. The Maruts, the Cagatt (metre), the Saptadara
(hymn), the Vairupa (song), the rainy season, the
downward breath (apana), 6ukra, the Adityas — these
rise in the West ; they warm, they rain, they praise,
they enter again into him, they look out from him.
That is the tranquil, the soundless, fearless, sorrow-
less, joyful, satisfied, firm, immovable, immortal,
eternal, true, the highest abode, bearing the name
of Vishmi.
4. The Vfove Devas, the Anush/ubh (metre), the
Ekavimsa. (hymn), the Vair&^a. (song), the autumn,
the equal breath (samana), Varu»a, the SAdhyas —
these rise in the North ; they warm, they rain, they
1 See VII, 1 1, abhidhy&tur vistrftir iva.
Z 2
Digitized by
Google
340 MAITRAYAATA-BRAHMAiVA-UPANISHAD.
praise, they enter again into him, they look out from
him. * He is pure within, purifying, undeveloped,
tranquil, breathless, selfless, endless.
5. Mitra-Varu»au, the Pankti (metre), the Trma-
vatrayastriwia (hymns), the .Sakvara-raivata (songs),
the snowy and dewy seasons, the out-going breath
(udana), the Angiras, the Moon — these rise above ;
they warm, they rain, they praise, they enter again
into him, they look out from him — who is called
Pra#ava{Om), the leader, consisting of light, without
sleep, old age, death, and sorrow.
6. .Sani (Saturn), Rahu and Ketu (the ascending
and descending nodes), the serpents, Rakshas, Yak-
shas, men, birds, xarabhas, elephants, &c. — these rise
below ; they warm, they rain, they praise, they enter
again into him, they look out from him — he who is
wise, who keeps things in their right place, the centre
of all, the imperishable, the pure, the purifier, the
bright, the patient, the tranquil.
7. And he is indeed the Self, smaller (than small)
within the heart, kindled like fire, endowed with
all forms. Of him is all this food, within him all
creatures are woven. That Self is free from sin 1 ,
free from old age, from death and grief, from hunger
and thirst, imagining nothing but what it ought to
imagine, and desiring nothing but what it ought
to desire. He is the highest lord, he is the supreme
master of all beings, the guardian of all beings, a
boundary keeping all things apart in their right
places 2 . He the Self, the lord, is indeed vSambhu,
Bhava, Rudra, Pra^apati, the creator of all, Hirawya-
1 See.ffMnd.Up.VIII, 7, 1.
2 See Kh&adi. Up. VIII, 4, 1, where we find setur vidhrj'tir eshaw
lokanam
Digitized by
Google
vii PRApArffAKA, 8. 341
garbha, the true, breath, the swan, the ruler, the
eternal, Vishwu, Naraya#a. And he who abides in
the fire, and he who abides in the heart, and he who
abides in the sun, they are one and the same. To
thee who art this, endowed with all forms, settled in
the true ether, be adoration !
8. Now follow the impediments in the way of know-
ledge, O King 1 ! This is indeed the origin of the net
of bewilderment, that one who is worthy of heaven
lives with those who are not worthy of heaven. That
is it. Though they have been told that there is a
grove before them, they cling to a small shrub. And
others also who are always merry, always abroad,
always begging, always making a living by handi-
work ; and others who are begging in towns, per-
forming sacrifices for those who are not allowed to
offer sacrifices, who make themselves the pupils of
6udras, and .Sudras who know the sacred books ;
and others who are malignant, who use bad language,
dancers, prize-fighters, travelling mendicants, actors,
those who have been degraded in the king's service ;
and others who for money pretend that they can lay
(the evil influences) of Yakshas, Rakshasas, ghosts,
goblins, devils, serpents, imps, &c. ; and others who
falsely wear red dresses 2 , earrings, and skulls; and
others who wish to entice by the jugglery of false
arguments, mere comparisons and paralogisms, the
believers in the Veda — with all these he should not
1 This king is not meant for Br?hadratha.
2 This refers to people who claim the privileges and licence of
Sannyasins without having passed through the discipline of the
preceding ajramas. As this was one of the chief complaints made
against the followers of .Salcyamuni, it might refer to Buddhists,
but it ought to be borne in mind that there were Buddhists before
Buddha.
Digitized by
Google '
342 MAITRAYAJVA-BRAHMAJVA-UPANISHAD.
live together. They are clearly thieves, and unworthy
of heaven. And thus it is said :
' The world unsettled by the paralogisms of the
denial of Self, by false comparisons and arguments,
does not know what is the difference between Veda
and philosophy 1 .'
9. BWhaspati, having become .Sukra, brought forth
that false knowledge for the safety of Indra and for
the destruction of the Asuras. By it they show that
good is evil, and that evil is good. They say that we
ought to ponder on the (new) law, which upsets the
Veda and the other sacred books 2 . Therefore let no
one ponder on that false knowledge : it is wrong, it
is, as it were, barren. Its reward lasts only as long
as the pleasure lasts, as with one who has fallen from
his caste. Let that false science not be attempted,
for thus it is said :
(1) Widely opposed and divergent are these two,
the one known as false knowledge, the other as
knowledge. I (Yama) believe Na&ketas to be
possessed by a desire of knowledge; even many
pleasures do not move thee 3 .
(2) He who knows at the same time both the
imperfect (sacrifice, &c.) and the perfect knowledge
(of the Self), he crosses death by means of the
imperfect, and obtains immortality by means of the
perfect knowledge 4 .
(3) Those who are wrapped up 8 in the midst of
1 If we translate thus, the use of vidya for vrith& vidyd is
unusual ; if we follow the commentary, we should have to trans-
late, he does not know the Veda and the other knowledge.
* All this may refer to Buddhists, but not by necessity, for there
were heretics, such as Br»haspati, long before .Sakyamuni.
8 See KaJh. Up. II, 4. 4 See Va£. Up. n.
6 Vesh/yamana^, instead of vartamana^.
Digitized by
Google
VII PRAPATJ/AKA, II. 343
imperfect knowledge, fancying themselves alone wise
and learned, they wander about floundering and de-
ceived, like the blind led by the blind 1 .
10. The gods and the demons, wishing to know
the Self, went into the presence of Brahman (their
father, Prafapati) a . Having bowed before him, they
said : ' O blessed one, we wish to know the Self,
do thou tell us.' Then, after having pondered a
long while, he thought, these demons are not yet
self-subdued 3 ; therefore a very different Self was
told to them (from what was told to the gods). On
that Self these deluded demons take their stand,
clinging to it, destroying the true means of salva-
tion (the Veda), preaching untruth. What is untrue
they see as true, as in jugglery. Therefore, what is
taught in the Vedas, that is true. What is said in
the Vedas, on that the wise keep their stand.
Therefore let a Brahman not read what is not of
the Veda, or this will be the result.
1 1. This is indeed the nature of it (the Veda), the
supreme light of the ether which is within the heart.
This is taught as threefold, in the fire, in the sun,
in the breath. This is indeed the nature of it, the
syllable Om, of the ether which is within the heart.
By it (by the Om) that (light) starts, rises, breathes
forth, becomes forever the means of the worship and
knowledge of Brahman. That (light, in the shape of
1 See Katf . Up. II, 5.
* Cf. KAknd. Up. VIII, 8.
* I prefer ayat&tm&naA, though it is the easier (sugama) reading,
as compared with anyatitm&naA, those who seek for the Self else-
where, namely, in the body. It seems to me to refer to those who,
without having subdued the passions of their body, wish to obtain
the knowledge of the Highest Self. Possibly, however, the author
may have intended a climax from aayaXitxainzA to anyatamam.
Digitized by
Google
344 MAITRAYAiVA-BRAHMAiVA-UPANlSHAD.
Om), when there is breathing, takes the place of the
internal heat, free from all brightness 1 . This is like
the action of smoke ; for when there is a breath of
air, the smoke, first rising to the sky in one column,
follows afterwards every bough, envelopes it and takes
its shape 2 . It is like throwing salt (into water), like
heating ghee 3 . The Veda comes and goes like the
dissolving view of a master-magician 4 . And here
they quote:
' Why then is it called " like lightning ?" Because
as soon as it comes forth (as Om) it lights up the
whole body. Therefore let a man worship that
boundless light by the syllable Om.'
(i) The man in the eye who abides in the right eye,
he is Indra, and his wife abides in the left eye 5 .
(2) The union of these two takes place in the cavity
within the heart, and the ball of blood which is there,
that is indeed the vigour and life of these two.
(3) There is a channel going from the heart so far,
and fixed in that eye ; that is the artery for both of
them, being one, divided into two.
1 This seems to be the meaning adopted by the commentator ;
but may it not be, sending forth brightness ?
2 The simile is not very clear. The light of Brahman is below
the sphere of fire in the body. That sphere of fire becoming
heated, the light of Brahman becomes manifest. When the fire
has been fanned by the wind of sonant breath, then the light of
Brahman, embodying itself in the wind and the fire, manifests itself
first in the mere sound of Om, but afterwards, checked by throat,
palate, &c, it assumes the form of articulate letters, and ends by
becoming the Veda in its many branches.
8 As these are outwardly changed, without losing their nature,
thus the light of Brahman, though assuming the different forms of
the Veda, remains itself.
4 See before, VII, 1.
8 See Bnh. Up. IV, 2, 2, 3, where Indra is explained as Indha.
Digitized by
Google
VII PRAPA777AKA, II. 345
(4) The mind excites the fire of the body, that fire
stirs the breath, and the breath, moving in the chest,
produces the low sound.
(5) Brought forth by the touch of the fire, as with
a churning-stick, it is at first a minim, from the
minim it becomes in the throat a double minim ;
on the tip of the tongue know that it is a treble
minim, and, when uttered, they call it the alphabet
(<tto«x««) *•
(6) He who sees this, does not see death, nor dis-
ease, nor misery, for seeing he sees all (objectively,
not as affecting him subjectively); he becomes all
everywhere (he becomes Brahman).
(7) There is the person in the eye, there is he
who walks as in sleep, he who is sound asleep, and
he who is above the sleeper : these are the four
conditions (of the Self), and the fourth is greater
than all 2 .
(8) Brahman with one foot moves in the three,
and Brahman with three feet is in the last.
1 A comparison of this verse with AT^and. Up. VII, 26, shows
the great freedom with which the wording of these ancient verses
was treated. Instead of —
Na paryan mr/tyum paryati na rogaw nota du^khatam,
Sarva/» hi pajyan paryati sarvam apnoti sarvaraA,
the .ATMndogya Up. reads :
Na p&ryo nWtyum paryati na rogaa? nota du^khat&m,
Sarvaw ha p&syaA paryati sarvam £pnoti sarvajaA.
2 The conditions here described are sometimes called the Vwva
(YauvSnara), Taig-asa, Pra^raa, and Turlya. In the first state the
Self is awake, and enjoys the world ; in the second he sees every-
thing as in a dream ; in the third the two former states cease, and
he is absorbed in sleep ; in the fourth he becomes again the pure
Self. In the first state the Self has the disguise of a coarse material
body; in the second of a subtle material body; in the third its
disguise is potential only; in the fourth it has no disguise, either
potential or realised.
Digitized by
Google
346 maitrayajva-brAhmajva-upanishad.
It is that both the true (in the fourth condition)
and the untrue (in the three conditions) may have
their desert, that the Great Self (seems to) become
two, yes, that he (seems to) become two \
1 ' By reason of the experience of the false and the true, the great
Soul appears possessed of duality.' Cowell.
V *
I
' !
Digitized by
Google
TRANSLITERATION OF ORIENTAL ALPHABETS.
347
Ft n «» i n.
D
D
'0
'0
*\ JJ *)^J
^^a &;<►«/
ts fc tz P
r. as c ?\ c
- - UoJ-U
- _- UoJU
J» iw
K)
•^
k)*>
d
al •
V & XS V? \F
«•■»
-a - fi J*
00
3
5
a
-i 'a
.a
gg
'■3
8
a
o
•2 a
5r 'S
a *
.3 s
C
CO
§
.2
c
00
...i
W
d
•a
M
CO
3
1 «
■a .
• 'S. • 'I
i a
• s • s
j &
03
8 *§
*H N W ■* »0 O *» <*> * ® S 2
«5 ■* «<5 <C t-
Digitized by
Google
34& TRANSLITERATION OF ORIENTAL ALPHABETS
- -3
e q
p- r . njs
.B O — M
5.
•b ' D
<3 -» • •*» D-o
■>>
9-
b<"> 9
t • .i T>-o
Vb
?*
init.
? ■% e.\?
1
<^
B-
lefr . nr* ir|S|8 -if
S
N N-
-a
to
H .
si
.a
s
00
a,
CO
OS O
— IM
11
5 £
.-< cm
IM CM
00
CD
•a
CD
a. - 3
rt CM
.2 .2
"o "3
S E
oo 3
(3 OS
=> 2
c- £•
j : <
•3
c
H
CO
CM
2
"3
ye, o
J 1
. 3
■c
'3.
CO
Tttincot^oocno^ieMm^iao^
eM(NCM<MCMCMCOCOC<5COeOC0C0»
Digitized by
Google
FOR THE SACRED BOOKS OF THE EAST.
349
• . . (.
00
*.§, : .* .
a * •
<H
a '■'.'.'. r
Q OFl n
o *
j -
-A •=» • '?) • -\
: : > :
«_ •
1 «>
-» -a • • • -\
3> : > :
«_ .
1 «>
. .fc, . .^
• • • • rv
':?
• in
» •
S> «
• • •
:&
■ * : 1 -:
»*
"» ft -J, .
•o to (l» |w & ^
. . xr
Sr If (a- *
! » •
. : r-r (f
.'.....
' K !
! . . .
** 5 "<* *§ « • *
• • • . s
>, • ■
• • s
. -!
oo efl
a-** 5 . a * J
«s its
1
■i
2
'S.
1
§ e
S3
-8
CQ
"3
8" e
8 ^
GQ
'3
a
2
1
'a
s
a
•C 5
1
H
2
CO
02
sS
on
as
rt N
M T*
w
CO t»
00
W
CO «3H
T* *(
Tit •*
•*
«3H ■*
T(<
« .3
.53
a,
02
<3 a3
5 .3
< >
Digitized by
Google
35°
TRANSLITERATION OF ORIENTAL ALPHABETS.
<jj <d •— «~
S <0 4> <0> £
o • 5
I--M
►*-
>| il |. tj,
»b
> v ;
•I * h !>
H'i>
i|)
:.'J,
5 3 " *>
~«v^
2/
-9-5-~
to
P £ »r«r le^ri^^lR • * '*
?*
^ 5
O MJ j O <8 <«J
- 8 S t t SO
Digitized by
Google
Digitized by
Google
Digitized by
Google
UNIVERSITY OF CALIFORNIA LIBRARY
BERKELEY
Return to desk from which borrowed.
This book is DUE on the last date stamped below.
JAN 191948
tf
fttf
w 3A953U
W» 9, 5 1955^
5Jan'56RE0
HFC l 5 1955 LU
150CF60AR
LD 21-100m-9,'47(A5702sl6)476
26.%
W62JU
iJjAR 3
1966 5 y
MM 2 7 1963
m 2 1963
10%y'65LD
O LD