(navigation image)
Home American Libraries | Canadian Libraries | Universal Library | Community Texts | Project Gutenberg | Children's Library | Biodiversity Heritage Library | Additional Collections
Search: Advanced Search
Anonymous User (login or join us)
Upload
See other formats

Full text of "Finnish Bible"

Google 



This is a digital copy of a book that was preserved for generations on library shelves before it was carefully scanned by Google as part of a project 

to make the world's books discoverable online. 

It has survived long enough for the copyright to expire and the book to enter the public domain. A public domain book is one that was never subject 

to copyright or whose legal copyright term has expired. Whether a book is in the public domain may vary country to country. Public domain books 

are our gateways to the past, representing a wealth of history, culture and knowledge that's often difficult to discover. 

Marks, notations and other maiginalia present in the original volume will appear in this file - a reminder of this book's long journey from the 

publisher to a library and finally to you. 

Usage guidelines 

Google is proud to partner with libraries to digitize public domain materials and make them widely accessible. Public domain books belong to the 
public and we are merely their custodians. Nevertheless, this work is expensive, so in order to keep providing tliis resource, we liave taken steps to 
prevent abuse by commercial parties, including placing technical restrictions on automated querying. 
We also ask that you: 

+ Make non-commercial use of the files We designed Google Book Search for use by individuals, and we request that you use these files for 
personal, non-commercial purposes. 

+ Refrain fivm automated querying Do not send automated queries of any sort to Google's system: If you are conducting research on machine 
translation, optical character recognition or other areas where access to a large amount of text is helpful, please contact us. We encourage the 
use of public domain materials for these purposes and may be able to help. 

+ Maintain attributionTht GoogXt "watermark" you see on each file is essential for in forming people about this project and helping them find 
additional materials through Google Book Search. Please do not remove it. 

+ Keep it legal Whatever your use, remember that you are responsible for ensuring that what you are doing is legal. Do not assume that just 
because we believe a book is in the public domain for users in the United States, that the work is also in the public domain for users in other 
countries. Whether a book is still in copyright varies from country to country, and we can't offer guidance on whether any specific use of 
any specific book is allowed. Please do not assume that a book's appearance in Google Book Search means it can be used in any manner 
anywhere in the world. Copyright infringement liabili^ can be quite severe. 

About Google Book Search 

Google's mission is to organize the world's information and to make it universally accessible and useful. Google Book Search helps readers 
discover the world's books while helping authors and publishers reach new audiences. You can search through the full text of this book on the web 

at |http: //books .google .com/I 



mi m ll 

■>;•■..■ 

■ 



H ■• . 



^5^.- 



J"'- * 






.■ ^ 



fv. 



f'-Vs 



;■* 



^..:^ 






.■". ■# 






'I ; ■ 



I 

FINNISH BIBLE 



SPECIAL EDITION 



AMERICAN BIBLE SOCIETY 

(NSTITUTKD IN THK YEAB 1816 

NEW YORK 
1920 



i^tfaOKMa^la 



"\ 



BIBLIA 



ELI 

M 



P YHA RAAMATTU 



VANHA JA UUSI TESTAMENTTI. 



ENGLANNIN JA ULKOMAAN BIBLIASEURA 



r ■ Tn bt» 



HELSINKI 

1911 



KIELELLISESTI KORJATTU PAINOS NOUDATTAMALLA 
ARMOSSA ASETETUN BIBLIA*KOMIT£AN KAANNOKSIA. 






VANHAN TESTAMENTIN KIRJAT. 

SivQ. Lokuja. 

IMooseksen Kirja 5 . . 50 

2Moosekse]i Kirja , , 58 . . 40 

SMooseksen Kirja "....... 102 ., 27 

4Mooseksen Kirja . . . . » 134 .. 36 

5 Mooseksen Kirja , . 178 . . 34 

Josuan Kirja 217 . . 24 

Tuomarien Kirja 242 . . 21 

Ruutin Kirja : 267 . . 4 

1 SamueUn Kirja 270 . . 31 

2Samuelin Kirja ^ ...... 303 .. 24 

1 Kuningasten Kirja 830 . . 22 

2 Kuningasten Kirja -. . 862 .. . 25 

lAikakirja 882 ,. . 29 

2Aikakirja ,.,...... 421 .. 36 

Esran Kirja 456 . . 10 

Nehemian Kirja . 465 . . 13 

Esterin Kirja . 479 . . 10 

Jobin Kirja 487 . . 42 

Psaltari 513 .. 150 

Salomon Sananlaskut 580 . . 31 

Salomon Saama^a 602 . . 12 

Salomon Korkea Veisu 610 . • 8 

Profetat: 

Jes^a 614 . . 66 

Jeremia < 663 . . 52 

Jeremian Valitusvirret 718 . . 5 

Hesekiel 723 . . 48 

Daniel 773 . . 12 

Hosea 788 . . 14 

Joel 795 . . 3 

Amos 798 . . 9 

Oba^ja .... ... .V. 803 . . 1 

Joona 804 . . 4 

Mika 806 .. 7 

Naham 810 . . 3 

flabakuk 812 . . 3 

Sefapja 814 . . 3 

Haggai 817 . . 2 

Sakarja ." 818 . . 14 

IfakUda 827.. 4 




UUDEN TESTAMENTIN KIRJAT. 



Slvu. 

Matteuksen Evankeliumi 3 

Markuksen Evankeliumi . 38 

Luukkaan Evankeliumi « 60 

Johanneksen Evankeliumi 98 

Apostolien Teot 126 

Apostoli Paavalin Kirjeet: 

Kirje Roomalaisille .162 

1 Kiije Korinttolaisille 179 

2 Kirje Korinltolaisille 194 

Kiije Galatalaisille 205 

Kirje Efesolaisille 210 

Kiije Filippiiaisille 215 

Kiije Kolossalaisille .219 

1 Kirje Tessalonikalaisille 223 

2 Kiije Tessalonikalaisille 226 

1 Kirje Timoteukselle 228 

2 Kirje Timoteukselle 232 

Kiije Tiitukselle 235 

Kirje Filemonille 237 

Kiije Hebrealaisille 238 

Pielarin 1 Kirje 249 

Pietarin 2 Kirje . . . , , 254 

Johanneksen 1 Kirje 256 

Johanneksen 2 Kirje . , 261 

Johanneksen 3 Kirje 261 

Jaakobin Kirje - ♦ , 262 

Juudaan Kiije , , . , 266 

Johanneksen Ilmestys . 267 



Lukuja. 


. . 28 


. , 16 


. . 24 


. . 21 


. . 28 


. . 10 




10 




. 13 









6 




4 




4 




5 




3 




6 




4 




3 




1 




13 




5 




. 3 




. 5 




. 1 




. 1 




. 5 




1 




. 22 



*v ~ f- 



ENSIMMAINEN MOOSEKSEN KIRJA. 



Aniiu loi JumaUi taivaan ]a maan. 

" Pi. »«. 90:2. joaas. Job. 1:1, ». Eel. ];1B, 

IT. Bet*. 11 & 

1 Ja maa oil autio ]a lyhJSJa pi- 
mcTi olt lyvyyden pfiailS, fa Juma' 
Ud Henki lifkkuj vetlen pIftllB. 

1 J* Jumala tanol; „(ul)'Oon val- 
hDi," Ja valkcus lull. tXor.iA 

4. Ja Jumala nflht valkeuden hy- 
likil. NlfiiJuinals«roilllvaIkeuden 
pimeydesia. 

i, Ja Jumala kulsui valkeuden pSl- 
tlkil.Ja plmeyden kulsui hBnySksl. 
U mn ehtoosta Ja aamusla enslm- 
nlincu pBtvB. 

1 Ja Jumala sanol: „lulkooa vah- 
Tuui vetlen vaUieelle, erolllamaan 



, ,, merk«lktl 

tBrBEm&Bnalal.pBivBtjBVUtf 
uei. Pl.l3e;?t. Jci.SISS. 

15. Ja oikool valolksl lalvaan vah- 
vuudessa, palslamaan maanpBBlle." 
Ja lapahtul nlln. 

16. Ja Jumala lekl kak»t snnria *a- 
loa: suuremmsn valon pfllvflfi hal- 
liLsemaan. ja vUhemmBn valon yA> 
IB halllUemaan, Ja IShdet. 

17. Ja Jumala panl ne talvaan vah- 
vQuteen, palslamaan maan pBfllle, 

18. Ja hallllsemaan pfllvBB Ja ySlfl, 
lekB eroitlamaan valkeulta pimey- 
desia. Ja Jumala uSkl sen hyvBkil. 

19. Ja lull ehloosta ]a aamusla uel- 
JBs pBlvB. 

20. Ja Jumala sanol: ..kuohuttakoot 
, vedet yllBkyllB tilkkuvalsla elftlmlB; 
la tinnut leaiakiWt maan pBflllB lal- 
^an Bvaruudessa". 

21. Ja Jumala lol snurel mertelBI- 
metjakalkklnalsellilkkuvaiselelfll- 
mel, Joila vedel kuohuttival yllSkyl- 
IB, kanhin lalnsajBlkeen, Jalialkkl- 
nalset sjlvelliset linnut, lainsa jfll- 
keen. Ja Jumala uflki tea hyvBksl. 

22. Ja Jumala slunasi heitll. Ja m- 
DOl : ..olkaal hedelmBlliset Ja lIsBin- 
lyknat. Ja Iflytlflkast meren vedel, 
Ja llnnuf lliBBnlykOOl maan pBBIIB.'' 

23. Ja lull etiloosia Ja aamusla vll- 
des pBlvB. 

M.5a ■ 



1 Jumala sane 



„luollahoait 



ilelevaisia Ja maan peloja 
...keen." Ja tapahlul niln. 
25. Ja Jumala tekl maan pedot la- 



JBlki 



keen' Ja kal^Onalset matelevalsel 
maan pflSlU lainsa jfilkeen. Ja Ju- 
mala nfiki sen hyvBksl. 
26. Ja Jumala sanoi: ..lehkBBmmclb- 
mlnen meidSn kuvakiemme, mel- 
dBn muotomme jBlkeen; Ja he val- 
lilkoot kalal meressB, Ja laivaa' "- 



J a karjen Ja koko maan, ja 
, Jolka maalla maletevai." 
27. Ja Jumala loi ihmlsen omaksl 
kuvakMnw, Jumalau kuvakil HSn 



1 MOOS. 1. 2. 



hdnet loi : mieheksi ja vainfoksi loi 
Ufin heidflt. 

1 Moos. 5:1. 9:6. Ef.4:24. Kol.3:10. 

28. Ja Jumala siunasl heitd ; ja Ju- 
mala sanpi heille: ,,olkaat nedel- 
mfilliset Ja lisfifintykfifit ja tfiyttflkfifit 
maa, ia tehkfifit se alamaiseksenne; 
ja vallitkaat kalat meressd, ja tai- 
vaan linnut, \a kaikki elSimet, jot- 
ka maan pfifiilft liikkuvat.*' 

29. Ja Jumala sanoi: „katso, minll 
annan teille kaikkinaiset ruohot, jois- 
sa siemen on, koko maan pSfillS, 
ja kaikkinaiset hedelmfilliset puut, 
joissa siemen on, leille ruuaksi. 

1 Moos. 9:3. 

30. Ja annan kaikille maan elfii- 
mille. ja kaikille taivaan linnuille, 
sekS kaikille, jotka matelevat maan 
pflfiUd, joissa elfivfi sielu on, kaik- 
kinaiset viheriiliset ruohot sydtfivftk- 
si.*' Ja tapahtui niin. 

31. Ja Jumala katsoi kaikkia, mitft 
Hfin tehnyt oli, ja katsb, ne olivat 
sangen hyvftli J a tuU ehtoosta ja 
aamusta Kuudes pftlvft. 

2 Luku. 

S^bbattl. Bdenin paradilsl. Vaimon 
laomlnen. 

J a niin taivas ja maa valmistettiin, 
ja kaikki heidfln loukkonsa. 

2. Ja Jumala p9d(ti seitsemfintenll 
pfiivfinii tyOnsfi, jonka Hfin tehnyt 
oU, ja lepfisi seitsemfintenfi pfiivfinfi 
kaikista teoistaiisa, jotka hfin teh- 
nyt oil. 2 Moos. 20:11. 31:17. 5Moo8.6:14. 

Hebr. 4.4. 

3. Ja Jumala siunasl seitsemfinnen 
pftivfin ja pyhitti sen, sillfi Hfin le- 
pfisi sinfi pfiivfinfi kaikista teoistan- 
sa, iotka Hfin luonut ja tehnyt oH. 

4. Nfiin on syntynyt mitfi taivaassa. 
ja maan pfifillfi on, koska he luotiin, 
sillfi. ajalla, jolloin Herra Jumala te- 
ki maan ja taivaan. 

5. Ja el ollut vielfi yhtfikfifin kedon 
pensasta maan pfifillfi, eikfi yhtfikfifin 
kedon ruohoa vielfi kasvanut. Sillfi 
ei Herra Jumala antanut sataa maan 
pfifille, eikfi ollut ihmistfi. maata vil- 
jelemfissfi ; 

6. vaan sumu nousi maasta, ja kas- 
toi kaiken maan pinnan. 

7. Ja Herra Jumala teki ihmisen 
maan tomusta. ja puhalsi hfinen sie- 
ramlinsa elfivfin hengen; ja tuli 
ihminen niin elfivfiksi sieluksi. 

I Kor. 15:458. 

3. Ja Herra Jumala istutti paradii- 
sin Edenissfi itfifin pfiin, ja pani sii- 
hen ihmisen, jonka hfin tehnyt oli. 

9. Ja Herra Jumola kasvatti maas- 



ta kaikkinaiset puut, ihanaiset nfih- 
dft ia hyvfit syddfi, ja elfimfin puun 
keskelle paradiisia, niin myOs hy- 
vfin ja pahan tiedon puun. Ilin.2:7. 

10. Ja Edenistfi kfivi virta, joka kas- 
leli paradiisia; ja sitten jakaantui se 
neyfifin pfifihaaraan. 

ll.-Ensimmfiinen kutsutaan Piison; 
se juoksee koko Hevilan maan ym- 
pfiri, jossa on kultaa. 

12.. Ja sen maan kulta qn kalHs; ja 
sie}lfi myOslOytyy bedellion, jaoniks- 
kivefi. 

13. Toinen virta kutsutaan Giihon; 
se juoksee koko Etiopian maan ym- 
pfiri. 

14. Kolmas virtk kutsutaan Hidde- 
keU ja se juoksee Assyrian editse. 
Ja neljfis virta on Frat. 

15. Ja Herra Jumala otti ihmisen 
ja pani Edenin paradiisiin, viljele- 
mfifin ja vartioimaan sit^. 

16. Ja Herra Jumala. kfiski ihmis- 
tfi, sanoen: „S3'd vapaasti kaikkinai- 
sista puista paradlisissa ; 

17. mdtta hyvfin ja pahan tiedon 
puusta filfi syA : sillfi jona pfiivfinfi 
sinfi siitfi sydt, pitfifi sinun kuole- 
malla kuoleman.'* 

18. Ja Herra Jumala sanoi : „ei ole 
ihmisen hyvfi olla yksinftnsfi ; minfi 
teen hfinelle avun, joka on hfinelle 
sopiva.** 

19. Kun Herra Jumala oil tehnyt 
maasta kaikkinaiset kedon elfiimet, 
ja kaikkinaiset taivaan linnut, toi 
Hfin ne Adamin eteen, nfihddksensfi, 
kuinka hfin ne nimittfiisi; sillfi niin- 
kuin Adam kaikkinaiset elfiimet ni- 
mitti, niin ne kutsutaan. 

20. Ja Adam antoi kaikelle kaijalle, 
ja taivaan linnuilleja kaikille kedon 
elfiimille heidfin nimensfi. Mutta Ada- 
mille ei Idytynyt apiia, joka olisi 
hfinelle sopiva ollut. 

21. Ja Herra Jumala vaivutti Ada- 
min ras(caasen uneen, ja hfinen nuk- 
kuessaan, otti Hfin yhden hfinen kyl- 
kiluistansa, ja tfiytti sen paikan li- 
halla. 

22. Ja Herra Jumala rakensi vai- 
mon siitfi kylkiluusta, jonka Hfin 
Adamista otti, ja toi hfinet Adamin 
eteen. l Kor. 11:8. l Tim. 2:13. 

23. Niin sanoi Adam : „tfimfi on nyt 
luu minun luistani, ja liha minun 
lih'astani; kutsuttakoon hfin mie- 
hettfireksl, sillfi miehestfi hfin on o- 
tettu.*t iKor.li«,». 

24. Sentfihden pitfifi mlehen luopu- 
man isfistfinsfi ja fiidistfinsfi. ja vai- 
moonsa sidottu oleman, ja he tule- 
vat yhdeksi liliaksi. MaU.l9'.6. Mark. 

10:6,7. 1 Kor. 6:16. £f.6:31. 



1 MOOS. 2. 3. 4. 



25. Ja Adam ja hftnen vaimonsa 
oUvat molemmat alasti, eivfttkA hfi- 
venneet. 

3 Luku. 

SyntUnlankeemiu. 

J a kftrme oli kavalampi kaikkia 
muita maan elSimifi, jotka Herra 
Jmnala tehnyt oli; Ja se sanol vai- 
molle: „olisiko Jumala sanonut: &!• 
kftfit sv0k6 puista paradiisissa?** 

2. Nifnvaimosanoikfirmeelle: mHIC 
saamme JcyllA svOd^ muittenpuiden 
bedelmista, jotka ovat paradiisissa; 

3. mutta sen puun hedelmfistft, joka 
on keskeim paradiisia, on Jumala 
sanonut : ,.&lkSSt sy((kO siitfi, Ja SI- 
kflAt ruvetko siihen, ettette kuolisi.** 

1 Moos. 2:18,17. 

4. Nlin kfirme sanoi vaimolle: ^ette 
suinkaan kuole; Job. 8:44. 

5. vaan Jumala tletSfi, ettfl kun le 
syOtte siitfi, aukenevat teidiln sil- 
mftnne, niin ettfi tulette niinkuin Ju- 
mala , tietfimfifin hyvfin ia pahan**. 

6. Ja vaimo nSkl, ettfi oli hyvfisyOdfi 
siitfi puusta, Ja ettfi se oli inana nfih- 
dfi, ja se oli suloinen puu antamaan 
ymmfirrystfi; ja hfin otti sen hedel- 
mfistft Ja s<(i, ja antoi miehellensfi- 
kin siitfi Ja hSns6i. 2Kor.ll3. lTini^:l4. 

7. Siiloin aukenivat heidfin molem- 
pien silmfit, ja he huomasivat olevan- 
sa alasti; Ja he sitoivat yhteen fiiku- 
nalehtifi Ja tekivfit itsellensfipeitteitfi. 

8. Ja he kuulivat Uerran Jumalan 
kfiyskentelevfin paradlisissa,kun pfii- 
vfi viilefiksi tuh. Ja Adam vaimon- 
sa kanssa lymyi Herran Jumalan 
kasvojen edeslfi puiden sekaan para- 
diisissa. 

9. Mutta Herra Jumala kutsul Ada- 
min,ia sanoihfinelle: „kussasolet?'* 

10. Ja hfin vastasi: Mminft kuulin 
sinun fifinesi paradiisissa, ja pelkft- 
sin, sillfi minfi olen alasti; ja sen- 
tahden minfi lymyin". 

11. Mutta Hfin sanoi^ ^kuka sinulle 
ilmoitii, ettfis alasti olet? Etk6 syO- 
nyt siitfi puusta , josta minfi sinua 
haastoin syOmfistfi?** 

12. Niin sanoi Adam : „vaimo, Jon- 
kas annoit miuulle, antoi minuUe 
siitfi puusta, Ja minfi sOin.'* 

13. Siiloin sanoi Herra Jumala vai- 
molle: ,,miksi sen teit?" Ja vaimo 
sanoi : „kfirme petti minun, ja mi- 
nfi s6in.'* 

14. Ja Herra Jumala sanoi kftrme- 
elle: „koska tfimfin teit, kirottu ole 
sinfi kaikesta karjasta, Ja kaikista 
maan elfiimistfi; sinun pitfifikfiymfin 
vatsallasi. Ja syOmfia maata kaiken 
elinaikasi. 



15. Ja minfi panen Whollisuuden 
sinun ja vaimon rftliUe, ja sinun sio- 
meuesi ja hfinen siemenensfi vfilil- 
le ; se on rikkipolkeva sinun pfifisi, 
ia sinfi olet pistfivfi hfintfi kantapfifi- 
hfin.** Boom. 16:20. Hebr. 2:14 s. 1 Job. 8:8. 

16. Ja vaimolle sanoi hfin? ,.minfi 
saatan sinulle paljon tuskaa, kun 
raskaaksi tulet ; sinun pitfifi synnyt- 
tftmfin lapsiakivu]la,jamiehesipuo- 
leen pitfifi sinun halusi oleman, Ja 
hfin on sinua vallitseva". 

Er. 6:22 88. lPiet.S:l. 

17. Ja Adamille sanoi hfin: „koska 
kuunlclit vaimoasi, Ja sOit puusta, 
jo*;ta minfi kielsin sinua, sanoen: 
,filfi siitfi syO\sentfihden olkoonmaa 
kirottu sinun tfihtesi : vaivalla pitfifi 
sinun elfittfimfin Itsesi siitfi kaiken 
elinaikasi. 

18. Oijantappuroita ja ohdakkeita 
on se sinulle kasvava, ja sinun pi- 
tfifi maan ruohoja syOmfin. 

19. Otsasi hiessfi pitfifi sinun sy5- 
mfin leipfifisi, siihen asti kuin ma- 
aksi Jfilleen tulet. sillfi siitfi sinfi o- 
tettu olet. Sillfi maa sinfi olet, ja ma- 
aksi pitfifi sinun jfilleen tuleman.** 
P8.90:3. 104:29. 8a*m.3:2a 12:7. Boom. 6:12. 

20. Ja Adam antoi valmollensa ni- 
men Eva, sillfi hfin on kaikkien elfi- 
vitten fiiti. 

21. Ja Herra Jumala teki Adamille 
ja hfinen vaimollensa nahoista vaat- 
teet ja puetti heidfin yllensfi. 

22. Ja Herra Jumala sanoi: „katso, 
ihminen on niinkuin yksi meistfi, 
tietfien hyvfin ja pahan; mutta fil- 
kOOn hfin nyt ojentako kfittfinsfi, ja 
ottako elfiman puusta, syOdfiksensfi 
ja elfifiksensfi ijankaikkisesti.** 

23. Sentfihden Herra Jumala joh- 
datti hfinet ulos Edenin paradiisista 
maata viljelemfifin, josta hfin otet- 
tu oli. 

24. Ja Hfin ajoi ihmisen ulos, la pa- 
ni itfipuolelle Edenin paradiisia Ke- 
rubimin vfilkkyvfillfi miekalla vartl* 
joimaan tietfi elfimfin puulle. 

4 Luku. 

KainJaAbel. Ksinhi jUkelftiset Set 

J a Adam tunnusteli vaimoansaEvaa, 
ja hfin tuli raskaaksi, ja synnytti 
Kainin; siiloin hfin sanoi: „mlnft 
olen saanut miehen.** 

2. Ja taas hfin synnytti pojan, Abe- 
lin, edellisen veljen. Ja Abel tuli 
lampuriksi, mutta Kain peltomie- 
heksi. 

3. Ja tapahtui ionkun aJan perfistfi, 
ettfi Kain uhrasiHerallelabJanniaan 
hedelmistfi. 



1 MOOS. S. S. 



)l. RMun oil MltMinBiikymmenet) I kyramenlB ajaslalkaa; qltlen hBn 



•iobtjui vanha, kun hfin tUlli Ma- 
hilaleeUn. 
11 Ji hOn eli sillen kahdeki 



10. Koko Jaredin ikS oil yhdeksfin- 
Htia ]■ hsksiieilsemniiakymmeDlfl 
UMlafkaa; sliien hfln kuoll. 

S.HeaokolivlIdenseilsemaitakyiii- 
nwiU ■jaiiajan TBDha, kun Ma 
MlU Heluulan. 

2i. Ja lillcn kun hfia oil Metusa- 
tan liltianvi, pysyl hflnjumallieua 
cumlojfl kolmeiataa aiastaUtaa. ta 
•UW noiUa (a lyllOrifl. 

B. Ja kohollenokln Ihfi (^i kolme- 
w^ Ja viiiUeilsemflliakymmeara 

Ji Run han oil elinyt Inmallseill, 
« UaU enaa oUul; slllnjumala olH 
IJien poll. Hebr.ua, Jnad.v.H. 

a. Helnsala oil sadan ja ieil$emBn 
TbdeksailBkyQimenia afaitajan van- 
■>■■ kUQ hfla lilUi LamekiD. 

A Ja itllcD han eli v<eia ■eilsG' 
=ita»»taaja kakil yhdeksiltHkym- 
■enU ajailalkaa, ]a slttti palkia Ja 



WUrii. 
n. Boko 



T. Boko Hehualan Ika oil yhdek- 
j-OHIaa Ja yhdeksflnMitsemfllia- 
gnmenU ajattafksa: Mtten bfln 

S. Uunek oU aadan Ja kahdett \h' 
ukatlBkyinnienia ajastalan vanfia, 
Ji lUtd pojan. 

S-Ja anlol handle nimen Noak; 
"noen: „tB>nfl on lohdollava melia 
HHslinnie ]a kailemme vaivoiua 
MMn paalla, Jonke Her™ on kl- 
ronnul.'- 

n Sltten ell hBn vilslsalaa yhdek- 
■nkyjiimenia villi ajaslaikaa, Ja 
Uilttpoikla Ja lyllflrifi. 

IhKoko Lame^in Ika oli seiUe- 



kuolt. 

.33. Noak oli vlldensadan ajaslajan 

vanha, kun hBn sjlllt Semln, Ramin 

iaJafetin. 

6 Luku. 
pibDua. JuinaU Jullilu tulTUi 



tulCTI 



Arkki n 



J a tapahtul, kun Ihmisel rupesival 
lisaSolymaan maan pSBllB Ja 
slUtlvai tyliarifi, 

a. niln JunialanpojalnBklvatlhmls- 
lea lytlSret kaunilksl, Ja otiivat vai- 
moikseen kaikUla ne, joila halusi- 
val. ,Mitt.24:3S. Luitk.lT27. 

8. Sillotn sanol Herra: „ei minun 
tienkenl ole nuhteteva Ihmisia jian- 
kaikkiseali, slIIB hSn on erhelyksis- 
iBnsB liha ; aenlBhden oikoon Hanel- 
1e ailiaa sala kakslkymmenia ajast- 

i. Sil'henatkBan.nilnkuin myOhem- 
mlnUn, oli Banhereila maan pBBlin, 
kun JumalHii pojal makaslvatjhmis- 
len lyllArifl ja he ollval siillSneet 
heille: nflmfll olival urool, ne mut- 
nen huutuisat miehet. 

5. Mulla Herra nflki Ihmisen pa- 
huuden suurehsl maan pflBllB: la 
kalkkl hBnen sydSminensB aivoilUS 
oU alnoaslansa paha ioka alka. 

IHooa.a:21. Matt. l&ilB. 

6. Ja Herra kulul ihmisen lehneen- 
la maan paAlle. ja lull murheelli- 
seksl lydllnimessansfl. 

7. J a Herra ganol: ..rninB lahdon 
ihnalaen, Jonka minS loin, hukutlaci 
maan pBSIIQ, hamasta IhmiseslBnIin 
kaijaan, matolhin Jalaivaan linlui- 
hln asll; silll mina kadun nlilfi 
lehneenl." 

8. Nulla Noak I6yEl armon H«rran 

S. TfimB on Noakin sukukunla. No- 
ak oli hurskas Ja vakaa mles ajat 
'ansa, Ja eli Jumatiscsll. 

Hebi.ll:!'. aPlciSJt. 

10. Ja Noak silril kolme poikaa, Se- 
mln, Haniln ja Jafelln. 

11. Mulla maa oil lurmellu Jume- 
lan kasvoJ«n ede3sa,Ja IBynnBnsB vfl- 
kiyallaa. 

IS. Silloln kalsahll Jumala maan 
pnnlle, ia katso, se oil lurmellu ; siL- 
In kaikkl liha oil lurmellul ttensS 
in pflnilB. 

Ja Jumala sanoi Noakjllc; „kai- 

lihan loppu on minun eteeni 

ul; BillA maa on IIIynnBnaS vA- 

kivBlIaa.Jota he harjQftiaval,Ja kal- 

so.mlnfl hukulan heidBI ynixamaaii. 



Lamekin IkB oil seilie' kanssa. ' 

Ja teilKinfinkebdekialla* I 14. Tee iliellesi wkki hongMla, ja 



1 MOOS. 6. 7. 



tee sisfille oliiisijat, Ja tervaa se si- 
Mltll Ja ulkoa. 

15. Ja tee se nilin: kolmesataa kvy- 
nfirfitll olkoon arkin pituus, viisi- 
kymmentll kyynfirfitfi nfinen.levey- 
tensfi, ja kolmekymmentft kyyi)fira- 
Ifi korkeutensa. 

16. Tee .arkkiin akkunoita Ja pfifitfi 
ne kyynArfin korkealle ylhfiftltfl; Ja 
pane arkin ovi sen kylkeen. Ja tee 
siihen kolme polijaa, aliihmainen, 
kcskimfiinen ja yllmmAinen. 

17. Ja minA, katso, mtofi annan tul- 
la vedenpaisumisen maanpSfillehu- 
kuttamaan kaikkea lihaa, jossa elA- 
vft henki on taivaan alia, fa kaikki, 
mitA thaan pfiAllft on, pitftfi hukku- 
man. 

18. Mutta sinun kanssasi minfi teen 
liitlonija sinun pitAA arkkiin sisftlle 
menemAn, sinun Ja sinun poikasi; 
ja sinun emAntAsi. Ja poikasi emAn- 
nAt sinun kanssasi. 

19. Ja sinun pitAA saattaman ark- 
kiin kaikkinaisia elAimiAkaikestali- 
liasta, kaksittain kaikista, koiralcsen 
ja nnaraksen JAAmAAn elAmAAn kans- 
sasi: 

ao. linnuistalaistansa,kaHasta1ais- 
tansa, kaikkinaisista malelevaisista 
inaan pAAIlA laistansa. Kaikkia nAi- 
lA tulkoon kaksittain sinun tykOsi, 
liengissA pidettAviksi. 

21. Ja Ota myOtAsi kaikkinaista ruo-. 
kan» jota syOdAAn, ia kokoa se ty- 
kOsi, sinulle Ja heille elatukseksi.** 

22. Ja Noak leki sen; kaikki milA 
Jumala hAnen kAski, niin hAn teki. 

7 Luku. 
TnlTE talee. 

J a Herra sanoi Noakille: nmene 
arkkiin,. sinA ja koko sinun liuo- 
neesi; sillA mina olen nAlinyt sinun 
hurskaaksi rainun edessAni tAlIA a- 
jalla. 2Plet2:5. 

2. Kaikista puhtaista elAiniistA ota 
tykOsi seitsemAn ja seitsemAn, koi- 
ras Ja naaras^ mutta saastaisistaelAi- 
mistA kaksin, koiras ja naaras; 

3. niinmyCs taivaan linnuista seit- 
semAn ja seitsemAn, koiras ja naa- 
ras, eltA suku jAisi elAmAAn koko 
maan pAAlIA. 

4. SUIa seitsemAn pAivAn perAstA 
annan minA sataa maan. pAAlIe nel- 
jAkymmentA pAivAA ja nelJAkym- 
mentA yOtA, Ja liukulan maan pAAI- 
lA kaikki elAvAtluontokappaieettJot-^ 
ka minA tehnyt olen.'' 

5. JaNoak teki kaikki niinkuin Her- 
ra hAnelle kAski. 

6. Noak oil kuudensadan Aiasla- 



jan vanha^ kun vedenpaisumus tull 
maan pAAile. 

7. Ja hAn men! arkkiin poikinensa, 
vaimonensa^ ja hAnen poikaiiisa vai- 
mot hAnen kanssansa, vedenpaisu- 
musta pakoon. 

8. Puhtaista -eUirrii^tA ja saastaisis- 
ta. ja Hhnuista ja kaikista, kuin ma- 
televat maan pAAllA, 

9. meni hAnen tykOnsA arkkiin kak- 
sittain, koiras Ja naaras, niinkuin 
Herra Noakille kAskenyt oli. 

10. Ja kun seitsemAn pAivAA kulu- 
nut oli, nousi tulvan vest maan 
pAAlle. 

11. SinA vuonna. kun Noak oil kuu- 
densadan ajastajan vanha, toisel- 
la kuukaudella, seitsemAntenAtoisIa 
pAivAnA kuusta, kuohuivat kaikki 
syvyyden lAhteet, Ja taivaan akku- 
nat aukenivatr 

12. Ja maan pAAile satoi neljAkym- 
mentA pAivAAjaneljAkymmentAyOtA. 

13. Saniana pAivAnA meni Noak ark- 
kiin, Ja Sem, Ham ja Jafet, Noakin 
pojat, ja Noakin vaimo, ia kolme hA- 
nen poikainsa vaimoa hAnen kans- 
saiisa, 

14. riiin myOs kaikellaiset pedot, 
Ja kaikellainen karja, ja kaikellaiset 
maan pAAllA matelevaiset, sekA kai- 
kellaiset linnut, ja kaikki lentAvAi- 
set, joilla siivet ovat. 

15. Ne fnenivAt kaikki Noakin tykO 
arkkiin, kaksittain kaikesta lihasta, 
Jossa elAvA heiiki oli. 

16. Ja ne olivat koirakset ja naa- 
rakset kaikki naisesta lihasta, ia me- 
nivAt sisAUe, niinkuin Jumala hA- 
nelle kAskenyt oli. Ja Herra sulkf 
hAnen jAlkeensA. 

17. Silloin tulvaili vettA neU|ikym- 
mentA pAivAA maan pAAIle, Ja vedet 
paisuivat ia nostivat arkin yl6s, ja 
veivAt korkealle ihaasta. 

18. Niin vedet saivat vallan, ja pai- 
suivat sangen suuresti maan pAAlle, 
niin ettA arkki oli vesiajolla. 

19. Ja vedet saivat sangen suuren 
vallan, ja enenivAt niin suuresti 
maan pAAlle, ettA kaikki korkeat 
vuoret koko taivaan alia peitettiin. 

20. ViisitoistakymmentA kyynArAtft 
korkealle kAvivat vedet vuorten yli, 
jolka peitettiin. 

21. Silloin hukkui kaikki liha, joka 
maan pAAIlA matelee, linnut, karla, 

fiedot, Ja kaikki, jotka maan pAAllA 
iikkuvat, ja kaikki ihmiset. 

22. Ja kuivan maan pAAllA kaikki, 
joissa elAvA henki oli, kuolivat. 

23. Niin hukutettiin kaikki , milft 
maan pAAllA oli, ihmisestA niin kar- 
Jaan asti, Ja matoihin, Ja taWaan 



10 



1 MOOS. 7. S. 9 



iiQlulhin aaU, kaikki hukutelliln 
maan pfifiltA; alnoastansa Noakjai, 
ja ne, Jotka tifineu kanssansB olivat 

34. JavedeioIivBlvallolllanaamaan 
pUUU sals vlisikyiDmentB paiv9B. 

8 Lukn. 

Tain Ulkaa. Ilinkln abri ]■ Jnmalui 

Clltoin Juniala niuisli Noakia ]a 
'^ kaikkia elaimia, ja kaihkea kar- 
iaa, jotka hAneu kaassansa ollval ai^ 
klssa. Ja Jumala.nosti luulen maan 
pSfllle, ja vedet laskeutuivat. 

2. Ja syvyyden Iflhteet sekfi lalvaan 
akkunat lukilUin.lasalfelUivaasIa 
aseleltiin. 

3. Ja vedel maan pflBlta yhl las- 
kensival ja v9henlvBI sadan viiden- 
kyniiiieaen pfifvao peraslfi. 

i. Ja seitsemanlenStaista pSlvBnfl, 
seibemannessa kuukaudessa, aset- 
tui arkki Aranitjn vuorelle. 

£. Mutta vedet vahenlvat vBhene- 
mj»man hamaan kymmenenleeD 
kuDkauleen asti. EnsimmaisenSpai- 
vloa kymmenenlenB kuukautena 
■dlnivfit vuorten kukkulal. 



7.ja antot kaanieeti leoiaa ulos; 
se fensl edes lakalaln. tikai kuin ve- 
det maan pfiaitfi kuivuivat. 

S. Sillen IShElti hBa kyhkysen lykO- 
Snsa. DShdaksensB, olivatka vedet 
juosneet pais maan pBHIIfi. 

9. Kua ei kyhkynen lOyianyl palk- 
kaa, kussa jalkaaiisa lepuultaisi, pa- 
lasi se hflnen lykOnsfi arkkiin; siltS 
vedet peiltiveivjelakokoniaan, Niio 
Noak (nensl kaiensB ja Dlti hflnen 
lykOnsa arkklln. 

10. Sitlea odotll hanvlelfl tolsetseit- 
temftn pSlvfiB, ja antol laas kyhky 
lenlenlBa.arklslB. 

11. Se palasi hOnen tykflosB ehloo- 

Buolella, ja kalso, suussansa tol se 
Ijypuun luoreen lehden, jonka oli 
murtanut. Niln Noak ymmanl, eltfl 
Tcdel maan paaita olivat laskeulu- 



temtntenB kolmatlahytnmenflntenB 
pBivanfi tolseisa kuuksudessa. 

15. Silloin Jumala puhnl Noakllle, 

16. ..Lflhdearklsla.stnBjaslnunval- 
moai, Ja sinun polkasl.ja sinun pol- 
ka isl valmol slnun kanssasl. 

17. Kaikkinaisel eiaimet. latka sl- 
nun tykOnBsl oval, kalkklnalsesla 
lihasta, sekB li-mulsla etifl karjasta, 
ja kalkista maielevalsista maan pBBI- 
IB, vie ne ulas kanssasi, lilkkukoot 
ne maan pSBIlB, Ja olkoot hedelmBI- 
Ilset ja lisBBnlykOOl maan pBBllB." 

18. Nlln Noak meni ulos polklnen- 
»a ja vaimonensaja polkainsa vai- 
Riol hSnen kanssansa. 

19. Kaikki eiaimet.kalkklnalsetma- 



arkista, jokainen lainsa jBlkeen. 
30, Ja Noak rakensi Herralle altla- 
rln Ja otti kaikklnalstapuhdaslakai^ 
Jaa, Ja kalkkinalsia puhtaita iinlu- 
ja. ja uhrasi polltouhria alttarilla. 

21. Ja Herm lunsHepylyshajun. Ja 
HBn sanoi sydBmrnessansB: ..en mi- 
na silleen enBB maata kiroa Ihmi- 
sen Jflhden; slUB ihmlken sydBm- 
men atvoilus oa paha taamasla lap- 
suudesta; enkfl minS enBB hBvJIfi 
kaikkia. Jolka eiavBI, nllnkntn minB 
Iehnytolen.IMaoa,a;6.Matt.l6:19.Jes.M:9. 

22. Nlln kauan. kuin maa seisoo, 
ei ole kylvBmlnen ja ntlltflminen, 
vilu ja helle, suvi Ja talvl. pflivB ja 



Jer.33:a. 



yfi koskaan lakkaava." 

g Luku. 

jDmilui liltto NoilEln ktnwa. Mukla 
pnbeet pojlllefn; blnen kmlunuiH. 

J akin ja hSnen 

leiile: ,,o)kaal 
h< ykeai ja IByl- 

: ja hBmmBsly- 

kl maan pBRIIB, 

ki I alia, kaikki, 

ic al; Ja ksikU 

ki at teidBn tial- 

luunne annelul. iMooa.i:zs. 

3. Kaikki. Jotkallikkuvat ja elBvSI, 
olkoot tellle ruuakji; samoinkuln 
vlherlBlsen motion, olen minB kaik- 
ki tellle anlanul. lMcioa.id9. 

4. Ainoastansa BlkBBI syOkO lihaa. 



IB. GUOO 



. i2a«, 28 



5. Tottsesll mlnB lahdon vealla tel- 
dftn verenne teldfin sielujentie Iflh- 
den; kalkilta etaimJItfl mlnB sen la li- 
tton vaalla. Ja ll)inls§ri kfldetlB,Ilt^ 



-vjssfl ullhtthiian. 

15. Jb niln mlnfi mulalan liltlonl 
minun ja letdSn vfllillUniie, ]a joka 
eBBvBn olennon vQlillB, oil se mita 
tlhiia hyvansA, el lei enS& vedenpal- 
Eumusla pidS tulemsn kaikkea li- 
haa hukullamaan. 

16. Senlflhden pilSfl kaaren pllvissS 
oleman, etta kun mlnfl kalson sitfi, 
Diln muistan bIIR i}ankalkklsla lilt- 
loa Jumalan Ja joka el&vlln olennon 
vailliakBikklnBlstalihaa,kutnmaaD 
pfiSlia on." 

17. Ja Jumata saool ills Noakllle: 
i.tBma on sen IlUon merkkl, jonka 
mina olen tehnyl mlnun la kaiken 
llhan vfllllle masn pSBIIfi'' 

18. Ja Noan pojat, Jolka IBksivBt 
arklsia, ollvnl Sem. Ham ]a Jafel. 
Ja Ham oil Kanaanin IsS. 

19. NQmai oval kotme Noakin poi- 
kaa, Ja helsIB hajoslval asujalmel 
kalkkeen maahan. 

30. Ja Noak rupeat pelloinlehekal, 
Ji litulll vUnlmMO. 



hBn ja tnakasi peltlBmfttia mala: 

22. kun Ham, Kanaanin IsB, nBki 
IiansB hflvyn, kertol hBa lUIB mo- 
lemmille velJillensB, jotka ulkona 



nBhneet IsflnsB hapyB. 
24. Kun Noak herSsi vUnislBniS. Ja 
set lieiaa, mita haoen nuorln pol- 
kanSB hBnelle lehnyt oil, 



HllensB!" 

2B. Ja vtelB hBn sanol: „ktH«tly ol- 
koon Herra, Semin Jumala, Ja Kb' 
naan olkoon hBnen orjansal 

27. Jumala levltiakOOn Jafeltn, Ja 
hBn asukoon Semin majoissa. Ja Ka- 
naan olkoon hBnen orjansa!" 

38. Jb Noak eli vedcnpaisumlMn 
jaikeen kolmesalaa vllslkymmenia 
ajaslaikaa. 

29. KDko Noakin Ika oil sits yhdek- 

sBniaiaa viislkymi 

sltlen h&n kuolt. 



) oil sits yhd 
:nta i^astaik 



bellle synlyl lapsla vedcnpatsumi- 
sea ifllkeen. lAIk.i:4B. 

2. Jafeltn lapsel ollvat: Gamer, Ma- 

fog, Madal, Javan, Tubal, Mesek Ja 
irai. 

3. Mulla Gomerin lapset: Askenas, 
Rifal Ja Togarma. 

4. Javanin lapset: Ellsa Ja Tarsia, 
KltlimtlBlset ja Dodanilalsel. 

5. NSisia oval jBlkelset hajonneel 

Eakanain luoloihla ja heidBn maa- 
untllnsB, llsekukin Oman klelensfl, 
suhukunlansa ja kansansa JBlkeen. 

B. Hamin lapsel: Ku9,Mlsreim, Put 
Jb tianaan. 

7. Kustn Inpsel: Seba, Havlla, Sab- 
IB, Raema ja Sableka. itaeman lap- 
sel: SabaJB Dedan. 

3. Mulla Kus siilli Nlmrodini hia 
rupesi olemaan valtias maassa. 

9. HBn oil myOs jalo melsflmles 
Herran edessB. SlItB on sananlasku: 
,,seonjBlomelsamies[IeiTanedestll. 
nlinkulo Nimrod." 

ID. Ja hBnen vallakunlansa elku oU 
Babel, Erek, Akkad ja Kalae, SilUi- 
arln maalla. 



1 UOOS. 10. It. 



11. Siilfl maakunnasta lull hfto As- 
tyrlaan, la rakensl Nlnlven. Reho- 
bot-Irin ja KalBjiin, 

II. ]a inySs Ressen, Ntniven ]a Ka- 
lakln VBiheellB; Ifimfi on se suuri 
kaupunki. Jon.l;!. 3:i,i. 

13. Hisrsim slllli LudttHlset, Ana- 
mllaisel, Lehabllaiset, NaftukltalMl. 

14. pHlrnsitaiseMaKaslukllaiselJ ais- 
la oval iDlleet Filislealalsel ]a Kaf- 
loTllalsel. 

15. Hutta Kanaan stilll ealkoitensB 
SldoDln. la Helln, 

16. ]a Jebusin, Emorin. GIrgasIn, 

17. Hivin, Arkin, Sinln, 
IS. ia Arvadln. Semarin Ja Hama- 

tla. SUI«n haJosivBl Kananealalslen 

19. Ja Kananealaltlen r(|Jal olIvDI 
Sldonlsta Gerarin kautia hamaan 
Galsaan, «ek(t Sodomaaii, Oomorra- 
an, Adamaan ja Sebolmlln pBJn. La- 
nan asU. Hoe. 11:8. 

2D. Namill oval Hamln lapsel hei- 
dfln sukukantalnsa ja kiellensS JBl- 
keen.heidBnmaakiinnJssaiisajakan- 
toiisansa. 

21. Mutla mTOtSemille.JaTetln van- 
hlmmalleveuellcsynlyi lapsta; hfla 
oU kaikklen Eberin laslen tsS. 

SI Semin lapsel ovat : Elam Ja As- 
mr, Arpaksad, Lud Ja Aram. 




1 HuUa kimhesiiHyivAt iiUnpBin, 



lOyilvSt he kedon Slnearln raaalla, 
ja Bsnivat slelln. 

3. Ja he sanolvalkeskenflnsa: „klly- 
kBflmme tlileja tekemaSn ja pollta- 
niaan." Ja hellia ollval tlilliklvlen 
sijassa, la maan plhka slleekal. 

i. Ja he sanotvat: ..kilykBBmTne, rn- 
kenlakaamme lliellemme kaupunki 
Ja tomliJoka laivaaseeii uloltuu.lch- 
dftkiemme itsellemme nlinefi; silten 
elmelinhajoiteltaisikalkklinnialhln. 

5. Silloin Herra aslul alas kalso- 
niasQ kaupunkla ja loraia, Jola ih> 
mislen lapsel rakensival. 

6. Ja Herni sanol ; ..katso, he oval 
yhlBlnlnen kansa.ja yhlfliainen klell 
on heilla kntkilla, jn inifl ovat he 
ruvenneel lekemSan; JnlSsialflhlieu 
voislvathetehdB.mltfivaaninieUvBt. 

7. KSykeamme, Bslukaamme alas, 
ja sekoillakaamme slella heidfinkle- 
lensB, nlln ellei loinen ymmarlSisI 
tolsensa klelta." 

8. Ja nlin Herra hajolltl heidBI slel- 
IB kalkklln maihln; ja he takkasi- 
val sita kaupunkla rakenlamasla. 

9. Slita sal se nlmensB Babel, slllil 
sielie Herra sekolltl koko maan kJe- 
len; la Herra hajoilll heldfit slellB 
kalkklln molhin. 

10. Tflma onSemlnsukukunla. Sem 
oli sadan ajaslajan vaaha ja slilli 
Arpaksadin. kaksl ajastafkaa veden- 
paisiiinlsenjlllkeen.lAl)[.l:l7.LUBk,33t. 

n, Ja sUten ell hBn vlellk viislsalaa 
, Bjaslaikaa. ja slilli poikia la tyttBrlB. 

12. Arpaksad oli vjidenneljBllBkvm- 
— ntfi ajaslajan vanha, kun hBn 

:i Salakln. 

13. Ja slllen ell hBn vIelB neljBsa. 
laa kolme ajaaleikaa, ja slittl polkla 

, ja lyllBrifl. 

14. Salak oil kolmenkymmeiien ajas- 
lajan vanha, kun hBn sillll Eberin. 

15. Ja slllen ell hBn vlelft neljnsa- 
laa kolme ajaslaikaa, Ja slitti polkla 
ja lyllBrlB. 

le. Eber oil neljannetjatlBkymmen- 
IS njastajan vanha, kun hfln slitti 
. Pelegln. 

17. Ja sltlen eli hBn vleli neUSut- 
tan kolmekyiamenia ajaslaikaa, Ja 
slilll poikia la tyllBrlB. 

18. Peleg oli kotmenkymmenen ajas- 
lajan vanha, kun hBn sillll Begun. 

19. Ja silten ell hBn vielfl kaksisa- 
laa yhdeksBn ajaslalkaa, ja siitii pof- 
k)s > lyllBriB. 

20. Regu oil kahdenneljBltakyni< 
menta alastajan vanba.kun taBnlUl- 
H SeruBin. 

21. Ja silten eli hBn vielB kaksUa- 
laa seitsemBn ajastalkoa.ja slllUpot- 
kia Ja lyltBria, 



1 MOOI§. 11. 12. 



2). Serug oli kolmenkymmenen a- 
tastigan vanha, kun hfin siitti Na- 
horin. 

23. Ja sitten eli hfin vielfi kaksisa- 
taa igasteikaa^ ja siitti poikia ja tyt- 
tfirifi. 

24. Nahor oli yhdeksimkolmalta- 
kymmentft lOastajan vantia.kunlifin 
siitti Tarakin. 

25. Ja sitten eli hftn vielll ^ata yh- 
deksfinloistakymmentfiajastaikaaja 
siitti J>oikia ja tyltnriS. 

26. Tarak oli seitsemfinkymmenen 
ajastaian vanha, kun hSn siitti Abra- 
min, Nahoriii ja Haranin. 

27. Tfimfi-on Tarakin sukukunta: 
tarak siitti Abramin.Natiorin ja Ha- 
ranin. Haran siitti Lotin. lAik. 1:26. 

28. Ja Haran kuoli isfinsfi Tarakin 
tykOnfi, syntymfi-maallahsa Kaldean 
Urissa. 

29. Ja Abram ja Nahor ottivat itsel- 
lensfi vaimoja; Abramin vaimon ni- 
mi oli Sarai, ja Nahorin vaimon 
nimi Milka, Haranin tytfir»'joka oli 
Milkan ja Jiskan isfi. _ 

30. Mutta Sarai oli hedelmfitfin, ei- 
kft oUut h^nellfi lasta. iMoos. 17:17. 

31. JaTarak otti poikansa Abramin 
Ja Lotin, poikansa Haranin pojan,se^ 
kfi miniSnsfi Sarain, poikansa Abra- 
min vaimon, ja he Ifiksivfit kaldean 
Urista menemfiSn Kanaanin maal- 
le, ja tulivat Haraniin, ja asuivat 
siellfi. Jos. 24:28. Neb. 9:7. 
.32. Ja Tarakin ikfi oli kaksisataa- 
viisi i^astaikaa ; ja hfin kuoli Hara- 
nissa. 

12 Luku. 

▲bramin kutsvmlnen. HiUien tolonsa Ka- 
naaamaalle. Hftnen matkansa Bgypttin. 

J a Herra sanoi Abramille: ,tlfihde 
maaltasi Ja synlvmfi-paikastasi Ja 
isfisl huon6esta, . sille maalle, jonka 
minfi sinulle osoitan; 

Ap.t. 7:38. Hebr. 11:8. 

2. niin minfi teen sinun suureksi 
kansaksi, ja siunaan sinun, ja teen 
sinulle suuren nimen, ja sinfi olet 
siunaus oleva. iMoo8.i3:i6. 

3. Minfi siunaan niitfi, jolka sinua 
siunaavat, ja kiroan niitfi, jotka si- 
nua kiroavat. Ja sinussa pitfifi kaik- 
ki sukukunnat maan pfiallfi siuna-v 
tuksi tuleman.'' iMoos. 18:18. 22:18. 26:4. 

28:14. Ap. t. 3:25. Gal. 8:8,16. 

4. Niin Abram Ifiksi, niinkuin Her- 
ra hfinelle sanonul oli, ja Lot meni 
hfinen kanssansa. Ja Abram oli vii- 
denkahdeksattakymmentfi ajastajan 
vanha Haranista IShtiessfinsfi. 

5. Ja Abram otti vaimonsa Sarain, 
ja Lotin, veljensfi pojan, tavaroinen- 



sa, jotka he olivat koonneet, ja ne 

Ealvelijat, jotka he olivat saaneet 
[aranissa, ja Ifiksivfit matkustamaan 
Kanaanmaalle, ja tulivat Kanaan- 
maalle. 

6. J a Abram vaeisi sen maakunnan 
Ifipi, hamaan Sikemin paikkakun- 
taan Mooren tammistoon asti. Ja sii- 
hen aikaan asuivat Kananealaiset 
maassa. 

7. Silloin nfikyi Herra Abramille ja 
sanoi: „sinun siemenellesanhannM- 
nfi tfimfin maan.'' Ja hfin rakehsi 
siinfi alttarin Herralle, joka hfinelle 
oli ilmestynyt. 1 Moos. 13:15. 5 Moos. 34:4. 

Neb. 9:8^ Ap.t. 7:5. 

8. Sitten siirtyi hfin etemmfiksivuo- 
ren tykO, Betelistfi itfifin pfiin,japanl 
siihen majansa, niin ettfi Betel oli 
Ifinnen puolella ja Ai idfin puolella; 
ja siihen hfin rakensi alttarin Her* 
ralle, ja rukoili Herran nimeen. 

9. Sitten Abram Ifiksi sieltfi etem- 
mfiksi, ja. vaeisi etelfifin pfiin. 

10. Niin tuli kova aika maahan* ja 
Abram meni alas Egyptiin, olemaan 
muukalaisena siellfi; sillfi sangen 
kova aika ,oli maassa.. 

11. Mutta'kun^hSn Ifihestyi Egyp* 
tifi, puhui hfirrvaimollensa Saraille: 
„katso, armaani, minfi tiedfin siitun 
ihananmuotoiseksi vaimoksi. 

12. Kun Egyptilfiiset saavat sinun 
nfihdfi, niin he sahovat: ,tfimfi on 
hfinen vaimonsa,* ja tappavat mi- 
nun, ja antavat sinun elfifi. 

13. Sano siis' itsesi minun sisarek- 
seni, ettfi minulle hyvin kfivisi si- 
nun tfihtesi, ja mina elfiisln sinun 

VUOkses.'* 1 Moos. 20:2, 13. 26:7. 

14. Kun Abram tuli Egyptiin, nfiki- 
vfit Egyptilfiiset vaimon juuri iha- 
naksi. 

15. Ja Faraon ruhtinaat nfikivfit hfi- 
nen, ja ylistivfit hfintfi Faraolle; ja 
vaimo vletiin Faraon huoneeseen. 

16. Ja Abramille tehtiiii hyvin hfi- 
nen tfihtensfi. Hfin sai lampaita ja 
karjaa ja aaseja, ja palvelijoita, ja pii- 
kqja, ja aasintammoja ja kameleja. 

17. Nfutta Herra vitsasi Faraota ja 
hfinen huonettansa suurilla vitsaiik- 
sillaSarain,Abraminvaimon4fihden. 

18. Silloin kutsui Farao Abramin 
tykOnsfi ja sanoi : „miksi tfimfin mi- 

.nuUtS teit? mikset ilmoittanut mi- 
nulle hfintfi vaimoksesi? 

19. Miksi sanoit: ,hfin on minun si- 
sareni?' ja niin minfi otin hfinen vai- 
moksieni? katso, tfissft on sinun vai- 
mosi, Ota hfin ja mene.** 

20. Ja Farao kfiski miestensfi saat- 
taa- Mnel ulos ja hfinen vaimonsa, 
ja kaikki mitfi hfinellS oTi. ^ 



14 






1 MOOS. 13. 14. 



13 Luku. 

Abnun palaa EAnaftnmaAlla. Lot •rkanee 
taftnestft. 

Niin Abram Ifiksi jlllleen ylOs Egyp- 
tista vaimonsa fa kaiken tavaran- 
sa kanssa, ja Lot hfinen kanssahsa, 
EtelS-maalle. 

2. Ja Abramilla oli sangen paljon 
karjaa, hopeata ja kultaa. 

3. Ja hftn matkusti eteenpAin Ete- 
Id-maalta Beteliin asti, hamaan sii- 
hen paikkaan, jossa hfinen majan- 
sa oli ennen oilut, Betelin ja Ain 
vaiheella, 

4. juuri siihen paikkaan Johon hfin 
ennen altlarin oli rakentanut ; ja A- 
bram rukoili siinfi Herran nimeen. 

5. Mutia Lotilla, joka Abramia seu- 
rasi, oli myOs lampaila, karjaa ja 
me^oja. 

6. Ja ei heitft vetAnyl niaa yhdessA 
asumaan; sillfi heillfi oli paljon lava- 
rata, eivfitkfi taitaneet yhdessfi asua. 

1 Moos. 86:7. 

7. Sentfihden oli riita Abram in ja 
Lotin paimenten vfilillfi. Ja siihen 
aikaan asuivat vielfi Kananealaiset 
ja Feresilfiiset maassa, 

8. Niin Abram sanoi Lotille: „fi1- 
k6dn oiko riita minun ja sinun vfi- 
liliasi, ja minun ja sinun paimen* 
tesivfiiiUll;mehftn olemmeve^jekset. 

9. EikO kokomaaoleedessfisiavoin- 
na? erifi minusta; jos sinfi menet 
vasemmalle, menen minfi oikialle, 
ja jos sinfi menet oikialle, • menen 
minfi vasemmalle.** 

10. Niin Lot nost( silmfinsfi, ja nfi- 
ki, ettfi koko Jordanin laakso oli ve- 
sirikas; ennenkuin Herra Sodoman 
jaGomorran hukutti.oli se nlinkuin 
Herran yrttitarha, nlinkuin Egyptin- 
maa, aina Soariin asti. 

11. Ja Lot valitsi itsellensfi koko Jor- 
danin lakeuden. Ja hfin matkusti 
itUn pfitn; ja niin he erkanivat 
k>itistansa. 

11 Abram asettui Kiihaanmaalle ; 
ja Lot asui lakeuden kaupungeissa, 
ja majaili aina Sodomaan asti. 

13. Mutta Sodoman kansa oli paha 
ja rikkoi kovin Herraa vastaan.' 

1 If ootf. 18:2088. 19:4 88. Hes. 16:4888. 

14. Ja Herra sanol Abramille, sitte 
kain Lot ol! erinnyt hfinestfi : „nos- 
ta nyt silmifisi ja katso siitfi, missfi 
asat, pohjoiseen, etelSfin, itfifin ja 
lAnteen pain. 

15. SiUfi kaiken sen maan, minkfi 
ofiet, annan minfi sinulle ja sinun 
•ieniMMllesi ijankaikkiseksi ajaksi. 

1M008.12:7. 



16. Ja teen sinun siemenesl niinkuin 
tomun maan pfifiUfi: jos joku yoi 
lukea tomun maan pfifillfi, niin hfin 
my^is vol sinun siemenesl lukea. 

IM008. 1S:&. 26:4. Hebr. 11:12. 

17. Nouse ja vaella maata pitkin ja 
poikin; sillfi sinulle minfi sen an- 
nan." 

18. Niin Abram slirsl maJ9nsa, ja 
kfivi asumaan Mamren tammistoon, 
joka on Hebronissa: ja hfinrakensi 
siinfi altlarin Herralle. 

14 Luku. 

Kedorlaomerin sotaretki. Lot pelastetaan. 
Aturam ja Melklsedek. 

J a tapahtui sllloin, kun Amrafel oli 
, Sinearin kuninkaana, Ariok Ella- 
sarin kuninkaana.KedorlaomerEla- 
min kunlnkaana ja Tideal Goimin 
kuninkaana, 

2. ettfi he Ifiksi vfit sotimaanBeraa.So- 
doman kuningasta, Birsaa, Gomor- 
ran kuningasta, Sineabia« Adaman 
kuningasla, Seraeberifi,Seboimin ku- 
ningasta, ja Belan, se on Soarin, ku- 
ningasta vastaan. 

S.Nfimfi kaikki yhdistyivfitSiddimin 
laaksossa, jossa nyt on Suolainen 
meri. 

4. He olivat olleet kaksiloistakym- 
mentfi ajastaikaa kuningas Kedor- 
laomerin alia; mutta kolmantena- 
loista ajastaikana olivat he hfinestfi 
luopuneet. 

5. Neljfintenfitoista ajastaikana tuli 
Kedorlaomer, ja ne kuninkaat, jotka 
hfinen kanssansa olivat Ja lOivfit Ra- 
falaiset Astarot-Karnaimissa, ja Su- 
silalset Hamissa, Emilfiiset Save-Klr- 
jataimissa, 

6. sekfi Horilaiset Seirin vuorella, 
aina Paraniln asti, korpea liki. 

7. Sitten he palasivat ja tulivat En- 
Mispatin tykO,se on Kades, ja ryOsti- 
vfit Koko Amalekilaisten maan ; niin 
myOs lOivfit he Amorealaisel , jot- 
ka asuivat Haseson-Tamarissa. 

8. Niin Ifiksivfit Sodoman kuningas, 
Gomorran kuningas, Adaman kunin- 
gas, Seboimin kuningas ja Belan, se 
on Soariii, kuningas ja ryhtyivfit so- 
taan Siddlmin laak^ossa 

9. Kedorlaomeria,Elamin kuningas- 
ta, Tidealia, Goimin kuningasta, Am- 
rafelia, Sinearin kuningasta, ja Ari- 
okia, Ellasarin kuningasta vastaan, 
neljft kuningasta viittfi vastaan. 

10. Mutta Siddimin laaksossa oli 
monta maanpihkakuoppaa. Ja So- 
doman ja Gomorran kuningas 1y5- 
tlln ja putosivat kuopplin, ja jfifineet 
pakenivat vuorille. 



15 



dan ruoknvaransB Ja menlvBI 

12. Ja he olllvBt royOs Lotln, Abra- 
TDln veljen pojen, kanssnnsa }a hlt- 
nen lavaransa, ]b menlvfll malkaan- 
5b; sills hBn asui SodomassH, 

13. Siltofn tuli yksl, Joka pBennul 
□H, la timoiltl sen Abramllle, sllle 
Hebnalalselle, loha asul Amorea- 
luisen Mamren, Eskolin Ja Anerfn 
veljen, laminUlossa. NUinB olivatlil- 
lossa Abramln kanssa. 

U. KuQ nyt Abram huull veljensS 
oletuksl kiinnl.varusllhSnomiH, ho- 
tons synlyneilfl, uskoluEla palve- 
lijollansB, koltnesalaa ]a kahdek- 
Miilolsta, ja Biol heiia (akaa Danlin 

BSti. 

15. Jb h9n jakof vSkenifl Ja karkaii 



lella Damaskoa. 

16. Ja ban toi takoUin kaiken la- 
vuran: ]b myCs -retjentA LoHn ]a 
hanen lavaransa toi hBn lakaisin, 
niin myOs virimol JB vBen. 

17. Kun Abram pulasi lyOmasia Ke- 
dorlaomeria ja niilD kunlnkaila, jot- 
ha ollval bin en kanssansa, meni 
Sodoman knulngas hBnIB vastaan 
Saven laaksossa , jola „kuniDkaan- 
laaksoksl" sanotaan. 

18. Multa Melkisedek. Salemin ku- 
nin^s, lol lelpfls ]a vilniB; Ja hBn 
oil ylhnmfiUen Jumalno pappi. 

PLllOrf. Hebr.ftiLia. T:1h. 

19. Ja bBa slunasi hflnia, ja sanoi: 
(jJuDallu ole llnB. Abram, kalkklen 
korkeimmallB Jumalalla, Jonka tal- 



Kun nBma ollvat lapahtuneel, lull 
Herren saiia Abramln tykS dB- 
yuB, sanoen: „flia pelkflfl, Abram, 
mlnB olen sinun kllpesi ; sinun palk- 
kasl on oleva sangea »uuri." 

2. Multa Abram sanoI : „Herra,Her- 
ra.niilil minulle sitren annaiyinina- 
han lOhden lapsilonna IBBIIB, ja mi- 
nunhuoneeni perilllsekst InleelBmfi 
Eleasar Damaskosta," 

3. J a Abram sanoi vtelfl: „inlnul)e 
et anlanut aiemenlB; kalso, mtnun 
koiopalkolliseiil on minua perl vs." 

4. Mulla katjo, Herran sana lull 
hBnen tykOnsB, sanoen; ,>el IBmB 
sinun peri; vaan jokasinunniumila- 
tasi luiee, se on sinus perivB." 

5. Ja hBn vel hBnen ulos, Ja lanoi ; 
,, kalso lalvaalie Ja lue IBhdel, loa ne 
kidal lukea." JaHBn sanoi hBnelle : 
„nlln sinun slemenesi on oleva." 

lHoo&.19»t. 32:17, tJIwa.ta-.lt. 
EHOM. 1023. 

6. Abram uskoi Herran, iBHlnluki 
sen hBnelle vanhurshaudeksl. 

lto(Hn.4&Ig. Gal.IAJiBk.S3K 

7. Ja HBn tanoi hSnelle: „n]lna 
olen Herra, joka sinun vein ulos 
Kaldean Urisl*. aniaakseni ainullB 
(BmBn maan oraaksesi." 

S. Mulla hSn sanoi: „ Hem, Herra, 
mlslBminBlieiaislnsenomiitavanlf" 

9. Silloln HBn senol hBnelle: „tno 
minulle kolmlvuollnen hehkoinen, 
Ja kolmivuotinen vuohi, Ja kolml- 
vuotinen oinas, niin myfls meltlnea, 
Ja nuorl kyhkylBlnen. 

10. Ja bBn lot nflma kaikkl. la Ja- 
kot ne keshelta kahlia, Ja panl l($e- 
kunkln osan toinen tolsensa koh- 
dalle; vsan llnluja et hBn Jakanut. 

11. Niln petollnnul lullval Hhaln 
pBfille ; mulla Abram karkoilli ne. 

13. Kuu nyt aurinko oil laskemal- 
slllaau Ja raskas uni oil langennul 
Abramln pBBIle, kalso, -'■- *•"— 






pSBllei 

13. Ja HBn tanoi Abramille: „niln 
liedB lollaesit, ellfi sinun slemenesi 
^o oleva muukalalsena ilinA maas- 
B, Joka el beldBn omansa ole, Ja 
leidSn Ifi^lyy oijana alia, Ja he vai- 
non tapabtuvaneUBsalBii 
JMoot. 1-JSn. 1B:ID. 
Ati.tT«u. 
H. Uulla allle kansalle, Jonka or- 
' — a hcovat, koslanmloB; jaiUlen 



ajaalaiiwa. 



1 MOOS. 15. 16. 17. 



15. Sinfi menet Isfiisi tykO rauhassa, 
ja haudataan hyvftssfi ^fissd. 

1 Moos. 26:8. 

16. Matia neljSnnessa miespolvessa 
he tanne palajavat; sillS Amorea- 
laisten pahuuden mitta ei ole enneh 
ttysi." 

1/. Ja kun aurinko oH laskenut ja 
pimeys joutunut, katso, uunissa pa- 
loi tuli; ja liekki kSvi kappaleitten 
keskelta. 2Moos. I3r2l. 19:18. Jer. 34:18. 

18. Sind pnivfina teki Herra liiton 
Abramin kanssa, sanoen : „sinun sie- 
menelles annan minS tfimfin maan, 
hamasta Egypt! n virrasta suureen 
Fratin virtaan asti : l Moos. 12:7. 

2M008. 23:31. 5 Moos. 34:4. iKun. 4:21. 
2Alk.9.26. Ps. 80:12. 

19. Kainilaisfen, Kenitsildisten ja 
Kadmonilaisten, 

20. Hetimtsten, Feresllfiisten ja Ra- 
falatsten, 

21. Amorealaisten, Kananealaisten, 
Gergesilftisten jaJebusilatsten maant* 

1 6 Luku. 
Hagar ja Ismael. 

Ta Sarai, Abramin vaimo, ei syn- 
^ nytt&nyt hSnelle lapsia. Mutta 
hSnellfi oli egyptilftinenpiika,jonka 
nimi oli Hagar. 

2. Niin Sarai sanoi Abramille: „kat- 
so, Herra on minun sulkenut syn- 
nyttSlmilsta ; menle siis minun pii- 
kani luo. ehka min9 saisin lapsia 
hSnesm.*' Ja Abram totteli Sarain 
Sanaa. 

3. Ja Sarai, Abramin vaimo, otti 
^pliiaisen piikansa Hagarin, ja 
ante! sen miehellensd Abramille vai- 
moksi. Silloin oli Abram asunut Ka- 
naanmaalla kymmenen ajastaikaa. 

4. Ja hSn makasi Hagarin tykOnS. 
joka tuli raskaaksi. Kun hUn tunsi 
itsensS raskaaksi, tuli hflnen emSn- 
tSnsfi halvaksi h9neh silmissfinsd. 

5. Niin sanoi Sarai Abramille : f^mi- 
nuUe tapahtunut vflflryys langetkoon 
sinun paailesi. Minft nnnoin minun 
piikani sinun helmaasi, ja kun hSn 
tunsi itsensfl raskaaksi, halpenin mi- 
nShSnen silmissfinsd. Herra tuomit- 
koon minun ja sinun vaiillfisi." 

6. Malta Abram sanoi Saraille: „kat- 
so, sinun piikasl on sinun kSsissfisi, 
t«c handle mitfi tahdot." Knn Sarai 
siilen kuritti hftntfi, niin hfin pakeni 
hanen tykOftnsfi. 

7. Mutta Herran Ehkeli ISysi hfinen 
▼esiiahteen tykOnfi korvessa, senlfih- 
teen tykOnfi, joka on Surin tiellfi. 

& Ja hftn sanoi: „Hagar, Sarain 
piika, kusta tulet? ja kuhunka me- 



net?"* Hfin vastast: „m!nft pakenin 
emfintfifini Saraita.'* 

9. Ja Herran Enkeli sanoi hftnelle: 
„palaja emfintfisi tykO, ja nOyryytfi 
itsesi hfinen kfitensfi alle.** 

10. Ja Herran Enkeli sanoi vielfi: 
„minfi lisftfin suuresti sinun sieme- 
nesi, niin ettei sitfi taideta lukea 
paljouden tfthden.'* 

11. Vielfi sanoi Herran Enkeli hfi- 
nelle: „kat^o, sWfi olet raskas, ja 
synnytfit pojan , ja sinun pitfift kut- 
suman hfinen nimensfi Ismael, sillfi 
Herra on kuullut sinun vaivasi. 

12. Hfinestfi tulee tuima mies; ja 
hfinen kfitensfi oft jokaista vastaan, 
ja jokaisen kfisi hfintfi vastaan; ja 
hfin on asuva kaikkien veljiensfi 
edessfi." ' IMooa. 26:18. 

13. Ja Hagar nimitti Herran, ioka 
hfintfi puhutteli: „sina Jumala, joka 
nfiet minun." Sillfi hfin sanoi : „01i- 
sinko todellakin pikimmfiltfi nfihnyt 
hfinet, joka minun nftkeeT* 

14. Sentfihden nimitti hfin sen kai- 
von: „sen elfivan kaivoksi, joka mi- 
nun nakee;** se on Kadeksen ja Ba- 
redin vfilillfi. l Moos. 24:82. 25:11. 

15. Ja Hagar synnytti Abramille po- 
jan ;ja Abram antoi pojallensa, jonka 
Hagar synnytti, nimen Ismael. 

Gal. 4:22. 

16. Ja Abram oli kuudenyhdeksatta- 
kymnienta ajastajan vanha, kun Ha- 
gar synnytti hanelle Ismaelin. 

17 Luku. 

Jumala uudistaa Jiittonsa Abrahamin 

kanssa ]a lupaa Isaakista eiemeneo. 

Ymparileikkaus. 

Kun Abram oli yhdeksankyimne- 
nen yhdeksan ajastaikainen, na- 
kyi Herra Abramille, ja sanoi hfi- 
nelle: „mina olen Jumala kaikki- 
v^ltias; vaella minun edessani, ja 
ole vakaa. 

2. Ja mina teen liittoni minun ja 
sinun vaiillesi, ja lisaan sinun sangen 
suuresti." 

3. Ja Abram lankesi kasvolllensa, 
ja Jumala puhui hanen kanssansa, 
sanoen : 

4. „Katso, Mina olen, ja minun liit- 
toni on sinun kanssasi, ja sina tulet 
suuren kansan isaksi. Room. 4:17. 

5. Sentfihden ei sinua pidfi enaa 
kutsuttaman Abram, mUtta Abraham 
on sinun nimesi ,oleva; silia mina 
oleti tehnyt sinun suureil kansan 
isaksi. 

6. Ja teen sinun sangen suuresti 
hedelmfilliseksi, ja asetan sinun kan- 
soiksi, ja kuninkaat tulevat sihust% 



17 



1 MOOS. 17. 18. 



7. Ja MitiA teeu liittoni minun ja I 
sinun vfilille, ja sinun siemenesi vS- 
lille sinun jfilkeesi, suvusta sukuun 
ijankaikkiscksi liitoksi.niin ettS mt- 
n& olen sinun Jumalasi, ja sinun 
siemenesi J u mala sinun jftlkeesi. 

8. Ja Mind annan sinulle ja sieme- 
nellesi sinun iSlkeesi sen maan, jossa 
sinfl muukalainen olet, koko Kanaan- 
maan ijftiseksi omaisuudeksi ; ja Mi- 
nfi olen heidSn Jumalansa.*' 

9. Ja Jumala sanoi viel3 Abraha- 
mille: „pid3 siis minun liittoni» si- 
nS ja sinun siemenesi sinun jftlkeesi, 
suvusta sukuun. 

10. Ja tAmd on Ititto, joka teidSn 
tulee pitAd, minun ja teiddnvSIillfin- 
ne, ja sinun siemenesi vMillH sinun 
jMkeesi : kaikki miehenpuoli teidftn 
seassanne pitfifi ympSrileikattaman. 

3Moo8. 12^3. Luuk. 2:21. Ap. t 7:8. 

Room. 4:11 ss. 

11. Ja teidSn pitfiS ympArileikkaa- 
man teidAn esinahkanne liha: se on 
oleva liiton merkiksi minun ja tei- 
dAn vniill&nne. 

12. KahdeksanpAivSisenft pitfifi ym- 
pftrileikattaman teiddn seassanne 
kaikki miehenpuoli,suvusta sukuun, 
kotona synlynyl ja jokainen rahal- 
la ostettu muukalainen^ joka ei ole 
sinun siemeneslAsi. 

13. Kaiketi ymp&rileikattakoon se- 
ka kotona synlynyt, etta rahalla os- 
tettu; ja niln minun liittoni on- ole- 
va teidan lihassanne ijankalkkiseksi 
liitoksi. 

14. Mutta jokainen ymparileikkaa- 
maton miehenpuoli, joka ei ym- 

Earileikkauta esinahkansa lihaa, on 
avitettava kansastansa ; han on mi- 
nun liittoni rikkonut.'^ 

15. Ja Jumala puhui vieia Abraha- 
mille, sanoen: „aia kutsu vaimoasi 
Saraita enaa Saraiksi, vaan Saara 
olkoon hanen nimensa. 

16. Silia Mina siunaan hanta, ja 
annan hanestakin sinulle pojan; Ali- 
na siunaan hanen, Ja han on tuleva 
kansoiksi, ja kansam kuninkaat tu- 
levat hanesta.'* lMoo8.l8:lO. 21:2. 

17. Niin Abraham lankesi kasvoil- 
lensa, naurahti, ia sanoi sydammes- 
sansa : j.syntyisikfi sadan-ajastaikai- 
sellepoika?jasynnyttaisikdSaarayh- 
deksankymmenen aJAStaikaisena?'* 

18. Ja Abraham sanoi Jumalalle: 
, Joska Ismael saisi eiaa sinun edes- 
sasil'' . 

19. Niin sanoi Jumala: „totisesti 
Saara, sinun vaimosi, synnyttaa si- 
nulle pojan, ja sinun pitaa hanen 
nimensft kutsuman Isaak; ja Mina 
teen minun liittoni hanen kanssansa 



ijankaikkiseksi liitoksi . hanen sieme- 
nellensa hanen jaikeensa. 

20. Ismael ista olen Mina my(Ss si- 
nun rukouksesi kuiiUut; katso. Mi- 
na olen siunannut hanta, ja teen 
hSnen hedelmailiseksi, }a lisaan ha- 
nen sangen suuresti : kaksitoistakym- 
menta ruhtinasta on han siittava, 
ja minft teen hanen suureksi kan- 
saksi. 1 Moos. ^:16. 

21. Mutta liittoni teen mina Isaakin 
kanssa, jonka Saara on sinulle 
synnyttavft tahan aikaan tulevana 
vuonna." Room. 9:7. 

22. Ja kun puhe oli paatetty Abra- 
hamin kanssa, meni Jumala ylds 
hanen tyk^ansa. 

23. Ja Abraham otti poikansa Is- 
maelin, seka kaikki kotona synty- 
neet, ja kaikki ostetut, kaiken mie- 
henpuolen Abrahamin huoneessa, 
, a ymparileikkasi heidan esinah- 

lansahhan, kohtasina paivana, niin- 
cuin Jumala oli puhunut hanen 
canssansa. 

24. Abraham oli yhdeksankymme- 
nen yhdeksan ajastaikainen , kun 
hanen esinahkansa liha ymparilei- 
kattiin. 

25. Mutta Ismael, hanen poikansa, 
oli kolmentoista ajastaikainen, kun 
hanen esinahkansa liha ymparilei- 
kattiin. 

26. Samana paivana ymparileikat- 
tiin Abraham ja Ismael, hdnen poi- 
kansa ; 

27. ja kaikki miehenpuoli hanen 
huoneessansa , kotona syntyneet ja 
muukalaisilta bstelut, ymparileikat- 
tiin hanen kanssansa. 

1 8 Luku. 

Herran kftynti Abrahamin luona. Uudis- 

tettu lupaus Saaralle. Abraham rukoilee 

Sodoman edestft. 

J a Herra ndkyi Abrahamille Mam- 
ren tammistossa, jossa han istui 
majansa ovella, kun pAiva oli pala- 
vimmallansa. 

2. Kun ban silmansa nosti ja kat- 
sell, katso,kolmemie$taseisoi hanen 
edessansa ; ja kun ban naki heidan, 
juoksi ban heita vastaan majan ovel- 
ta, ja kumarsi itsensA maahan, 

Hebr. 13:2. 

3. ja sanoi: „Herra, jos mina olen 
armon 16ytanyt sinun edessasi, niin 
aia mene palvelijasi ohitse. 

4. Sallikaat, etta tuodaan vahan 
vetta pestaksenne jalkanne, ja levAt- 
kaat puun alia. 

5. Mina tuon teidan eteenne kap- 
paleen leipaa, virvoittakaat sydAn- 



18 



1 MOOS. 1«. 



ifinne, ennenkuiii tnenctte, koska 
kerran poikkesitte feidfin palveli- 

ianne tvKG/* He sanoival; ,,tee niin- 
cuin smfi olet puhunut/* 
6. Niin Abraham riensi majaan Saa- 
ran tyk6, ja sanoi : ,,tuo ioutuin kol- 
me niittaa sdmpylS-jauhoja , sotke 
ja leivo kaltiaisia/' 

I, Multa itsejuoksi Abraham karjan 
tyk6,otti nuoren ja kauniin vaslkan. 
ja antoi palvelijalle, joka riensi val- 
mistamaan sitS. 

' S. ^fl hfin toi volta ja maitoa, ja va- 
sikan« jonka hSn oli antanut valmis- 
taa, Ja pan! heidftn eteensfi ; ja hfin 
seisoi itse heidfin edessfinsfl puun 
alia, kan he sOivftt. 

9. Niin sanoivat he hftnelle: „kus- 
sa on sinun vaimosi Saara?*' hfin 
vastasi: ,,tuolla majassa.** 

10. Ja Hfin sanoi: ,,minfi palajan 
sinun tykOsi tfillfi ajalla tulevana 
vuonnaja kalso. vaimollasiSaaralla 
on oleva poika.*' Ja sen kuuli Saara 
majan ovelta, joka oli hfinen taka- 
nansa. IMoos. 17:19. 21:1 s. Room. 9:9. 

II. Mutta Abraham ia Saara olivat 
vanhat Ja ijfilliseksi Joutuneet, niin 
etlfi Saaralta olivat lakanneet vai- 
molliset menot. Boom. 4:19. Hebr. ll:li. 

12. Sentfthden nauirahli Saara itsek- 
sensfi, ja sanoi: .,.nfiin vanhaksi tul- 
tuani, minfik6 antai^in itseni heku- 
maan? Ja mlnun herranikin on 
\'anhentunot.** i Piet. SHL 

13. MutlaHerra sanoi Abrahamille: 
,,raiksi Saara nauroi, sanoen: ,mi- 
nfik6 todellakin synnyttfiisin, joka 
olen vanhaksi tullut?* 

14.0nkoHerralIe mitfikfifin mahdo- 
tonta? Mftfirfitlyyn aikaan minfi pa* 
lajan sinun tykOsi tulevana vuonna, 
ja Saaralla on poika." 

Luuk. 137. 2Kiiii. 4:16. 

15. Niin Saara kielsi, sanoen: „en 
minfi nauranut;** sillfi hfinhfimmSs- 
tvL Mutta Hfin sanoi: „ei ole niin, 
nnfi nauroit." 

16. Silloin nousivat miehet ja Ifik- 
sivfit menemfifin Sodomaan pfiin ; ja 
Abraham men! heidfin kanssansa 
saattamaan heitfi. 

17. Ja Herra sanoi : „sa]aisinko mi- 
nfi Abrahamilta, mitfi minfi teen? 

Am. 3:7. Jaak.2:23. 

18. Abrahamistahan totjsesti on tu- 
leva suuri ja vfikevft kansa, ja kaikki 
kfinsat maan pfifiUfi pitfifi hfinessfi 
siunattaman. i Moos. ]2*.3. 22:18. 2^:4. 

28:14. 2 Moos. 1:7. Ap.t3:2a Gfa.8:8. 

19. Sillfi minfi olen hfinen valinnut, 
eltfi hfin kfiskisi lapsiansa ja jfilkeis- 
tfi perhettfinsfi Herran tietfi pitfi- 
mfiant Ja tekemfiftn hurskautta Ja 



oikeutta ; jolta llerra saattaisi Abra- 
hamille kaikki, mitfi Hfin hftnelle lu- 
vannut on.** 

20. Ja Herra sanoi: ^Huuto on suu- 
ri Sodomasta ja Gomorrasta, ja hei- 
dfin syulin$fi ovat sangen raskaat. 

1 Moos. 13:13. 19:13. Hes. 16:49. 

21. Minfi astun nyt alas katsomaan, 
ovatko he aivan niin tehneet kuln 
huuto heistfi on tullut minun etee- 
nii vai eikO, cttfi minfi sentietfiisin.** 

22. Ja miehet kfifintyivfit sieltfi, ja 
menivfit Sodomaan pfiin. Multa A- 
braham jfii vielfi seisomaan Herran 
eteen. 

23. Ja Abraham astui hfinen tykOn- 
sfi, ja sanoi : „hukutatko inyOs van- 
hurskaankin jumalattoman kanssa? 

21. Jos kaupungissa olisi viisikym- 
mentfi vanhurskasta, hukuttaisitko 
mv5s ne, etkfi sfifistfiisi sitfi paikkaa 
viidenkvmmenen vanhurskaan tfih- 
den, jotKa siellft olisi vat? 

25. Pois sc sinusta, ettfi sen tekisit, 
ja kuolettaisit vanhurskaan Juma- 
lattoman kanssa, ja niin vanhurs- 
kaan kfivisi kuin jumalattomankin! 
Pois se sinustal EWIS kaiken maa- 
ilman Tuomari oikeutta tekisi?** 

Room. 8:6. 

26. Niin Herra sanoi : , Jos minfi lOy- 
dfin viisikymmentfl vanhurskasta So- 
doman kaupungissa, niin minfi sfifis- 
tfin kaiken sen paikan heidfin tfih- 
tensfi.** 

27. Mutta Abraham vastasi ja sanoi : 
„katso, minfi olen ruvennul puhu- 
maan minun Herrani kanssa, vaik- 
ka olen tomu ja tuhka. 

28. Mitfi, jos olisi viisi vailla viides- 
tfikymmencstfi vanhurskaasta , ka- 
dottaisitko viiden tfihden koko kau- 

ungin?** JaHfin sanoi: „en kadota, 
OS minfi 15ydfin siellfi viisiviidettft- 
kymmenia.'* 

29. Ja hfin puhui vielfi Hfinelle, ja 
sanoi: „kenties siellfi lOytyisi neljfi- 
kymmentfi?'* Ja Hfin sanoi: ,,en tee 
sitfi niitten neljfinkymmenen tfih- 
den.** 

30. Abraham sanoi : „filk6fin minun 
Herrani vihastuko, ettfi minfi vielfi 
puhun; mitfi, jos lOvtyisi siellfi kol- 
mekymmentfi?'* Ja Hfin sanoi: .,en 
sitfi tee, jos minfi lOydfin siellfi kol- 
mekymmentfi.'* 

31. Ja hfin sanoi taas: „katso, minfi 
olen ruvennut puhumaan Herrani 
kanssa: „mitfi, jos lOytyisi siellfi kak- 
sikymmentfi?" Ja Hfin sanoi: „en 
kadota kahdenkymmenen tfihden.** 

32. Vielfi hfin sanoi: „filk6Gn mi- 
nun Herrani vihastuko, jos minfi 
ainoastansa tfimfin kerran vielfi pu- 



I 



19 



1 MOOS. 18. 19. 



hun; ,mitft» jos sielia lOytyisi kym- 
menen?** Ja Hftn sanoi: ,,^n kaaota 
kymmenen tflhden.** 
$3. Ja Herra meni pois sitten kun 
hftn oliAbrahamin kanssapuhunut; 
ja -Abraham palasi koHansa. 

19 Luku. 
Sodoroan hftvitys. Lotla vaimo Ja tyttftret 



J a ne kaksi enkelift tulivat ehtoona 
Sodomaan, if 
portissa. Kun Lot nftki heidSt, nousi 



Sodomaan, ja Lot istui Sodoman 



hSn heitS vastaan, kumarsi kasvoil 
lensa maahan, 

2. ja sanoi : „katsokaat, minun her- 
rani , poiketkaat palvelijanne huo- 
neesen y^iksi, ja anlakaat pestS jal- 
kanne, ja aamulla varhain noustu- 
anne menette matkaan.*'Hesanoivat: 
„ei suinkaan, vaan kaduUa me yOtft 
pidftmme,*' 1 Moos. 18:286. Hebr.l3r2. 

3. Mutta hlln ahkerasti vaati heitfi; 
ja he poikkesivat hdnen tykOnsS, ja 
tulivat hfinen huoneesensa. Ja hfin 
valmisti heille aterian ja leipoi hap- 
pamattomia leipifi, ja he sOivfit. 

4. Ennenkuin he maata panivat, 
tulivat kaupungin miehet, Sodoma- 
laiset, nuoret javanhat, kaikki kan- 
sa joka kulmalta, ja piirittivflt huo- 
neen. 

5. Ja he kulsuivat Lotin ja sanoivat 
hdnelle: „kussa ovat ne miehet, jot- 
ka sinun tykOsi yOlIft tulivat? tuo 
heitS roeidfin tykOmme, tun teak- 
semme heitfi." 

Tuom. 19.-22. Jes. 3:9. Room. 1:27. 

6. Silloin Lot meni ulos heidSn ty- 
kOnsft oven eteen, sulki oven jfii- 
keensS, 

7. ja sanoi: „&lkftdt toki, rakkaat 
veljeni, tehkO niin pahoin. 

8. Katsokaat, minuila on kaksi ty- 
tfirtfi, jotka ei vielfl miehestfi mitfiSn 
tiedft ; ne minS tuotan teille, tehkfi&t 
heille mitfi tetahdotte. Kunhanvaan 
nftille niiehille ette mitd5n pahaa 
tee; sillfi sentAhden ovat he tulleet 
minun Mttoni suojaan." 

9. Mutta he sanoivat: „mene mat- 
kaasi 1** Ja he sanoivat : „tuo yksi on 
tullut muukalaisenaolemaan, ja tah- 
too kuitenkin hallita. Mutta nyt me 
teemme enemmSn pahaa sinulle 
kuin heille.** Ja he karkasivat vfiki- 
vallalla Lotin pfifille ja hyOkkdsivAt 
ovea sfirkemfian. 

10. Silloin miehet ojensivat kStensfi 
ulos, ja tempasivat Lotin tvkOnsS 
huoneesen, ja sulkivat ovenkiinnl. 

2Piet2:7. 

11. Ja miehet, jotka huoneen oven 
edessft oUvati IdivAt he sokeudella, 



pienet ja suuret, niin ettA he vAsyi- 
vAt ovea etsiessAnsA. viis. 19:16. 

12. Ja miehet sanoivat Lotille: ,Jos 
sinulla vielA on. omaisia tAAllA, vA- 
vyjA, pdikia, tyttAriA, tahi muita 
tfissA kaupungissa, vie ne ulos tAstft 
paikasta. 

13. SillAme hukutamme tAmAnpal- 
kan; koska heidAn huutonsa on 
suuri Herran edessA, niin Herra 
lAheUi meidAt heitA hukuttamaan.** 

1 Moos. 18:20. 

14. Niin Lot meni ulos, ja puhutteli 
vAvyjAnsA, joitten pitisaamanhAnen 
tyttarensA, ja sanoi: „nouskaat ja 
lAhtekAAt tAstA paikasta, sillA Herra 
hukuttaa tAmAn kaupungin.** Mutta 
vAvynsA luulivat hAnen leikkiA las- 
kevan. 

15. Kun nyt aamurusko nousi, kil- 
ruhtivat enkelit Lotia joutumaan, 

i'a sanoivat: „nouse, ota vaimosi ja 
[aksi tytArtAsi, jotkasaapuvillaovat, 
ettet hukkuisi tamAn kaupungin pa- 
huudessal** 

16. Ja kun hAn viipyi, tarttuivat 
miehet hAnen kAteensA, ja hAnen 
vaimonsa ja kahden tyttArensA kA- 
teen, sillA Herra tahtoisAAstAAhAntA, 

i'a taluttivat hAnen ulos ja jAttivAt 
lAnen ulkopuolelle kaupunkia. 

Vil8.10A 2Piet2:7. 

17. Ja johdattaissaan heitA ulos, sa- 
noi toinen: „pakene sielusi tAhden; 
AIA katsahda taaksesi, ja AlA my6s 
pysAhdykoko tAUA lakeudella; vaan 
pakene vuorille, ettet hukkuisi.** 

18. Mutta Lot sanoi heille: „Voi, 
Herran i I 

19. Katso, palvelijasi on lOytAnyt 
armon sinun edessAsi, sinA olet teh- 
nyt laupeutesi suureksi , ionka mi> 
nulle osoitit, pelastaaksesi sieluani; 
en taida mina pAAstA pakoon vuo- 
rille ennenkuinonnettomuussaavut- 
taa ininun ja minA kuolen. 

20. Katso, kaupunki tuolla on lAhel- 
lA paetakseni sinne, ja se on pieiii. 
Salli minun paeta sinne — sehan on 
niinpieni-,ettAsielunijAisielAmAAni* 

21. Niin sanoi HAn hAnelle: „katso, 
lAssAkin asiassa olen minA sinun 
rukouksesi kuullut; en hAvitA sitft 
kaupunkia, josta puhut. 

22. RiennA, pakene sinne; sillA en 
minA taida mitAAn tehdA, ennen- 
kuin sinne pAAset.** SentAhden kut- 
sui hAn sen kaupungin Soariksi.* 

23. Kun aurinko oil nousnut maan 
yli, ja Lot tullut Soanin, 

24. niin antoi Herra sataa Sodoman 
ja Gomorran pAAlle tulildveA ja tul^ 
ta. Herralta taivaasta, 

25. ja kukisti ne kaupungU, ja koko 



20 



1 HOOS. ig. 20. 



KD lakeuden yaoA Icalkld nllden 
kaupuolden asuvalset, ]a maHn kai- 
lun. iKoom. i>23. Js. WIS. Jcr. MM. 
Bn-WA Boa.l1& Am. luL lAUklT^r 
loud. ¥. r. 
a. Nulla Lotin valmo, Joka scu- 
rati hintfi, katiol laaksensa Ja muui- 
tul iiial«patsaakst. YlUtOiT. 

LUDk. 1713Z. 
27. Ja kun Abraham nousi varhain 
aullajamenisi ihea palk kaan, k u*- 



!&}> kaluhli Sodomaanja Gomor- 
raan pafn, Ja sllmalli koko lakeutia, 
Dim nflkl hBn, ellB savu nausi maas- 
O Dilnkuin pSlsln savu. 

a. NiEn tapahtui slU, etia kun Ju- 
1« kuklsll sen lakeuden kaupun- 



£, muisti HflD Abrahamla, ja Joh. 
tU Lolln ulos hfivltyksen keskellB, 
UTlllfiessfifln ne kaupuDgll, jojlsa 

30. Ja Lot IBksi Soariila Ja asui 
tuorislossa, Ja kaksl hftnen lytBr- 
"— "•"—n kanssansa- sillB hfln 
i Soarissa; ja hfln oil 
SB, Ma Ja molemmal lyHB- 



atal hfinc 



nuula mletlB maan pBailtt, makaa- 
■aaan meidln kanssamme, koko 
naaflroan tavan JSlkeen. 

31 KBykSBmrne, Juollakaamme i- 
limine vlinlllB. Ja maalkaamme hB- 
ua kanssansa, nerfitlfiBktemnieisBs- 
iDlnie slemenlS." 

33. Niin he Juottivat IsBnsB sinfi ySnB 
viinilU. Ja vanhempi lull ja niakasl 
lunsl kanssa, etkB bBn huomanuul, 
^oilu hln lull makaamaan ja koska 



naa, ja asui Kadekieii Ja Surin 
. -ilbeetia, Ja oil muukalaliena Gera- 

3. Ja Abraham mooJ valmoatanta 
Saaraala: „hSn on minun siiarenl." 
Nitn Ablmelek. Genrin kunlaBas, 
tBhetti Ja aiilol noulaa Saaran ly- 
kAnsB. IHosa. 13:13. 

3. Mulla Jumala lull Ablmelekin 
)ykO ;61IB unesM Ja sanol hBnelle: 
.Jialso, slnun pllBa kuoleman sen 
valmon IShden. Jonkas ollanut olel; 
slIlB hSn on loisen mieheD avlovai- 



lahdolko surmala biinkaankin kao- 
san? 

5. EikQhBnsanonulmlnulle: .hfin 
on minun slsarenl?* Ja hfin lUekln 
sanol: ,hBn on minun vdJenl.' Yk- 
slvakalselta sydBmmellB Ja vlallo- 
mllla hBsllia olen mlnfi sen lehnyl." 

6. Ja Jumala 8anoi hBnelle unessa : 
..rnlnB myOs tiedBn, ellB sydBmme»t 
yksivakaisuudessa olel sen lehnyl. 
SenlBhdeu minfi myOs eslin sinup 
rlkkomaslB mlnua vaslaan; enkft 
sallinut sinun ryhlvB hBneen. 

7. Niln anna nyt mlehelle hBnen 
ralmonsa lakaisln; sillB hBn on pro- 
fella, Jahfln on rukollevaslnunedes- 
ISsI. ellB saal elBB. Mulla jos el sinB 
anna hBnIB Iskalsin. niln tiedS, etlB 
lotisesli kuoiel, Ja kaikkl milB sinulla 

8. Niin Ablmelek nODSl verhaln aa- 
nulla ja kutsui kaikkl pa Ivelijaosa, 

ja puhui nSmB kaikkl heidBn kuu|. 
lensB : ja mlehel cielkBslvBI suuresti. 

9. Ja Ablmelek kuUul Abrahamln. 
a sanoi hBnelle: ..mllBs meille tell? 

_a milB minA olen rikkonul slnua 
vastaan, ellB saatlt minulleja valla- 
kunnalieni niln suuren rikoksen? 
sinB olel lehnyl mlnua kohlaan ml- 
IB ei sovl lehda." 

10. Ja Ablmelek aanot vlelB Abra- 
hamllle: „mltB larkoitjt.ellBslBmBa 

11. Abraham sanol: ., minfi ajalte- 
lln: kenlles el IfissB paiknssa oleyh- 
IBBn Jumalan pelkoa, ja he surmae- 
VBl mlnul vaimoni tfihden. 

12. Ja hSn on tosln slsarenl; slllfi 
iBn on Isfinl lylBr. vaan ei Billnl 



1 MOOS. 20. 21. 



kohtaan, kuhunka paikkaan ikSnfl 
tulemme, ettfl sanot ininusta: ,han 
on ve^eni!* 

14. Niin Abimelek otti lampafta, Ja 
karjaa, ja palvelijoita, ja piikoja, ja 
antoi Abrahamille; ja Ifthetti hftnelle 
Saaran, hfinen vaimonsa. 

15. Ja Abimelek sanoi : ,,katso, mi- 
nun maani on avoinna sinun edes- 
sftsi ; asu kussa sinuUe parhain kel- 
paa.** 

16. Ja hfin sanoi Saaralle: „katso, 
minfi annan veljellesi tuhannen ho- 
peasiklift, ne pitftA oleman sinulle 
silmfiln peitteeksi, kaikkien edessd, 
Jolka sinun kanssasi ovat; niin olet 
sin9 kaikkien edessd viattomaksi to- 
distetlu.** 

17. Mutta Abraham rukoili Juma- 
lata« ja Jumala paransi Abimelekin, 

ia hanen vaimonsa, ja h&nen pii- 
[ansa ; ja ne siittivdt. 

18. Sillfl Herra oil perfiti sulkenut 
kaikki kohdut Abimelekin huonees- 
sa, Saaran, Abrahamin vaimon kah- 
den. 

21 Luku. 

Isaak Byntyy. Ismael ]a Hagar korvessa. 
Alnndiamin liitto Abimelekin kanssa. 

J a Herra katsoi Saaran puoleen, 
niinkuin HAn sanonut oli ; ja Herra 
teki Saaralle, niinkuin hfin oli pu- 
hunuL 1M008.17U9. 18:10,14. Matt 1:2. 

Hebr. 11:11. 

2. Ja Saara tuli raskaaksi , ja syn- 
nykti pojan Abrahamille hfinen van- 
huudessansa, silld ajalla, minkft Ju- 
mala hftnelle sanonut oli. 

3. Ja Abraham nimitti poikansa, 
joka hftnelle syntynyt oli, jonka Saa- 
ra hftnelle synnylti, Isaak. 

4. Ja Abraham ympftrileikkasi poi- 
kansalsaakin kahdeKsan-pftivftisenft, 
niinkuin Jumala hftnen olikflskenyt. 

1 Moos. 17:11. Ap.t7:8. 

5.. Abraham oli sadan ajastaikainen, 
kun Isaak, hftnen poikansa, hftnelle 
syntyi. 

o. Ja Saara sanoi : „ Jumala on teh- 
nyt minulle naurun; kuka ikftnft 
sen saa kuulla, hftn nauraa minua.'* 

7. Ja sanoi vielft: „kuka oHsi tai- 
tanut sanoa Abrahamille : ,Saara on 
lapsia imettftvfi*; sillft minfi olensvn- 
nytlfinyt pojan hftnen vanhuudes- 
sansa? 

8. Ja lapsi kasvoi ja vieroitetUin; 
ja Abraham teki suuret pidot sinfi 
pftivSnft, jona Isaak vieroitettiin. 

9. Ja Saara huomasi, ettft sen egyp- 
tilftisen Hagarin poika, jonka tftmft 
oli Abrahamille syonyttfinyt, oli pilk- 
kasja. 



10. Ja hftn sanoi Abrahamille: „i|ja 
ulos tftmft palkkavaimo poikinensa; 
sillft pal kka vaimon pojan ei pidfi 
perimftn minun poikani Isaakin 
Kanssa.*^ OaL 4:30. 

11. Tftmft Sana oli Abrahamin mle- 
lestft sangen karvas, hftnen poikansa 
tfihden. 

.12. Mutta Jumala sanoi Abraha- 
mille: „ftlft Ota sitft niin pahaksesi 
poikasijapalkkapiikasi tfthden. Kal- 
kissa mitft Saara sinulle sanoo,kuulc 
hfintS; sillft Isaakissa pitftft sinulle 
siemenkutsuttaman. Room. 9.7. 

Hebr. 11:18. 
13. Minft teen myOs piikasi pojan 
kansaksi, koska hftn sinun sieme- 



nesi on. 



*( 



lM0(i8. 16:10. 17.-20. 



14. Niin nousi Abraham aamulla 
varhain, otti leipftft ja vesileilin, ja 
antoi Hagarille, ja pani hfinen sel- 
kfiftnsft; Ja antoi hSnelle pojan, ja 
laski heidfit menemfifin. Niin hftn 
meni matkaansa, ja eksyi Bersaban 
korvessa. 

15. Kun vest oil loppunut leilistfi, 
h«itti hftn pojan yhdenpensaanalle. 

16. Ja menipois, ja istui hftnen koh- 
dallensa noin joutsen kantaman maV 
kan pfifthftn; sillfi hfln sanoi: „en 
minft voi nfihdft pojan kuolemata.** 
Ja istuen hftnen kohdallansd, ratkesi 
hfin ftftneen itkemftftn. 

17. Ja Jumala kuuli pojan ftftnen; 
ja Jumalan Enkeli huusi Hagaria 
taivaasta, ja sanoi hfinelle: „mikft 
sinun on, Hagar? 91ft pelkftft; sillft 
Jumala on kuullut pojan ftftnen, 
kussa hftn makaa. 

18. Nouse, Ota poika, ja tue hfinUl 
kftdellftsi; sillfi minfi teen hftnen 
suureksi kansaksi.'*^ 

19. Ja Jumala avasi hftnen silmftn- 
sft, ettft hftn nftki vesikaivon: niin 
hftn meni ja tftytti leilin vedellft, ja 
antoi pojan juoda. 

20. Ja Jumala oil pojan kanssa; ja 
hfin kasvoi, ja asui korvessa, ja tuli 
tarkaksi joutsimieheksi. 

21. Ja hfin asui Paranin korvessa; 
ja hfinen ftitinsft otti hftnelle viiimon 
Egyptinmaalta. 

22. Siihen aikaan puhul Abimelek 
la hfinen sotapfifimiehensfi Pikol A- 
brahamille, sanoen: „Jumala on si- 
nun kanssasi kaikissa,mitfi sinfi teet. 

1 Moos. 26:26. 

23. 'Niin vanno .nyt minulle tfissfi 
Jumalan kautta, ettet ole minulle, 
eikfi pojalleni, eikfi poikani pojalle 
petollinen ; vaan sen laupeuden jftl- 
keen, jonka minft tein sinulle, tee 
sinft my6s minulle. ja sille maalle, 
jossa olet muukfilamep/* 



2Z 



1 MOOS. 21. 22. 



24. Niin sanoiADranam: ,,sen minfl 
tannon.'* 

25. Ja Abraham nuhteli Abimelekia 
sen vesikaivon tfthden, Jonka Abi- 
meleki;! palvelijat olivat vfikivallalla 
ottaneet. 

2S. Ja Abimelek sanoi : ,«en ole mi- 
nft Hetftnyt, kuka sen teki; et ole 
sinftkfiftn ilmoittanut minulle, enkA 
minft ole sitft ennen kuullut, kuin 
IfinftpflnS.'' 

27. Niin otti Abraham larnpaita Ja 
kariaa, ja antoi Abimelekille ; ja he 
tekivfit molemmat liiton keskenflnsft. 

28. Ja Abraham asetti seitsemfin 
karitsaa laumasta erinftnsfi. 

29. Niin Abimelek sanoi Abraha- 
mille: .,mihinkfl nfimSseitsemfin ka- 
ritsaa, jotka olet asettanut erikseen ?** 

30. Hfin vastasi: „nfimfl seitsemfln 
karitsaa pitfifi sinun ottaman minun 
kSdestflni, todistukseksi minulle,ettfl 
minfi olen tfimftn kaivon kaivanut.** 

31. Sentfthden nimitti hftn sen pal- 
kan Ber>Saba ; sillfi siinfi he molem- 
mat vannoivat keskenfinsfl. 

1M008.28*.81,88. 

32. Ja niin he tekivfit lijton Ber- 
sabassa. Ja Abimelek nousi sekS Pi- 
kol, hftnen sotapftfimiehensfi, ja pa- 
lasivat Filistealaisten maalle. 

33. Ja Abraham istutti puita Ber- 
sabassa; ja rukoili siina Herran, 
ijankaikkisen Jumalan niemeen. 

34. Ja hfin oli muukalalnen Filis- 
tealaisten maalla kauan aikaa. 

22 Luku. 

Abnbam koetelUum. Kristas lorataan. 
Kahorin sakvtaulo. 

Kan nflroS olivat tapahtuneet,koet* 
teli Jumala Abranamia, ja sanoi 
hSnelle: „AbrahamI" Hfin vastasi r 
«,katso, tfissfi minfi olen.** Hetnr. 11:17 ss. 
2. NUn Hfin sanoi: „ota nyt Isaak, 
sinnn alnoa poikasi, Jota rakastat« 
ja roene Morian maaile, ja uhraa 
hfinet siellft polttouhriksi yhdellfi 
viistfi vuorista, jonka minfi sinuUe 
sanova olen/* 

S. NUn Abraham nousi varhain aa- 
mnlla, Ja valjastl aasinsa, ja otti 
kaksi palveiyatansa myOtfinsa, sekfi 
poikansalsaakin ; sitten halkoili hfin 

Elttouhrin puita Ja valmisti itsensfl, 
Ifiksi menemfifin sille paikalle, 
ika Jumala hfinelle oli sanonut. 

4. Run Abraham kolmantena pfii- 
vftnfi nosti silmflnsfi ja nfiki sen pai- 
kan kaukaa, 

5. sanoi hfin palvelijoillensa : ,,ol- 
kaat te tfissfi aasin lykOnfi; mutta 
minfi ja poika kfiymme tuonne. Ja 



kun me olemme rukoilleet, niin me 
palajamme teidfin tykOnne.'* 

6. Ja Abraham otti polttouhrln hal- 
vot, ja sfilytti poikansa Isaakin sel- 
kfifin , mutta itse hfin otti tulen Ja 
veitsen kfiteensfi; ja he kfivivfit mo- 
lemmat yhdessfi. 

7. Niin sanoi Isaak isfillensfi Abra- 
hamille: nisfir* Hfin vastasi: ,4fissfi 
minfi olen, polkanl.'* Ja hfin sanoi: 
„katso, tfissfi on tuH ja halot; mutta 
kussa on lammas polttouhriksi?** 

8. Abraham vastasi: ,«Jumala on 
katsova Itsellensfi lampaan polttouh- 
riksi, poikani.** Ja he kfivivfit mo- 
lemmat yhdessfi. 

9. Ja kun he tulivat sille paikalle, 
josta Jumala oli hfinelle sanonut. 
teki Abraham siihen alttarin,Ja panl 
halot; sitten sitoi hfin poikansalsaa- 
kin, ja pani hfinet alttarille halkojen 
pfifille. Jaak.2:21. 
. 10. Ja hfin ojensi kfitensfi, ja otti 
veitsen, teurastaaksensa poikaansa. 

li; Silloin Herran Enkelt huusi hfi- 
nelle .talvaasta, sanoen: „ Abraham, 
Abraham !** Hfin vastasi : „tfissfi mi- 
nfi olen.** 

12. Hfin sanoi: „filfi satuta kfittfisi 
poikaan, filfikfi hfinelle mitfifin tee; 
sillfi nyt minfi tiedfin, ettfi sinfi 

{lelkfifit Jumalata, kun et ole sfifis- 
finyt ainokaista poikaasi minun 
tfihteni.** 

13. Niin Abraham nosti sUmfinsfi, 
ja huomasi takanansa oinaan, joka 
oli sarvistaan tarttunut pensastoon. 
Niin Abraham meni, otti sen oinaan 
ia uhrasi polttouhriksi poikansa si- 
jaan. 

14. Ja Abraham nimitti sen paikan : 
Herra on edeskatsova; josta vlelft 
tfinfipfinfi sanotaan: Herran vuorella 
edeskatsotaan, 

15. Mutta Herran Enkeli huusi Abra- 
hamille toistamiseen talvaasta, 

16. Ja sanoi : „minfi olen vannonut 
itse kauttani , sanoo Herran* 'koska 
tfimfin teit, etkfi sfifistfinyt ainoata 
poikaasi, Hebr. 6:13. 

17. niin minfi suuresti slunaan si- 
nua, ja runsaasli lisfifin sinun sie- 
menesi niinkuin taivaan tfihdet, la 
niinkuin sannan meren rannalla. Ja 
sinun siemenesi on voittavavihollis- 
tensa portit. . i Moos. 13*16. 16:6. 

Matt16:l8« Lttak.l:78. 

18. Ja sinun siemenessfisi pitSfi kaik- 
ki kansat maan pfifillfi siunatuksl tu- 
leman, kdska minun fifinelleni kuu- 
liainen olit.** . iMoo8.i2.*3. 18:18. 26:4. 

Ap. 1 8 :2s. Gal. 8:8. Jes. 66:16.. Syr. 4422. 

19. SUte palasi Abraham palvell- 
joittei>so tykO; ja he nousi vat Jamat- 



23 



1 HOOS. 21 23. 24. 



kualtvatyhdeufl Benabaan. Ja Abni- 
bam asul BersabassB. 
ao. Kun nSma clival tapahluneel, 
ilmottetliln Abrabamille, sanoen: 
„katso, Milka on myOs synnyltHnyt 
poihia sinun veljellesi Nahorille, 



Jal-Arbassa.jo- 
inmaallai Nlin 
m kuolemas J a 



laseilsemfin 
lajaslaikaa; nc 
olivatSaa 

2. JaSaa 

Abraham 
llki hSnIfl. 

3. Silten noutt hHn, IBksi pols kuol- 
leeo lykOB, ]a puhul Helln lapsllle, 

4. „Mina olen muukalalaen asukas 
lykOnflnne ' antakaat minulle perin- 
tOhauta teldan lykOnanne, hauda- 
lakseni sllhen minun kuolleeni." 

6. NlinvaslaslvalHetinlapselAbra- 
hamla, sanoen hBnelle: 

C. „Kuule melts, rakastierra; sin9 
olet Jumalan ruhllnas meidSn kea- 
keUSmme; haulaa sinun kuolleest 
meidfin parhaasen haulaamnie. El 
ykslkeon meistfi slnua kiellfibaulaa- 
masta sinun kuollullas] hflDen hau- 
laahsa," i Mooa. -25:10. 60:13. Ap,t-T:l«. 

7. Nlin Abrabam nousi ja kumarsl 
tnaan kansan. Helln laslen, edessB, 

8. Ja banpuhulheille, sanoen: .Joa 
aallltte, etifi minB haulaan minun' 
kuolieenl. nlin kuulkaal mlnuq, ja 
puhulelkaal minun puoiestani Efro- 
nla, Soarln poikaa, 

9. ellB hfln aniafsl minulle Mah- 
pelan luolan, joka hltnellR on vai- 
nionsa perSllfl; l&yllflhlntaavastaan 
anlakoon sen mlnulle perlDlOhau' 
daksl leldBn keskellBnne." 

10. Ja Efron blul Hetin lasten kes- 
kellB:'NilnvBstasiE(h)n,He<iiBlnen, 
Abrabamia, kalkkien Metin polkaln 
kuullen, Jolka hBnen kaupunktnsa 
porlisia kulklvat, sanoen: 

' 11. ..El.lnlnua herranl.vaan fcuule 
minua ; ten valnloo mtnB annan sl- 
nulle, ja luolan, ]oka sllnl on. an- 



nan minB slnulle; mfnun buuanl 
lasten nShden lahjoltan minSsenst> 
nuUe: haulaa sinun kuollessl.'* 

IZ Abraham kumarei maan kaosan 
edessB, 

13. Ja puhui ER-onille maan 'kan- 
san kuullen, sanoen : , joSpa kullen- 
kla minua kuulisiil mlnfi annan r^ 
ban valniosia, ota se minulla; ]■ 



15. „{]erninl, kuule mlnua ; neljBii- 
tadan hopeaslklln maa, mll9 se on 
minun ja sinun vAlillfii? haulaa st- 
nun kuolleesl." 

16. Abraham kuull Efhinla. ja pun- 
nitsi hBnelle rahasumman, mtakft 
hflnmftBrSnnylollHetlnlailen kuul- 
len: neljBsBlaa aikliB hopeala, k&y- 
paa rahaa. 

17. Ja nlin Efronln valnlo, Joka 
Makpelassa on Hamren kohdalla, 
vainio luolinensa, Ja kaikkl puul 
sllnB vainlolla, }a koko sen pllrissfl, 

18. vahvlsletllin Abrahamille omai- 
suudeksl kalkkien Helln laslen nnh- 
den, Jolka kulklvat hSnen kanpun- 
k ill SB porttata. 

IB. Ja silten haulasf Abraham Saa- 
ran, valmonsa. Makpelan vainion 
luoban Mamren kohdalla, Joka on 
Hebron Kanaanmaalla. 

20. Nlin 



Kun Abraham oil vanha la Joutu- 
nul lJBIIiseksl.]a Hemofi aiunan- 
nut bSnen kaiklssa, 
2. sanol hanvanhimmallehuoneen- 



mlnun kupeenl alle; 

S. Ja lupaa mlnulle valalla Herran, 
laivaan Ja maan Jumalan kautla, 
eltel Ola valmba minun poialI«nl 
Karianealaiaien lyllfirisIB, Jolden »^ 
Bssa mInB aaun; 

4. vaan ihene minun isBnl maahan 
ja minun sukunl lykfl, ]a ola slellB 
minun pojallenl Isaakille vnimo." 

5. Palvelija sanol hBnelle: .Josniln 
tapahluiai. el lei valmo lahtolsl seu- 
rata minua IBFiSn maahan. pilHflkS 
minun viemBn sinun poikasl takij- 
sln sllie maalle, josla ol^l IBhIenyl?" 

S. Abraham sanol hBnelle: ..vara, 
eltel vie polk'aaht sinne lakaisfn. 
7. Hem, laivaan Jutnala, Joka mi- 



nuallanl, }■ Joka minun 
puhnl ]k vannoi mlnulle, unoen: 
iiinuD aiemeiicllesl min& aOBan O- 
mln mun,' hBn IBheltSI Enkelintft 
«laaa edeliatl , alia elta slelta uutt 
pajKllcDl valmon. lHooi.l%T. uns. 
U.-T, 11. 

t. Uatla los el vaimo tahdo seureU 
timia, nila tlnfi olet vapaa IftilS mi- 
nun valailanl: fllfi vaan vie polkaanl 
ilnneiUleea.'' 

9. Kiln latld palveiya kftleniB het^ 
nnu Abraham In kupeenalle Javaa-' 
nd hlnelle sen. 

M. Ji pslvelija oiti kymmenen ka- 
mdia heirrasB kamelelsta, Ja Uksl 
maUuUe: hfia oil! myOi myOUinBl 
kaikklnalslB taerraiua tavaraa; Ja 
vmIsI niln Hetopolainia»n Nahoria 
kmpankUn. lUooa-ii^Si. 

11. Sielii aaloi haa kamellea laskea 
polTlIleaiaulkGnakaupunKlita veil- 
uUvon, lykOni ehloopuolella, Jolln 
«i*lki vaimovBea tapa oli IBhtell 
vets ammenlaiiiaBn, 

11 Ja hBn sanot: ..Herra, mlnun 
himnlAbnihamlnJumala, suo ml- 
nnllemeneil;! tfial pfllvBiiS, ia lee 
linpent herrallenl Alirahamllle. 

11 Eatso, mini seinHi Ifissfi veal- 
ludvan lykOnB ; Ja kaupunktlalalen 
Iflttnl tulevat vetlflammenlamaan. 

li HUn luo nyt, etIB ae lyltC, jolle 
miol.HiDon: .kallisla (Bane veai- 
"""■"' D Juodakseni,' Ja hflo 



: Jno, Ja minS Juotan my{>s 
kamelisl,' on Juuri se, jonka 



Uj^olet laupeuden tehoyl her- 

1S.J* enneokula taBnlakkaslpuhu- 
inula.katw, Bebekka lull, Joka sya- 
>ya<n dU BetucUlIe, Hllkon, Abrafia- 
pia veUenNahorln valmon, poialle. 
h hinellB oU vesiasHa otallansa. 

1 Moot. !2:J3. 
,». TVltfl oil laoaen Iharia nBhdS, 
li vleb nellayt,-eIkB yksikUa mt« 
tilnt hineea ryhtynvi; hBn menl. 
•^UhleeUe, tfijill asUansa, ]a hill 



aslaiua ninheen, Ja Juokat laai kal- 
folle ammentamaan, la ammeul 
kalkllle hfinen kamelelllenM. 

21. Malta mlei kalseli hBnIB BBn^ 
lOnnB tielBBksensB, ollko Herra leh- 
nyi hflnen malkaiua oimelUselul, 
vat el. 

23. Kun tltlen kaikkl lutmelll oU- 
vat Juoneet, antot mlei hloelle kul< 
taUen nenBrenkaan.JokapatDoipuo- 
lea tiklla, sekS. kak^ ktillalda ran- 
nerengaslB, jolka pataoival kymm«- 
nen sSdlB. 



neeisa s({aa meldfia yfllS ollaksem- 



bBn aynnytit kahDiille." 

25. Ja hfln vielS lanoi hBnelle: ,.on 
mcillS olkia Ja karjan ruokaa kyllfl, 
Ja myOs lijaa yOia-olla."'- 

26. Silloln mlei kumarlul maaban, 
J a rukotll Herraa, 

27. ja iaaol : „klltelty olkoon Herra, 
mlnun herranl Abruhamln Jumala, 
Joka ei otianul potalanpeutlauMja 
totuullansa mlnun herrallanll mlnua 
on Herra Johdattanul UlIS tlellfi ml- 
herraniv"""" " " 



fiitlnsfl huoneesSB. 



ka' sanot: .nBln on mies puhuiiut 
mlnulle/ nlla tull hltn miehen tykO, 
Joka selaol knmelein luonn kalvolla. 
SI. JahOnsanoi: „Iule sUtlle, alnB 
Herran slunaltUimllBseisolulkonaT 
mine oten huoneen valmttlanut, se> 
kS sllaa kamelelUe." 

32. Niln miesmenihuoneesen; s(el< 
IBrllsultMn kamelll ia panllln olkla 
Ja ruokaa kamelellfe, sekB luollin 
vellS pesIB hBnen Jalkansa Ja niilten 
miesten Jatal, Jolka bBnen kanxsanM 
oil vat. 

33. Sille panllln ruokaa hflneneleen* 
9B. Mutta hBnaanoi: ,.en minfl lyA, 
ennenkiiln olen puhunut aiiaiO." 
Laban vaslasl : „puhu.'' 

34. Silloln hBn sanol: „intnfi olen 
Abraham in patvelije, 

35. Ja. Herra on runsaasU riiinan- 
nul minun herraal, Ja hfln oi| sun,- 
rekst lullul. H9a on antanut hBnella 
lampaila Ja kuriaa, hopeala Ja kul- 
■- palyeIi]oiiaUpiM«.l«imekl« 






1 MOOS. 24. 



36. Ja Saara, minun herrani vaimo, 
on vanhalla ijflUftnsfl synnyttlinyt 
herralleni nojau; h&nelle on h&n 
antauut kaikld, mitft hfineilfl on. 

lMoo8.2l:2. 

37. Ja minun herrani vannoitti mi- 
nua, sanoen : ,&1A ota pojalleni vai- 
moa Kanancalaisten tyttaristft, joi- 
den maalla minft asuu; 

38. vaan mene minun isfinihuonee- 
sen ja sukuni tyliO, Ja ota sieltft po- 
jalleni vaimo/ 

39. Multa minft sanoin herralleni: 
,mitfi, ios vaimo ei seuraisi minua?* 

40. Niin hftn sanoi minulle : ^Herra, 
jonka edessft minft vaellan, Ifthettflft 
Enkelinsft sinun kanssasi« joka tekee 
sinun matkasi ounelliseksi* niin ettft 
saat pojalleni vaimon minun suvus- 
tani ja minun isfini huoneesta. 

41. Sinft tulet vapaaksi minun va- 
lastani, kun kerran tulet minun su- 
kuni tykO ; jos eivfit he anna hfintft 
sinulle, niin sinft olet vapaa valas- 
lani.* 

42. Niin minft tulin tftnftpftnfi Ifth- 
leelle, ja sanoin : ^Herra* minun her- 
rani Abrahamin Jumala, jos sinft 
olet tchnyt minun matkani onnelli- 
seksi, jota niinft nyt vaellan, 

43. niin suo n^^X sen tapahtua, kun 
seison tftssft vesikaivon tykdnft, ettft 
jos joku tytlO tulee vettft ammenta- 
maan ja minft sanon hftnelle: ,an- 
ua minulle vfthftn vettft juoda as- 
tiastasi\ 

44. ja hftn sanoo minulle : Juo sinft, 
minft ammennan myOs sinun kame- 
leillesiS ettft hftn juuri on se vaimo, 

i'onka iierra on mftftrftnnyt minun 
lerrani pojalle.* 

45. Ja ennenkuin olin lopettanut 
puhumasta sydftmmessftni, katso, 
niin l^ebekka tuli, vesiastia olallan- 
sa, ja astui alas Ifthteelle ammenta- 
maan. Niin minft sanoin hftnelle: 
,annas minun juoda.' 

46. Hftn riensi, laski vesiastian olal- 
tansa alas ja sanoi: juo, minft juo- 
tan myOs kamelisi.' Niin minft join; 
ja hftn juotli myOs kamelit. 

47. Ju minft kysyinhftnellft, sanoen: 
,kenenkft tytftr sinft olet?' hftn vas- 
tasi : ,minft olen Beluelin tytftr, Na- 
horin pojan, jonka Milka hftnelle 
synnytti.' Niin minft panin nenftren- 
kaan hftnen otsaansa ja ranneren- 
kaat hftnen kftsiinsft. 

48. Ja minft kumarruin maahan ru- 
koillakscni Herraa, ja minft kiitin 
Herraa, minun herrani Abrahamin 
Jumalata, joka oil minun johdatta- 
nut oikiata tietft, ettft saisin herrani 
pojalle hftnen veljensft tytlftren. 



49. Ja nyt, jos te tahdotte herralleni 
laupeuden ja totuuden . niin sano- 
kaat minulle; jos ei, niin sanokaat 
sekin minulle, ettft kftftntftisin itseni 
toisaall^, oikealletaikkavasenunalle 
puolelle.** 

50. Niin vastasi Laban ja Betuel, 
ja sanoivat: „tftmft asia on tullut 
uerralta ; sentfthden emme taida si- 
nua vastaau puhua, ei pahaa eikft 
hyvftft. 

M. Siinft on Rebekka edessftsl. ota 
hftnet ja mene, ja olkoon hftn sinun 
herrasi pojan vaimo, niinkuinHerra 
on sanonut.** 

52. Kun Abrahamin palvelija kuuli 
heidftn sanansa, kumartui hftn maa- 
han Herran eteen. 

53. Ja palvelija toi hopea- ja kulta- 
koristeita sekft vaatteita, ja antoi Re- 
bekalle; vaan hftnen veljellensft ju 
ftidillensft antoi hftn kalliita lahjoja. 

54. Niin h6 sOivftt ja joivat, hftn ja 
miehet, jotka hftnen kanssansa oil- 
vat, ja viipyivftt siellft yOtft. Mutta 
aamuUa, kun nousivat, sanoi hftn; 
„pftftstftkftftt minua herrani tyk6.*' 

55. Mutta tytdn veli ja ftiti sanoi- 
vat: „olkoon tylld meidftn tykdnftm- 
me eaes kymmencnkin pftivftft; sit- 
ten saat mennft.'* 

56. Niin sanoi hftn heille: „ftlkftftl 
viivyttftkO minua; sillftHerraon teh- 
ny t minun matkani onnelliseksi.Las* 
kekaat minua menemftftn herrani 
tyk6." 

57. Niin he sanoivat: „kutsukaani- 
me tyllO ja kysykftftmme, mitft hftn 
sanoo.** 

58. Ja he kutsuivat Rebekan ja sa- 
noivat hftnelle: „tahdotkomennft til- 
mftn miehen kanssa?** Hftn vastasi: 
„mencn.** 

59. Niin he pftftttivftt, ettft heidftn 
sisarensa Rebekka ynnft hftnen imet- 
tftjftnsft Ifthtisi Abrahamin palvelijan 
ja hftnen seuralaistensa kanssa. 

60. Ja he siunasivat Rebekkaa ja 
sanoivat hftnelle: „sinft olet meidftn 
sisaremmcj lisftftnny tuhannen tu- 
hanneksi ; ja sinun siemenesi omis- 
takoon vihamiestensft portit.** 

61. Niin Rebekka nousipiikoinensa, 
isluivat kamelein selkftftn, ja seura- 
sivat sitft niicstft. Ja palvelija otti 
i^cbekan myOtftusft, ja men! mat- 
kaansa. 

62. Mutta Isaak oli paluumatkalla 
siltft kalvolta, joka kutsuttiin „sen 
elftvftn, joka minun nftkee;** sillft 
hftn asui Etelftmaalla. 

1 Moos. 16:14. 25:11. 

63. Ja ehtoopuolella oli hftn Ifthte- 
nyt rukoilemaan kedolle; ja kun 



26 



t MOOS. 24. 25. 



hin nostt sflmftxisft, nfiiki hftii kame- 
Ilea Ifihestyvftn. • 

6i Ja kun Bebekka npsH sllmSnsS 
ja nftki Isaakin, laskeusi hAn maa'. 
han kamelin seljfistft, 
66. ja sanoi palvelijalle : „mikfi mies 
iftm& on, joka kedolla kfiy meitft vas- 
taan?" Palvelija vastasi : „se on mi- 
nun herrani.** Niin hlln otti silniik- 
kO'Vaatteen ja peitti kasvoosa. 

66. JapalveiyaKertoi Isaakille kuin- 
ka hftn oU asian tolmittanut. 

67. Jji Isaak vei hftnet fiitinsft Saa- 
ran majaan; ja hfin otti Rebekan 
vaimokseen ja rakasti hSntfl. Niin 
sai Isaak lohdutuksen surussaan 
ftitinsft kuolemasta. 

25 Luku. 

Eetaran lapset Abrahamin kuolenilBL 
. bmaelin sukutaulu. Isaakin pojat. 

J a Abraham otti taas vaimon, jonka 
nimi oli Ketura. 

2. Han synnytti hfinelle Simranin, 
Joksanin,-Medaniu, Midianin, Jis- 
bakin Ja Suakin. 

3. Mntta Joksan siitti Seban ja De- 
(lanin. Dedanin lapset olivat : Assu- 
rilaiset,Letusilaiset ja Leummilaiset. 

4. Midianin lapset olivat: Efa,Efer, 
Uanok, Abida jaEldaa; nfimfitkaik- 
id ovat Keturan pojat. 1 Aik. 1:32, 83. 

5. Ja Abraham antoi luilkki, kuin 
hinellft oU, Isaakille. 

6. Mutta niille lapsille, jotka jalka- 
vahnoista olivat, antoi hfin lalxioja, 
ja ifthettiheidftn vielft elfiissSnsfi pois 
poikansa Isaakin tykOfi, itfifin pfiin, 
Itfimaille. 

7. Ja tfimfi on Abrahamin elinaika, 
minkfi hfin eli : sata viisikahdeksat* 
takymmentfi i^astaikaa. 

& Ja hfin vaipui kuolemaan by vfil- 
li ijfillfi, vanbana ja elftmfistfi kyl- 

uftntyneenfi, ja koottiin kansansa 
tyko. 

9. Ja hfinen poikansa Isaak ja Is- 
>nael hautasivat hfinen Makpelan 
luolaan, Efronin, Hetilfiisen Soarin 
Ppjan, vainiossa, Mamren kohdalla. 

10.Siihenvainioon, jonka Abraham 
oli ostanutHetin lapsilta, siihen hau- 
oatUin Abraham , ja Saara, hfinen 
vaimonsa. - 1 Moos. 233-^19. 

U. Ja Abrahamin kuoleman jfilkeen 
siunasiJumala hfinen poikansa Isaa- 
kin. Ja Isaak asui sen Kaivoa luona, 
jonka nimi on : „sen elfivfin kaivo, 
Joka minun nfikee.'* iMoos. 16:14. 

12. Mutta tfimfl on kertomus Ismae- 
Unsavusta, Abrahamin pojan, jonka 
nagar, Saaran egyptilainen piilia, 
•ytoytU. 



13. Ja nfimft ovat Ismaelin poikaln 
nimet, heidfinnimiensfi Jasukuku'ta^ 
tainsa jfilkeen : Nebajot, Ismaelin esi* 
koinen,sitten Kedar,Adbeel,Mibsam, 

14. Misma, Duma, Massa, 

15. Hadar» Tema, Jetur, Nafts Ja 
Kedma. 1 Aik. 1:29 a. 

16. Nfimfi ovat Ismaelin lapset, ja 
nfimft heidftn nimensfi, heidfin ky- 
lissfinsfi ja kaupungeissansa: kaksi- 
toistakymmenta ruhtinasta kansoi- 
nensa. 

17. Ja tfimfl on Jsmaelin ikfl: sata 
seitsemfin neljfittfikymmentfiajastai- 
kaa; la hfin vaipui kuolemaan ja 
koottiin kansansa tykO. 

18. Mutta he asuivat Hevilasta ha- 
maan Suriin asti, joka on Eavptin 
kohdalla As83rriaan mentfiessfi. Itfifin- 

gfiin kalkista veljistfinsfi asettul 
fin. 1 M008. 16:12. 

19. Ja tfimfi on kertomus Isaakin, 
Abrahamin pojan, suvusta. Abraham 
siitti Isaakin. 1 Aik. l*.34. Matt 1:2. 

20. Ja Isaak oli neljfinkymmenen 
ajastaikainen, kun*hfin otti Rebekan, 
syrialaisen Betuelin tyttfiren Meso- 
potamiasta, syrialaisen Labanin si- 
saren, itsellensfi vaimoksi. 

21. Ja Isaak rukoili Herraa valmonsa 
edestfi, sillfi hfin oli hedelmfitOn; ja 
Herra kuuli hfintfi, ja Rebekka, hft* 
nen valmonsa, tuli raskaaksi. 

22. Ja lapset svsfisivfit toinen tois* 
tansa hfinen kohdussansa. Niin hfin 
sanoi : , Jos nfiin piti kfivmfin, miksl 
minft olen tfimmOmen?*'^Ja hfin meni 
'kysymfifin Herralta. 

23. Ja Herra sanoi hfinelle: „kaksi 
kansaa on sinun kohdussasl, ja kah- 
talainenvfikierkaneesinun ruumiis- 
tasi ; mutta toinen kansa voittaa tol- 
sen, ja suurempi palvelee vfihem* 
pfitfit* 1 Moos. 27:29. 2 Sam. 8:14. Mai. 1:2. 

Boom. 9:1088* 

24. Kun aika tuli synnyttfifi, katso, 
kaksoiset olivat hfinen kohdussansa* 

25. Ensimmfiinen, joka tuli ulos, 
oil ruskea ja kokonansa niinkuln 
karvainen vaippa ; sentfihden antoi« 
vat he hfinelle nimen Esau. 

26. Senjfilkeen tuli ulos hfinen vel- 
jensfi, joka piti kfidellfinsfi Esaun 
kantapSfistfi; ja he .antoivat hfinelle 
nimen.Jaakob. Kuudehkymmenen 
ajastaikainen oli Isaak heidfin synty« 
essfinsfi. HoR.l2:3. Matt 1:2. 

27. Ja poikaset kasvoivat, in Esau 
tuli jaloksi metsfi- ia peltomieheksi; 
miitta Jaukob oli yksivakaiaea mies 
ja asuj majoissa. 

28. Ja Isaak rakasti Esauta, sillfi 
hfin sOi mielellfinsfi metsfisaalista. 
MuttQ Rebekka rakasti Jaakobia. 



27 



1 MOOS. 25. 26. 



29. Rerran kun Jaakob oH keittfinyt 
herkun, tuli Esau metsflstfi, Ja oli 
vfisyksissfl. 

90. NiinEsausanoiJaakobille: ^an- 
na minun syOdft tftstft ruskeasta her- 
kasta, slllft minft olen vflsyksissS.** 
Sentfihden kutsutaan hfinEdomiksi. 

31. Mutta Jaakob sanoi : Minyfl mi- 
nulle tSnftp&nS sinun esikoisuutesi." 

32. Esau vastasi: „katso, minS kuo- 
len kuitenkin; mitfi minun ^iifft esi- 
koisuudesta onkaan?** 

33. Ja Jaakob sanoi: „niin vanno 
minulle tfin&pfinfi.** Ja hfin vannoi 
hSnelle, ja mOi Jaakobille esikoi- 
suutensa. Hebr. 12:16. 

34. Niin Jaakob antoiEsaulle lelpfift 
Ja hemekeittoa; ja hfin sOi ja joi, 
nousi ja meni pois. Nflin halpana 
piti Esau esikois-oikeuttaan. 

26 Luku. 

Isaak Qerarisia. Abimelekin llitto. Esaun 
vaimot. 

Mutta kallis aika tuli maalle, toi- 
nen sen entisen jlllkeen, joka oli 
Abrahaminaikaanoilut. Silloinlsaak 
Ifiksi Abimelekin, Filistealaisten ku- 
ninkaan, tykO Gerariin. 

2. Niin Herra ilmestyi hfinelle, ja 
sanoi: ,,filfi meneEgyptiin, vaanasu 
sillfi maalla, Jonka minfi sanon si- 
nulle. 

3. Die muukalainen tfillfi maalla, 
ja minfi olen sinun kanssasi, ja siu- 
naan sinua, sillfi sinulle Ja sinun 
siemenellesi minfi annan kaikki nfi- 
mfi maat, ja vahvistan sen valan, 
jonka minfi olen vannonut isftllesi 
Abrahamille. 

4. Ja minfi enennfin sinun sieme- 
nesi niinkuin taivaan tflhdet, ja an- 
nan sinun siemenellesi kaikki nfimfi 
liiaat; ja sinun siemenessfisi pitfifi 
kaikki kansat maan pfifillfi siuna- 
tuksi tuleman, i Moos. 12:3. 13:15. 

15:18. 18:18. 22:17. 28:4. 28:14. 

5. sentfihden ettft Abraham oli kuu- 
liainen minun fifinelleni, Ja piti mi- 
nun oikeuteni, kfiskyni, sfiatyni Ja 
lakini.** 

6. Niin Isaak asui Gerarissa. 

7. Ja kun sen maan kansa kysyi 
hflnen vaimostansa, sanoi hfin : „han 
on minun sisareni;^* sillfi hfin pel- 
kfisi sanoa: ^hfin on minun vaimo- 
ni/* ajatellen: .,tfimfin paikkakun- 
nan miehet voisivat mfnut tappaa 
Kebekan tfihden, sillfi hfinonkaunis 
kasvoiltaan.'* 

8. Ja tapahtui, kuii hfin oli siellfi 
kauan aikaa viipynyt,katsoi Abime- 
lek, Filistealaisten kuningas, akku- 



nasta, Ja nftki Isaakln byvftilevfin 
vaimoansa. 

9. Niin kutsui Abimelek Isaakin Ja 
sanoi : ,,katso, totisesti hfin on sinun 
vaimosi, miksi olet sanonut: ,hfin 
on minun sisareni?** Ja Isaak sanoi 
hfinelle: „niinft ajattelin, ettfi muu- 
toin minut tapettaisiin hflnen tfih- 
tensA." 

10. Abimelek sanoi: ,,miksis tflmfin 
meille teit? olisi helposti voinut ta- 
pahtua,ettfi Joku kansasta olisi maan* 
nut sinun vaimosi kanssa, la niin 
olisit saattanut meidfin pfiftllemme 
rikoksen.** i Moos. 20:9. 

11. Niin Abimelek antoi kflskynkai- 
kelle kansalle, sanoen: ,Joka ryh* 
tyy tfihfin mieheen, taikka hfinen 
vaimoonsa, hfinen pitfifi totisesti kuo* 
leman." 

12. Ja Isaak kylvl tfissfi maassa, \a 
sai sinfi vuonna satakertaisesti; siUft 
Herra siunasi hfinen. 

13. Ja mies tuli voimalliseksi: ja 
hyOtyi hyOtymistfinsfi siksi, ettfi ban 
tuli varsin rikkaaksi. 

14. Ja hfinellfi oli paljon tavarata 
lampaissa ja kaijassa, oli myOs pal- 
jon perhettfi; sentfihden Filistealai- 
set kadehtivat hfintfi. 

15. Ja he tukitsivat kaikki kaivot, 
iotka hfinen isfinsfi palvelijat olivat 
kaivaneet, hfinen isfinsfi Abrahamin 
aikana, ja tfiyttivfit ne mullalla. 

lMoos.21:SS. 

16. Ja Abimelek sanoi Isaakille: 
,,mene pois meidfin tykOfimme, sillfi 
sinfi olet tullut paljon vfikevfimmfiksi 
meiia." 

17. Niin Isaak Ifiksi sieltfi Ja s(joitti 
itsensft Gerarin laaksoon, ja asui 
siinfi. 

18. Ja Isaak antoi ifilleen kaivaa ne 
vesikaivot, jotka olivat kaivetut hfi- 
nen isfinsfi Abrahamin aikana, ja 
iotka Filistealaiset Abrahamin kuo- 
leman jfilkeen olivat tukinneet; ja 
hfin nimitti ne niillfi nimillfi, kuin 
hfinen isfinsfi ne oil kutsunut. 

19. Niin kaivoivat my6s Isaakin pal- 
velijat laaksossa Ja lOysivfit sieltfi 
luontolfihteen. 

20. Mutta Gerarin paimenet rilteli- 
vfit Isaakin paimenten kanssa, ja sa- 
noi vat: „tfimfi on meidfin vetemme.** 
Niin hfin nimitti sen kaivon Esekik- 
si, koska he olivat riidelleet hfinen 
kanssansa. 

21. Niin kaivoivat he toisen kaivon; 
a siitfikin tuli riifa, jonka tfihden 

fin nimitti sen Sitnaksi. 

22. Niin hfin siirtvi pois sieltfi toi- 
seen paikkaan ja kaivoi toisen kai- 
von, Josta ei riidelty. Sentfihden nl- 



iJ 



28 



1 MOOS. 26. 27. 



mitti hfln sen Rehobotiksi, ja sanoi: 
,^yt Herra on antanut meille ava- 
famman alan.niin ettfl voimme eiien- 
tyfl maassa.'* 
23.SiUen siirtyi hfin sieltflBersabaan. 

24. Niin Herra ilmestyi- hAaelte si- 
nii yOnft, ja sanoi : .^ninft olen sinun 
isfisi Abrahamin Jumala. AJS pel* 
kiUH, sillil minfl olen sinun kanssasi. 
ja siunaan sinun, ja annan sinun 
siemenesi lisAAntyfi. minun palveli- 
jani Abrahamin tfthden.'^ 

25. Ja hSn rakensi siin3 alttarin, ja 
nikoili Herran nimeen, ja teki sii- 
lien mi^nsa; ja hfinen palvelijansa 
kaivoivat siilien kaivon. 

26. Niin Abimelek men! hftnen ty- 
kAnsfi Gerarista sekft Ahusat, hftnen 
ystdvfinsft, ja Pikol, hftnen sotf^ouk- 
konsa pdiimies. 

27. Mutta Isaak sanoi hftnelle . ^mik- 
si te tulette minun tykOni , vaikka 
te vainoatte minua, ja aioitte minun 
pois teidfin tykOfinne?*'^ 

28. He sanoivat : „me nftimme sel- 
vftsH, ettfl Herra on sinun kanssasi, 
^ntfthden me ajattelimme: ,vanno- 
kaanune keskenftmme vala, me ja 
sinft, niin ettft teemme liiton sinun 
lunssasi, 

29. ettet tekisi meille mitftfin va- 
hinkoa, niinkuin emme mekftftn ole 
sinuun ryhtyneet, emmekft tehneet 
siaallfr muuta. kuin hyvftft, ja las- 
kimme sinun rauhassa menemflftn.* 
Sinii Diet nyt Herran slunatfu.'* 

30. Ja hftn valmisti heille pidot, ja 
he sfiivftl ja joivat. 

31. Seuraavana aamuna varhaln he 
vannoivat toinen toiseUensa valan; 
klsaak laski heidflt menemftftn, ja 
oe menivSt pois hftnen tykOftnsft 
rauhassa. 

32. Samana pftivftnfl tulivat Isaakin 
Palvelijat ja ilmoittivat hftnelle kai- 
^osta, jonka he kaivaneet olivat, ja sa- 
ooivathfinelle:„mel6ysimmevedent' 

33. Ja hftn kutsui sen Sabaksi : siitfi 
on kaupunki saanut nimen Bersaba 
hamaan tfthSn pfiivftftn asti. 

fi Kun Esau oli netjftnkymmenen 
iBsti^an vanha, otti hftn Juditin, He- 
liiien Berin tyttftren, vaimokseen, 

S BtsmaUn, Hetilftisen Elonin tyt- 

ttren. 
35. Mutta ne olivat Isaakille ja Re- 

hekane mlelikarvandeksi. 

27 Luku. 
Itaak siunaa poikianaa. 

Vnn nyt Isaak oli tullut vanhaksi, 
^^ia hanen silmflnsA pimenivftt, et- 
^ kfin nflhnyt, kutsui hftn Esaun, 



aias 
tfUli 



vanhemman poikansa, Ja sanoi hftr 
nelle: „minun poikanl/' Hftn vas- 
tasi: ,,tftssft minft olen.*^ 

2. Ja hftn sanoi : ,,katso, minft olen 
vanhentunut, enkfi tiedft minun kuo- 
lemapftivftftni. 

3. Ota siis nyt sinun aseesl, viinesi 
Ja joutsesi, ia mene kedolle Ja pyy- 
dystft minulle metsftnotus; 

4. tee sit ten minulle himoruokaa, 
senkaltaista kuin minft rakastan, niin 
minft sOisin Ja minun sieluni siu- 
naisi sinua,ennenkuin minft kuolent* 

5. Mutta Rebekka kuuli Isaakin nfti- 
tft puhuvan poikansa Esaun kanssa. 
Ja Esau meni metsftftn, pyytftmfiftn 
metsftnotusta, tuodaksensa kotia. 

6. Niin puhui Rebekka pojallensa 
Jaakobille. sanoen: „katso, minft 
kuulin isftsi puhuvan ve^jesi Esaun 
kanssa, ja sanovan: 

7. ,Tuo minulle metsftnotus, ja tee 
minulle himoruokaa syOdftkseni, et- 
tft siunaisin sinua Herran edessft en- 
nenkuin minft kuolen.* 

8. Niin kuule nyt, poikani, mitft sa- 
non, ja tee, niinkuin kftsken. 

9. Mene laumaan, ota sieltft minul- 
le kaksi hyvftft vohlaa: niin minft 
teen niistftiiimoruokaalsftllesi, niin- 
kuin hftn rakastaa. 

10. Ja sinun tulee viedft se isftllesi 
syOtftvftksi, ettft hftn siunaisi sinua, 
ennenkuin hftn kuolee.'* 

11. Niin Jaakob sanoi ftidillensftRe- 
bekalle: „katso, ve^eni Esau on kar- 
vainen, mutta minft olen sileft-ihol- 
nen. 1 Moos. 26:25. 

12. Kenties koskettelee isft mlnua, 
ja niin minft joudun petturlksl hft- 
nen edessftnsft ja saatan pftftlleni ki- 
rouksen siunauksen sijaan." 

13. Mutta hftnen ftitinsft sanoi hft- 
nelle: „se kirous tulkoon minun pftftl- 
leni, poikani; tee vaan niinlcuin 
sinullesanon,menejatuoseminulIe" 

U. Niin hftn meni ja otti ja toi fti- 
dillensft; ja hftnen ftitinsft valmisti 
himoruuan Jota hftnen isftnsftrakasti. 

15. Ja Rebekka otti vanhemman 
poikansa Eteun parhaat vaatteet, jot- 
ka huoneessa hftnen tykOnftnsft oli- 
vat, ja puetti nuoremman poikansa 
Jaakobin niihin. 

16. Vaan vohlain nahat kftfiri hftn hft- 
nen kftsiinsfl ja paljaaseeo kaulaansa. 

17. Sitten antoi hftn sen himoruuan 
Ja leivftn, jonka hftn valmlstanut oli, 
poikansa Jaakobin kftteen. 

18. Ja hftn tuli isftnsft tykO,Ja sanoi: 
„isftni!** Hftn vastasi: ..tftssft olen. 
Kuka blet, poikani?*' 

19. Jaakob sanoi isftllensft: „minft 
olen EsaUiSiBunesikoisesi; mioAolen 



29 



1 MOOS. 27. 



niin tehnyt, kuiti sinft mihulle kfis* 
kit; nouse sHs, istu Ja syO minun 
saaliistani,«ttfl slniin sfelusi siunaisi 
minua.** 

20. Mutta Isaalc sanoi pojallensa: 
„minun poikani^ kuinkas olet nlin 
Qopiasti fOytfinyt?'' Ja hfin vastasi: 
tfHerra, sinunJumalas1,antoi minun 
sen kohdata.** 

21. Niin sanoi Isaak Jaakobille !',.tu- 
le tfinne, poikani,koetellakseni,olet* 
ko poikani Esau vai etkO.** 

22. Nifn Jaakob astui is2|nsft Isaa- 
kin tykO; ja kun hftn siveli hSntS, 
sanoi li^kn : „fifini on Jaakobin Sfini, 
muUa kfidet oval Esaun kfidet;'' ' 

23. eikfi hflq tuntenut hfintfi, sillft 
hfinen kiktensd olivat karvaiset, niin- 
kuin hfinen ve^ensfi Esaun kftdet; 
ja liftn siunasi hftntft. 

24. Ja hfin kysyi hfineltfi: ,»oletko 
minun poikani Esau?'* Hfin vastasi : 
„olen." 

25. Niin hfin sanoi: ,,tuo siis tftnne, 
ettfi sOisin poikani saaliista la mi- 
nun sieluni siunaisi sinUa.** Niin hfin 
toi sen hfiiielle, la hfin sOi. Hfin toi 
myOs h'finelie vimifi, ja hfin jof. 

26< Ja Isaak, hfinen isfinsfi, sanoi 
hfinelle: ^tule mrt liki, minun poi- 
kani, ja anna minun suiita.** 

27. Ja hfin astui liki ja antoi hfi- 
nen suuta. Niin^fin tunsi hfinen 
vaatteensa hajun, ja siunasi hftntfi, 

. ia sanoi : „katso, minun poikani ha- 
ju on hiinkuin kedon haju, jonka 
Herra on siunannut. Hebr. 1120. 

28. Jumalaantakoonsinulletaivaan 
kastetta ja maan lihavuutta, sekS 
yitfikyllfi jyvifi ja viihifi. 

29. Ransat palvelkoot sinua, ja su- 
kukunnat kumartakoot sinua. Ole 
sinun veljesi herra, ja sinun fiitisi 
lapset langetkoot sinun jalluii&i juu- 
reen! Kirottu oikoon se, jolia sinua 
kiroo, ja siunattu, joka sinua siu- 
naa!** i Moos. 12:3. 

30. Kun Isaak olipfifitlfinyt siunauk- 
sensa Jaakobille, ja Jaakob juuri 
oil Ifihtenyl isfinsfi Isaakin tykOfi, 
niin Esau, hfinen veljensfi, tuli met- 
sfistfimfistfi. 

31. Sitten valmisti hfin myOs himof 
ruuan ja vei isfillensfi, ja sanoi hfi-i 
nelle: „not|skaan isfini, ja syOkOGn 
poikansa saaliista, ettfi sinun slelusi 
siunaisi minua.'* . 

32. Niin vastasi Isaak, hfinen isfin- 
sfi, hfinlfi : „kukas olet?** hfin sanoi : 
„minft olen sinun poikasi , ■ csikoi- 
sesi Esau.'* 

33. Niin Isaak vapisi hfimmfistyk- 
sestfi sangen koyin ja sanoi : „kuka 
oil sitten se metsfimies, joka mitiul- 



le saaliin toi? minfi sdin liaikista,^ 
ennenkuin sinfi tulit, ja minfi ^iu- 
nasin hfinen; hfin on myds jfifipfl 
siunatuksi.** 

34. Kpn Esau kuuli isfinsfi puheen, 
valitti hfin kovalla fifinellfi, ja hfinen 
mielensfi kfivi sangen liatkeraksi ; ja 
hfin sanoi isfillensfi: „siunaa n^yos 
minuakin, isfini.** 

35. Mutta hfin vastasi: „sinttn vel- 
jesi on tullut kavaliiudella, ja vie- 
nyt pois siunauksen sinulta.*^ 

36. Silloin hfin sanoi : „hfinen ni- 
mensfihfin onkin Jaakob, ja lifin on 
nyt Icalisi kertaa minun pettfinyt. 
Minun esikolsuuteni hfin sal, fa kat- 
so, nyt hfin vei minulta pois siu- 
hauksenl.**. Ja hfin kysyi: „eikiS si- 
nuila ole yhtfifin siunausta minulle 
an taa ?* * . i Moos. 25:31 as. 

37. Niin vastasi Isaak ja sanoi Esa- 
ulle: „katso,- minfi olen a$ettanut 
hfinen sinun herraksesi, kaikki hfi- 
nen veljensfi olen minfi hfinelle pal- 
veiyaksi antanut, jyvillfi ja vilnillfi 
olen minfi hfinen varustanut; mitfi 
minfi siis nyt sinulle teen, poikani?** 

38. £saU sanoi isfillensfi: „yksikO 
vaan siunaus sinulla onkin, isfini? 
siunaa myOs minuakin, isfini 1** Ja 
Esaii rupesi fifineensfi itkemfifin. 

39. Silloin vastasi Isaak, hfinen isfin- 
sfi Ja sanoi hfinelle: „katso,asulnsijasi 
maanpfifillfieitaijoasinullelihavuut- 
ta eikfi liastetta ylhfifiltft taivaasta. 

40. Mutta miekallasi olet sinfi eifit- 
tfivft it^esi ja diet palveleva veUefisi. 
Ja tapahtuu, kun retkiltfisi palajat. 
ettfi sfiijet hfinen ikeensfiniskastasi.** 

41; Ja Esau alkoi vihala Jaakobia 
siunauksen tfihden Jonka hfinenisfiji^ 
sfi oil hfinelle antanut. . Ja, Esau sa- 
noi itseksensfi: „isflni murhepfiivfit 
Ifihestyvfit, siUfi minfi tapan veUeni 
Jaakobin.** Obad. v. lO. 

42. Kun Rebekalle ilmoitettiin, mi- 
tfi hfinen vanhempi poikansa Esau 
oil sanonut, kutsutti hfin luokseen 
nuoremman poikansa Jaakobin, ja 
sanoi hfinelle: „katso, veljesi Esau 
aikoo sinulle kostaa siten, ettfi hfin 
sinun tappaa. 

43. Niin kuule nyt, poikani. mitfi 
sinulle sanon: valmista itsesi japa- 
kene kohta veljeni Labanin tykO Ha- 
raniin ; 

44. ja ole hfinen tykOnfinsfi vfihfin 
aikaa.kunnes veljesi kiukkuasettuu. 

45. ja siihen asti, ettfi hfinen vihan- 
sa lakkaa sinusta, ja hfin unhottaa 
mitfi hfintfi vastaan tehnyt olet. Niin 
minfi sitten ifihetfin ja tuotan sinun 
sieltfi. Miksi kadottaisin teidfit mo- 
lemmat samalla kertaa?** 



30 



t MOOS. 27. as. as. 



46. J«Rebefcka*Bno1lM«ldIle: ,,mt- 
nfi olen tuullunui ellmHAni Hetin 
tyt<lrlen lahden. Jos Jaakob ollaa 
valmon Hetin tytiarislfl, Jolka oval 
nllnkutn nftmBliin IflraSn maan tyt- 
l&ria. milA minun sllleh on elBmSs- 
taiUl" lMi>o*.3tMH. 

28 Luku. 
Jukobln luko Labwiln luo. 

SilloiD Isaak kuisul polkanu Jaa- 
kobin ]a liunasl hints : ia hSn 
kflski, 3a sanoi hdnelle: „fiia ola val- 
mi» Kanaanin lyltBrlslfi, 
3. vaan nouse Ja mene Mesopota- 
Rilaaa, BelutliD, »inun Blllil hia, 
buoaeeseen, ta ola Itiellesl sfeliB 
valmo L«banin, slnun enosi, lyltfl- 
risia. Has. 13:12. 

3. Ja Jumaln kaikklvalUas ilunal- 
koon slnuB, Ja tehkMn siaua hedel- 
mfilliseksl Ja eneniakOOn slnun, nfin 
citft paljon kansoja slnusla tullsl. 

4. XntekooaHBninySssinulleAbra- 
hamin siunaukien, sinulle Ja slnun 
■iemencllesi linun kanisast. ellfl pe- 
rlslt sen maan, Josm muukalalsena 
olet, Jonka Jumals Abrahtiinllle on 
■ntanut." IMoo&lZSu IS:U>. 

5. Nlin Iflhetll Isaak Jaakobin 1y- 
kOfinsa menemflBn Mesopolamiaan. 
Labanin. syrialsUen Betuelln pojan 

gItO, loka oil Hebekan, Jaakobin Ja 
laun aidin, veil. 

6. Kun nyt Esau nSkl, cita Isaak 
oli liuDannut Jaakobin Ja IfihettB- 
nyt bSa«n Hesopolamlaan, ottamaan 
sldie IlKllensa vainion — eIIIB hfln 
(rii. slunannut hanlfl Ja kllskenyt, 
lanoen: ^a ola valmoa itsellesi 
Bauaanin lyttBrfsIA' — 

T. Ja kun hSn nflkl, eltB Jaakob oli 
uUlensfl Ja fildlllensB kuuUainen, Ja 
oienl fttesopotamlaan. 
t, nlln Esau ymmBrsi, ettel Isaak. 
hinen ItAiuB, volnul kflnlB Kanaa- 
nin IvIiariB. 

iln ty- 
,Abra. 



IS. Ja kaho, Herra teltoi yllnnS 
nilden pBBIia,Ja sanoi: „nilnaoten 
Herra, Abrahamtn, slnun isBsi, Ju- 
mala Ja Isaakln Jumala. TlmBn 
maan, Jonka pBalla makaat, annan 
mina ilnulle Ja stoun siemenelles. 
lHooB.H:L 

H. Ja ainun slemeneil onolevanlln 
kuin maan tomu, Ju sinfl levenel 
lanteen Ja ilBBn. pohiaan Ja elelflfin 
pBia. Ja sinussa Ja slnun sjemeneB- 
sfisi piiaa kaikkl sukukunnat maan 
pBBIIB slunatuksl luleman. 

IMoai.12^ M:1B. 23:17». &H«k119I). 
ObI. S:Ut. 

IE. Ja kalso. minB olen slnun kant- 
sasi, Ja varjelen sliiua. kuhunkaa 
ikBnfinsB Joudut, Ja saalan ainun 
jailensB IBhBn maahan ; sillB en mi* 
nB hylJBB sinua, kunnes olen kaikkf 
lehnyl, mllB minB sinulle puhunut 

IB, Kun Jaakob herBsf uneitansa, 
nlln hBn sanol: ,.totlsesll on Herra 
lassfl paikassa, enkB minB slltt tie- 
Ifinyl.'* 

17. Niin hBn pelkasi Ja sanol: .,IB- 
varmaaukln pyhB paikkaj 



Ifissfl tollsesti a: 



u Jumala, 



a IBssJ 



d^ttl Oljyfl sen pOBlle. 

IMooi. 31:13. KM. nUH. 

19. HBnkutsuf sen palkanBeleliksl; 
multa ennea mulnoln oli sen kau* 
punaln nlmt l^ua. 

30. Ja Jaakob lekl lupaukseii, m- 
noen: , Jos Jumala on mlnunkant- 
sant, Ja varjelee minua IBIIB tielii, 
Jola minB vaellan, sekS an,laa ml- 
nulle lelpaa syOdBksenI, Ja vaatella 
verhoksenl. lAlk-laD. 

21. Ja minB pBBseii lulemaan rau- 
hassa kolla isBni lykO, nfla on Uec 
ra dieva minun Jumalanl: 

22. Ja IBma klvl. jonka minB panin 
pyslyyn mulslopalsaaksi, on luleva 
Jumalan huoneeksl;Ja kalklsta, ml- 
la minulle annal. annan mlaB loU- 
tesll sinulle kymmeneksit." 

SMOOL 31:31m. 

39 Luku. 
Jostabln palveltii labanln luoua. 

J a Jaakob IfiMi matkaan Ja lull 
Iiamallle. 
2. SlellB sal hBu nBhda kalvon ke> 
dolla. Ja kalso, kalvon luonn ma- 
kasl kolme lammaalaumaa, sillB sli> 



1 MOOS. 29. 



3. Sinne koottiin alna kaikki laumat, 
ja sitten vieritettlin kivi kaivon suul- 
ta« ja iuotettiin lampaat, ja vieri- 
tettun Kivi jfilleen kaivon suulle. 

4. Ja Jaakob sanoi miehille: „vel- 
Jeni, kusta te olette?'* he vastasivat: 
„Haranista ollaan." 

5. Hfin sanoi heille: „tunnetteko 
Labanin, Nahorin pojan?*' he vas- 
tasivat: ^tunnemme kyllA.** 

6. HSn kysyi edelleen : „voiko hfin 
hyvin?** he vastasivat: „kyllfi hfln 
on terveenfl. Ja katso, tuossa tulee 
Rakel, hfinen tyttflrensA, lammasten 
kanssa/* 

7. Niin h^n sanoi: ^katso, vielfi on 
paljo pfiivda, eikfi vielft ole aika kar- 
jaa koota; niin juottakaat siis lam- 
paat, ja ajakaat ne laitumille/* 

8. Mutta hesanoivat: „emme taida 
sitfi tehdfi ennenkuin kaikki laumat 
kokoontuvat, ja kivi vicritetddn kai- 
von suulta; sitten me juotamme 1am- 
paal." 

9. Vielfi hfinen puhutellessaan hei- 
tft,tuli Rakel isfinsfi lammasten kans- 
sa; siilil hfin kaitsi lampaita. 

10. Kmi Jaakob nSkiRaKelin,enon- 
sa Labanin tyttAren , ja enonsa La- 
banin lampaat, niin meni hfin ja 
vieritti kiven kaivon suulta, jajuot- 
ti enonsa Labanin lampaat. 

11. Ja Jaakob antoi Rakelin suuta 
ja rupesl itkemSfin. 

12. Ja Jaakob ilmoitti hfinelle, ettfi 
hfin oil hSnen isfinsfi sukulainen 
ja Rebekan poika. Niin Rake] juok- 
si ja ilmoitti sen isSlIensfi. 

13. Mutta kun Laban kuuU sano- 
man Jaakoblsta, sisarensa pojasta, 
riensi hfin h&ntft vastaan, ja otti 
hfinen syliinsfi, antoi hfinen suuta, 
ja vei hfinen huoneesensa; ja hfin 
kertoi Labanille kaikki mitfi hfinel- 
le oil tapahtunut. 

14. Niin sanoi Laban hfinelle: „si- 
nfihfin olet minun luuni ja lihani.'' 
Ja hfin oil hfinen tykOnfinsfi koko 
kuukauden. Tuom. 9:2. 

15. Sitten sanoi Laban Jaakobille: 
„sinfihfin olet minun sukulaiseni; 
mutta palvelisitko sentfihden minuu 
llman palkkaa? Sano, mitfi tahdot 
Dalkaksi ** 

16. Ja Labanilla oil kaksi tylfirtfi; 
vanhemman nimi oil Lea, ja nuo- 
remman nimi oli Rakel. 

17. Mutta Lea oii heikkosilmfiinen; 
vaan Rakel oli soreakasvuinen ja iha- 
namuotoinen, ja ihana kasvollta, 

18. JaJaakobrakastiRakeiia; sentfih- 
den hfin sanoi: „minfipalvelensinua 
seitsemfin ajastaikaa Rakelin, nuo- 
remman tyttftresi tfihden.*'Ho8. 12*^3. 



19. Laban vastasi: t,parempi on.et- 
tfi minfi hfinen annan sinulle, kuin 
jollenkin toiselle. Ole minun tykd- 
nfini." 

20. Niin palveU Jaakob RakeUn tfih- 
den seitsemfin ajastaikaa; ja ne oii- 
vat hfinestfi niinkuin muutamat pfii- 
vfit, sillfi hfin rakasti Rakelia. 

21. Ja Jaakob sanoi labanille: „an- 
na nyt vaimoni minulle, sillfi aika 
on tfiytetty; anna minun mennfi hfi- 
nen tykOnsfi." 

22. Niin Laban kutsui kokoon sen 
paikkakunnan miehet ja piti hfifit. 

23. Mutta ehtoona otti hfin tyttfiren- 
sfi Lean, ja vei sen Jaakobin tykd; 
ja hfin raakasi sen tykdnfi. 

24. Ja Laban antoi tyttfireilensfi Le* 
alle piikansa Silpan piiaksi. 

25. Aamulla nfiki Jaakob, ettfi se 
olikin Lea. Silloln hfin sanoi Laba- 
nille: „miksi tfimfiii minulle teit? 
enk^ minfi Rakelin tfihden palvellut 
sinua? miksi minun petit?'* 

26. Niin vastasi Laban: „ei ole mei- 
dan maan tapa, ettfi nuorempi an- 
neiaan ennen vanhempaa. 

27. Anna nyt tfimfin hfifiviikon ku- 
lua umpeen; sitten annan sinulle 
sen toisenkin,jos palvelet mmua vie- 
Ifi toiset seitsemfin ajastaikaa.'* 

28. Jaakob suostui siihen ja antoi 
Lean hfifiviikon kulua umpeen; sit- 
ten antoi hfin hfinelle myds tyttfiren^ 
sfi Rakelin vaimoksi. 

29. Ja Laban antoi tyttfireilensfi Ra- 
kelille piikansa Bilhan piiaksi. 

30. Niin hfin makasi myOs Rakelin 
kanssa, ja piti Rakelia rakkaampana 
kuin Leaa ; ja hfin palveli Labania 
vielfi toiset seitsemfin ajastaikaa. 

31. Mutta kun Herra nfiki, ettfi Le- 
aa pidettiin halpana, niin teki hfin 
hfinen hcdelmfiliiseksi ; mutta Rakel 
oli hedelmfitdn. 

32. Niin Lea tuli raskaaksi ja syn- 
nytti poian, ja antoi hfinelle nimen 
Ruben, ja sanoi: „Herra on katso- 
nut minun ahdistustani, ja nyt on 
mieheni rakastava minua^'* 

33. Ja hfin tuli taas raskaaksi, ja 
synnytti pojan, ja sanoi: „Herra 
on kuuUut minua pidettfivfin hal- 
pana, ja sentfihden on Hfin myOs 
tfimfin minulle antanut.** Ja hfin an- 
toi hfinelle nimen Simeon. 

34. Ja hfin tuli jfilleen raskaaksi ja 
synnytti pojan, ja sanoi: „nyt minun 
mieheni pysyy minun tyic6nfini; sil- 
lfi minfi synnytin hfinelle kolmepoi- 
kaa.'' Sentfihden ^nnettiin hfinelle 
nimi Levi. 

35. Ja hfin tuli vielfi raskaaksi, ja 
synnytti pojan, ja sanoi: „nytmiu2i 



32 



1 MOOS. 29. 30. 



kiilfin Herraa.*' Sent&hden antoi 
hSn hSnelle nimen Juuda. Sitten 
lakkasi hfin synnyttftmflsta. 

30 Luku. 

JaakoUn muut lapset. Jaakobille karttuu 
omaisuutta. 

Kun Rakel ndki, ettci hAn saanut 
lupsia Jaakobisla, kadehti hSn 
sisartansa,jasanoi Jaakobille: „han- 
ki minulle lapsia, taikka kuolen.'* 

2. SilloinJaakob vihastui kovinRa- 
kcliin ja sanoi: ,,olenko mindJuma- 
lan sijassa, joka on sinulta kieltft- 
nyt kohdun hedelmSn?*' 

3. Mutta Rakel sanoi: «,ti&ss3 on mi- 
nun piikani Bilha, makaa hSnen 
kanssansa, etti& hdn synnyttflisi mi- 
nun helmaanl, ja minfi saisin lapr 
sia hdnestS/' 1 Moos. 16:2. 

4. Niin hfln antoi hJlnelle piikansa 
Biihan valmoksi, ja Jaakob makasi 
hilnen kanssansa. 

5. Niin Bilha tuli raskaaksi ja syn- 
nvtti Jaakobille pojan. 

I. Ja Rakel sanoi: f,JumaIa ratkai- 
si minun asiani, ja kuuli minun Sft- 
neni,ja iintoi minulle pojan.** Sen- 
tfthden nimitti hSn hfinen Dan. 

7. Ja taas Bilha, Rakelin piika, tuli 
raskaaksi ja synnytU Jaakobille toi- 
sen pojan. 

8. Niin sanoi Rakel : „minft olen ja- 
losli kilpaillut sisareni kanssa, ja 
olen voittanut.** Ja hfin antoi hftnel- 
le nimen Naflall. 

9. Kun Lea nflki, ettfl hdn lakkasi 
synnyttflmdstfi.otti hfin piikansa Sil- 
pan ja antoi hflnen Jaakobille vai- 
moksi. 

10. Niin synnytti Silpa, Lean piika, 
Jaakobille pojan. 

II. Ja Lea sanoi: „onneksir* ja an- 
toi bSnelle nimen Gad. 

12. Ja Silpa , Lean piika, synnytti 
Jaakobille toisen pojan. 

13. Niin Lea sanoi: ^ol, autuasta 
minua! sillfl immet kiittSvfit minua 
autuaaksi.** Ja bUn nimitti hSnen 
Asseriksi. 

14.NUnRuuben men! ulos nisun kor- 
Juun aikana, ja lOysi lemmenmar- 
loia vainJolta ja toi ne fiidillensn Le- 
aUe. Niin sanoi Rakel Lealle: ,, an- 
na minulle poikasilemmenmaijojat* 

15. Mutla hfin vastasi h&nlfi: ,,eikd 
io riilil, ettfi olet minulta miehen 
vienyt; (ahdolko nyt ollaa poikani 
leronieDmarjal?** Niin Rakel sanoi: 
uhyvS, maatkoon hfin Iftoft yOnS si- 
000 kanssasi poikasgl lemmenmar- 



lasi, men! Lea hfintil vastaan ja sa- 
noi: „minun kanssani pitfifi sinun 
makaaman, sillft minft olen sinun 
kalliisti ostannt poikani lemmen- 
maijoilla.** Ja hfin makasi sen yOn 
hftnen kanssansa. 

17. Ja Jumala tfiytti Lean toivomuk- 
sen, ja hSn tuli raskaaksi ja syn- 
nytti Jaakobille viidennen pojan 

18. Niin Lea.sanoi: «,Jumalaonpal- 
kinnut sen minulle, ettS minfi an- 
noin piikani miehelleni.** Ja hdn 
antoi hftnelle nimen Isaskar. 

19. Ja Lea tuli taas raskaaksi, jasyn- 
nyttiJaakobille kuudennen pojan. 

20. Ja Lea sanoi: „Jumala on mi- 
nulle byvdn lahjan antanut: nyt on 
mieheni pysyvS minun tykOndni, 
silld minfi olen synnyttdnyt hfinelle 
kuusi poikaa.** Ja h9n nimitti hdnen 
Sebuloniksi. 

21. Sitten synn^rtti h&n tyttfiren, ja 
antoi hflnellc nimen Dina. 

22. Mutta Jumala muisti myOs Ra- 
kelia ; ja Jumala kuuli hfintfi ja saat- 
toi hhnen hedelmfilliseksi. 

23. Niin hSn tuli raskaaksi, ja syn- 
nytti pojan, ja sanoi: „JumaIa on ot- 
tanut pois minun ylenkatsceni.** 

24. Ja hfin pani hfinelle nimen Jo- 
sef, sanoen: „Herra lisfitkdOn mi- 
nulle vielfi toisen pojan.** 

25. Sen jfilkeen kun Rakel oli syn- 
nyttfinyt Josefin, sanoi Jaakob La- 
banille: „salli minun Ifihteft kotiini 
ja omalle maalleni. 

26. Anna minulle vaimoni ja lap- 
seni, joiden tfihden olen sinua pal- 
vellut, ja anna minun IShtefi pois; 
siqfihfin itse tiedfit, kuinka olen si- 
nua palvellut.** IN008. 31*^88. 

27. Ja Laban sanoi hfinelle : „anna 
minun saada suosiota sinun edes- 
sfisi, sillfi minfi ymmfirrfin, ettfi Herra 
on siunannut minun sinun tfihtesi.'* 

28. Ja hfin sanoi vielfi : „mfifirfifi siis 
sinun palkkasi, ja minfi sen annan'* 

29. Hfin vastasi hfinelle: „^infi tie- 
dfit, kuinka minfi olen palvellut si- 
nua, ja mi ten karjasi on karttunut 
minun hoidossani. 

30. Sillfi perati vfihfisen oli sinulla 
minun tuliessani, muttanytseonpal- 
joksikasvanut.ja Herra on siunannut 
sinut, mihin vaan minun toimeni u- 
lottui.Milioin minfi sitten saanruvela 
katsomaan onian huoneeni parasta?'* 

31. Laban sanoi: „mitfi mmfi sinul- 
leannan?** Mutta Jaakob sanoi: „ei 
sinun tarvitse minulle mitfifinantaa. 
Mutta jos teet, niinkuin nyt sinulle 
sanon, niin minfi vielfi edelleen kait- 
sen ja hoidan sinun laumaasi. 

32. Minfi kfiyn tfinfipfinfi kaiken si- 



[FbnhhJ S 



d3 



1 MOOS. 30. 31. 



nun laumasi lApllse, ja eroitan siel- 
Id kaikki pilkulliset ja kirjaval, sekd 
kaikki hallavat karitsain seassa etlS 
kirjaval ja pilkulliset vuohten seas- 
sa; semmoiset olkoot minun palk- 
kani. 

33. Ja kun vaslaisuudessa tulet omin 
silmin katsomaan, mik5 on minun 
paJkkani. on minun hurskauleni to~ 
distava minusta. ja kaikki. jolka ei- 
vdt ole pilkulliset taikka kirjavat 
vuohista eikd hallavat lampaista,pi- 
tns katsottaman varastetuiksi.'* 

34. Niin sanoi Laban: ,,hyv9, ol- 
koon niinkuin olet sanonut!*' 

35. Ja sind paivdnS eroitii Laban 

Eilkulliset ja kirjaval kauriitjakaik- 
i pilkulliset ja kirjavat vuohet, 
kaikki. joissa jotakin valkoista oli, 
ja kaikki hallavat karitsat, ja antoi 
ne poikainsa hoitoon. 

36. JahfinasettikolmenpSivanmat- 
kan itsensft ja Jaakobin vdlille. Ja 
Jaakob kaitsi Labanin jddnyltd lau- 
maa. 

37. Mutta Jaakob otti tuoreita rai- 
taisia, mantelipuisia ja vaahteraisia 
sauvoja ja kuori niihin valklat juon- 
teet, paljastain puun valkian plinnan. 

38. Sittenpanih^nsauvat, jolka h3n 
kuorinut oli, laumain eteen vesiruu- 
hiin ja juomaastioihin, joista he joi- 
Vat; ja heillS oil juuri kiima-aikan- 
sa, kun tulivat juomaan. iMoo8.3i:i2. 

39. Ja niin laumat siittivdt sauvain 
33ress3, ja niin tulivat sikiOt pilkul- 
lisia, iuonteisia ja kirjavia. 

40. Sitten Jaakob eroitti karitsat, ja 
asetti eldinten silmdt Labanin lau- 
massa pilkullisiin ja hallaviin p§in; 
ja niinmuodoin han teki itsellensS 
oman lauman, eikd laskenut niitd 
Labanin laumaan. 

41. Ja kunvoimakkaammateldimet 
olivat kiimaisillaan, pan! Jaakob sau- 
vat laumain silmAin cteenruuhiln« 
niin ett^ he siitinisivi^t sauvain M- 
ressd. 

42. Mulla kun heikommat elSimet 
kiimailivnt, niin h[\n ei niitS pan- 
nut. SillfV tavalla tulivat heikommat 
elAimet Labanille ja volm'akkaam- 
mat Jaakobille. 

43. Silts lull mies sangen 3veri3fik- 
si, niin ettA hanellS oil paljon 1am- 
paita sek§ piikoja ja palvelijoita, 
kameleja ja aaseja. 

31 Luku. 
Jaakob pakenee Labanin luota. 

Mutta hfin sal kuuUa, ettn Labanin 
pojat puhuivat ja sanoivat : „Jaa- 
l(Ob on saattanut Itsellensa kaiken 



isfimme tavafain; ja siitfi meiddn 
isflmme tavarasla on h9n saattanut 
itsellensa kaiken tSmdn omaisuu- 
den.*' 

2. Ja Jaakob nSki myOs,ettei Laban 
katsellut hSntS samoilla silmilJd 
kuin ennen. 

3. Silloin Herra sanoi Jaakobille : 
.,palaja isSisi maalle ja sukusi tykO ; 
ja mind olen sinun kanssasi.** 

4. Niin Idhetti Jaakob ja kutsui 
Rakelin ja Lean kedolle laumansa 
tykO, 

5. ja sanoi heille:«,mind nden, ettei 
isdnne katsele minua samoilla sil- 
millS kuin ennen, vaikk'a kuitenkin 
minun isfini Jumala on ollut mi- 
nun kanssani. 

6. Ja le itse tiedStte, ettS minfi olen 
kaikellavoimallanipalvcllutisdSnne. 

7. Mutta isdnne on pettdnyl minun 

1'a muuttanut minun palkkani jo 
Lymmenen kertaa. Jumala ei kui- 
tenkaan ole sallinut hdnen tehdil 
mitdfin vahinkoa minulle. 

8. Kun hdn sanoi: .kirjaval olkoot 
sinun palkkasi\ niin kaikki lauma 
kantoi kirjavia. Mutta kun hdn sa- 
noi: ^pilkulliset olkoot sinun palk- 
kasi\ niin kaikki lauma kantoi pil- 
kullisia. 

9. Niin on Jumala ottunut isdnne 
lavaran, ja antanut minulle. 

10. Kun siittdmisen aika tuli, nos- 
tin mind silmdni ja ndin unessa, ja 
katso, kauriit, jotka nousivat lau- 
man pdfllle, olivat juonteiset, pilkul- 
liset ja kirjavat. 

11. Ja Jumalan Enkeli sanoi minul- 
le unessa: „Jaakob!" ja mind vas- 
tasin: „tdssd mind olen.'* 

12; Silloin hdn sanoi: ^.nosta sil- 
mdsi ja katso, kaikki kauriit, iotka 
nousevat lauman pddlle, oval juon- 
teiset, pilkulliset ja kirjavat; silld 
mind olen ndhnyt kaikki, mild La- 
ban sinulle tekee. 

13. Mind olen Jumala, jonka ndit 
Betelissd, jossa voitelil kiven, {a jos- 
sa teit minullelupauksen; nousesiis 
nyl ja Idhde tdltd maalta, ja pala- 
ja syntymdmaahasl.** 

1 Moos. 28:1288. 32:0. 

14. Niin vastasivat Rakel ja Lea.ja 
sanoivat hdnelle: „onkomeilld ennd 
osaa tai perimistd isdmme huonees- 
sa? 

15. Eik6 hdnolepltdnytmeitdmuu- 
kalaisina? Silld hdn on myynyt mei- 
ddl, ja perdti syOnyt meiddn hm- 
tamme. 

16. Sentdhden kaikki tavara. jonka 
Jumala on ottanut meiddn isdllfim- 
me, meidftn se on ja meidflm lastem- 



34 



1 MOOS. 31. 



me. Tee siis kaikki. niUft Jumala si- 
nulle on kfiskenyt.^' 

17. Silloin nousi Jaakob ja nosli lap- 
sensajavainionja kamelein selkitdn. 

18. Ja vei pois kaiken karjansa. ja 
kaiken tavaransa, jonka oli koon- 
nut, sen oman karjansa, kuin hdn 
oli saanut Mcsopolamiassa, mennflk- 
se^sd isSnsil Isaakin tykd Kanaan- 
maalle. 

19. Multa Laban oli mennyt kerit- 
semdUn laumaansa; niin l^akel va- 
rasli isfinsa huone-jumalat. 
Tuom. 17*.5. 18:14, 17. 1 Sam. 19:13. Ho8. 3:4. 

20. Ja Jaakob ISksi varkain pois 
syrialaisen Labanin luola, silld tiAn 
ei ilmoittanut liSnclIe, etlfl hftn pa- 
keni. 

21. Niin hdn pakeni, ja kaikki, mi- 
ld h^inellS oli, nousi ja meni virran 
ylitse; ja h3n ohjasi matkaansa Gi- 
leadin vuoria konden. 

22. Kolmantena p&ivflnS sai Laban 
tiet&S, ettH Jaakob oli paennut. 

23. Niin hdn otti veljens(( kanssan- 
sa, ja ajoi tiSntfi takaa seitsemiin 
p&lvfikauden matkan; ja h&n saa- 
vutti hSnet Gileadin vuorella. 

24. Mutta Jumala oli tullut syria- 
laisen Labanin tykO yOlIS unessa, ja 
sanonut h^inelle: „vuro itsedsi, ettet 
puhu Jaakobia vastaan, oil se milii 
hyvansfl." 

25. Ja Laban Ifihestyi Jaakobia. Mul- 
ta Jaakob oli niajansaasettanutvuo- 
relle. Ja Laban veljinensfiasetli my5s 
majansa Gileadin vuorelle. 

26. Niin sanoi Laban Jaakobille: 
„mikd teko Uimfi on, cttfi varkain 
Uksil luotani, ja veil mukanasi tyt- 
tiireni, nlinkuin ne olisivat miekalla 
voilelut? 

27. Ja miksi salaa pakenit ja var- 
kain laksit luotani? K«n et sitA il- 
moittanut, niin en voinut'sfnua saat- 
taa matkalle iloUa, lauluilla, trum- 
puilla ja kanteleilla. 

28. Ja sinA et sallinut minun cdes 
suuta antuu lasten lapsilleni ja tyt- 
lurilleni. SinA olet tyhmSsti tehnyt. 

29 Ja minulla olisi kylla voimaa 
tchdil teille pahaa ; mutia teidJln isfin- 
ne Jumala sanoi mcnncenfl yOnami- 
nuller ,varo itseAsi puhumasta Jaa- 
kobia vastaan, oli se mitA hyvAiisA !' 

30. Ja kun nyt kumminkln lAksit 
pois, koska niin suuresti ikAvOitsit 
isAsi huoneesen, miksi varaslit mi- 
nun jumalani''** , ^ , 

31. Silloin vastasi Jaakob ja sanoi 
Labanille: „minfi pelkAsin, ja luu- 
Hn sinun vAklvallalla ottavan pois 
minultfl lyttflresi. 

32. Multa jonka tykdft sinft lOydAt 



junudasi, ci sen pidA efAmAn. Mei- 
dAn veljiemme lAsnA ollessa voit 
katsclla, onko minun tykOnAni mi- 
tAAn sinun omaasi, ja ota se pois.'* 
Multa ei Jaakob tielAnyt Rakelin 
niilA varastaneen. 

33. Niin Laban meni Jaakobin ma- 
jaan. Lean majaan ja heldAn mo- 
lempain piikainsa majaan, mutta ei 
lOylAnyt mitAAn. Ja hAn lAksi Lean 
majasta ja lull Rakclii^ majaan. 

34. Mutta Hukel oli otipnut huone- 
jumalat ja |)annut kamelinsatulaan 

ia istui sen pAAllA; ja Laban etsi 
Laiken majan, eikA 15ytAnyt. 

35. Ja hAn sanoi isAIlensA : „A1A vi- 
hastu, herrani, etten saala nousta 
sinun edessAsi, sillA minulla ovat 
vaimoin menot.'* Ja Laban etsi, ei- 
kA IdytAnyt huonejumaliunsa. 

1 Muos. 18:11. 
30. Silloin Jaakob vihastui, ja soi- 
masi Labania: hAn puhui ja sanoi 
hAnelle: „mikA on rikokseni, mitkA 
pahattekoni,kun niin vihamiclisesti 
olet minua ajanul takaa? 

37. SinA olet kalsellul kaikki minun 
tavaruni ; mitA olet lOytAnyt kaikista 
sinun talosikaluista?TuoselAhAn mi- 
nun ja sinun velleisi eteen, etlA he 
ratkaisisivat meidAn kahden vAiillA. 

38. MinA olen ollut sinun lykOnAsi 
jo kaksiky mmentA ajaslaikaa, ja 1am- 
paasi ja vuohesi ei ole hedelmAtlO- 
niAt olleet; en ole minA syOnytoinai- 
ta sinun laumastasi; 

39. enkA ole tuonut sinulle pedolta 
haaskattua; mutta minun lAylyi se 
maksaa, sen olet minun kAaeslAni 
vaatinut; samoin myOs milAikAnfin- 
sA sinulta pAivAlIA tahi ydllA oli va- 
rastettu. 2 Moos. 22:12 s. 

40. Palveluksessasi on minua raslt- 
tanut helle pAivAIIA ja vilu ydllA, ja 
uni on paennut minun silmistAni. 

41. MinA olen jo kaksikymmenlA 
ajaslaikaa ollut huonecssasi, neljA- 
loisla ajaslaikaa palvelin sinua kali- 
den tytlArcsi IAhden,'ja kuusi ajas- 
laikaa laumasi lAhden; mulla sinA 
olet muuttanut palkkani kymmenen 
kertaa. 

42. JoUei minun isAni Jumala, Ab- 
rahamin Jumala, jota mv^s Isaak 
pelkAA, olisi ollut minun\>uolella^ 
ni, niin sinA olisil minun pAAslAnvt 
perAtityhjAnA. Mutta Jumala on nAh- 
nyt minun vaivani ja kAtteni tvdt, 
ja nuhteli sinua menneenA yOnn.** 

Jes. 8:13. 

43. Niin vastasi Laban ja sanoi Jaa- 
kobille: „tyttAreloval minun tylt Are- 
ni, ja pojal ovat minun poikani, fa 
laumat ovat minun laumani.jakaik- 



35 



1 MOOS. 31. 32. 



ki kuin sinfi nfiet ovat minun; mitd- 
pft minft voisin tehdfi tfinfipSn& tyt- 
tflrilleni ja heiddn lapsillensa, jotka 
he oval synnyttSneet?! 

44. Tule siis nyt ja tehkHAmme lift- 
to' keskenAmmc; ja se oikoon lodis- 
tuksena minun ja sinun vflliliasi.'' 

45. Niin otti Jaakob kiven ja pani 
pvstv>'n muislopatsaaksi. 

46.JaJaakobsanoi veljillensS: „koot- 
kaat kivifi.'* Ja he toivat kivia ja 
Iekiv5t roukkion; ja he atrioitsivat 
siinfi sen roukkion pflSlia. 

47. Ja Laban antoi sille nimen Je- 
gar sahaduta;*muUa Jaakob nimit- 
ti sen Gilead. 

48. Niin Laban sanoi: „t3m3 rouk- 
kio oikoon lodistus tdn9p3n3 minun 
ja sinun vniillfisi." Siilfi sai se ni- 
men Gilead, 

49. multa myOskinMispa; sillS hdn 
sanoi: „Herra oikoon valvoja sinun 
ja minun vfllilld, kun erkanemme 
toinen toiseslamme. 

50. Jos sind vaivaat minun tyttd- 
ridni,taikkaolalmuitavaimoja,pait- 
.si minun lytOridni, niin tiedS,vaik- 
ka ei yhtd5n ihmista olisi lAsnd, et- 
tii Jumala on todistaja minun ja 
sinun vSlillfisi.'' 

51. Ja Laban sanoi viel3Jaakobille: 
„katso« t5md roukkio ja l3mS muis- 
topatsas, jonka minft panen minun 
ja sinun vAlillesi, 

52. tdmil roukkio oikoon todistus, 
ja lamd patsas oikoon todistus, elten 
minA kdy lAmAn roukkion ohi sinun 
tykOsi, etkA sinA kAy lAmAn rouk- 
kion ja lAmAn patsaan ohi minun 
tykOni vahinkoa tekemAAn. 

53. Abrahumin Jumala ja Nahorin 
Jumalu« joka oli heidAn isAinsAkin 
Jumala, oikoon tuomari meidAn vA- 
lillAmme.*' Ja Jaakob vannoi hAnen 
kuuUansa, jola hAnen isAnsA Isaak 
pelkAsi. 

54. Ja Jaakob uhrasi leurasuhrin 
vuorella ja kutsui sukulaisensa ate- 
rialle kanssansa. Ja kun he olivat 
syOneel, olival he y6lA vuorella. 

55. MuMa aamulla varhain nousi 
Laban. ja kun hAn oli suuta anta- 
nut lastenlastensa ja lytArlcnsA, siu- 
nasi hAn heitA, ja lAksi matkalle 
Icotiansa jAlleen. 

32 Luku. 

Jaakob varustaikse kobtaaroaan Esauti. 
H&D^n taistelunsa Jumalan kanssa. 

Mutta kun Jaakob malkusti tielAn- 
sA mydten, tulivat Jumalan en- 
kelit hAntA vastaan. 
2. Ja kun hAn nAki heidAt, sanoi 



hAn: „tAmfi on Jumalan sotajoukkol* 
Ja hAn antoi sille paikalle nimen 
Mahanaim. 2KaD.6:i7. Ps.34:8. 

3. Ja Jaakob lAhetti .sanansaattajat 
edellAnsfi veljensfi Esaun tykO, Sei- 
rin maakunfaan, Edomin maalle, 

4. ja kdski heitA, sanoen: „sano- 
kaat nAin herralleni Esauile: ,nAin 
sanoo sinun palvclijasi Jaakob: mi- 
nA olen ollut muukalainen Labanin 
lykOnA ja viipynyt siellfl tAhAn asti ; 

5. ja minulla on karjaa, aaseja, 
lampaita, palvelijoita ja piikoja. Ja 
nyt lAhetin ilmoittamaan tAtA her- 
ralleni,eltA saisin suosiota edessAsi*.** 

6. Kun sanansaattajat palasivat Jaa- 
kobin tykA, sanoivat he: „me koh- 
tasimme sinun veljesi Esaun; jahdn 
tulee sinua vastaan, Ja neljasataa 
miestA hAnen kanssansa.** 

7. Niin Jaakob peljAstyl kovin, la 
ahdistus tuli hAnen pAAllensA; ja 
hAn jakoi vAen, joka oh hAnen kans- 
sansa, sekA lampaat, ja karjan ja 
kamelit kahteen joukkoon. 

8. SillA hAn ajatteli: „jos Esau tu- 
lee toisen joukon pAAlle, ja lyO sen, 
niin jAAnyt joukko voi paeta.** 

9. Ja Jaakob sanoi: „minun isAni 
Abrahamin Jumala, ja minun isAni 
Isaakin Jumala, Herra, joka sanoit 
minuUe: ,palaja maallesi ja sukusi 
tykO, niin minA teen sinulle hyvAA,* 

1 Moos. 31:13. 

10. minA olen mahdoton kaikkcen 
siihen armoon, ja kaikkeen siihen 
uskollisuuleen, jonka olet palvelijal- 
lesi osoittanut. SillA kun tAmAn 
Jordanin ylitse menin, ei minulla 
muuta ollut kuin minun sauvani; 
mutta nyt olen minA kasvanut kah- 
deksi joukoksi. 

11. Pelasia nytminua veljeni Esaun 
kAsistA; sillA minA pelkAAn hAnen 
tulevan ja lydvAn minut sAAstAmAt- 
tA AitejA ja lapsia. 

12. SinA olet Use sanonut: ,min5 
teen- sinulle paljon hyvAA, ja lisAAn 
sinun siemcnesi niinkuinsnnnan me- 
ressA, jola paljouden tAhdcn ei voi 
laskea." iMoo?. 2$!i. 

13. Ja hAn oli ydtA siinA, ja olli kA- 
sillA olevasta omaisuudcstaan ja lA- 
h^tti lahjoja veljellensA Esauile, 

14. kaksisataa vuohta,ja kaksikym- 
menlA kaurisia, kaksisataa lammas- 
la ja kaksikymmenIA jAArAA, 

15. kolmekymmentA imcttAvAA ka- 
melia varsoinensa, neljAkymmcntA 
lehniAA jn kymmenen hArkAA, seka 
kaksikymmenIA aasia ynnA niilten 
kymmenen varsaa. 

16. Ja hAn anioi nAmA palvelijoit- 
tensa johloon, kunkin lauman erik- 



36 



1 MOOS. 32. 33. 



sens9Jasanoi pnlvelijoillensn: ,.inen- 
ka5i ininun edelhlni* ja pildkdiit vfl- 
limalka laumojen vfililld/' 

17. Ja hdn kitski ensimmniselle, sa- 
noen:,.kunveljeniEsaiikohtnasinun 
ja kysyy sinulla« .kenenkil palvelija 
olel.'ja kuhunka mcnel? ja kcnen- 
kfi nfiniil einimcl oval, joita ajat e- 
ileliasir 

18. niin sano: ,nnmA oval palve- 
'lijasi Jaakobin lalijat, jotka IiAii id- 

helinsl hcrrallcni Esaulle; ja kalso, 
hfin tulec Use meidAn jiHissHmmc." 

19. Saniotn k5ski hiin my6s toiscUc 
ja kolmannelleja kaikillc niillc, jol- 
ka ajoivat laumaa, sanoen: ^nHnid 
ininun sanani puhukaal Esaulle, kun 
le hSnen kohlaatte. 

20. Ja sanokaat myOs: ,katso,sinun 
palvelijasi Jaakob tulee meidHn j3- 
lissammet* Sillil hiln ajalteli: „mina 
lepyirm hilnen latijoilla, jolka edel- 
lilni menevfit; sitletahdonminAnnii- 
dA lifinen kasvonsa, ehk5 hAn otlaa 
minua vastaan y.slAvfll]isestr.*' 

21. Niin lalijal menivdl liSncn cdel- 
ldns3; mutta ilse oil hAn siinA yO(A 
joukkoinensa. 

22. Mutia ydllA hAn nousi ja otii 
kaksi vaimoansa ja nc kaksi pii- 
kaansa, ja yksiloistakymmenlA las- 
lansa, ja mcni Jabbokin luotuspai- 
kan yli. 

23. HAn otli nc ja vei heidAt virran 
vlilse, ja vei rayds ylllsc kaikki, mi- 
lA hAnellA oli. 

24. MutIa Jaakob jAi sille puolelle 
vksindnsS. Silloin |)aineli yksi mles 
hilnen kanssansa aina aamuruskon 
nousuun asti. 

25. Ja kun hAn nAki, etlci hAn voil- 
lanul hAnlA,tarttui hAn hAnen ronk- 
kaluuhunsa, niin ctlA Jaakobin ronk- 
kaluun pAA nyrjAhtyi painellcssa hA- 
nen kanssansa. 

26. Ja mies sanol: t.pAAslA minua, 
sillAaamuruskonousee.** Mutta hAn 
vastasi : ,,en minA pAAstA sinua, jol- 
lei siunaa minua." 

27. Niin hAn sanoihAnellc: „mikA 
sinun nimesi on?'* hAn vastasi: „Jaa- 
kob.** 

28. Hiln sanoi : „ei sinua enAA pidA 
kulsullaman Jaakob, vaan Israel on 
nimesi oleva, sIllA sinA olel taislel- 
lul Jumalan ja Ihmlsten kanssn, ja 
olel voitlanut.*' 1 Moos. 35:10. 

29. Niin Jaakob kys^i hAnellA, ja 
sanol: „sanos nyt smun nimesi." 
Nulla hAn vastasi: «,miksi mhiun 
oimeikni kysyt?" Ja liAnsiunaslhAn- 
lA silnll Daikassa. Tuoin.i3:i7ss. 

30. Ja Jaakob anioi sille paikalle 
nJmen Pniel: ..siUft/' sanoi hAn: 



„minA olen n Ahny I Jumalan kasvois- 
ta kasvoihin, ja olen pelastanut sie- 
luni." 

31. Ja kun hAn Pnielin ohitse kA- 
vi, nousi aurinko, ja hAn ontui rci- 
deslAnsA. 

32. SenlAhden eivAt Israelin lapse! 
tAnAkSAn pAivAnA sy6 reisisuonta, 
joka juoksec ronkknluun pAAn ylit- 
se, koska HAn oli tarttunut Jaakobin 
ronkkaluuii pAAIiAn reisisuonen koh- 
dalla. 

33 Luku. 

Jaakob Ja Esau kohtaavat toisensa. 

la Jaakob nosti silmuhsA ja nAki, 
*^ ja katso, Esau 4uli, ja neljAsataa 
miestA hAnen kanssansa. Niin hAn 
jakoi lapse! Lealle ja Hakelille, ja 
molemmille piioille. 

2. Ja hAn asetti piiat lapsinensa en- 
simniAisiksi; sitAIAhin Lean hAnen 
lastensa kanssa, ja Hakelin Josefin 
kanssa jAiinimAiseksi. 

3. Mutta itse hAn kAvi heidAn edel- 
lAnsA, ja kumartui maahan seitsc- 
mAn kertaa, lAhestyessAAn veljeAnsA. 

4. Mutta Esau juoksi hAnlA vastaan 
ja syleili hAnlii, halasi hAnIa kau- 
lasta ja suuta antoi hAnen; ja he it- 
kivAl. 

5. Ja kun hAn nosti silmAnsA ja nA- 
ki vaimot ja Ia|)set, sanoi hAn: „kut- 
ka nAniA seurassasi ovat?" HAn vas- 
tasi: „ne ovat lapset, jotka Jumala 
on lahjoittanut sinun palvelijallesit* 

6. Niin piiat lAhestyivAt lapsinensa 
ja kumarsivat hAnen edessAnsA. 

7. Ja lAhestyi myos Lea lapsinensa 
ja kumarsi hanen edessansA. Sitlen 
tuli Josef ja Hakel, jotka myds 
kumarsivat hAnen edessAnsA. 

8. Niin hAn sanoi: „mikA on koko 
sen joukon tarkoitus, jonka minu 
kohdannutolen?" HAn vastasi: ,,tah- 
toisin saada suosiota herrani edessA." 

9. Mutta Esau sanoi: „minulla on 
kyllA; minun veijeni, pidA oniasi.** 

10. Jaakob vastasi: „ei niin; mutta 
jos minA olen saanut sinun suosiosi, 
niin ota lahjani mInun kAdeslani; 
sillA minA nAin sinun kasvosi, niin- 
kuin minA ollsin nAhnyt Jumalan 
kasvot, kun niin yslAvAllisesti otit 
minun vastaan. 2San). 19:27. 

11. Ota siis se tcrvehdyslahja, jonka 
minA olen slnuUe lAhetlAnyt; sillA 
Jumala on ollutminuUearmoUinen, 
ja minulla on kylla kaikkinaista." 
Niin hAn vaati liAntA, ja hAn otti. 

2 Sam. 25:27. 

12. Ja Esau sanoi: „]AhtekAAmme 
jo malkustamaan; minA vaellan si- 
nun kanssasi." 



37 



1 MOOS. 33. 34. 



13. Mutta hfin snnoi hSnelle: „her- 
rani tieldA minulla olevnii pieniA 
lapsia, ja imeUfivAisia lampaita, ja 
karjaa ; jos niitft yksikfiAn pAivft ko- 
vasti ajetaan, kuolee koko lauma. 

14. Niin inh(ek05n herrani palveli- 
jansa edelhl; mutta minft seuraan 
hiljaksensa, sen mukaan kuin karja 
ja lapset kflydd voivat, siksi kuin 
tulen herrani tyk6 Seiriin.'' 

15. Niin Esau sanoi: „minii jdtftn 
kuitenkin sinulle osan siita vSestd, 
joka minun kanssani on.*' H9n vas- 
tasi: „miksi niin? Anna minun aino- 
astansa saada suosio herrani edessd.'* 

16. Sitten £sau palasi sinS pAivJknfi 
omaa tietfinsS Seiriin. 

17. MuttaJaakob matkustiSukkotiin, 
ja rakensi itseIIens3huoneen, ja teki 
majat'lcarjallensa. Sentfihden antoi 
hSn sille paikalle nimen Sukkot. 

18. Ja Jaakob pdfltti matkansa Me- 
sopotamiasta ja tuli rauhassa Sike- 
mm.kaupunkiin, joka on Kanaan- 
maalla, la sijoitti itsensS kaupungin 
ulkopuolelle. 

19. Ja osti sen palan peltoa, johonka 
hAnoli asetlanutmajansa, Hemorin, 
Sikemin isltn, lapsilta,sadan pennin- 
gin hinnalla. Jos. 24:32. Ap. 1 7:16. 

20. Ja rakensi siihen alttarin ja ni- 
mitti sen: „v&kevfi on Israelin Ju- 
mala.*" 

34 Luku. 

Vftki Yalta Dinalle. Jaakobin polkain kosto. 

J a Dina, Lean tyt21r« jonka \\J^n Jaa- 
kobille oli synnytt&nyt, meni kal- 
seiemaan sen maakunnan tyttdrid. 

2. KunSikem, Heviiaisen Hemorin, 
sen maakunnan ruhtinaan, poika, 
naki hdnen, otti hAn hdnen, ja ma- 
kasi hSnen ja h9p5isi hSnen. 

3. Ja hAnen sydSmmensd kiintyi 
Dinaan, Jaakobin tyltdreen; hSn ra- 
kasti tyttfin ja puhutteli hSntft suioi- 
silla sanoilla. 

4. Ja Sikem puhui isfillensft Hemo- 
rille, sanoen: „ota minulle lfim5 
tyltO vaimoksi.'^ 

5. Ja Jaakob kuuli, ettS he hUnen 
tyttarensS Dinan olivat hfivftisneel. 
Mutta koska hSnen poikansa olivat 
lauman kanssa kedoila, niin valkeni 
Jaakob sik^i kuin he tulivat kotiin. 

6. Niin Hemor, Sikemin is9, meni 
Jaakobin tykO puhuttelemaan hUnlS. 

7. Silloin tulivat Jaakobin pojat ke- 
doita, kun saivat kuuUa mitfl oli ta- 
pahtunut. Ja miehet tulivat surulli* 
seksi ja vihastuivat sangen kovin, 
etta hfin oli tehnyt ilkityOn Israe- 
lissa, maaten Jaakobin ty ttaren ; sillfi 
ei se ollut oikein tchty. 



8. Niin puhui Hemor heidfin kans- 
sansa, sanoen: „minun poikani Si- 
kemin sydfin halajaa teidftn tytftr- 
tjlnne; antakaat siis se hfinelle vai- 
moksi. 

9. Tulkaamme langoiksi keske- 
nfimme; antakaat teidfin tytt&riSnnc 
meille« ja ottakaat jfiileen meidftu 
tyltdrifimme teille. 

10. Ja asukaat meidfin kanssamme; 
maa olkoon teille avoinna, asukaat, 
myOkfiftt ja ostakaat siinfi, ja omis- 
taicaat maata.'' 

11. Ja Sikem sanoi isfiUe ja veljille: 
^antakaat minun saada suosio teidfin 
edessfinne; ja mitfi te sanotte mi- 
nulle, sen minfi annan. 

12. Anokaat minulla rohkiasti hue- 
menlahjaa ja antimia, ja minfi an- 
nan, mitn te vaaditte; antakaat mi- 
nulle vaan se tyttO vaimoksi.*' 

13. Niin vastasivat Jaakobin pojat 
Sikemille ja hfinen isfillensfl Heme* 
rille, ja puhuivat viekastellen, kos- 
ka hfin oli heidfin sisarensa Dinaa 
hfivfiisnyt, 

14. ja sanoivat heille: „emme voi 
siihen suostua, ettfi antaisimme si- 
saremme ympfirileikkaamattomalle 
miehelle; sillfi se olisi meille hfipi- 
fiksi. 

15. Mutta ainoastaan sillfi ehdolla 
me suostumme teihin, ettfi rupeatte 
meidfin kaltaisiksemme , tiiin ettfi 
kaikki miehenpuolit^idfiosieassanne 
ympfirileikataan. 

16. Sitten me annamme meidfin tyt- 
tfiremme teille, ja otamme teidfin 
ty ttSrifinne meille, ja asumme teidfin 
kanssanne, ja me tulemme yhdeksi 
kansaksi 

17. Mutta joUette kuule meitfi ettekfi 
ympfirileikkauta itsefinne, niin me 
otamme meidfin tyttflremme, ja me- 
nemme matkoihimme.*' 

18. Ja heidfin puheensa kelpasi He- 
morille ja Sikemille, Hemorin po- 
jalle. 

19. Ja nuori mies ei viivytellyt sitfi 
tekemflstfi, sillfi hfin rakasti suuresti 
Jaakobin tytfirtft; ja hfintfi pidettiin 
suuremmassa kunniassa kuin kaik* 
kia muita hfinen isfinsfi huoneessa. 

20. Niin tuli Hemor ja hfinen poi- 
kansa Sikem kaupunkinsa porttiin, 
ja puhuivat heiafin kaupunkinsa 
mienille, sanoen: ' 

21. „Nfimfi miehet ovat rauhalli^et 
meitfi kohtaan, ja tahtovat asua ja 
elfifi tfissfi maassa, ja katso, maa on 
kyllfi avara heille. Ruvetkaamme ot- 
tamaan heidfin tyttfirifinsfi meille vai- 
moiksi, ja ahtakaamme meidfin tyt- 
tfirifimme heille. 



38 



1 MOOS. 34. 35. 



22. Mutta atnoastaun sillfi ehdolla 
ne miehet suostuvat asumaan mei- 
dAn kanssamme ja tulemaan yhdeksi 
kansakst, ettfi kaikki miehenpuoli 
mddfinseassamroeympftrileikataan, 
niinkuin he myOs ympftrileikatut 
ovat. 

23. Heidfin karjansa ja tavaransa, 
ja kaikki heidfin elftimensd, eikA ne 
olemeidftn omamme? Jos vaan hei- 
din tahtoansa noudatamme, niin 
heasuvat meidAn kunssamme.** 

2i. Ja kansa kuuli Hemoria ja h&- 
nenpoikaaDsaSikcmiS, kaikki kansa, 
joka kaupungin portin sisSlIA asui ; 

a kaikki miehenpuoli, jotka asuivat 

urapungin portin sisSIHi, ympfiri- 
IdkkauUi itsensd. 

25. Ja tapahtui kolmantena pSivfi- 
nS, kun ne kipeimmillftnsfi clival, 
etta ne kaksi Jaakobin poikaa Sime- 
on ja Levi, Dinan veljet, ottivat 
kumpikin miekkansa jamenivfit roh- 
kiasdkaupunkiin ja tappoivat jokai- 
sen miehenpuoien. i Moos. 49:5 as. 

2S. Ja lie tappoivat myOs Hemorin, 
ja hftnen poikansa Sikemin miekan 
teriUlfi, ja ottivat Dinan Sikemin huo- 
neesta ia menivfit pois. 

27. Niin tulivat Jaakobin pojat ta- 
pettoiden pSftlle ja ryOstivSt kau- 
pongin; sillft he oiivat hftv&isneet 
heidan sisarensa. 

28. Ja he veivfit pois heidfin lam- 
punsa, kaijansa, aasinsa, ja mitA 
lekft kaupungissa ettft kedolla oli. 

29. Ja kaikki heidftn tavaransa, lap 
Kttsa ja vaimonsa he ottivat saaliik- 
seen; niin myOs kaikki, milfi huo- 
neissa oli. 

.30. Mutta Jaakob sanoi Simeonille 
jaLeville: „te olelte minulle onnet- 
tomanden tuot laneet,saattaen minun 
kaisevaiseksi llkmflnmaakunnanasu- 
^sille, Kananealaisille ja Feresi- 
ttisille. Minun kansani on ainoas- 
laan vflhftinen joukko; ja nyt he 
kokoontuvat minua vastaan ja tap- 
pavat minun, ja minS hukutetaan, 
ja minun perheeni.*' 
31. Mutta he vastasivat: „olisiko 
sitten sisarellemme tehtftvS niinkuin 
portoUc?** 

35 Luku. 

Jukob BetelissiL Benjamin syntyy. Bakel 
ja Isaak kuolevat 

]a Jamala sanoi JaakobiUe: „nouse 
^ ja mene ylOs Beteliin, ja asu siel- 
U, ja tee siihen alttari Jumalalle, 
ioka sinulle Umestyi, kun sinfi pa- 
seoit veljesi Esaun edestfil'' 

1 Moos. 28:12 ss. 

2. NUn sanoi Jaakob perheellensfi, 



ja kaikille, jotka hfinen kanssansa 
olival: .,eroiltakaal pois vieraal ju- 
malat, jotka teidftnkeskell&nne ovat, 
ja puhdistakaat itsenne ja muutta- 
kaat vaatteenne, 

3. ja nouskaamme ja menkflflrame 
yl6s Beteliin, ettfl minft tekisin sii- 
hen alttarin Jumalalle, joka minua 
kuuli hflta-aikanani, ja on ollut mi- 
nun kanssuni liclia, jola minS vael- 
sin.** . , 

4. Niin he antoival JaakobiUe kaik- 
ki vieraat jumalat, jotka heidSn ka- 
sissSnsa oiivat, ja hcidttn korvaren- 
knansa, jotka heidan korvlssansa 
olival. Ja Jaakob kaivoi ne maahan 
sen Inmmen alle, joka oli Sikemin 
kohdalla. 

5. Siltcn he inksivat matkalle. Ja 
Jumalan peiko tuli niille kaupun- 
geille, jotka olival heidan ymparil- 
fansa, niin ellcivai he ajaneel Jaa- 
kobin poikia tnkaa. 

6. Niin tuli Jaakob Lusiin Kanaan- 
maalla, se on Belel, kaiken sen vaen 
kanssa, joka hanen seurassansa oli. 

7. Ja han rakensi siihen alttarin, 

J a kutsui sen paikun El-Be^el; silia 
lumala ilmeslyi siina handle, pae- 
tessansa veijensft edesta. 

1 Moos. 28:10. 

8.JaDebora,Rebekan imettaia,kuo- 

11 ja haudattiin alemmaiselle puo- 

lelle Belelia, tammen alle; ja se kul- 

sultiin itkutammeksi. 

9. Ja Jumala ilmeslyi taas Jaako- 
biUe, sitte kuin han oli tullut Meso- 
polamiasta, ja siunasi hanta. 

10. Ja Jumala sanoi hanelle: „sinun 
nimesi on Jaakob: mulla ei enaa 
pidft sinun nimesi olemnn Jaakob, 
vaan Israel on nimesi oleva.** Ja 
niin sai han nimen Israel. 

1 Moos. 32:28. 1 Kun. 18*31. 

11. Ja Jumala sanoi hanelle: „mi- 
na olen kaikki vallias Jumala, ole 
hedelmailinen jaenene. Kansa, jopa 
kansain joukko on sinusta tuleva; ja 
kuninkaat tuleval sinun kupeistasi. 

12. Ja sen maan, jonka mma olen 
antanut Abrahamille ja Isaakille, 
annan mina sinulle; ja sinun jaikei- 
selle siemenellesi annan mina sen 
maan.** l Moos. 12:7. 26:3. 

13. Ja niin meni Jumala ylOs ha- 
nen tykoansa siina paikassa, missa 
han hanen kanssansa oli puhunut. 

1 Moos. 17:22. 

14. Mutta Jaakobasetti kivisenmuis- 
topalsaan siihen paikkaan, jossa 
Han hanen kanssansa oli puhunut, 
ja uhrasi juomauhria, ja kaasi Oljya 
sen paaile. 

15. J a Jaakob kutsui sen paikaOf 



39 



1 MOOS. 35. 3d. 



Jossa Jumala h&n^n kanssansa oli 
puhunut. Betel. 

16. Ja he matkustivat Beteiistfl, ja 
kun vielfi oli vdhSn malkaa EJfra- 
tiin, svnnytti Rakel, ja synnyUdmi- 
nen oli hanelle sangen raskas. 

17. Ja kun tuskansa olivat korkeim- 
millaan, sanoi apuvaimo hfinelle: 
.,2\id pelkftA, silla myOs Idssa saat 
pojan.** 

18. Mulla lienkensft IShteissd, aivan 
kuoilessaan, kutsui hftn hflnen ni- 
mensS BenonI ; mutta hdnen isdnsft 
antoi hfinelle nimen Benjamin. 

19. Niin kuoli Rakel; ja h&n hau- 
datliin Efratin tien viereen, se on 
Betlehem. 

20. Ja Jaakob pani patsaan hdnen 
hautansa pdSlle; se on vielfi tHnSAn 
Rakelin hautapatsas. 

21. Ja Israel matkusti siitA eteen- 

f»5in ja asetii majansa tuolle puo- 
elle Ederin lornia. Mik.4:8. 

22. Ja se (apalilui« kun Israel asui 
siinft maakunnassa, men! Ruuben ja 
makasi Bilhan, hflnen isflnsfl jalka- 
vaimon, kanssa. Ja Israel sai sen 
kuulla. .Ja Jaakobilla oli kaksitoisia 
polkaa. 1 Moos. 49:4. 

23. Leanpojatolivatnfimfl: Ruuben, 
Jaakobin esikoinen, sitten Simeon, 
Levi, Juuda, Isaskar ja Sebulon. 

24. Rakelin pojat olivat: Josef ja 
Benjamin. 

25. Bilhan, Rakelin piian, pojat oli- 
vat: Dan ja Naftali. 

26. Silpan. Lean piian, pojat olivat: 
Gad ja Asser. Nflmfl ovat Jaakobin 

pojat, jotka hflnelle syntyivflt Meso- 
potamiassa. 

27. Ja Jaakob tuli isflnsfl Isaakin 
tykO Mamreen, Arban kaupunkiin, 
ioka on Hebron, jossa Abraham ja 
Isaak olivat muUkalaiset olleet. 

1 Moos. 37:1. 

28. Ja Isaak oli sadan ja kahdek- 
sankvmmen^n ajaslaikainen; 

29. ja hfln vaipui kuolematin ja 
koottiin kansansa tykO, vanhana ja 
elflmflstfi kyilflflntyneenfl. Ja hflnen 

Koikansa Esau ja Jaakob hautasivat 
flnen. 1 Moos. 25:8. 

36 Lujcu. 

Esaun sukutaulu. 

Tflmfl on Esaun, se on Edomin, 
sukukunta. 
2. Esau otti vaimoja Kanaanin tyt- 
tflristfl: Adan, Elonin Hetilfiisen 
tyttflren, ja Oholibaman, Anan, He- 
vllflisen Sibeonin pojan, tyttflren, 

1 Moos. 26:34. 28:9. 

3« ja Basmatin, Ismaelin tyttflren, 
Nebajotin sisaren. 



4. Ada synnytii Esaulle Elifan. Ja 
Basmat svnnytti Reguelin. 

5. Oholibama synnytti Jeusin, Jae- 
lamin ja Korakin. Namfl ovat Esaun 
lapset, jotka hflnelle syntyivflt Ka- 
naanmaalla. 

6. Ja Esau oiti vaimonsa, poikansa 
a tyttflrensfi ja kaikki pernekunta- 
aisensa, sekfl karjansa Ja juhtansa, 

. a kaiken sen tavaransa, jonka hfin 
oli koonnut Kanaanmaalla, ja meni 
toiselle maalle, veljensfl Jaakobin 
tykOfl. 

7. Sillfl heidfln tavaransa oH niin 
suuri, etteivflt tailaneet vhdessA 
asua ; se maa, jossa he muuKaJaiset 
olivat, ei riittflnyt hellle kaijansa 
paliouden tflhden. 1 Moos. 13:6. 

8. Niin Esau asettui Seirln vuorelle, 
Esau, joka kutsutaan myOs Edom. 

Joe. U'A. 

9. Nfimfl ovat Esaun, Edomilalsten 
isfln, suvut Seirin vuoreila. 

10. Nfimfl ovat Esaun poikain ni- 
met: Elifas, Adan, Esaun vaimoo, 
poika; ja Reguel, Basmatin, Esaun 
vaimon, poika. 

11. Ja Elifaan pojat olivat: Teman, 
Omar, Sefo, Gaelam ja Kenas. 

12. Mutta Timna oli Elifaan, Esaun 
pojan, jalkavaimo, joka synnytti hfl- 
nelle Amalekin. Neovat Adan, Esaun 
vaimon lapset. 

13. Mutta Reguelin lapset ovat nfi- 
mfl : Nahat, Serak, Samma ja Missa. 
Ne ovat Basmatin, Esaun vaimon, 
lapset. 

14. Mutta tiflmfl olivat Oholibaman, 
Esaun vaimon,pojat,Anan, Sibeonin 
pojan, tyttflren lapset, jotka hfln syn- 
nytti Esaulle i Jeus.Jaelam jaKorak. 

15. Nfimfl oval Esaun lasten ruh- 
tinaat: Elifaan, Esaun esikoisen, lap- 
set ovat nflmfl: ruhtinas Teman, run- 
tinas Omar, ruhtinas Sefo, ruhtinas 
Kenas, 1 Aik. 13&. 

16. ruhtinas Korak, ruhtinas Gae- 
tam, ruhtinas Amalek. Nflmfi ovat 
Elifaasta syntyneet ruhtinaat Edo- 
min maalla, ja ovat Adan lapset. 

17. Ja nfimfl ovat Reguelin, Esaun 
pojan, lapset: ruhtinas Nahat, ruh- 
tinas Serak, ruhtinas Samma, ruh- 
tinas Missa. Nfimfi ovat Reguelista 
syntyneet ruhtinaat Edomiiaisten 
maalla ja ovat Basmatin, Esaun vai- 
mon. lapset. 

18. Mutta nfimfi ovat Oholibaman, 
Esaun vaimon lapset: ruhtinas Jeus, 
ruhtinas Jaelam, ruhtinas Korak. 
Nfimfl ovat ruhtinaat Oholibamasta, 
Anan tyttflrestfi, Esaun vaimosta. 

19. Nfimfi ovat Esaun lapset ja hei- 
dfin ruhtinaansa. Hfln on Bdom^ 



40 



1 MOOS. 36. 37. 



20. Mutta nflmS ovat Seirin, sen 
Horilaisen, lapset. iotka silia manlla 
asuivat: Lotan, Sobal, Sibeon, Ana, 

lAik. 1:38. 

21. Dison, Eser ja Disan. Nfimft ovat 
Uorilaisten ruhtinaat, Scirin lapset, 
Edomin maalla. 

22. Mutta Lotanin lapset ovat. Hori 
jaHemani;jaLotaninsisaroIiTinina. 

23. Sobalin lapset oval ndmft: Al- 
van, Manahat, Ebal, Scfo ja Onam. 

2(. NfimA ovatSibeonin lapset : Aija 
ja Ana. TilmS on se Ana, joka kor- 
vcssa lOysi ISmpimfit Ifibtect, kaites- 
sansa isSnsfl Sibeonin aaseja. 

25. Mutta Anan lapset ovat: Dison 
ja Oholibama, Anan tytAr. 

26. Disonin lapset ovat: Hemdan, 
Esban, Jitran ja Keran. 

27. Eserin lapset ovat: Bilhan, Saa- 
van ia Akan. 

28. Disanin lapset oval. Us ja Aran. 
29.N5mSovat Horilaistenrulilinaat: 

ruhtinas Lotan, ruhtinasSobal, ruh- 
tinas Sibcon, ruhtinas Ana, 
30. ruhtinas Dison, ruhtinas Eser, 
ruhtinas Disan. Nfini5 ovat Hori- 
laisten ruhtinaat, nSmft heidSn ruh- 
tinaansa Seirin maalla. 
' 31. Mutta kun1nkaat,jotka Edomin 
maalla hallitsivat, ennenkuin joku 
kuningas hallitsi Israelin lapsia, 
ovat nSmfi: lAik. 1:43. 

32. Kuningasna Edomissa oli Rela, 
Beorinpoika; ja hftnen kaupunkinsa 
niroi oli Dinhaba. 

33. Ja kun Bela kuoli, tuli Jobab, 
Serakin poika,Bosrasta, kuninkaak- 
si hdnen sijaansa. 

34. Kun Jobab kuoli, tuli Husam 
Teroanilaislen maalta kuninkaaksi 
bilnen sijaansa. 

35. Kun Husam kuoli, tuli Hadad, 
Bedadin poika, kuninkaaksi hfinen 
sijaansa, loka lAi Midianilaiset Moa- 
bilaisten kedolla; ja hdnen kaupun- 
kinsa nimi oli Avit. 

36. Kun Hadad kuoli, hallitsi Samla 
Masrekasla hfinen sijassansa. 

37. Kun Samla kuoli, tuli Saul ku- 
ninkaaksi. hSnen sijaansa, Rehobo- 
tista virran tykAfi. 

38. Kun Saul kuoli, tuli Baalha- 
nan, Akborin poika, kuninkaaksi 
bfinen sijaansa. 

d9. Kun Baalhanan, Akborin poika, 
kuoli, tuli Hadar kuninkaaksi hdnen 
&ijaansa,ja hdnen kaupunkinsa nimi 
oU Pagu; ja hfinen vaimonsa nimi 
oli Menetabeel, Matredin tytSr, joka 
Mesahabin tytUr oli. 

40. Ja nUma ovat Esaun ruhtinas- 
len pimel heidfin sukujensa, asunlo- 
paikkainsa ja nimiensfi suhteen : ruh- 



tinas Timna, ruhtinas Alva, ruh- 
tinas Jetet, 1 Aik. 1*.51 as. 

41. ruhtinas Oholibama, ruhtinas 
Ela, ruhtinas Pinon, 

42. ruhtinas Kenas, ruhtinas Te- 
man, ruhtinas Mibsar, 

43. ruhtinas Magdiel,ruhtinaslram. 
Nfim9 ovat Edomin ruhtinaat, niin- 
kuin he asuneet ovat perintOmaal- 
lansa; ja Esau on Edomilaisten is3. 

37 Luku. 

Josef n&kee unta. Hftn myOdft&n Egyptiin. 

J a Jaakob asui siinS maassa, jossa 
hSnen isftnsS oli muukalainen ol- 
lut, Kanaanmaassa. i Moos. 35:27. 

2. Ja tftmfi on kertomus Jaakobin 
sukukunnasta. Josef oli seitsemlin- 
toista ajastaikainen, kun hftn kaitsi 
karjaa veljeinsft kanssa, ja hftn oli 
nuorella ijfillftnsft isftnsfi vaimojen 
Bilhan ja Silpan lasten kanssa; ja 
Josef ilmoitti isftUensft, mitd pahaa 
heistft kuului. 

3. Mutta Israel rakasti Josefia enem- 
min kuin kaikkia muita lapsiansa. 
koska hftn oli syntynyt hftnelle van- 
halla ijfillftnsft; ja hftn teetti hflnellc 
pitkftn hamcen. 

4. Kun hftnen veljensft nftkivfit, ett^. 
isft rakasti hfinlft enemmin kuin kaik- 
kia hftnen veljiftnsft, vihasivat he 
hftntft,eivfttkftvoineetpuhutellahftn- 
t-i ystftvftllisesti. Ap.t7:9. 

5. Sillen Josef nftki unen ja ilmoit- 
ti sen veljillensft; tftstft he rupesi- 
vat hftntft vielft enemmin vihaamaan. 

6. Sillft hftn oli heille sanonut: „kuul- 
kaa tfttft unta, jonka minft nftin. 

7. Me olimme sltovinamme Ivhteitn 
vainiolla, ja minun lyhteeni nousi 
seisomaan, ja katso, teidftn lyhteennc 
seisoivat ympftrillft ja kumarsivat 
minun lyhettftni.** 

8. Silloin sanoivat hftnen veljensft 
hftnelle: „sinftkO tulisit meidftn ku- 
ninkaaksemme, ja sinftk6 hallitsisit 
meiia?" Ja he vihasivat hftntft vielft 
enemmin hftnen unensa ja puheensn 
tfthden. 

9. Sitten nftki hftn taas toisen unen 
ja kertoi sen veljillensii , sanoen: 
„kuulkaa, minft nftin vielft unta; kat- 
so, aurinko, kuu ja yksiloista tftht6ft 
kumarsivat niinua.*' 

10. Ja kun hftn sitd kertoi isftllensft 
ja veljillensft, nuhlcli hftnen isftnsft 
hftntft ja sanoi h5nelle: ,,niikft uni 
se on, jonka olet nfthnyt? PilftftkO 
minun ja sinun ftitisi ja veljesi tule- 
man ja kumartuman sinun edessftsi 
maahan?'* 

11. Ja hftnen veljensft kadehtivat 



(Finnishl 2* 



41 



t MOOS. 37. 38 



hfintd; mutia hAnen isAnsd piti nfl- 
mfi sanat mieless9nsd. 

12. Kun hSnen veljensfi kerran oli- 
vat mehneel kaitsemaan isftnsft kar- 
jaa Sikemiin, 

13. sanoi IsrnelJosefille: „eik6 vel- 
jesi kaiisc knrjaa Sikemissfi? Tule, 
minftinhelcnnsinunheidantykOnsfi.** 
HAn vaslasi : „tdss9 mind olen.'* 

14. H5n sanoi: „m€ne katsomaan, 
kuinka veljesi voivat ja kuinka kar- 
jnn laila on, ja palaja minulle sitd 
sanomaan.** Niin hftn Idhetti hftnen 
Hebronin laaksosta; ja h9n tuli Si- 
kemiin. 

15. Siellfl yksi mies kohtasi hSnet 
liarhaillessaan kedolla, ja kysyi hfi- 
neitfl, sanoen: „mitfls etsil?^' 

16. Hfin vastasi : ^minft etsin velji- 
dni; sano minulle, missfi he kait- 
seval karjaa.** 

17. Mies sanoi: „he ISksivftttfifiltfi ; 
sillft mind kuulin heiddn sanovan: 
IJkhteknnmme Dolaniin/* Niin Josef 
cisi edelleen veljiSnsd ja I6ysi hei- 
ddl Dotanissa. 

18. Kun he kaukana nflkivfithfinen, 
ennenkuin hfin heilS Ifthestyi, piti- 
vdt he neuvoa hfinlA vastaan, tap- 
paaksensa hfintS. 

19. He sanoivat toinen toisellensa: 
„katso, tuossa unennfikijil tulee. 

20. Tulkaa siis, tappakaamme hft- 
net, ja heittflkfidmme kuoppaan; 
sitten sanomme: ,paha peto on hfi- 
nen syOnyt.* Niin saadaan ndhd5, 
milft nSnen unistansa tulee.*' 

21. Kun Ruuben sen kuuli, tahtoi 
hdn hdnid pelastaa heidSn kSsistdn- 
sS, ja sanoi : „ftlkSdmme hfinen hen- 
keftns3 ottako.*' i Moos. 42:22. 

22. Ja Ruuben sanoi vielfi heille: 
„dlkA5 vuodattako verta, vaan heit- 
tfikJia hfin tfihSn kuoppaan, joka on 
korvessa, mutta Slkftfl satuttako kAt- 
tanne hSneen.'' SlllA hAn tahtoi 
pelastaa hAntA heidAn kAsistAnsA, 
saallaaksensa hAnet jAlleen isAnsA 
lyk«. 

23. Ja tapahtui, kun Josef tuH vel- 
jiensA tykO, riisuivat he hAneltA ha- 
meen, sen pitkAn hameen, joka hA- 
nen yllAnsA oli, 

24. ja ottivat hAnen ja helttivAt 
kuoppaan; mutta kuoppa oli tyhjA, 
eikA oilut siinA vettA. 

25. Sitten istuivat he syOmAAn. Ja 
kuQ he nostivat silmAnsA ja katseli- 
vat, niin nAkivAt he Ismaelilaisten 

ioukon tulevanGileadista; ja heidAn 
Lamelinsa kantoivat rohtoja, balsa- 
mia ja hajupihkaa, ja he vaelsivat 
viemAAo niitA alas Egypliln. 

26. Silloin sanoi Juuda veljillensA: 



,,mitA me siitA hyOdymme, ettA me 
murhaamme meidAn veljemme ja 
salaamme hAnen verensA? 

27. Tulkaa ja mydkAAmme hAn Is- 
maelilaisille; ja AikAAmme satuttako 
kAtlAmme hAneen. sillA hAn on mei- 
dAn veljemme ja lihamme." Ja vel- 
jet kuuUvat hAntA. 

28. Kun Midlanilaisten kauppamie- 
het siitA menivAt ohitse, vetivAt he 
Josefin ylOs kuopasta, ja mOivAt hA- 
net Ismaelilaisille kahteenkymme- 
neen hoplasikliin. Ja nAmA veivAt 
Josefin pois Egyptiin. Ps. 105:17. 

Ap.t7:9. Ylis.l0:13. 

29. Kun sitten Ruuben palasi kuo- 
palle, niin katso, ei ollut Josef kuo- 
passa. Silloin hAn repAisi vaatteensa, 

30. ja palasi veljiensA tykO, ja sa- 
noi: „ei ole nuorukainen siellA; voi 
minua! kuhunka minA menen?** 

31. Niin he ottivat Josefin hameen, 
ia tappoivat kauriin ja tahrasivat 
hameen vereen. 

32. Sitten he lAhettivAt sen pitkfin 
hameen kotiin isAn )uo ja sanoivat : 
„tAmAn me lOysimme; tunnustcde, 
onko se poikasi hame vai ei?** 

33. Ja han tunsi sen, la sanoi : „tft- 
mA on minun poikanf hame, paha 
peto on hAnen syfinyt; Josef on raa- 
deltu kuoliaaksif * 

34. Ja Jaakob repAisi vaatteensa, 
ja kAAri itsensA sAkkikankaasen, ja 
murehti poikaansa kauan aikaa. 

35. Ja kaikki hAnen poikansa ja 
tyltArensA nousivat hAntA iohdutta- 
maan; mutta eihAn tahtonut antau 
itseAnsA lohduttaa, vaan sanoi: nmi- 
nA menen murehtien alas poikani 
tykO hautaan.'' Niin itki isA Josefia. 

36. Mutta Midianilaiset veivAt hAnet 
Egyptiin ja mOivAt Potifarille, Fa- 
raon kamaripalvelijaile ja henki- 
varkijain pAAmiehelfe. lMoos.S9:l. 

38 Luku. 

Juudan pojat Juuda ja Tamar. 

Slihen aikaan tapahtui, ettfi Juuda 
meni alas veljeinsA tykOA ja poik- 
kesiAdullamiin yhdenmiehen tykd, 
jonka nimi oil Hira. 

2. Ja Juuda nAki siellA kananea- 
laisen, Sua nimisen roiehen tyUAren 
ja olli hAnen luokseen ja meni hA- 
nen tykOnsA. 

3. Ja hAn tuli raskaaksi ja ssrnnytti 
PQjan, Ja antoi hAnelle nimen Ger. 

4. Ja nAn tuli (aas raskaalcsi, ja 
synnytti pojan, ja kutsui hftnen ni« 
mensA Onan. 

5. Ja hAn synnytti vielA- pojan , ia 
hAnelle antoi han nimen Sela. ja 



42 



1 MOOS. 38. 39. 



Juuda olf Kesibissfl, kun h9n sen 
synnytli. l Aik. 2:3. 

6. Ja Juoda otti esikoisellensa Ge- 
riUe vaimon, jonka nimi'bli Tamar. 

7. Mutta Ger, Juudan esikoinen, oli 
paha Herran cdessll ; ja Herra kuo- 
letti hAnen. 4 Moos. 26:19. 

8. Niin sanoi Juuda Onanille : ,,mene 
veljesi vaimon tyk6, ota hfin aviok- 
ses,herilttliaksesveljellesisieinen(fi.*' 

5 Moos. 25:6. Matt. 22:24. 

9. Mutta Onan tiesi, ettei perillinen 
olisi tullut liftnen omaksensa; kun 
hdn siis makasi veljensfi vaimon 
kanssn.anloi hfin siemenensfi mennft 
maahan, ja turmeli sen, ettei hfin 
olisi anianut veljellensd perillistS. 

10. Jase mita hfin teki; ei kelvannut 
Herralle; sentfthden Herra kuoletti 
myOs hanen. 

11. Niin sanoi Juuda miniSllensA 
Tamarille: ^ole Iesken9 sinun istisi 
liuoneessa siilien asti kuin minun 
poikani Sela tulee tSvsikasvuiseksit' 
Silia hSn ajatteli: „enkfi kuoleeliSn- 
kin, niinkuin hfinen veljens5kin.'* 
Niin Tamar meni pois, ja oH isfinsA 
huoneessa. 

12. Kun kauan aikaa oli kulunut« 
kuoli Suan tytftr, Juudan vaimo. Ja 
kun Juuda oli ilsensfi lohduttanut, 
meni hSn TImnatiin, lammastensa 
keritsijdin tykO ystftvftnsA Hiran 
kanssa Adullamista. 

13. Niin ilmoilettiin Tamanile, sa- 
noen : „katso. appesi meneeylOsTim- 
natiin keritsemfifin lampaitansa.** 

14. Silloin riisui hfin yltfinsS leski- 
vaatteensa, verlioitti itsensA ja peiHi 
kasvonsa, ja kSvi istumaan Enaimin 
poritiin, joka on liellft Timnatiin. 
Sillil hiin ndki, etia Sela oli kasva- 
nut, eikS hSntfi annettu sille vai- 
moicsi. 

15. Kun Juuda nftki hftnet, luuli 
h9n sen portoksi; sillA hfin oli peit- 
titnyt kasvonsa. 

16. Ja hSn poikkesi tien oheen hfi- 
ncn tykOnsft, ja sanoi: „annas mi- 
nun maala kanssasi;** silld ei hSn 
liennyt sita minifiksens9. H9n vas- 
tasi: ,,mitA minulle annat, jos sind 
makaisit minun kanssani?'' 

3 Moos. 18:15. 

17. Hdn sanoi : ,,minfi IShetlin kau- 
riinlaumastani.** HAnvastasi: «,anna 
siis minulle pantti niin kauaksi kuin 
sinil sen IShetftt.'* 

18. Hfin sanoi: „mitA minfl sinulle 
pantiksi antaisin?*' Hfinvastasi: ,,sU 
nettisormuksesi.rihmasi, ja sauvasi, 
joka kfidessfisi on.** Niin hAn antoi 
ne hfinelle, ja makasi hflnen kans- 
sansa ; ja ItAn lulj raskaaksi hflncstfi. 



19. Ja hfin nousi ja meni, pnni pois 
silmikon, ja puki jfilleen Icskivaat- 
teet yllensfi. 

20. Mutta Juuda Ifihetti kauriin ys- 
lAvfinsfi knnssa Adullamista, sandak- 
scnsa vaimolta pantin takaisiu ; mut- 
ta tfimfi ei lOytfinyl hfintfi. 

21. Niin hfin kyseli sen paikan mic- 
hiltfi, sanoen: „kussa on se portto, 
joka istui Enaimissa tien ohessa?'* 
Hevastasivat: „ei tfissfi oleyhtfikfifin 
porltoa ollut.** 

22. Mutta hfin palasi Juudan tykn, 
ja sanoi: „en minfi 16ytfinyt hfintfi. 
sen paikan miehet sanoivat my6s. 
ettei siellfi ole yhtfikfifin porttoa o1- 
lul.** 

23. Niin Juuda sanoi : „pitfikOOn hfin 
nc, ettemme hfipififin tulisi; katso, 
minfi Ifihetin kauriin, mutta sinfi ct 
lOytfinyt hfintfi.'* 

24. Liki kolmen kuuknudcnpcrfislfi 
ilmoitcttiin Juudallc: ,.sinun mini- 
fisi Tamar on salnvuoteessa oilut, ja 
katso, salavuoteesta on hfin myds 
raskaaksi tullut.** Juuda sanoi: ,fVic> 
kfifl hfin poltettavaksi.'* 

25. Mutta kun hfin tuotiin cdes, Ifi- 
hetti hfin appcnsatyk5. sanoen: „sii- 
tfi miehestfi, jonka nfimfi ovat, olcn 
minfi raskas.** Ja hfin antoi sanoa: 
,>tunnetko, kenenkfi on tfimfi sinclti- 
sormus, rihma ja sauva?** 

26. Ja Juuda tunsi ne. ja sanoi: 
„hfinellfi on oikeus puolellansa mi- 
nua kohlaan, kun en minfi antanut 
hfinellepoikaaniSelaa.'' Kuilenkaan 
ei hfin enempfifi hfintfi maannul. 

27. Kun hfinen sittenpiti synnyttfifi, 
niin katso, kaksoiset olivat hfinen 
kohdussansa. 

28. Ja hfinen synnyttfiissfinsfi pisti 
toincn ulos kfitcnsfi fsilloin sitol apu- 
vaimo siihen punaisen langan, sa- 
noen: „tfimfi tulee ensisli ulos.*' 

29. Mutta kun hfin veti kfilensfi ta- 
kaisin, tuli hfinen veljensfi ulos; ja 
hfin sanoi: „miksis olet sinfi tunkc- 
nut ilscsi esillc?*' Ja hfincUe annet- 
tiin nimi Peres. 

30. Sitte tuli hfinen veljensfi ulos, 
jonka kfidessfi oli sepunafnen lanka; 
ja hfin sai nimen Serak. iA]k.2:4. 

Matt. 1:3. 

39 Luku. 

Josefin palvelus ja vankeus. 

J a Josef vietifn alas Egyptiin; ja 
Potifar, egyplilfiinen mies, ioka 
oli Faraon hovimies ja henkiyartijain 
pfifimies, osti hfinen Ismaelilaisilta, 
jotka hfinen sinne alas vieneet oli- 
vat. 1 Moos. 37:36. Ps. 106:17. 
2. Ja Herra oli Josefin kanssa, niin 



43 



t MOOS. 39. 40. 



ettfi hfin oli onnellinen mies; ja hSn 
oleskeli isAntdns^, Egyptildisen, huo- 
neessa. 

3. Ja hfinen isAnt9nsfi nftki, ettA 
Herra oli hdnen kanssansa; sill5 
kaikki, mitS hdn teki, anioi Herra 
mcnestyi) hSnet k3dess9nsi\. 

4. Ja Josef sai suosion h5nen edcs- 
sdnsd ja luli hAnen palvelijaksensa; 
ja hdn aselli hdnet huoneensa yli, 
ia kaikki mitit hdnelld oli, antoih5n 
n3nen kdleensH. 

5. Ja siitd ajasta kuin hdn olihfinen 
pannut huoneensa ja kaiken lava- 
ransa pUdlle, siunasi Herra sen Egyp- 
lilAisen huoneen Josefin (dhden, ja 
Herran siunaus oli kaikissa niiss3, 
jotkahAnellAkotonajakedollaolivat. 

6. Sentnhden antoi hdn kaikki Jo- 
sefin haltuun, milft hdnellS oli, eikd 
tiedustellut mitddn hdneltfi, paitsi 
sitA ruokaa, jonka hfin s6i. Mutta 
Josef oli sorea-vartaloinen, ja ihana- 
muotoinen. 

7. Ja tapahtui tfimdn jAlkeen, ettd 
hSnen isftntdnsS vaimon himo alkoi 
palaa Josefiin, ja hAn sanoi hfinelle: 
,,makaa minun kanssani/' 

8. Mutta hAn kielsi. ja sanoi isfln- 
tfinsfi vaimoile: „kalso, minun isdn- 
tdni ei tiedusta minulla, mita huo- 
neessa on, vnan kaikki milA hdnellA 
on, antoi hHn minun kAsiini. 

9. £i pidA hAn itseAnsA tAssA huo- 
neessa suurempanu minua, ei my6s 
Ole hAn kieltAnyt minulta mitAAn 
muuta kuin sinul, koska olet hAnen 
vaimonsa; kuinka siis minA niin 
paljon pahaa tekisin ja rikkoisin 
jumalata vastaan?'* 

10. Ja hAn puhui joka (sAivA sen- 
kaltaisia JosefiUe; mutta ei hAn tah- 
tonut maata hAnen kanssansa* eikA 
olla hAnen kanssansa. 

11. Ja tapahtui yhtenA pAivAnA, ettA 
Josef meni huoneeseen askaroitse- 
maan, eikA ollut ketAAn perheestA 
lAsnA. 

12. Ja hAn tarttui Josefin vaippaan, 
sarioen: „makaa minun kanssani.'* 
Mutta hAn jAtti vaippansa hAnen 
kAteensA, pakeni ja meni uios. 

13. Koska hAn nAki , ettA han jAtti 
vaippansa hAnen kAteensA ja pakeni 
ulos, 

14. huusi hAn perhettAnsA, ja sanoi 
heiile: „kalsokaa, hAn on tuonut 
mcille hebrealaisen miehen, saatta- 
maan meitA hApiAAn; hAn tuli mi- 
nun tykOni makaumaan minun kans- 
sani, mutta minA huusin korkialla 
AAneUA. 

15. Ja kun hAn kuuli, ettA minA 
llAnekkfiAsti huusin, JAtti h&n mi- 



nulle vaippansa vi^reeni, pakeni Ja 
meni ulos.'* 

16. Niin hAn pili hAnen vaippansa 
tykonAnsA, siihen asti kuin liAnen 
isAntAnsA tuli kotia. 

17. Ja puhui hAnelle samat sanal, 
sanoen : .,se hebrealainen palvelija, 
jonkasoletmeille tuonut, tuli minun 
tyk6ni, saattamaan minua hAoiAAn. 

18. Mutta kun minA AAneklifiAsti 
huusin, jAtti hAn vaippansa viereeni 
ja pakeni ulos.'* 

19. Kun hAnen isAntAnsA kuull puoH- 
sonsa sanat. joita hAn puhui hAnelle, 
sanoen: „niin on sinun paivelijasi 
tehnyt minuUe," vihastui hftn ko- 
vasti. 

20. Ja isAntA otti Josefin ja pani 
vankihuoneeseen, jossa kuninkaan 
vangit olivat; ja niin hAn oli siellA 
vankiliuoneessa. 

21. Mutta Herra oli Josefin kanssa 

1'a osoitti laupeutensa hAntA kohtaan, 
a antoi hAnen saada suosiota van- 
(ihuoneen johtajan edessA. Ap«t7:9. 

22. Niin johtaja antoi kaikki vangit 
vankihuoneessa Josefin hoi toon, niin 
ettA kaikki mitA siellA tehtiin, se teh- 
tiin hAnen kauttansa. 

23. Javankihuoneen johtaja ei pitA- 
nyl mitAAn murhetia niistA, jotka 
hAnen kAdessAnsA olivat; sillA Herra 
oli Josefin kanssa, ja mitA hAn teki, 
sen antoi Herra menestyA. 

40 Luku. 

Juomanlaskijan ja leipojan unet 

J a sitten tapahtui, ettA Egyplin ku- 
ninkaan juomanlaskija ja leipoja 
rikkoivat herraansa, Egyptin kunin- 
gasta vastaan. 

2. Niin Farao vihastui molempiin 
hovimiehiinsA, juomanlaskijaan ja 
leipojaan. 

3. Ja heitti heidAt vankiuteen hen- 
kivartijain pAAmiehen huoneeseen, 
siihen vankihuoneeseen, jossa Josef 
oli vankina. 

4. Ja henkivartijain pAAmies pani 
Josefin heidAn kanssansa, palvele- 
maan heitA. Jaheolivatvankiudessa 
jonkun aikaa. 

5. Kun n^t Egyptin kuninkaan juo- 
manlaskija ja leipoja olivat sidottuna 
vankihuoneessa, nAkivAt he molem- 
mat samana yOnA unta, ja kunkin 
unella oli oma merkityksensA. 

6. Kun Josef tuli aamulla heidAn 
tykOnsA ja nAki heidAn murheelli- 
seksi, 

7. kys]^i hAn niiltA Faraon palveli- 
joilla, jotka hAnen kanssansa her- 
ransa vankihuoneessa olivat, Ja sa- 



a 



1 MOOS. 40. 41. 



noi: „iniksi te olette tfinfipftnflniin 
surulliset?** « 

. 8. He vastasivat hfintft: „ine olem- 
me nfthneet unia, eikd ole sen selit- 
tSjaa*" Niin sanoi Josef heille: ,«Ju- 
roalan on selitys ; kuitcnkin kerto- 
kaa se minulle?* 

9. Niin yllmmainen juomanlaskija 
kertoi unensa Josefille, ja sanoi hA- 
nelle: „mina n5in unta, ja katso, 
viinipuu oil minun edess3ni. 

10. Ja siind viinipuussa oli kolme 
haaraa; ja se putikesi viheriOitse- 
maan, kukat synlyivfit ja sen rypfi- 
leel tuleentuivat viinimarjoiksi. 

11. Ja Faraon juoma-astia oli mi- 
nan kfidessdni; niin minS otinviini- 
Qiarjat ja pusersin ne Faraon juoma- 
asUaan, ja annoin sen juoma-astian 
Faraon kSteen.** 

12. Silloin sanoi Josef h3nelle: „tS- 
n)§ on sen selitys: kolme haaraa 
oval kolme pAivaft; 

13. kolmen pAivSn perSstS korottaa 
Farao sinun pdAsi, ja asettaa sinuf 
jdllensS entiseen virkaasi; ja sinA 
annat Faraon kAteen juoma-astian 
niinkuin ennenkin, kun olit hAnen 
juomanlaskijansa. 

14. Mutta muista minua, kun si- 
nun hyvin kAy, ja tee se laupeus 
minuUe, ettA puhuisit minusta Fa- 
raolle, ja antaisit ottaa minun tAAUA 
ulos. 

15. SillA mlnA olen vAAryydellA vie- 
ty Hebrealaisten maalta; enkA ole 
lAAllAkAAn milAAn tehnyt Jonka tAh- 
den minua olisipitAnytpanna tAliAn 
vankihuoneesen.'* i Moos. 37:28. 

16. Kun ylimmAinen leipoja nAki, 
etIA selitys oli hyvA, sanoi hAn Jo- 
sefille: „minA myOs uneksuin, ja 
kalso, kolme vehnAIeipA-koria oli 
minun pAAni pAAIlA. 

17. Ja ylimmAisessA korissaolikaik- 
kinalsia leivoksia, joita Farao syO; 
ja linnut sOivAt niitA korista minun 
pAAnI pAAltA.*' 

18. Silloin vastasi Josef ja sanoi: 
„tAmA on sen selitys: kolme koria 
ovat kolme pAivAA. 

19. Ja kolmen pAivAn perAstA ylen- 
(Au Farao sinun pAAsi, ripuslaen 
sinul hirsipuuhun; ja linnut syOvAt. 
sinun lihaasi." ' 

20. Ja tapahtui kolmantena pAivA- 
nA, kun Farao vietti synt}rmApAi- 
vAAnsA, teki hAn pidot kaikille pal- 
velijoilleiisa , ja ylensi silloin sekA 
ylimmAisen juonianlaskijan ellA v- 
limmAisen lelpojan pAAn palvelijoit- 
Icnsa kesken. 

21 HAn asetti ylimmAisen juoman- 
laskijan jAUeen entiseen virkaansa, 



niin ettA hAn antoi Faraon kAteen 
juoma-astian. 

22. Mutta ylimmAisen lelpojan an- 
toi hAn hirtlAA, niinkuin Josef oli 
heille selityksessAAn sanonut. 

23. MuUa ylimmAinen juomanlas- 
kija ci muistanut Josefia, vaan un- 
hotti hAnen. 

41 Luku. 

Faraon uni. Josefin ylennys. N&lkftvuodet 

J a tapahtui kahden ajastajan perAs- 
tA, eltA Farao nAki unen. HAn oli 
seisovinansa virrnn lykAnA. 

2. Ja kalso, virrasia astui ylOs seit- 
semAn kaunista ja lihavala lehmAA, 
jotka kAvivAt laitumclla heinikossa. 

3. Ja katso, niitten perAsIA tuli vir- 
rasia yl6s toisel seilscmAn lehmAA, 
rumaa ja laihaa, ja seisahluival nil- 
den toisten lehmAin viereen virran 
reunalla. 

4. Ja ne rumat ja laihat lehmAt 
sOivAl ne seilsemAn lihavala ja kau- 
nista IchmAA. Niin Farao herAsi. 

5. Ja hAn nukkui jAlIeen ja nAki 
toisen kerran unta; ja katso, seilse- 
mAn lAysinAisIA ja kaunista lAhkA- 
pAAIA kasvoi yhdessA oljessa. 

6. Ja katso, seilsemAn pienIA ja ilA- 
tuulen surkaslullamaa tAhkApAAlA 
kasvoi niiden jAIkeen. 

7. Ja ne seilsemAn laihaa lAhkAA 
nielivAt ne seilsemAn paksua ja lAy- 
sinAisIA lAhkApAAIA. Niin Farao he- 
rAsi ja huomasi, etIA se oli uni. 

8. Aamulla oli hAnen mielensA le- 
volon; ja hAn lAhetli ja antoi kutsua 
kokoon kaikki Egyplin noidat ja tie- 
lAjAt; ja Farao kertoi heMle unensa. 
Mulla ei ollut ketAAn, joka ne osasi 
selillAA FnraoUe. Dan. 2:1 s. 

9. Niin puhui ylimmAinen juoman- 
IaskijaFaraolle,sanoen: „minA muis- 
Ian tAnApAnA minun rikokseni. 

1 Moos. 40:1 8. 

10. Kun Farao vihaslui palvelijoi- 
hinsa, ja pani minun ja yliinmAisen 
leipojan vankiutccn henkivartijain 
pAamiehen huonccsen, 

11. niin me molemmat nArmme sa- 
mana yOnA unia, ja kummankin 
unella oli omn mcrkilyksensA. 

12. Ja siellA oli nicidAn kanssamme 
hebrealainen nuorukainen, henki- 
vartijain pAAmiehcn palvelija, jame 
kerroimme hAnclle, ja hAn selitli 
meille mcidAn uncmme; kumman- 
kin unen mukaan hAn antoi seli- 
lyksen. 

13. Ja niinkuin hAn meille selllli, 
niin se tapahtui; sillA minA uselel- 
liin minun virkaani, ja hAn liir- 
letliin." 



45 



1 MOOS. 41. 



14. Niin Ifihetti Farao. ja antoi kut- 
sua Josefin; ja he kiireesti ottivat 
liAnen ulos vankihuoneesta. Ja hfln 
antoi itsensft kerit^ ja muutti vaat- 
teensa, ja tuli niin Faraon tykO. 

Pa. 106:20. 

15. Niin sanoi Farao Josefille: ^mi- 
na olen unta nStinyt, eikft ole sen 
selittfljata. Mutta minft olen kuul- 
lut sinusta sanottavan, ettS kun 
unen kuulet, niin sinft taidat. sen 
selillfiil/' 

16. Josef vastasi Faraota,- sanoen: 
„ei ole se minun voiroassani ; mutta 
J u mala tahtoo FaraoUe teiidft hy- 
vfia." 

17. Silloln puhui Farao Josefille: 
„nftin unta, ettfi seisoin virran ran- 
nalla. 

18. Ja katso, virrasta tuli ylOs seit- 
semfin lihavata ja kaunista lehmAd, 
jotka kftvivflt laitumella heinikossa. 

19. Ja katso, heiddn jdikeensft tuli 
yl6s toiset seitsemftn pientfi, rumaa 
ja laihaa lehmfld ; en ole koko Egyp- 
tin maalla nflhnyt niin rumia. 

20. Ja nftm§ laihat ja rumat lehinAt 
sOivdt ne ensimmftiset seitsemSn li- 
havata lehmfiA. 

21. Ja kun he olivat syOneet, ei hei- 
dftn pfiailftnsfl ensihkafin luntunut, 
ettS olivat syOneet; vaan he olivat 
yhtS rumat kuin ennenkin. Sitten 
minA herfisin. 

,22. Ja taas nAin minA unessa'seit- 
semAn tAysinAistA ja kaunista tAh- 
kApAAtA kasvavan samassa oljessa. 

23. Sen jAlkeen nousiylOsseitsemAn 
kuivaa, pientA jaitAtuulensurkastut- 
tamaa tAhkApAAtA. 

24. Ja nAmA pienet tAhkApAAt nieli- 
vAt ne seitsemAn kaunista lAhkApAA- 
lA. MinA olen tAmAn kertonut tietA- 
iille, mutta ei ole yhtAAn, joka sen 
minulle selittAisi.'* 

25. Silloin sanoi Josef FaraoUe: ^Fa- 
TaonunetmerketsevAtsamaa;Jumala 
ilmoittaa FaraoUe, mitA HAn on te- 
kevA. 

2^. Ne seitsemAn kaunista lehmAA 
ovat seitsemAn vuotta, ja ne seitse- 
mAn tAysinAistA tAhkApAAtAova^nyOs 
seitsemAn vuolta; ne merkitsevAtsa- 
maa. 

27. Mutta ne seitsemAn |aihaa ja 
rumaa lehmAA, jotka. astuivat yl.Os 
heidAn jAlkeensA^ ovat seitsemAn 
vuotta, ja samoin ne seitsemAn lai- 
haa ja itAtuulen surkastuttamaa tAh- 
kApAAtA; seitsemAn nAIkAvuotta on 
tuleva. 

28. TAtA minA tsrrkoitin, kun Fara- 
oUe sanoin, ettA Jumala ilmOittaa 
Fc^aolle» mi^AilAn on tekevA. 



29. KafsOfSeitsemAnviljaista vuolta 
tulee koko Egyplin maahan. 

30. Ja niiden JAlkeen tulee seitse* 
mAn nAIkAvuotta, niin ettft entinen, 
viljan kyllyys unhotetaan Egyptin' 
maalla, ja kallis aika hAvittAA maa- 
kunnan. 

31. Ja ei enAA mitAAn tiedetA viljan 
kyllyyde^tA maakunnassa tAmAn kal- 
liin fiijan tAhden, joka tulee; sillA 
se on ol6va ^ngen raskas. 

32. Mutta kun uni nAytettiin kaksi 
kertaa FaraoUe, se tietAA, ettA Juma- 
la on yarmasti. pAAttAnyt asian, ja 
Jumala on plan sen tekevA. 

33. EtsikOOn siis-Farao toimellista 
ja taitavata miestA, aisettaaksensa 
Egyptin maan yli. 

34. TehkOdn Farao niin ; ja asetta* 
koon myOs pAAIIysmiehiA maakun- 
taan, ja antakoon kpota viidennen 
osan viljaa EgypUn jnaasta niinA 
seilsemAnA viljavuonna. 

35. Ja he kootkoot kaikkinaista ra- 
vintoa niinA hyvinA vuosina, jotka 
tulevat, ja pankoot jyviA Faraon hal- 
tuun varaksi kaupungeissa, ja pitA- 
k06t ne tallella, 

36. niin ettA ruokaa olisi tAhteelle 
pantu maakunnalle niinA seitsemAnA 
nAlkAvuonna, jotka tulevat Egyptin 
maahan. Siten ei maan tarvitse hA- 
vitA nAljAn tAhden.*' 

37. TAmA puhe kelpasi FaraoUe ja 
kaikille hAnen palveliioillensa. 

38. Ja Farao sanoi palvelijoillensa : 
„taidammeko me lOytAA ionkun, jos- 
sa Jumalan Henki on, niinkuin tAs- 
sA miehessA?'* 

39. Ja Farao sanoi Josefille: „kos- 
ka Jumala on tAmAn kaiken sinulle 
ilmoittanut, niin ei ole yhtAAn niin 
taitavata ja ymmArtflvAistA kulii si- 
nA olet. 

40. Slnun pitAA oleman minun huo- 
neeni pAAUysmiehenA, ja sinun sa- 
nallesi pitAA kaiken minun kansani 
kuuliaisen oleman; ainoastansa ku- 
ninkaallisessa istuimessa tahdon mf- 
nA olla korkiampi sinuat* Ps. 105:21. 

. Ap.t7M0. lMakk.2:53L 

41. Ja Farao sanoi vielA Josefille: 
pkatso, minA olen asettanut sinun 
koko EgypUn haltijaksi.'* 

42. Ja Farao otti sormuksen kAdes- 
tAnsA ja pani sen Josefin kAteen, pu- 
etti hAnen kalleisiin liinavaatteisiin* 
ia ripusti kultaviyat hAnen kaula- 
tiansa. 

43. Ja hAn antoi hAnen ajaa vau- 
nussa lAhimpAnA kuningasla ja kAs- 
ki huulaa hAnen edeliAnsA: „Ab- 
rek!'' Ja hAn asetti hAnen koko E- 
gyptin maan ylii 



46 



1 MOOS. 41. 42. 



44. Ja Farao sanoi Josenilc: ,.mina 
olea Farao; ja ilman sinun tahdol- 
tasl filkdOn yksikfifin nostako kfit- 
tflnsd taikka Jalkaansa koko Egyp- 
tin maassa.** 

45. Ja Farao anloi Josefillc nimen : 
Safnal-Panea, ja antoi hflnelle As- 
natin, Onin papin Poliferan lylia- 
ren. vaimoksi. Niin Josef laksi mal- 
kustamaan katsellaksensa Egyptin 
maata. 

46. Josef oli kolmenkymmenen ajas- 
taikainen, kun hfin seisoi Faraon, 
Egypiin kuninkaan edessfi. Ja Jo- 
sef laksi Faraon tykOd, ja vaeisi ym- 
piri kaiken Egyptin maan. 

47. Ja maa anloi ylen runsaat sa- 
dot niind scitsemAnfi viljavuohna. 

48. Ja hSn kokosi nlinS seitsemSnd 
vuonna kaikkinaisen elatuksen, jo- 
ka oli Egyplin maassa, ja pani sen 
iallelle kaupunkeihin; mith ela!d.s- 
ta maa kasvoi kunkin kaupungin 
ympSristdlia, sen hfln siihen tallelie 
pani. 

49. Niin Josef kokosi sangen pal- 
jon jyvia, niinkuin santaa me- 
ressa, siilien asti etlfi lakattiin niitfi 
taslcemasia, silia ne olivat epaiu- 
kuisel. 

50. Ja Josefille syntvi kaksi poikaa, 
ennenkuin kallis aika tuli; ne syn- 
nylli handle Asnal, Potiferan, Onln 
MDin. lyiar. i Moos. 46:20. 48:6. 

51. Ja han antoi esikoisellensa ni- 
men Bfanasse; „siIia/'sanoi h§n, „Ju- 
mala on anianut minun unliottaa 
kaiken vaivani, ja kaiken isfini huo- 
necn.** 

52^ Mulla toiselle anloi han nimen 
praim; „silia," sanoi han, ^Juma- 
ja on tehnyt minun hedelmailiseksi 
karsimyksieni muassa." 

53. Kun ne seitsemdn viljavuotta 
ohval kuluneel Egyplin maalla, 

54. rupesi seitseman naikavuotta 
tulemaan, niinkuin Josef oli sano- 
nut; ja naika luii kaikkiin maakun- 
Uin. Multa koko Egyptin maassa 
oU leipaa. Ps. io&:i6. 

55. Kun Egyptin maa myOs karsi 
naikia.huusi kansa Faraolta leipaa. 
Muila Farao sanoi kaikille Egypli- 
lAisiile: ,.menk2(at Josefin tykO; mi- 
la han sanoo teille, se tehkaai." 

56. Kua nyt naika oli koko maas- 
sa, avasi Josef kaikki jyvaaitat joka 
^kassaju mfiiviljaaEgyptiiaisille. 
Mutta naianhata lull aina raskaam- 
maksi Egyplin maaila; 

57. Ja kaiKki maakunnat tuli vat 
Egyptiin oslamaan viljaa Josefil- 
ta: silia bata tult yhA suuremmaksi 
fcaiklssa maissa. 



42 Luku. 

Joseftn veljien enslmiuainen inatka 
Egyptlln. 

Mutta kun Jaakob kuuli,ettaEgyp- 
tissa oli jyvia myOda, sanoi nan 
pojillensa: „mita te Icatselette toi- 
nen loistanne?*' 

2. Ja han sanoi: „katso, mina olen 
kuuUut Egyptissaolevaniyvia; men- 
kaat alas sinne ia ostakaat meille 
sielta« etta me eiaisimme emmcka 

kuolisi.'* Ap. t. 7:12. 

3. Niin laksi kymmenen Josefln 
veljea matkalle oslamaan jyvia E- 
gyptista. 

4. Multa Benjamlnia, Josefin vel- 

iea, Jaakob ei lahettanyt veljien 
Lanssa; siiia han pelkasi, etta jotain 
vahinkoa hanelle tapahtuisi. 

5. Niin laksivat Israeiin lapset mui- 
den joukossa matkalle jyvia osla- 
maan; siiia.. naianhata oil Kanaan- 
maalla. 

6. Mulla Josef oli kaskynhaltijana 
maassa; han antoi myOda jyvia kai- 
kelle maan kansallc. Niin lulivat Jo- 
sefin veljel, ja kumartuival maahan 
kasvoillensa hdnen eteensd. 

7. Kun Josef naki veUensd, lunsi 
hanheidat; mutta ban lekeytyimuu- 
kalaiseksi heiia kohtaan, puhutleli 
heita ankarasli ja sanoi beille : „mis- 
ta le lulelle?" He vastasival: „Ka- 
naanmaalla , oslamaan jyvia syOta- 
vaksemme.'' 

8. Ja Josef lunsi veljensa; vaanbe 
eivai hania tunteneet. 

9. Multa Josefin mieleen johtuivat 
ne unet, jolka ban oli nahnyl heista. 
Ja ban sanoi beille: „te olette va- 
koojal, ja olette tuUeel katsomcan, 
misia maa avoinna olisi.'' 

lMoo6.37:6s8. 

10. He vastasival bama: „ei suin- 
Icaan, berrani; palvelijasi oval tul- 
leet oslamaan jyvia. 

11. Me olemme kaikki ybden mic- 
ben pojat, ja olemme rehellisia mie- 
bia; me, sinun palvelijasi, emme 
koskaan ole vakoojia olleel."* 

12. Mulla ban sanoi beille: „val 
niin; le olette tulleet kalsomaan, 
mista maa avoinna olisi.*' 

13. He sanoival: „me, sinun pal- 
velijasi, olimme kaksiloisla veljesia, 
ybden mieben pojaLKanaanmaalla; 
ja nuorin on nyt isamme tyk6na, 
mutta yksi ei ole enaa elossa.** 

1 Moos. 44:20. 

14. Josef sanoi beille: „niinan,kuin 
olenleille sanonut : te olette vakoojia. 

15. Ja mina tabdon Iciia koetella* 
Nila (otta kuin Farao eiaa, ellepa 



47 



1 MOOS. 42. 43. 



tfiflltA pfifise, jollei nuorin veljenne 
tule tSnne. IM008.437&. 

16. LflhettHkAflt yksi keskuudestan- 
ne, joka tuo teidfin veljenne tfinne. 
Muttatemuutsaattejfiadfl tSnnevan- 
giksi; nSin lahdoil koetella« oletteko 
puhuneet totta. Mutta ellei niin ole, 
niin oletle vakoojia, niin totta kuin 
Farao elSft.** 

17. Sitten li9n pani heidSt vankeu- 
teen kolmeksi pflivdksi. 

18. Ja kolmantena pftivfind sanoi 
Josef lieiile: „jos tahdotte eifld, niin 
tehkfi5t n&in, siI15 minft pelkSfin Ju- 
malala : 

19. .los olette rehellisiA miehift, niin 
antakaat yhden veljistfinne olla si- 
dottuna vankihuoneessanne; mutta 
menkflSt te muut ja viekfiHt kotia, 
mitA ostaneet olette lidikdS vastaan 
kotonanne. 

20. Tuokaat sitten nuorin veljenne 
minun tykdni; ja jos sananne tia- 
vaitaan todeksi. niin ei teidftn tar- 
vitse kuolla.'* Ja he lupasivat sen 
tehda. 

21. Mutta he sanoi vat foinen toi- 
sellensa : ^me olemme totisesti vian- 
alaiset meidfin veljemme tfthden; 
sillfi me nSimme hfinen sielunsa ah- 
distuksen, kun h9n meiltft armoa 
rukoili, emmekfi kuulleet h&ntft. 
Sent&hden on tSmft ahdistus tuUut 
meidfln pfiflllemme.** ' 

22. Ruuben vastasi heitft, sanoen: 
„enkO mind sanonut teille: ,ftlkfifit 
tehkOvfiftryyttS nuorukaiselle/ jaet- 
te tahtoneet kuuUa? Nyt hfinen ve- 
rensft meilld vaaditaan.'* 1 Moos. 87:21. 

23. Mutta he eiv5t tienneet Josefin 
sitft ymmdrtfivfin; sillft hftn puhui 
heille tulkin kaulta. 

24. Ja hfin kfiSnsi itsensS pois heis- 
ta ja itki. Kun han jaileen kaantyi 
"fieidan puoleensa ja puhutteli helta, 
otti has Simeonin heidan keskuu- 
destaan ja antoi sitoa hanet heiddn 
nahtensa. 

25. Ja Josef kaski tay ttaa beiddn sak- 
kinsa jyvilia ja panna heiddn rahan- 
sa jaileen itsekunkin omaan sak- 
kiin, ja antaa heille evasta matkalle. 
Ja heille tehtiin niin. 

26. J a he pani vat jyvansa aaseinsa 
selkaan ja laksivat sielta. 

27. Kun yksi heista avast sakkinsd, 
antaaksensa ruokaa aasillensa yOsi- 
jalla, huomasi han rahansa sakkin- 
sa suussa, 

28. ja sanoi veljillensa: „minulle 
on annettu rahani takaisin; katso, 
tassa ne ovat sakissani.'* Niin he 
saikahtyivat ja hamihastyneena kat- 
selivat toinen toistaan jasanolvatt 



,,miksi on Jumala meille niin teh- 
nyt?" 

29. Kun he tulivat isdnsa Jaakobin 
tykO Kanaanmaahan, ilmoittivat he 
hanelle kaikki.mita heille oli tapah- 
tunut, sanoen: 

30. «,Se mies, joka oli maakunnan 
herra, puhutteli meita ankarasti, ja 
piti meita maan vakoojina. 

31. Ja me vastasimme hanta: ,me 
olemme rehellisia miehia, emme- 
ka ole ikanansa olleet vakoojia. 

32. Me olimme kaksitoisia veljestS, 
isamme poikaa; yksi ei ole enSft 
elossa, ja nuorin on nyt isamme ty- 
kOna Kanaanmaalla.* 

33. Niin sanoi se miesjoka oli maa- 
kunnan herra, meille: ,siita olen na- 
keva, oletteko rehellisia miehia: jdt- 
takaat yksi teidanveljistanne minun 
tykdni« ja ottakaat mitft olette osta- 
neet elatukseksenne ja menkaat pois* 

34. Ja tuokaat sitten teidan nuorin 
veljenne minun tykOni. niin mind 
ymmarran, ettette ole vakoojia, vaan 
rehellisia miehia ; silloin annan 
mina myOs teidan veljenne teille ta- 
kaisin, ja te saatte tehda kauppaa 
tassa maakunnassa.*' 

35. Kun he sitten tyhjensivat sak- 
kinsa, lOysivat he kukin sftkissansll 
Oman rahakaarOnsa. Kun he tamdn 
nakivat, hammastyivat he ja heidan 
isansa. 

36. Niin sanoi Jaakob, heidan if fln- 
sa, heille: „te saatatte minun lap- 
sittomaksi. Josef on poissa, Simeon 
on poissa, ja Benjamininkin tahdot- 
te te nyt vieda pois; nama kaikki 
tuleval minun ylitsenif' 

37. NiinRuuben vastasi isailensa, sa- 
noen: „tapa molemmatpoikani, jol- 
len mina hanta jaileen sinulle tuo ; 
anna vaan hanet minun haltuimi, 
mina hanen sinulle jaileen tuon.t* 

38. Mutta ban sanoi: „ei minnii 

Soikanisaa menna teidanka'nssanne. 
[anen veljensa on jo kuollut, ja han 
on jaanyt yksin; jos hanelle tapah- 
tuisi jotakin pahaa tielia, jota te va- 
ellatte.niln te saattaisitte minun har- 
maat karvan'i murheellti liautaan.*^ 

^ 43 Luku. 
Josefln veljien toinen matka. Bgyptiln, 

Mutta naianhSta oli suuri. maassa. 
2. Ja kun olivat loppuuh syOneel 
ne jyvat, kuin be EgypUsta tuoneet 
olivat, sanoi heidan isansa heille: 
„menkaat jaileen sinne ja ostakaal 
meille jotakin elatusta.'* 
3. Niin vastasi hanta Juuda, sano- 
en: „se.mies vaku.utti meill« iinka- 



48 



1 MOOS. 43. 



nisti ja sanoi : ,ftlkMt tulko minan 
eteeni, jollei teidAn veljenne ole tei- 
dftn kanssanne.* 

4. Jos siis sinft nytlfihelfllveUemme 
meidSn kanssamine, niin Iflhaemtne 
malkalle ostamlian sinulle elati:^ta. 

5. Vaan ellet hftntft IfthetS, niin em- 
memekfifinsinneUhde; sillfisemies 
sanoi meille: ,ftlkfi§t tulko minnn 
eteenf , jollei teid§n veljenne ole tei- 
dSn kanssanne/*! Moos. 42:16, 20. 44:28. 

6.SiUoin sanoi Israel: ^miksi te teitte 
minulle sen pahan,ellfi sanoittesille 
mieheile teillft vielft olevan veljen?'* 

7. He vaslasivat: „8e mies Hedus- 
teli meistS ja suvastamme niin tar- 
kas(i,sanoen: ;vie]&kO teidfin isfinne 
eisa? Onko teillft vielft veljefl?' Niin 
me kerroitnme hftnelle asi^n oikein. 
Taisimmeko me tietfifi hfinen sano- 
▼an: .tuokaat veljenne tfinne?** 

S. Ja Juuda sanoi isfillensft Israe- 
UUe: „lfth€tS nuomkainen mlnun 
kanssani, niin me valmlstaumme 
Utiteinftftn matkaan, ettft me elfii- 
simme emmekfi kuolisi, sekft me 
ettfi sinft ja meidfin lapsemme. 

9. Minft takaan hfinen edestfinsft, 
vastaan hSnestfi; saat vaatia hfinet 
minan kfidestftni. Jollen minft tuo 
hfolfi jfilleen sintm tykOsi, ja pane 
kftnUl sinun etees, niin minft olen 
vikapftft sinun edessftsikokoelfimftnl 
ajan. l Moos. 44:32. 

10. Siim jollei meillfl olisi olhit vii- 
vytystft, totisesti olislmme jo toisen 
kerran tuUeet takaisin.'* 

11. Niin sanoi Israel, heidfin isfin- 
siheille: ,Jos nyt kumminkin niin 
ptIU oleman, niin tehkftfit nftin : of- 
lakaat maan parliaista hedelmistft 
teidSn astioihinne, ja viekftfit sille 
mjehelle lahjoja: vfthfin balsamia 
ja banajala, rohtoja ja hajupihkaa, 
daadeleita ja manteleita. 

12. Ottakaat myOs toinen raha mU* 
kaanne, paits! sitfi rahaa, jonka te 
toitte takaisin sfikki^n suussa ; saat- 
laa oUa, ettft se on epfthuomiosta 
tepahtunut. 

13. Ottakaat myOs veljenne mukaan- 
^\ ia valmistautukaat jftlleen me- 
nemafin sen miehen tykO. . 

li Jumala kalkklvaitias suokoon 
teidfln saada laupiuden sen miehen 
edessfl, ettft hftn pftfistftisi teilletakai- 
^n toisen veljenne ja Benjaminin. 
aatta minft, jos mfnun tftytyy lapsit- 
^omaksl tulla^tahdon lapsitonnaollat* 

15. Niin miehet ottivat lahjat, ja 
nhdenkertaiset rahat mukaansa, se- 
k* Benjamhiinf Ja he nousivat ja 
ipenivftt Ei^ptiin, Ja astuivat Jose- 
la eleeiu 



16. Kun Josef nftki Benjaminin hel* 
dftn kanssansa, sanoi hftn hovimes* 
tarilleen : „vie nftmfl miehet minun 
huoneeseeni, tee teurasta ja valmis- 
ta ateria; sillft heidftn tulee minun 
kanssani syOdft pfiivftllistft.'* 

17. Mies teki niinkuin Josef oli hftn 
nelle kfiskenyt, ja vei miehet Jose^ 
fin huoneeseen. 

18. Mutta he pelkftsivftt, kun he vie- 
tiin Josefin huoneeseen, ja sanoivat : 
„me viedSftn tftnne sen rahan tfth- 
den, jonka me viimein lOysimmesfi- 
keistamme; sillS he aikovat hyOkfttft 
meidftn pftfiUemme ja ottaa meidftt 
oniksensa sekft riistftfi melltft aa- 
simme." 

19. Sentfihden he menlvftt Josefin 
hovimestarin tykO, ja puhuttellvat 
hftntft huoneen oven edessft, 

20. ja sanoivat: .,kuule meitfi, her* 
ra t Kun edelUsellfl kerralla olimme 
tSftllft ostamassa jyvlft elatuksek- 
semme, 

21. Ja sitten tulimme ydpaikkaan, 
ja avasimme sftkkimme, niin oli if- 
sekunkin rahat hftnensftkkinsfisuus^ 
sa, tftysipainoiset rahat; sentfthden 
olemme nyt ne jftlleen tuoneet my5- 
tftmme. l Moos. 42:3S. 

22. Ja me olemme myOs tuoneet 
mukaamme toiset fahat ostaaksem- 
me jyvift ; sitfi emme tiedfi, kuka on 
entiset rahamme paunut meidftn sftk- 
kiimmei* 

23. Mutta hftn sanoi: „olkaat hy- 
vflssft turvassa, ftlkftSt peUfitkO: tei- 
dfin Jumalanne ja teidftn isftnne Ju- 
mala on antanut teilleaarteen teidftn 
sftkkiinne; teidftn rahanne olen minft 
saanut.'" Ja hftn to! Simeonin hei- 
dftn' tyktosft. 

24. Ja mies vei heidfit Josefin htio- 
neeseen. asettf heille vettft pestft 
heidftn jalkojansa, ja antoi ruokaa 
heidfin aaseillensa. lMoo&i8:4. 

25. Mutta he valmistivat lahjojan- 
sia, ennenkuin Josef tuli pfiivfillisel- 
le; sillft he oli vat kuulleet, ettft hei- 
dftn piti siellft syOmftn. 

26. Kun sitten Josef tuli huoneeseen, 
toivat he lahjat kfisissftnsA hftnelle 
ja kumartuivat maahan hftnen e- 
teensft 

27. Ja hftn tervehti heilft ystftyftlU- 
sesti ja sanoi : ..,onko teidftn vahha 
isftnne, josta minulle puhuitte. ter< 
veenft? VielfikO hfin elSft?" 

28. He vastasiVat : „sinun palvelljasi, 
meidftn isftmme, vol hyvin Ja elftft 
vielfi ;'' ia he kumartuivat Ja maa- 
han lankesivat hfinen eteensff;. 

29. Niin hfin nosti sllmfinsft Ja nftki 
veljensft Be^jaminib, ftitinsft pojAn, 



/ 



49 



1 MOOS. 43. 44. 



ja sanol : ttOnko tftmft teidfin nuorin 
veljenne, josta le sanoitle minulle?** 
Ja sanoi vielA: ,,Jumala oikoon si- 
nulle armollinen, minun poikani V* 

30. Mutta Josef puhui hfllStsesti; 
sill5 liikutus valtasi hflnen syddm- 
mcnsS, koska hAn rakasti vcljefinsfi, 
ja lifin elsi tilaisuutta itkedksensH, 
ja meni kammariinsa ja itki siellS. 

.SI. Si (ten, kuii hSn oli pessyt kas- 
vonsa, tuli hdn ulos; ja tidn nillitsi 
itsensS, ja sanoi : „(uokaa( ruokaa!" 

32. Niin pantiin esille ruokaa eri- 
nftnsS hAnclIe,- ja erindnsA heille, 
niin my5s Egyptildisille, jotka hfl- 
nen kanssansa atrioitsivat, erinilns5; 
sillfl Egyptilfliset eivflt syO Hebrea- 
laislen kanssa, se on EgyptilSisille 
kauhistus. l Moos. 46:34. Dan. 1:8. 

33. Ja he istutettiin vaslapSdtft hSn- 
td, esikoinen ensin esikoisuulensa 
tflhden, ja sitten nuoremmat aina 
ikflnsfl mukaan. Sitd miehet ihmet- 
telivflt keskendnsH. 

34. Ja heille kannetliin ruokaa hfi- 
nen pOydflltSnsfl; mutta Benjami- 
nillc viisi kerlaa enemmin kuin 
muille. Ja he joivat ja tulivat iloi- 
siksi hflnen kanssansa. 

44 Luku. 
Josef koettelee velji&nsft. 

Cenjfllkeen Josef kflski hovimesta- 
X ^riansa, sanoen: ,4flytS mieslen 
sflkit jyvillfl, niin paljo kuin niihen 
mahtuu, ja pane itsekunkin rahat 
hflnen sflkkinsfl suuhun. 

2. Ja minun maljani, se hopiamal- 
ja, pane nuorimman sflkln suuhun, 
ynnfl hflnen jyvflinsfl hinnan kans- 
sa.** Ja hHn teki niinkuin Josef hfl- 
nelle kflski. 

3. Aamulla pflivfln valjetessa pflfls- 
t^ttiin miehet menemflfln aaseinensa. 

4. Mutta kun he oiivat IShteneet 
kaupungista, eikfl vielfl kauas jou- 
llunect, sanoi Josef hovimestarillen- 
sa: „nousc ja aja takaa miehifl, ja 
kun heidftt saavutat, niin sano heil- 
le: ,miksi te olette hyvfln pahalla 
maksaneet? 

5. EikO teillfl se ole, josta minun 
herrani juo, ja josta hfln salaluita 
asioita tiedustelee? Te olette pahoin 
tehneet," 

6. Ja kun t^fin ^aavutti heidflt, pu- 
hui hfln nflmfl sanat heille. 

7. HevastasivathAntfl: „miksiherra 
senkaltaista puhuu? Pois se, ettfl si- 
nun palvelijasi niin tekisivflt. 

8. Katso, rahat, jotka me I6ysimme 
sflkkiemme suusta, olemme me jfll- 
leen sinuUc tuoneet Kanaanmaaita ; 



kuinka sifs olisimme varastaneet 
hopiata tflhi kultaa sinun herrasi 
huoneesta? 

9. Jonka tykdfl sInun palvelijoistasi 
se lOydetflfln, hfln kuolkoon ; ja me 
muut tahdomme jflfldfl orjHcsi her- 
rallenl." 

10. Hfln sanoi heille: „hyvfi, oikoon 
teidfln sananne jSlkeen ; jonka tykdfl 
se lOydetflfln, hfln oikoon minun or- 
jani. Mutta te muut olette vapaaf 

11. Ja he laskivat kiireesti kaikki 
sflkkinsfl maahan, ja jokainen avasi 
sflkkinsfl. 

12. Ja hfln etsi, ruveten vanhim- 
masta niin nuorimpaan asti; ja ho- 
piamalja Iflydettiin Benjaminln sfl- 

13. SjUoin he repflisivflt vaatteensa, 
ja itsekukin pan! kuormansa aasin 
selkflfln, ja kaikki palasivatkaupun- 
kiin. 

14. Ja Juuda veljinensfl meni Jo- 
sefin huoneeseen, jossa hfln vielfl 
silloin oli ; ja he lankesivat maahan 
hflnen cteensfl. 

15. Silloin Josef sanoi heille: „min- 
kfl tydn olettekaan tehneet? EttekC 
te kfisitfl, ettfl senkaltainenmies kuin 
minflolenkyllfltietflflsalaisetasiat?*' 

16. Niin Juuda sanoi: ,,mitfl me 
vastaamme herralleni, mitfl me pu- 
humme, taikka millfl me taidamme 
itseflmme puolustaa? JumalaonlOy- 
tflnyt sinun palvelijaisi vflflryyden. 
Katso, me olemme herramme orjat, 
sekfl me, ettfl se, jolta malja 16y* 
deltiin." 

17. Mutta hfln sanoi : „pois se, ettft 
minfl 4>iin tekisin! Se mies, jolta 
malja on Idydetty, oikoon minun 
orjani; mutta menkflflt te muut rau- 
hassa isflnne tykfl.*' 

18. Silloin astui Juuda hflnen ty- 
k6nsfl, ja sanoi : ,,ah minun herrani, 
suo nyt sinun palvelijasi puhua yksi 
Sana minun herrani kuullen, ja fll* 
kflOn sinun vihasi syttykO sinun pal- 
velijata kohtaan; sillfl sinfl olet niin- 
kuin Farao. 

19. Herrani kysyi palvelijoiltansa, 
sanoen ; ,onko teillfl isflfl taikka vel- 
jeflr 

20. Niin me vastasimme herralleni: 
,meillfl on vanha isfl, ja yksi veli, 
syntynyt isfln vanhalla iflllS, ja 
hfln on vielfl nuorukainen; mutta 
tflmfln veli on kuoUut, ja hfln on 
yksinSnsfl jflflny t flidistflnsfl , ja hfl- 
nen isfinsfl pitflfl hflnen rakkaana.* 

21. Niin sinfl sanoit palveiyoillesi : 
,tuokaat hfln tflnne minun tykOni, 
ettfl minfl saan nflhdfl hflnen.' 

22. Mat tu me vastasimme herralleni : 



50 



1 MOOS. 44. 45. 



,e{ taidanuorakainen jftttftflisfiftiuft ; 
sillfljoshftn j9ttaisi is^nsa, niin hftn 
kooUsi.' 

23. Niin sinft sanoit palvelijoillcsi: 
Jollei teicUln nuorin veljenne tule 
teidfto Iianssanne, niin ette saa enflfi 
tuUa minun kasvojeni eteen.* 

1 Moos. 42:15. 43:5. 

24. Ja kun me menimme sinun pal- 
velljasi, minun isflni, tykO, niin il- 
moltinmie hftnelle minun herrani 
sanal, 

25. ia kun meidfin is§mme sitten 
nnoi meille: ,menkfiSt jflUeen ja 
ostakaat meille jotakin elatusta/ 

28. niin me sanoimme : ,emme toh- 
di sinne mennfi; vaan jos meidftn 
nuorin- veliemme on meidfln kans- 
nmme, niin me menemme; sillS 
emme saa menn& sen miehen eteen, 
joUei meidSn nuorin veljemme ole 
meidfin kanssamme.* 

27. Niin sinun palvelijasi , minun 
isSni, sanoi meille: ,te tiedfitte, ettft 
minun vaimoni synnytti minulle 
kalui. 

.28. Ja toinen Ifiksi minun tyk6fini. 
ja minfi sanoi n : ,hSn on kuoliaaksi 
rerilty;' enkft oleminA h§nlft sittem- 
min nfihnyt. l Moos* 87:88. 

29. Jos te tflmfln myOs minulla 
viette pois, ja hftnelle tapahluisi jo- 
ialun Dohaa, niin te saattaisitte mi- 
pun harmaat karvani murheella 
liautaan.' 

30. Jos minfi nyt tulisin sinun pal- 
veUJasi, minun lsfini« tyk6,eikfi oiisi 
DQonilcainen meidfin kanssamme, 
jooka hengessfi hfinen henkensfi Hip- 

IKlll|-: 

31. niin tapahluisi , kun hfiq nfiki- 
siveltd nuonlRSinen olisi kanssam- 
ne, ettfi hftn kuolisi ; ja Ine, sinun 
pahreiyasi, saattaislmme niin muo- 
doin sinun palvelijasi, meidfin i- 
slfflme, harmaat karvat murheella 
aaulaan. 

32. Sillfi minft, sinun palvelijasi, 
olen luvannut vastata ntxorukaisesia 
USni edessfi-, sanoen: Jollen miiifi 
uintft tuo takaisin sinun tykOsi, niin 
minft olen siitfi kaiken minun elin- 
•ilnni viknpfift kfirsimfifin. 

1 Moos. 43:9. 

83. Anna siis nyt minun. sinun pal- 
velijasi, ififidft nuorukalsen sijaan 
kerrallenl oijaksi, ia anna nuo- 
niluUsen. mennft veljiensft kanssa 
koHin. 

3i Sillfi kuinka minfi taidan mennfi 
oftni tykO, jollei nuorukainen olisi 
unssani? Minfihfin silloin nftkisin 
nil surkeutta, iohon mihuh isfini 
joutuu." 



45 Lttku. 

Josef ilmolttM itsensft veljillensi. He palm- 
jmvat koUin. 

Silloin ei Josef enfifi voinut itsefih* 
sfi hillitfi kaikkien niiden edessfi. 
jotka hfinen ympfirillfinsfi seisoival, 
vaan hfin huusi: ,,antakaat kaikkien 
mennfi ulos minun tyk6fini.** Ja ei 
vksikfifin ollut Josefln tykOnfi, kun 
hfin ilmoitti itsensfi veljillensfi. 

AiK 1 7:13. 

2. Ja hfin ilki fifineensfi, niin ettfi 
Egyptilfiiset ja Faraon huonevfiki 
sen kuulivat. 

3. Ja Josef sanoi veljillensfi: „minfl 
olen Josef. VielfikO minun isfini 
elfifi?** Mutia ei hfinen veljensfi tai- 
taneet hflntfi vaslata; sillfi heoUvat 
niin hfimmfistyneet hfinen kasvoJ.en- 
sa edessfi. 

4. Niin sanoi Josef veljillensfi: „tul- 
knat minun tykOni.** Ja kun he tuli- 
vat, sanoi hfin: „minfi olen Josef, 
teidfin veljenne, jonka te mOitte 
Egyptiin. l Moos. 37:28. 89:1. 

5. Mutta filkfifit sitfi surko. fllkfifitkfi 
siitft kovin pahoillanne olko, ettfi te 
oletle minut tfinne myOneet; sillfi 
teidfin henkenne yllfipitfimisen tfih- 
den on Jumala minut teidfin edel- 
Ifinne tfinne IShettfinyt. i Moos. 50:20. 

6. Kaksi nfilkfivuotta on jo ollut 
maassa, ia vielfi tulee olemaan viisi 
vuotia, niin ettei kynnetfieikfi niitelfi; 

7. Mutta Jumala on minut Ifihettfi- 
nyt teidfin edellfinne, jbtta te sfiilyi- 
sittemaan pfifitlfi ja elos^ pysyisitte, 
ja monta tulisi pelastetuksi. 

8. Niin ette siis te ole minua tfinne 
Ifihettfineet, vaan Jumala; ja Hftn 
asetti minunFaraon neuvonantajaksi 
ja herraksi kaiken hfinen huoneensa 
yli, ja koko Egyptin itiaan ruhti- 
naaksi. 

9. Rientfikfifit nyt jamenkfifit minun 
isfini tyk6, jasanokaathfinelle : ,nfiin 
sanoo sinun poikasi Josef: Jumala 
on minun asettanut koko Egyptin 
maan herraksi, tule alas minun ty- 
kftni, ja filfi viivyttelel Ap. 1 7:14. 

10. Ja sinfi ofet asuva Gosenin 
maassa, ja olet oleva Ifihellfi minua, 
sinfi ja sinun lapsesi ja sinun las- 
tesi lapset, sinun karjasi, pienet ja 
suuret, la kaikki mitfi sinulla on. 
.11. Siellfi minfi elfitfin sinua — 
sillfi vielfi on viisi nfilKfivuotla — 
ettetsinfijasinunhuoneesi,ja kaikki 
kuin sinulla On, hukkuisi. 

12.Tehfin omilla silmiilfinnenfiette, 
ja veljeniBenjamihkin nfikee omilla 
silmiflfifin, ettfi minfihfin itse puhua 
teidfin kanssanne suusta suuhun. * 



61 



1 MOOS. 45. 46. 



13. Ja ilmoitfakaat minun isfilleni 
kaikki minun kunniani Egyptissfl, 
ja kaikki, mi (ft te nfthneet olette. 
Rientftkfiftt siis ja tuokaat minun 
isftni Iftnne/' 

14. Ja liftn halasi vdjeSnsfi Benja- 
minia kaulasta ja iiki, ja Benjamin 
myOs iiki hfinen kaulassansa. 

15. Ja hfin antoi suuta kaikille vel- 
iillensfi, ja itki heidftn rinnoillansa; 
ja sitte puhuiva* hfinen veljensft hfi- 
nen kanssansa. 

16. Kun sitten sanoma kerroltiin 
Faraon huoneessa« eltfi Josefin vel- 
jet olivat tulleet, oli Farao siitfi mie- 
lissfifin ja kaikki hfinen paWelijansa. 

17. Ja Farao sanoi Josefille: „sano 
veljillesi: ,nfiin tulee (eidfin tehdfi: 
sfilyttfikfifit tavaral teidfin juhtainne 
selkfifin>, ja Ifihtekfifit kotiinne Ka- 
iiaanmaalle, 

18. ja ottakaat teidfin isfinne ja tei- 
dfin perheenne, ja lulkaat minun 
tykOni; minfi annan teille mitfi pa- 
rasta on Egyptin maassa, ja te syOtte 
maan ytimen.* 

19. Minfi siis kfisken heille sano- 
maan : ,tehkfifit nfiin« ottakaat itsel- 
lenne vnunut Egyptin maalta pie- 
nille lapsillcnne fa vaimoillenne, ja 
(uokaat teidfin isfinne ja tulkaal 
(finne. 

20. Alkfifit sureko tavaroitanne; sillfi 
mitfi parasta on Egyptin maassa, on 
oleva teidfin.** 

21:; Ja Israelin lapset tekivfit niin. 
Josef antoi heille vaunut Faraon 
kfiskyn mukaanja antoi myOs heille 
evfifit mcitkalle. 

22. Ja hfin antoi vielfi itsekullekin 
heistfi juhlanuvun, mutta Benjami- 
nille antoi nfin kolmesataa hopia- 
siklifi, ja viidet juhlapuvut. 

23. Mutta isfillensfi Ifihetti hfinkym- 
menen aasia, sfilytettynfi Egyptin 
parhaimmilla tavaroilla, ja kymme- 
nen aasinlammaa, jotka kantoivat 

yvifi ja leipflfi ja evfistfi isfllle mal- 
[aa varten. 

24. Niin hfin Ifihetti veljensfi mat- 
kaan, ja sanoi heille : ^filkfifit riideIkO 
liellfi." 

25. Ja he Ifiksivfit Egyptistfi, ia tu- 
livat Kanaanmaalle isansfi Jaakobin 
tyk5. 

26. Ja he ilmoittivat hfinelle, sa- 
noen : „Josef elfifi vielfi ja on koko 
Egyptin maan herra." ^Iulla hfinen 
sydfimmensft pysyl kylmfinfi, sillfi 
ci hfin uskonut heitfi. 

27. Niin he kertoivat hfinelle kaikki 
Josefln sanat. jotka hfin heille oli 
puhunut. Ja kun hfin nfikl vaunut, 
jotka Josef oli liUiettftny t hfintfi tuo- 



^ 



maan, niin Jaakobin, heidSn Isftnsli, 
henki virkosi. 

28. Ja Israel sanoi : „nyt on minulla 
kyllft; poikani Josef vielfi elfifi. Minft 
tahdon Uhtefi hfintfi katsomaan en- 
nenkuin kuolen.** iMoob.46:30i 

46 Luku. 

Jaakob muuttaa Egyptiin. Hfinen sukutau- 

lunsa. 

J a Israel Ifiksi matkaan kaikkine 
ominensa. Ja kun hfin tuli Ber- 
sabaan, uhrasi hfin uhria isfinsft 
Isaakin Jumalalle. 

2. Ja Jumala puhui ydUfi nfiyssft 
Israelille, sanoen : ,, Jaakob, Jaakob!'* 
Hfin vastasi: „tfissfi minfi olen.** 

3. Silloin Hfin sanoi: „minfi olen 
Jumala, sinun isfisi Jumala; filfi pel- 
kfifi mennfi Egyptiin, sillfi minfi teen 
sinun siellfi suureksi kansaksi. 

4. Minfi menen Egyptiin sinun kans- 
sasi, ja minfi johdatan sinun sieltft 

, tnkaisin. Ja Josef on lask^va kfitensil 
sinun silmfiisi pfifille." 1 Moos. 50:1. 

5. Ja Jaakob Ifiksi Bersabasta; ja 
Israelin lapset veivfit isfinsfi Jaako- 
bin ynnfi pienten lastensa ja vai- 
moinsa kanssa vaunuissa, jotka Fa- 
rao oil Ifihettfinyt hfintfi tuomaan. 

6. Ja he ottivat karjansa ja tava- 
ransa, jotka he olivat koonneet Ka- 
naanmaalla, ja tulivat niin Egyptiin, 
Jaakob ja kaikki hfinen siemenensfi 
hfinen kanssansa. Jos. 24:4. Jes. 62:4. 

Ap. 1 7:15. 

7. Hfinen poikansa ja poikainsa po- 
jat hfinen kanssansa, hfinen tyttft- 
rensfi ja hfinen poikainsa tyttaret, 

i'a kaikki hfinen siemenensfi, vei hfin 
Lanssansa Egyptiin. 

8. Ja nfimfi ovat Israelin lasten ni- 
met, jotka tulivat Eg>'ptiin : Jaakob 
ja hfinen poikansa. Jaakobin esikoi- 
nen oli Ruuben. 2 Moos. 1:2 ss. 

9. Ja Ruiibenin laoset olivat: Ha- 
nok, Pallu, Hesron ja Karmi. 

2.M00S. 6:14 88. 4 Moos. 26:5 ss. 

10. Simeonin lapset: Jemuel.Jamin, 

Chad. Jakin, Soar, sekfi Saul, Kana- 

nealaisen vaimon polka. 1 Aik. 4:24. 

11. Levin lapset: Gerson, Kahat ja 
Merari. lAlk.6:l. 

12. Juudan lapset: Ger, Onan, Sela, 
Peres ja Serak. Mutta Ger ja Onan 
kuolivat Kanaanmaalla. Ja Peresin 
pojat olivat: Hesron ja Hamul. 

1 Moos. 38:3 ss. 2988. 1 Aik. 2:5. 4:1. 

13. Ja Isaskarin lapset : Tola, Puya, 
Job ia Simron. iAik.7:l. 

14. JaSebulonin lapset: Sered, Elon 
ja Jakleel. 

15. Nfimfi ovat Lean lapset) jotkb 



52 



ban synnytU Jaakoblllc Hesopola- 

miassa ; myCskin synny III hBn hRnel- 
l< tyttina, Dinan. Kaihki hfinen poi- 
binsa ia tyllBrensA olival kolmenel- 
iiUikymnienia henkeH. 

Ifc Gudin lopsel olival : Slfjon, Hag- 
«i. Sunl. Esbon, Eri, Arodi Ja Areli. 

17. Axserin lapsel: Jemna. Jesua, 
Juul, Beria, sekB faeidan lisarensa 
Scrik. Mulla Berian lapse! : Heber 
jaMalkiel. lAUc7:30, 31. 



21. Benjamin in lapiel olival: Beln, 
Beker, Asbel, Gera. Naaman, Ehi, 
Rm, Uupim, Huplm ja Ard. 

i£.Namaoval Rakelin lapsel, jolka 
ont Jaakobille synlyneel, kaikkl 
Thteensi neljSloislakymmenia hen- 

tLDaDinlapsehHusim. iHiws.2a:t2. 
il. Naftalln lapsel; Jekseel, Guni, 
Jwr is 



Iwii^ 



bui anioi lyllfirellensn llokelill 
bin synnylli aSma Jaakobill 



synnylli aSma Jaakobille, 
ikl yhteecsft lelUeman henkeJI, 
Kaikki hengel. jolka lulivai Jaa- 
UDln kanssB Egyptiin, ja olivat lul- 
hfl binen kupeislansa. oval kaikki 
Ibleensfl kuusiseilseniaitilkymmen- 
tl hmheS, paitsi Jaakobin polkaln 



"rnlvlvai Egyplisstt, _ 

iu« kaikki hengelJaakobinhuonees- 
H, }alka luUval Egypliin, olival yh- 

iHixM. IL&. fiMooa. 10:22. Ap. t.'...~ 
KJaban labetli edellllnsll Juudan 
3<atBa tyka, osoillamaan hUncUe 
liellGo&eniin; Ja he lulivai Gosenln 

a. HilD Joser anIoi valjastan 
DUma, ja IDksi isflflnsa Israella .__ 
lun GiKeniin. Ja kun hSn kohlasi 
binet, halasi hlln hSnta kaulasta ]i 
llUkauaiialkaahSr 



□ fcatvosi, Ja nfiin, etia vlelfi 



mollan Fanolle, Ja tanon hflnellB; 
.itilnun vcljeni Jn isBoi perhekunla, 

Iolka olival Kanasnmaalla, oval lul- 
eel mi nun tykCnl. 

32. He oval paimenia, Ja kailteval 
kariaa; sekl Ison etUI nienen kar- 
jansa. kaikki, milB heUla oli, oval 
h« tuoneet myClBnsA.- 

33. Kun sillen Farao kutsuu leilt 
luokseen Ja kysyy : ,mlka on leid&n 
toimcnne?' 

34. Niin sanokaal: ,ine, tloun pal- 
velijasl, olemmc toltuneel karjaa 
liallsemaan, hamaila meldBn nuo- 
ruudestammf niln tatiBn a»li, lekB 
me etUt meidfln isBmme.' Sltlea an- 
nelaan leidSn osua Gosenin maassa; 
slIIB kaikki palmeaet oval kauhislus 
Egypliiaillire:' iUaot.«:t. 3U<KU,S:a. 

47 Loku. 

Jukob Funuia Idoim. JoHeflo tolmel Bgyp- 
tlsift. JuUiob mUrU liADtauipiitlEliBDBL 
lilmollli Faraolle. ja 

vcMenl, heidBn liarjan^, picnel Ja 
luuret, JB kaikki, mlul lieillB on. 
ovat tuileel Kanaanmaalla ; ja nyl 
he ovat Gosenln maassa." 

2. Ja hBn olll viial veljistfinafl , Ja 
Bselti heldai Faraon eleen, 

3. Niin Farao sanol hfinen veljll- 
lensQ: ..niika teldfln loimenne on?" 
He vaslaslvBl: .,me, slnua palveli 
ja&l. olemme paimenia, seUI me eltB 
meidan isBmme." 

4. Ja he sanoivat vlelB Faraolle: 
„me olemme tuileel ajali 
tassa maassa ; sillS sinun ae 

lasi el ole laldunla karjalle , 

on kovB nalBnhaia Kaoaanmaalla. 
Salll nyl sinun palvelijasi aaua Go- 

5. NUq Farao puhui Josedilc, sa- 
noen: „»lnun Isfisi Ja veljesl oval 
tutleel sinun lykOsI; 

6. Egypt in maa on avoinr 
sSsl, aseta UBsl ]a velj^l a 

Earhaasen paikkaan maassu. nsu- 
ool Gosenin maassa. Ja joi lledSt 
heidan leassansa olevan kelvolllsia 
mIehiB, niin aiela heidat pasilys- 
miehiksi minun karjanl yli." 

7. Ja Josef loi IsBnsB Jsakobln, Ja 
asetii hflncTi Far;:on elecn. Ja Jaa- 
kob siuna^i Faraola. 

S. Niln Farao kysyl Jaakobllla: 
,.kulnka vanhH olei?'' 

9. Jaakob vaslasi Farsotlc: „minun 
vaellukseni alkaa oa keslBnyt sola 
JakolmekymmenlBajastaikaa: lyhyt 



stijoll- 






1 T^IOOS. 47. 48. 



vuoslen niSfir55nheidllnvaelIuksen- 

sa aikana.** lAik. 29:15. Ps. 119:19. 

' Hebr. 11:9, 13. 

10. Ja Jaakob siunasi Faraota ja 
Ifiksi niin hilnen tykddnsfi. 

11. Mutta Josef toimitti isfinsft ja 
veljensA asumaan, ja antoi heilie 
asumus-oikeuden Egyptin maassa, 
^arhaassa maan paikassa, Ramesek- 
sen raaassa, niinkuin Farao oli kfis- 
kenyt. 

12. J a Josef an loi elatuksen isSlIensS 
ja veljillensa ja koko isSnsS perhe- 
kunnalle, aina lasten lukumfi9rSn 
mukaan. 

13. Mutla ei ollut lcip5S koko maas- 
sa, sills nSlAnhStS oli suuri, niin 
e(tAEgyptinmaiajaKanaanmaand5n- 
tyi nnijan tShden. 

14. Ja Josef kokosi.myfidessaan vil- 
jaa kansalle, kaikki rahat mita lOy- 
tyi EgyptissA ja Kanaanmaalla. Ja 
Josef vei rahat F"araon huoneeseen. 

15. Kun rahalolivatloppuneelEgyp- 
tisl{\ ja Kanaanmaalta, niin tulivat 
kaikki EgyplilSiset Josefin tyk6, sa- 
noen: „anna meille leipSS; miksi 
meidAn pilfiisi kuoleman silmiesi 
Odessa? SilI5 meillA ei ole endd ra- 
haa." 

16. Josef sanoi heilie: „tuokaat tei- 
dfln karjanne, ja minfi annan teille 
karjaanne vastaan, jos ei teillfi ole 
rahaa.** 

17. Ja he toivat ka^jansa Josefille, 
ja Josef antoi heilie leipSft hevosia, 
ja lambaita, ja kariaa ja aaseja vas- 
taan. Niin h9h ruokki heitfi leivdlla 
sen vuoden, kaiken heidSn karjansa 
edestft. 

18. Kun se vuos! oli kulunut, tuli- 
vat he hftnen lykQnsS toisena vuon- 
na, ja sanoivat hfinelle : ,,emme tai- 
da salata sinulta,meid9n herraltam- 
me, etlei meillft enfiS ole rahaa, 
mutla kaikki kai^ammekin on jou- 
tunut meidSn herrallemme, eik9 ole 
mitAAn muuta nyt sinulle aniaa 
kuin oma itsemme ja peltomme. 

19. £t suinkaan tahdo,etfA kuolem- 
me sinun silmiesi edessA ja ettA pel- 
tomme jAAvAt autioksi? Ota meidAt 
ja meidAn peltomme leivAsIA, niin 
me ja meidAn peltomme tulemme 
Paraon omaksi. Anna ainoastaan sie- 
menct, ettA me elAisimme emme- 
kA kuolisi, |ia ettei maa jAisi au- 
tioksi.*'' 

20. Niin Josef osti koko Egy|)tin 
maan Faraolle, sillS EgvptilAiset 
m6ivAt iiellonsa, kun naikA heilA 
niin koviii ahdisti. Ja maa luli niin 
Faraon omaisuudeksi. 

21. Ja hAn siirsi kansan kaupun- 



keihiii yhdestA Egyptin fiSrestfi niin 
toiseen. 

22. Ainoastaan pappfen pelloa hAn 
ei ostanut, sillA papit soivAt siit^ 
mAArAtystA osasta, jonka Farao heilie 
antoi ; sentAhden el hcidAn tarvinnu t 
myOdA maatansa. 

23. Niin Josef sanoi kansalle: „kat- 
so, rainA olen nyt ostanut teidAt ja 
teidAn maanne Faraolle. Katso, tAssS 
on teille siemenet; kylvAkAAt nyt 
peltonne. 

24. Ja sadosta tulee teidAn antaa 
viides osa Faraolle; mutta neljA osaa 
pitAA oleman teille pellon siemeneksi 
ja teille vnnA niille ravinnoksi Jotka 
ovat teiaAn huoneessanne, sekA ruu- 
aksi teidAn lapsillenne.'* 

25. Niin he sanoiviit: „sinA olet 
meitA hcngissA pitAnyt; anna mei- 
dAn saada suosiola sinun, meidAn 
herramme, edessA, ja me tahdommc 
olla Faraon orjat." 

20. Ja Josef sAAsi sen koko Egyptin 
maalle, joka vielAkin on voimassa, 
ettA Faraolle on annettava viides 
osa. Ainoastaan pappien maa ei tul- 
lut Faraon omaisuudeksi. 

27. Niin asui Israel siis EgyptissA 
Gosenin maassa; ja he omistivat 
maata, ja enenivAt ja HsAAntyivSt 
suuresti. 

28. Ja Jaakob eli Eg[yptin maassa 
seitscmAntoista ajastaikaa, ja koko 
hAnen ikAnsA oli sata ja seitsemSn- 
viideltAkymmentA ajastaikaa. 

29. Ja kun sitten Israelin kuolin- 

yAivA lAheni, kutsui hAn poikansa 
osefin, ja sanoi hAnelle: ,oos minft 
olen saanut suosiola sinun edessAsi, 
niin Inske nyt kAtesi kupeeni alle, 
ja lupaa minulle rakkaulesi ja lau- 
peutesi tAhden, ettet hautaa minua 
Egyptiin, i Moos. 60:5. 

30. vaan annat minun levAtA m|. 
nun isAini tykdnA, ja ettA sinA viet 
minut EgyplistA, ja hautaat minut 
held An nautaansa.**- HAn yastasi : 
,,minA teen sinun sanasi jAlkeen.*' 

1 Moos. 23:19. 25:9. 35:2788. 49:29. 50:13. 

31. Mutta hAn sanoi : „vanno se mi- 
nulle.*' Ja hAn vannoi hAnelle. Sil- 
loin Israel- rukouksessa kalli&ti it- 
sensA pAAnalaiselle. 

48 Luku. 
Jaakob siunaa Josefia Ja hinen poikiansa. 

Jonkun aikaa sen jAlkeen ilmoitet- 
tiin Josefille: „katso, sinun isAsi 
sairastaa.** Silloin hAn otti molem- 
mat poikansa kanssansa, Manassen 
ja Erraimin. 
2. Niin Jaakobille ilmoitettiin, $a- 



54 



1 MOOS. 48. 49. 



noen: ,.kalso« sinun poikasi^ Josef 
tulee sinun tykOsi.'' Ja Israel vah* 
visti ilsensd ja istui vuoteessa. 

3. Ja Jaakx>b sanoi Josefille: „Ju- 
mala kaikkivaltias nUkyi mlnulle 
Lusissa Kanaanmaalla ja siunasi 
minua, l Moos. 28:12 88.35:6 s?. 

4. ja sanoi minuUe: ,katso, mind 
annan sinun olla hedelmfillisen ja 
lisSdntyA, ja teen sinun suureksi 
kansaksi ; ja annan tfimfin maan si- 
nun siemenelles sinun jAlkeesi ijan- 
kaikkiseksi perinnOksi.' 

5. Sinun molemmat poikasi, jolka 
sinulle oval syntyneet EgypUssfi, 
ennenkuin minfl tulin tfinne sinun 
lykOsi, oikoot minun: Efraim ja Ma- 
nasse oikoot minun, niinkuin Ruu* 
ben ja Simeon ovat minun. 

iMoo8.4l:£0s8. 

6. Mutta ne sinun lapses!, jotka olet 
siittfinyt niiden . jfilkeen , pitfifl ole- 
man sinun, ja He ovat nimitettflvfit 
veljlensfl nimellfl heidftn perimises- 
sftnsfi. Jos. 13:7. 16:18b. 

7. Ja kun minfi tulin Mesopolami- 
asta, kuoli minulta Rakel Kanaan- 
maalla matkalla, kun vielfi kappale 
matkaa oli Efrataan; ja minfi nau- 
tasin hfinet sielU Efratan tiellfi/' 
Palkan nimi on nyt Betlehem. 

1 Moos. 36:19 88. 

8. Ja Israel nfiki Josefin pojat, Ja. 
sanoi: ,.kutka nfimfit ovat?*' 

9. Ja Josef vastasi isfifinsfi: „ne 
ovat minun poikani, jotka Jumala 
on mioalle taAlIfi antanut." Ja hftn 
sanoi: „tuo heidfit minun tykOni 
siunatakseni heitfl/* 

10. SiUfi Israelii! silmflt olivat hfi- 
mftrfit vanhuudesta, eikfi hfin voinut 
hyvin nAhdfi. Ja hfin vei heidfit hft- 
nen tyk6nsfi; Ja hftn antoi heidfin 
tanta Ja otti heidfit syliinsfi. 

11. Ja Israel sanoi Josefille : „mlnfi 
en luullut nfikevfini sinun kasvoiasi ; 
mutta Jumala on antanut mmun 
ravOs nfthdfi sinun siemenesi.** 

ll Ja Josef otti heidfit pois hfinen 
sylistfinsS, ja kumarsi itseusfi maa- 
luin hfinen kasvojensa eteen. 

13. Sitten Josef otti heidfit molem- 
mat kfidestfi, oikiaan kftteensfi Eft^i- 
min, jonka hfin asetti Israelin vasem- 
man kfiden kohdalle, ja Manassen 
vasempaan kfiteensfi, Israelin oikian 
kflden kohdalle, Ja vei heidfit niin 
hflnen eteensfi. 

14. Mutta Israel ojensi oikian kfi- 
tensfi Ja laski sen Efraimin pfifin 
l^lle, Joka oil nuorempi; mutta 
vasenunan kfitensfi Manassen pfifin 
pUlIe. Hfinsiisasetti kfitensfi ristiin; 
sillAManasseolieslkoinen. Hebr. u:2i. 



15. Ja hfin siunasf Josefla, ja sanoi : 
^Jumala. jonka kasvojen eaessfi mi* 
nun isfini Abraham ia Isaak vaelta- 
neet ovat, Jumala, joka minun kain- 
nul on minun elinaikanani tdhfin 
pfiivfifin asti. IM008.17:1. 26-.5. Ps. 23.1. 

16. Enkeli, joka minun on pelasta- 
nut kaikesta pahasta, siunatkoon 
nfiitfi nuorukaisia, ettfi he nimitet- 
tflisiin minun ia minun isfiini Abra- 
hamin ja Isaakin nimellfi. ja kas- 
vaisivat aivan paljoksi maan pfifil- 
Ifi.** 2 Moos. 1:7. 

17. Mutta kun Josef nfiki Isfinsfi las- 
kevnn oikian kfitensfi Efraimin pfifin 
pfifille , otti hfin sen pahakseen ja 
rupesi isfinsfi kfiteen, siirtftfiksensfi 
sen Efraimin pfifin pfifiltfi Manassen 
pfifin pfifille. 

18. Ja Josef sanoi isfillensfi: „ei 
niin, minun isfini; tfimfi on esikoi^ 
nen, laske oikia kfitesi hfinen pfifinsfi 
pfifille.'' 

19. Mutta hfinen isfiinsfi kielsi sen, 

ia sanoi: •,minfi tiedfin kyllfi, poi- 
Lnni, minfi tiedfin; mvOskin hftn 
tulee kansaksi, mutta hfinen nuo- 
rempi veljensfi kuitenkin tulee suu- 
remmaksi kuin hfin, ja hfinen sie* 
menensfi tulee suureksi kansaksi.'* 

20. Niin hfin siunasi heltftjsinfi pfii- 
vfinfi, sanoen : , Joka tahtoo jonkun 
siunata Israelissa, niin sanokaan 
nfiin: ,Jumala tehkMn sinnn niin- 
kuin Efraimin ja Manassen\** Siten 
asetti hfin Efraimin Manassen edelle. 

21. Ja Israel sanoi Josefille: „katso, 
minfi kuolen; mutta Jumala on tei- 
dfin kanssanne, Ja vie teidfit Jfilleen 
isfiinne maahan. 

22. Minfi olen myOs antanut sinulle 
osan maata, pfifille sinun veljiesi 
osan, ionka minfi miekaliani ja jout- 
sellani Amorilalsten kfisistfi olen pt- 
tanut." IMoos. 34:2788. Job. 4:5. 

49 Luku. 
Jaakob siunaa poikiansa Ja kuole^ 

Ja Jaakob kutsui poikansa la sanoi : 
„kokoontukaat, ja minfi llmoitan 
teille, mitfi teille tapahtuu tulevai- 
sina aikoiiia. 

2. Tulkaat kokoon ja kunlkaat, te 
Jaakobin lapset, kuulkaat teidSn 
isfifinne Israelia. 

3. Ruuben. sinfi olet minun esikoi- 
seni, minun voimani ja vfikevyyteni 
alku, ensimmfiinen kunniassa, ja 
ensimmfiinen vallassa. 

4. Sinfi olet herkkfi niinkuin kuo- 
huvavesi,ei kfi sinun pidfiensimmfii- 
seksi jfifimfin , sillfi sinfi astuit isfisi 
vuoteeseen; siiloin sinfi sen saastu- 



55 



1 MOOS. 49. 



tit. Nlin, bfin noasi minun vuoteel- 
leni ! l Moos. 35:22. 1 Aik. 5:1. 

5. Simeon ia Levi ovnt veljel^sct; 
heidfin mielucansaovatmurha-aseet. 

lMoos.34:25ss. 

6. Minun sieluni ci suostu hei- 
dfln neuvoonsa, ja sydftmmeni ei 
vlidisly licidfln seurannsa; sillfi kiu- 
Kussansa ovat lie niiehen murhan- 
ncet, ja mielivallaisesti turmelleet 
hftrki^. 

7. Kirodu olkoon heiddn kiuk- 
kunsa, joka on niin tuima, ja hei- 
dlin julmuulensa, joka on niin 
armoton! Minfl eroitan heidAt Jaa* 
kobissa, ja hajoilan heid£it Israe- 
lissa. 

8. Juuda sinfi, sinua veljesi kiittfl- 
vflt; siniin kfitesi on oleva vihollis- 
tesi niskassa, ja isdsi lapse! sinua 
kumarlavat. 

9. Juuda on nuori jalopeura; saa- 
liilta olet sinfl noussut, poikani. Hdn 
on laskenul itsensft maahan, ja le- 
pAS niinkuin jalopeura, ja niinkuin 
emit jalopeura; kuka tohtii hAnta 
hfiirilft? 4Moos.24:9. I Aik. 52. 

10. Ei valtikkaa oteta poisJuudal* 
ta, eikA valliosauvaa hJInen jalois« 
tansa, siksi kuin Sankari tulee, ja 
hflnelle kansat ovat alamaiset. 

Matt. 2:6. 

11. Hdn sitoo varsansa viinipuu- 
hun, ja aasintammansa varsan ja- 
loon viinipuun oksaan. Hfln pesee 
vaatteensa viinissft, ja vaippansa 
viinimarjain veressfi. 

12. H§nen silmftnsft ovat punaiset 
viinistS, ja hampaansa valkiat ries- 
kasta. 

13. Sebulon on asuva meren ran- 
nalla, jossa haahdet oval satamassa; 
kylkensft kfifintAfi hSnSidonia kohti. 

&M008. 88:18s8. Jos. 19:1088. Je8.9:l. 

Matt. 4:15. 

14. Isaskar on vdkevA aasi, ja lepdil 
rnuhassa tarhassaan. 

15. HAn nSki lepoptiikan hyvflksi 
ja maan ihanaksi; ja hdn kuniarsi 
selkSnsH taakkojen alle, ja on veron- 
alainen palvellja. 

16. Dan on tuomitseva kansqansa, 
niinkuin joku toincnkin Israelin 
sukukunnista. 

17. Dan on oleva kdrmeenfi tiellfi, 
ja kyyknrmeen5 polulla; hAn puree 
hevosta vuokoiseen, niin e((i\ ratsas- 
taja seljdllensA lankee. 

18. Herra, minfi odotan sinun pelas^ 
tustasi ! Ps. U9:166. 174. 

19. Gad, hftnelle tekevdt sotajoukot 
vfikir>'nnAk6n : mutta htln onajava 
hcilA takaperin. Tuom. 10:7 88. ii:i, 33. 

1 Aik. 6:11—22. 



20. Asserlsta tulee hAnen lihava lei- 
pAnsA; ja hAnantaakuninkaalleher- 
kul. 5 Moos. 33.24. 

21. Naflali on nopia peura; ja 
liAn antaa suloisct puheet. 

Tuom. 4:6. 5:1. 

22. Josef on hedclmAllisen viini- 
puun vesa, licdelmAUiscn viini-puun 
vcsa lAhteen tyk()nA; sen oksat nou- 
scvat muurin vli.' 

23. Ampujat hAtyyItAvAt hAntA, am- 
puvat ja vainovat hAntA, 

24. vaan hAncn joutsensa pvsyy 
kuitenkin vahvana ja hAnen kAsi- 
vartensa lujina HAncn kAttensA kaut- 
la, joka on vAkevAJaakobissa, HAnen 
kauttansa, joka on paimen, Israelin 
kaltio. 

25. Sinun isAsiJumalalla.joka sinua 
on aultava, Kaikkivaltiaan kautta, 
joka sinun on siunaava, tulkoon si- 
nulle siunaus ylhAAllA, ja syvyyden 
siunaus alhaalta, niin my6s nisAin 
ja kohtuin siunaus! 

26. Sinun isAsi siunauksct uloltuvat 
korkealle, korkeammalle minun isAi- 
ni siunauksia ; ne ulottuvat ikuislen 
kukkulainihanaisuuleensaakka. Ne 
tulkool Josefin pAAnpAAile, ja hAnen 
pAAn laelle, joka veljiensA keskella 
on ruhtinas. 

27. Benjamin on raatelevainen susi; 
aamulla hAn syO saaliin, ja ehtoona 
saaliin jakaa.*^ Tuom. 2025. 

lSam.9:l8S. 14:47. 

28. NAmA kaikkj ovat kaksitoista- 
kymmentA Israelin sukukuntaa. Ja 
tAmA on se, jota heidAn isAnsA 
heille puhui siunatessansa heitA; 
kullekin heille antoi hAn eri siu- 
nauksen 

29. Ja han kAski heitA, ja sanoi 
heille: „minA kootaan nyt kansani 
tykd; haudalkaat minua isAini vie- 
reen, siihcn luolaan, joka on Efro- 
nin, HetilAisen, vainiossa, 

30. Makpelan vainion luolaan, joka 
on Mamren kohdallaKanaanmaalla, 
jonka Abraham osti vainion kanssa 
HetilAiselUi Efronilta perintdhau- 
daksi. 1 Moos. 28:1688. 50:13. 

31. Sinne ovat he haudannect Abra- 
hamin ja hAnen vaimonsa Saaran; 
sinne ovat hemyds haudanneet Isaa- 
kin ja Rebekan , hAnen vaimonsa. 
Sinne olen minA myds haudannut 
Lean, 1M008.23:19. 25:9.35:29. 

Ap.t 7:1583. 

32. siihen vainioon ja siihen luo- 
laan, Joka on ostetlu Hetin lapsilla.*' 

33. Kun Jaakob oli antanut tAmAn 
kAskyn pojillensa, nosti hAn jalkansa 
vuoteelle; ja hAn kuoli ja koottila 
kansansa tykO. 



w 



1 MOOS. 50. 



50 Luku. 
JaakobiD bautaus. Jesefin kuoleraa. 

Sllloin Josef lankesi isHnsA kasvoil- 
le, itki hAnen ylitsensA ja aiiloi 
hSnen ftuuta. 1 Moos. 46.4. 

.2. Ja Josef kAski niiia ISilkftreitn, 
jotka olivat hAnen palveluksessaan, 
balsamoimaan hftnen isSrisA^ Ja lAd- 
karit balsamoivat Israelin. 

3. Siihen kului neljakymmentA 
pdivAA; sillA niin monta oli voite- 
ius-pAivAA. Ja Egyptilfiiset itkivSt 
hllnIA seilsemdnkymmentft pAivftA. 

4. Kun murhepAivAt olivat kulu* 
neet, puhui Josef Faraoii palveli- 
joilIe« sanoen: ,.jos minA olen suo- 
sion saanul teidAii edessAnne, niin 
puhukaat Faraolle, ja sanokaat: 

5. ,Minun isAni vannotli minuat 
sanoen: katso, minA kuolen. hauiaa 
minua minun haulaani. jonka minA 
olenanlnnul kaivaa itsellent Kanaan* 
maalla/ Niin salli minun nyt lAiiteA 
hautaamaan isAAni; sitten oien taas 
palaava lAnne takaisln. 1 Moos. 47:29 ss. 

6. Farao vastasi liAnelle : „mene ja 
haulaa sinun isAsi, niinkuin hfln on 
sinaa vannoUanut.** 

7. NiinJosef lAksi Iiaulaamaan isAAn- 
sfl; ia hAnen kanssansa menivAt 
kaiklci Faraon palvelijaU lifinen per* 
hekunlansa vanliinimat, ja kaikki 
Egyptin niaan vanliimmal, 

8. niinkuin my5s Josefin perhe, ja 
hSnen veijensA, ja hAnen isansA per- 
hekunta. Ainoastansa lapsensa, ja 
lampaansa^ ja karjansa jAttivAt he 
Gosenin niaahan. 

9. Mydskin seurasivat hAnen kans- 
sansa vaunut ja raisasmtehet. Ja se 
oli sangen suuri joukko. 

10. Ja kun he lulivat Atadin riihen 
tykd, joka on sillA puolen Jordania, 
mia he piUvAt siinA suuren ja kat- 
keran valituksen; ja hAn pani toi* 
meen seitsemAn pAivAisen surujuh- 
lao isAnsd kuoleman johdosta. 

Syr. 22:13. 

11. Ja 4un Kanaanmaan asuvaiset 
nflkivflt surujuhlan Aiadin riilien 
lykAnfl, sanoivat lie: „CgyptilAise( 
siellfl pildvAt surujuhlaa.'' Siitfl on 
se paikka saanut nimen: CgyptilAis- 
ten valilus; ja se on stllA puolen 
Jordanin. 

12. Mutia hfinen lapsensa tekivAt 
hlnelle niinkoin hAn oli kAskenyt, 

13. ja veivflt hAnen Kanaanmaalle, 
ja haulasivat hSnen Makpelan vai* 
nion luolaan, jonka Abraham vai- 
oioo kanssa oli ostanul perinl6hau- 



daksi Efroniltn, HetilAisellA.Mamren 
kohdalla. iMoos.23 i6ss. Ap. t.7i6. 

14. Mutta silten kun Josef oli haut 
dannut isAAnsA. palasi hAn Egyptiin. 
hAn ja hAnen veljensA. jn kaikki, 
jolka hAnen kanssansa olival men* 
neet hautaaninan hAnen isAAnsA 

15. Kun Josefin veljet nAkival, eltH 
heidAn isAnsA oli kuollut, sanoivat 
he: „ehkA Josef nyt rupena vihaa- 
maan meitA ja koslaa meilie kaiken 
sen pahan, minkA me hAntA vaslaan 
tehneet olemme.*' 

16. SentAhden lAhettivAt he sano- 
maan JosefiUe: «vSinun isAsi puhut- 
teli meitA ennen kuolemaansa, sa- 
noen: 

17. ,Sanokaat nAin Josefille: minA 
rukoilen, anna nytveljillesi anleeksi 
heidAn rikoksensa ja pahuutensa, 
ettA he niin pahoin ovat tehneet si- 
nua vaslaan. Anna nyt anleeksi si- 
nun isAsi Jumalan palvelijain paha- 
tekot' Mutta Josef itki heidAn nAilA 
puhuissansa. 

18i Jn hAnen veljensA myOs tulivat 
ja lankesivatmaahan hAnen eteensA, 
ja sanoivat: „ka(so, meolemme si- 
nun palvelijasi.'* 

19. Josef sanoi heille: „AlkAAt |)el- 
j2|tkd; olenko minA Jumala? 

20. Te ajatlelilte minua vastaan pa- 
haa ; mutta Jumala on kAAntAnyt sen 
hyvAksi,ettA hAn tekisi, niinkuin nyt 
nahtAvA on, pelastaaksensa paljo 
kansaa. i Moos. 45:5. 

21. AlkAAt siis nyt peljAtkO; minA 
elAtAn teilA ja teidAn lapsianne.*' Ja 
hAn rohkaisi heitA^ ja puheli ystA- 
vAilisesti heidAn kanssansa. 

22. Ja Josef jAi asumaan Egyptiin, 
hAn ja hAnen isiUisA perhe; ja Josef 
eli sata ja kymmenen ajastaikaa. 

23. Ja hAn nAklEfraimin lapsetkol- 
manteen polveen; syntyi myOs Ma- 
kirin, Manassen pojan, la psia Josefin 
helmaan. 

24. Ja Josef sanoi veljillensA: „minA 
kuolen, ja Jumala on toiis'esti etsivA 
teilA, ja vie teidAt tAstA maasta sii- 
hen maahan, jonka hAn on itse van- 
nonutantaaksensaAbrahamille.Isaa- 
kille ja Jaakobille.'' 

25. Niin vannotti Josef Israelin lap- 
sia, sanoen: ^, Jumala on totisesti 
teilA elsivA; viekAAt pois minun luu- 
ni tAAllA.'* 2M00S. 13:19. Jos. 24:32. 

Uebr. 11:22. Syr. 49.18. 

26. Ja Josef kuoli sadan ja kym- 
menen ajastaikaisena ; ja he balsa- 
moivat hAnen ja panlvat arkkuua 
BgyptissA. 



57 



2 MOOS. 1. 2. 



TOINEN MOOSEKSEN KIRJA. 



EXODUS. 



I Lttku. 



Israelilaisten orjuus EgyptisAft. 

NfimS ovat Israelin lostcn nimet, 
jotka tulival Egypliin; Jaakobin 
kanssa he tulivat Itsekukin perhei- 
ncnsA : l Moos. 46:8 ss. 

2. Ruubcn, Simeon, Levi ja Juuda. 

3. Isaskar, Scbulon ju Benjamin. 

4. Dan. Naflali. Gad ja Asser. 

5. Ja kaikki hcnget, jotka Jaakobin 
kupeista olivat lullcet, olivat seitse- 
mnnkymmentfl henkefl. Multa Josef 
oil jo aikaisemmin Egyplissfi. 

1 Moos. 46:27. 5 Moos. 10:22. 

6. Ja Josef oli kuoUut, ja kaikki hft- 
nen veljensA, ja kaiklii senaikaiset. 

7. Ja Israelin lapse! olival hedel- 
m31Hsetjasuureslienenivfitjalisfifin« 
lyivflL ja sangen voimallisesti vah- 
vistuival, niin ettfl maa IdytiettHn 
heists. 1 Moos. 18:18. Ps. 105:24. Ap. t 7:17. 

8. Niin uusi kuningas tuli Egyptiin, 
joka ei Josefista mitfiAn tiennvt. 

9. Hftnsanoikansalle: ^katso* Israe- 
lin lusten joukko on suurempi ja 
vdkcvdmpi meitfi. 

10. Tulkaat, menetelkfiftmme viisa- 
asti heidfin kanssansa, ettei heitfi tu- 
lisi niin paljo. Sillfl jos joku sola 
syttyisi, voisivat he mennfl vihollis- 
temme puolelle ja sotia meitd vas- 
taan, ja sitten Ifihteft maasta pois.** 

11. Niin asetettiin heidfln ylitsensH 
tydjohtajat, jotka pakoittivat heltfl 
orjantvfinfiii; heidfin tflytyl rakenlaa 
Furaoile varastokaupungil Fitom ja 
Haamses. 

12. Mutta jota enemmfin he rasitti- 
val kansaa, slid enemmftn se Hsfiftn- 
tyi ja kasvoi. Ja he olivat harmis- 
saan Israelin lasten tfihden. 

13. Sentfihden Egyptilfiiset yhfi li- 
sfisivfit Israelin lapsille orjant6itft 
armahtamalta 

14. ja saattoivat heidfin elftmfinsfl 
katkeraksi raskaassa saven Ja tiilein 
tydssfi, ja kaikkinaisella rasltuksella 
kedoUa, ylimalkaiti kaikellalsella 
pakkotydllfi; jota he mfifirftsivfit hei- 
dfin tehtfivfikseen. 

15. Ja Egyptin kuningas puhui niil- 
le Hebrealaisille vaimoille, jotka 
auttoivat lasten synnytyksessft ^ toi- 
sen nimi oli Sifra Ja toisei) Pua — , 

16. ia tonoi: „kun te autatte He- 
breaJalsia valmoja heidfin synnyt- 
tAissfinsfl, niin pitfikfifit silmfiUfi, jos 
se on poika, niin surmatkaat se; 



mutta Jos se on tytfir, nltn antakaat 
sen elfifi.** 

17. Mutta apuvaimot pelkfisivfil Ju- 
malata, eivfitkfi tehneet niinkuin R- 
gyptin kuningas oli heille sanonut, 
vaan antoivat poikasten elfifi. 

18. Niin Egyptin kunin^fs kutsui 
apux'aimot luokseen ja sa.ioi heille: 
,,miksi te nfiin teette Ja annatte poi- 
kasten elfifi r* 

19. Niin apuvaimot vastasivat Pa* 
raota: ,,Hebreaiaiset vaimot eivftt 
ole niinkuin Egyptilfiiset; he ovat 
luonnostansa vanvemmat, ja ennen- 
kuin apuvaimo tulee heidfin tykOn- 
sfi, ovat he jo synnyttfineet.'* 

20. Ja Jumala teki apuvaimoille 
hyvin, ja kansa lisfifintyi ja eneni 
sangen suurestl. 

21. Koska apuvaimot pelkfisivfit Ju- 
malata, antoi Hfin heidfin huoneel- 
lensa menestystfi. 

22. Silloin antoi Farao kftskyn kai- 
kelle kansallensa, sanoen: „kaikki 
fisken syntyneetpoikalapsetovat hei- 
tettfivfit virtaan ; mutta kaikki tyttO- 
lapset saavat elfifi.'' Aik 1 7:19. 

2 Luku. 
Mooseksen syntymlnen, pelastus ja pako. 

Yksi mies Levin huoneesta meni 
ja nai Levin tyttfiren. 2Moo8.6:20. 

4 Moos. 26:69. 

2. Ja vaimo tuH raskaaksi ja syn- 
nytti pojan. Ja hfin nfiki, etta se oli 
ihana lapsi; ja hfin salasi sen kol- 
me kuukautta. i Aik. 6:8. Ap. t7:20. 

Hebr. 11:23. 

3. Mutta kun hfin ei voinut hfintft 
kauempaa salata, otti hfin kaisllai- 
sen arkun, sivusi sen maapihkallaja 

Eijillfi, ja pani iapsen siihen, ja las- 
i sen kaisilistoon, virran rannalle. 

4. Ja hfinen sisarensa asellui etem- 
mfiksi katsomaan, milen hfinelle kfi- 
visi. 

5.NiinFaraon ty tfir tuli alaspesemfifin 
itsefinsfi Virtaan, ja hfinen piikansa 
kfiyskentelivSt virran partaalla. Kun 
hfin nfiki arkun kaisilistossa, Ifihetti 
hfin piikansa ottamaan sen sieltfi. 

6. Ja kun hfin sen* avasi, nfiki hfin 
Iapsen, ja katso, lapsi Itki ; niin hfin 
armahtf sitfi ja sanoi: „lfimfi on He- 
brcalaisten lapsista.** 

7. Niin sanoi hfinen sisarensa Fa- 
raon tyttfirelle: „tahdotkos, ettfi mi- 
nfi menen kutsuroaan sinuUe imet- 



58 



2 MOOS. 2. 3. 



t^vSiscn Hebrealaisen vaimon, joka 
sinuUe sen lapscn imett3isi?'* 
& Faraon tytar sanoi hftnelle; ,,me- 
ne/^ Niin tyttO meni ja kulsui lap- 
sen fiidin. 

9. Ja Faraon lytfir sanoi hilnelle. 
,,ota I9m3 lapsi, ja imetfi se minulle, 
ja minfi annan sinullepalkan/* Niin 
vaimo oiti lapsen ja imetli se^ 

10. Mutta kun lapsi oU kasvanut, 
toi h3n sen Faraon tytldrclle, ja hSn 
otti sen pojaksensa, ja antoi hSnelle 
nimen Moose , sillK hdn sanoi: ,,ve- 
destS olen mind hftnet oltanut/' 

Ap. t 7:21. 

11. Ja tapahtui siihen aikaan, kun 
Mooses oil aikamiehcksi tullut, me- 
ni hiln veljiensS tykO, ja nSki hei- 
ddn orjuutensa. Ja hUn huomasi E- 
gyptilSisen miehen Iy0v3n Hebrea- 
laista miestii, hfinen veljednsd. 

12. Ja hdn katseli ympdrillensS sin* 
ne ja t5nne, ja kun hfin nftki, ettei 
ketiUIn ollut l^nfl, tappoi hdn sen 
Egyptilfiiscn ja kdlki santaan. 

13. Seuraavana pllivSnS menI hftn 
taas ulos ja nSki, kuinka kaksi He- 
brealaista miestfi tappelival keske- 
n§nsS ; ja hdn sanoi vadrintekijfiUe : 
„miksi ly6t iiUiimmflistfts?'' 

14. Hi&n vastasi: „kuka sinun on 
asettanut meidiln pdfimielieksemme 
ja tuonaariksemme? Tahdotko mi- 
nankin tappaa, niinkuin sinfi tapoit 
Egyptilfiisen?'* Niin Mooses pelkfisi, 
ja sanoi: „tosin asia on ilmi tuilut.'' 

Ap. 1 7:35. 

15. Ja Faraokin sai kuulla asiasta, 
ia bilii eisi Moosesta tappaaksensa. 
Malta Mooses pakeni Faraon edes* 
tH; ia hftn nysdlityi Midianin maal- 
la, ja istui kaivon tykOnS. 

16. Mutta Midianin papilla oli seit- 
semSn tytfirtS; ne tulivat vettfi am- 
mentamaan ja alkoivat tavttfifi ruu- 
het, juottaaksensa isHnsii lampaita. 

17. Niin tulivat mtiatamat paime- 
net ja tahtoLvat i^aa heidSt pois. 
Malta Mooses nousi ja auttoi heitS, 
ja juotti beidfin lampaansa. 

IS. Ja kun he tulivat isfinsft Regue- 
lin tykO, sanoi hfln: „kuinka te tft* 
ofipanft niin plan jouduitte?** 

19. Hesanoivat: .^bgyptilfiinen mies 
auttoi meitft paimenitten kflsistfi, 
ia myOs ammensi hftn vettft meille, 
Ja juotti lampaat.*' 

20. Ja hftn sanoi ty ttftrillensfi : „kus- 
sa hftn on? Mlksi te niin jfttitte mie* 
hen? KUtsukaat hftn syOmftfln mei- 
dftn fcanssamme.** 

21. Ja Mooses pfifttti jftftdft asumaan 
sen miehen tyko, ja nAn antoi Moo- 
sekselle ty ttftreusft Siponin vaimokd. 



22. Niin vaimo synnytti pojan, ia 
h9n anioi sille nimen Gersom; siUft 
hftn sanoi r„minfi olen muukalainen 
vieraalla maalla.** 2Moo0^ia:8t. 

23. Ja pitkfin ajan perftstft kuoli E- 
gyptin kuningas. Ja Israelin lapset 
nuokasivat oi^uuttaan ja huusivat 
Herran tyk6; ja heidftn huutonsa 
kohosi Jumalan tyk6. 

24. Ja Jumala kuuU heiddn huo- 
kauksensa; Jumala muisti liiUoan- 
sa Abrahamin, Isaakin ja Jaakobin 
kanssa. 

25. Ja Jumala katsahti Israelin las- 
ten puoleen, ja Jumala pit! hetstft 
murheen. 

3 Luku. 

Falava pensas. Mooses kutsutaan. 

Ta MooseSr. kaitsi appensa Jetron, 
^ Midianin papin, lalnpaita. Ja hftn 
ajoi kerran lampaat etemmftksi kor^ 

Eeen, ja tuli Jumalan vuoren Hore- 
in tykO« 

2. Ja Herran Enkeli ilmestyi hft- 
»nelle tulen liekissft pensaasta. Hftn 

nftki, ettft pensas paloi tulesta, ja 
katso, se el kuitenkaan kuiunut. 

&Moo«. 83:16. Ap.t^7:90S8. 

3. Niin Mooses sanoi: t,minfi kfiyn 
tuonnc katsomaan tfttft ihmeellistft 
nftkyft; miks*ei pensas pala tuhidcsi?** 

4. Kun Herra nftki hfinen menevfln 
katsomaan, huusi Jumal^ hftntft pen« 
saasta, ja sanoi: ,, Mooses, Mooses i** 
Hftn vastasi : „tftssft minfl olen.*** 

5. Hftn sanoi: „ftlft Ifthesty tftnne^ 
riisu kenkftsi jaloistasi ; sillft palkka, 
jossa seisot, on pyhft maa.** Jos. &15. 

6. Ja Hftn sanoi vielft; ,, minfl olen 
sinun isftsi Jumala, Abrahamln Ju- 
mala, Isaakin Jumala ja Jaakobin 
Jumala.'' Silloin Mooses peitU kas- 
vonsa, sillft Jumalan nftkeminen pe- 
loitti hftntft. Matt 22-.32. Mark. 12:26. 

Luuk. 20:37. Ap. t. 7:32. Hebr. 11:27. 

7. Ja Herra sanoi: „Minft olen hy- 
vin kyllft nfthnyt minun Egyptissft 
olevan kansani ahdistuksen, ja mi- 
nfl olen kuuUut heidftn huutonsa 
niiden tfthden, jotka heitft ahdista- 
vat ; sillft minft tiedftn mitft he ovat 
saaneet kftrsift. 

8. Sentfthden olen minft astunut 
alas heitft vapahtamaan EgyptilSis- 
ten kftsistft, ja viemftftn heitft tflltft 
maalta hyvftftn ja laviaan maahan» 
siihen maahan, jossa rieskaa ja hu- 
najata vuotaa, siihen paikkaan, jossa 
Kananealaiset, Hetilftiset, Amorilai- 
set, FeresHftiset, Hevilftiset ja Jebu- 
silaiset asuvat. 

9. Koska Israelin lasten huuto on 
tullut minun eteeni» ja minfl my^ 



59 



2 MOOS. 3. 4. 



olen nfihnyl heid3n ahdisluksensa, 
kufi Egyptilftisel heitft sortnvat, 

10. senltihden mene nvl. ja min5 
tahdon IShettilfi sinun Faraon lYk6, 
ja sinun tulee johdaltaa minim lean- 
sani. Israelin lapset, uIosEf^yplisin.*' 

11. Mutla Mooses sanoi Ju'malallc: 
,.kuka minS olen menemflAn Fara- 
on tykO ja viemAAn Israelin lapse! 
ulos Egyplisin? • 

12. HAn vastasi : „lotlsesli Mini! olen 
sinun kanssasi: ja tftmfi olkoon si- 
nullc merkiksi, clIA minfl olen si* 
nun inhetlfinyl: kun olet johdalla- 
nut minun kansani Egyptistd, niin 
palveletle Jumalala tail'a vuorella/* 

13. Silloin Mooses sanoi Jumalalle: 
,.kun minti tulen Israelin laslen ty- 
k6, ja sanon heille- ,teidAn is5inne 
Jumala on minun hlhetlAnyt teiddn 
tyk6nne/jahekysyvntminulta: .mi- 
k(i hSnen nimensfton?' niin mild mi- 
nun pil55 heille sanoman?*' 

14. Nlln Jumala sanoi Mooseksellc: 
„minA olen se, mikS minA olen.'' Ja 
sanoi vielS: ..nAin pildfi sinun sano- 
man Israelin lapsille: ,MinA olen 
lAhetti minun teid3n tykOnne." 

15. Ja Jumala sanoi vielS Moosek- 
selle: ^nSin pitSA sinun sanoman 
Israelin lapsille : ,Herra, leidQn isSin* 
ne Jumala, Abrahamin Jumala, 
Isaakin Jumala ja Jaakobin Jumala, 
Iflhetti minun leidAn lykOnne: tAmft 
on minun nimeni ijankaikkisesli, ja 
niin olen minfi nimltellfivS suvusia 
sukuun. 

16. Mene nyt ja kokoa Israelin van- 
himmat, ja sano heille: ,Herra, lei- 
d9n isAinneJumala, on nhkynyt mi- 
nulle, Abrahamin, Isaakin ja Jaa- 
kobin Jumala, sanoen: min5 olen 
pitanyt huolla teislfi,ja nAhnyl.milA 
teille on tapahlunut Egyptissd. 

1 Moos. 60:24. 

17. Ja olen sanonut: ,minft tahdon 
johdaltaa teilft ulos Egyplin ahdis- 
tuksesta,KananeaIaislen,HetilAislcn, 
Amorilaisten, Feresilfllslcn, HevilAis- 
ten ja Jebusilaislen maalle, jossa 
rieskaa ja hunajala vuotaa.* 

18. Ja kun he kuulevat sinun fiSne- 
si; niin mene sind Ja vanhimmat 
Israelista Egyplin kuninkaan tykO, 
ja sano hfinelle: ,Herra, Hebrealais- 
ten Jumala, on kohdannut meitfi; 
anna siis nyt meidSn mennSkolmen 

EfiivSn matka korpcen, uhraamaan 
lerralle, meidSn Jumalallemme.' 

2 Moos. 5:3. 8:27. 

19. Mutta mina tledfin, etiei Egyp- 
lin kuningas laske teitfi menemSan, 
muutoin kulnvllkevfinkfidenkautta. 

20. Silloin minft ojennan kflleni, ja 



vilsaan Egyplin maala kaikellaisilla 
ihmeillAni, joitn minA tekev3 olen 
heidfln keskellAnsS; ja sitlen hfln 

teidnt pansina. 

21. Ja minA onnan armon tA11e>kan- 
salle Eg>'ptilAisten edessA. elkl kufi 
Ic IShdelle, niin etie suinkaan ISh- 
de tyhjin kAsin; i Moos. 15:14. 

2 Moos. 11:2. ]2:35s8. 

22. vaan jokainen vaimo on anova 
kylfinsS vaimolla ja huonekunlalai- 
sellansa hopia- ja kullu-aslioila j:i 
vaatteita; ja nftmA tepanelle poikain- 
ne ja tylArlenne kannellavaksi. 
Nftin lesaaliin otalteEgypUldisillA.' 

4 Luku. 

Mooses saa lahjan tehdii ihmeiUi ja 
palajaa Egyptiin. 

Mooses vastasi ja sanoi: „mutta jos 
eiv.At usko minua, civSlkSkuun- 
lele sanojani, vnan sanovnl: ,ci ole 
Herra ndkvnyl sinulie?" 

2. Silloin flerra sanoi hSnellc: „mi- 
kil se on sinun kddessSsi?'* H9n vas- 
tasi: „sauva.*' 

3. JaHdn. sanoi: ,,heilA se maahan-* 
Ja hSn heilli sen maahan ; ja semuul- 
lui kSrmceksi. Ja Mooses pakeni 
sitfi. 

4. Mulla Herra sanoi Mooscksclle: 
..ojcnna kniesi,ja rupea hSnen pyrs« 
l66nsA." Niin han ojensi kAlcnsft ja 
larllui hfineen, ja sc muultui sau- 
vaksi hAnen kAcfessdnsd. 

5. Ja Herra sanoi: „senhlhden pi- 
IQA heidHn uskoman, ellS Herra, h«i- 
dUn isdinsS Jumala, -Abrahamin Ju- 
mala, Isaakin Jumala ja Jaakobin 
Jumala. on ilnieslynyl sinulle." 

G. Ja Herra sanoi vielA hflnelle: 
..pistfi nyt kfltcsi poveesl.** Ja hftn 
pisli sen* poveensa ; ja kun hAn veil 
sen ulos, kalso, hSnen kdtcnsfi oli 
spilalinen nlinkuin lumi. 

7. Ja IlAn sanoi: „pist5 kAlesi jfll- 
lecn povecsi." Ja hfln pisli kAlcnsA 
jAllcen poveensa. Ja kun hHn veli 
sen jAIIeen ulos poveslansa, niin 
kalso, se oli puhdas niinkuin hHuon 
muukin ihonsn. 

8. Ja Herra sanoi: „EIJeivdl he si- 
nua usko, eivAlkA ole kuuliaisci sa- 
nallesi ensimmSisen ihmcen lAhden. 
niin he uskovat sinua toisen ihmeen 
tAhden. 

9. Mulla clleivAt usko niilA kahia 
ihmellA, eivAlkA ola vaaria sinun so- 
noislasi, niin ola vcllA virrasia, ja 
kaada kuivallc maalle, niin se vesi, 
jonka olel ollanul virrasia, lu lee kui- 
valla maalla vereksi!** 

10. SiUoin sanoi Mooses Herralle: 



60 



a MOOS. 4. 5. 



..ah Herra, minulla ei ole puhelahjaa: 
ei sits ole minulla ennen oilut eikfi 
nytklUln sen jfllkeen kuin sinfi pal- 
velijasl kanssa puhunut olet; sillfi 
Aiinulla on hidas puhe ja kankia 
kieli/' 2 Mooe. 6:12, 80i Jer. I :& 

11. NiinHerrasanoihfinelle: „kuka 
on luonut ihmisen suun? Tahi kuka 
on tehnyl mykAn taikka kuuron,nfi- 
kevfln taikka sokian? Enk6,Minfi, 
Herra, ole niitd tehnyl? 

P8.M:9. ire8.S:268. 

12. Mene siis nyt, minfi olen sinun 
suasi kanssa, Ja opetan sinua, mitS 
sinun puhuman pitfifi.** Matt 10:19. 

Luuk. 12:12. 21:15. 

13. Mutta Mooses sanoi : ,,ah Herrn, 
liihelll joku muu, kenenkfl tahdot.'' 

14. Niin Herra vihastui suuresti 
Moosekseen, ja sanoi: „enkO minfi 
lunne Aaronia, sinun veljefisi, Le- 
vin suvusta, Ja hfin osaa puhua? 
Ja katso, hfin tulee sinua vastoan. 
Ja kun hfin nfikee sinun, niin hfin 
iloitsee sydSmmestfinsfi. 

15. Sinun pilfifi puhuman hfinelle, 
|a paneman sanat hfinen suuhunsa ; 
ja Minil olen sinun Ja hfinen suun- 
sa kanssa« ja opetan teitft, mitfl tei- 
dfin pilfifi lekemfin. 2 Moos. 7:2. 

16. Ja hfinen pitfifi puhuman sinun 
puoleslasi kansalle. Hfin onoleva si- 
nun suunasi, Ja sinfi hfinelle Juma- 
lana. 

17. Ja Ota Ifimfi sauva kfileesi, jolla 
sinfi olet tekevfi ihmeitfi.'' 

18w Niin Mooses Ifiksi sleltfi ja pa- 
lasi appensa Jetron tykd, ja sanoi 
hfinelle: ,«anna minun Ifihiefi velji* 
eni tykd, jolka ovat Effyptissfi, kal- 
somaan vic!Sk6 he elnvfit." Jetro 
sanoi Moosekselle: „menerauhassat' 

19. Ja Herra sanoi Moosekselle Mi- 
dianissa: „mene ja palaja Egyptiin; 
sillfi ne kaikki oval kuolleet, Jolka 
sinun henkefisi vfiijyivfil.'* Matt. 2:20. 

20. Niin Mooses otii vaimonsa ja 
poikansa, ja pani ne aasin selkfifin, 
ja- palasi Egyptiin; ja hfin otli Ju- 
mafan sauvah kfiteensfi. 2Moos.2:2l m. 

18:2 8S. 

21. Ja Herra sanoi Moosekselle: ,,kun 
nyl palajal Egyptiin jfilleen, niin 
muisla.ellfl Faraon edcssfi lect kaik- 
ki ne ihmcel. jolka minfi olen an- 
lanul sinun kfilecsi. Mulln minfi paa- 
dulan hfinen sydfimmensfi, niin ct- 
lei hfin pdfislfi kansua. 

2. Ja sllloin piUlfi sinun sanoman 
Faraolle* ,nfiin sanoo Herra: Israel 
on minun poikani. minun esikoiseni. 

Mat. 2:15. 

23. ja Minfi olen sinuUe sanonut: 
pfifista minun poikani palvelemaan 



minua.* Mulla sinfi et ole tahlonut 
pfifislfifi hfintfi. Sentfihden lapan mi- 
nfi sinun poikasi, sinun esikoisesi." 

2 Moos. 11:4.8. 12:2». 

24. Ja tapahlui, kun hfin oil matkal-. 
la, ettfi Herra maiapaikassa tuU hfin- 
tfi vastaan ja Ian lot hfinen tappaq. 

25. Niin Slpora otti kiven Ja ym- 
pfirileikkasi poikansa esinahan, Ja 
rupesi hfinen jalkoihinsa. Ja sanoi : 
^smfi olet minulle veriylkfi.** 

1 Moos. 17:14. 

26. Niin Hfin jfiiti hfinel rauhaan. 
Mulla fiilf sanoi: „veriylkfi ympfiri- 
leikkauksen Ifihden.** 

27. Ja Herra sanoi Aaronille: „ine- 
ne Moosesia vastaan korpeen.** Ja 
hfin meni, ja lull hfintfi vastaan Ju- 
malan vuorella ja anioi hfinen suula. 

28. Ja Mooses ilmoilli Aaronille kaik- 
ki milfi Herra Ifiheltfiissfifin hfinet 
oil puhunut ja kaikki Ihmeet, mit- 
kfi hfin hfinelle oil kfiskenyt. 

29. Niin meni. Mooses Ja Aaron, ja 
kokosivat kaikki Israelin lasten van- 
himmat. 

30. Ja Aaron puhui kansalle kaik- 
ki ne sanat, jolka Herra Moosekselle 
oli puhunut, Ja teki ihmeitfi kan- 
san edessfi. 

31. Silloin kansa uskoi. Ja kun he 
kuulivat, ettfi Herra oli etsinyt Is- 
raelin lapsia ja nfihnyl heidfin ah* 
disluksensa, lankesivat he maahan 
ja rukoilivat. 

5 Luku. 

Mooses ja Aaroo tulevot Faraon eteen* 
Kansan vaiva enenee. 

Sitten menivfit Mooses ja Aaron Fa- 
raon Iyk6 ja sanoival: „nfiin sa- 
noo Herra, Israelin Jumala: ,pfifistfi 
minun kansani pitfimfifin minulle 
juhlna korvessa.*' 

2. Farao vaslasi: „kuka on Herra, 
jonka kfiskyslfi minun tulisi pfifislfifi 
Israel? En minfi sillfi 'Herrasta mi- 
tfifin tiedfi, enkfi pfifislfi Israelia.*' 

3. Niin hesanoivat: „Hebrealaislcn 
Jumala on meille ilmestynyt; anna 
siis nyl meidfin mennfi kolmen pfii- 
vfin malka korpeen uhraamaanHer- 
ralle, meidfin Jumalallemme, eltei 
hfin rutolla tahi miekalla tulisi mei- 
dfin nftfillemme." 2 Moos. 3:18. 

4. Nlutia Eg3^ptin kuningas sano| 
hvillc: „miksi le, Mooses ja Aaron, 

S)id5ltc kansan heidfin lyfistfinsfi? 
4enkfifil lydhdnnel*' 

5. Farao sanoi vielA: „kalso, ilman- 
kin on kansaa liika paljon maassa, 
ja te vielfi nyt lahdotle heitfi jouti- 
laaksi saaltaa heidfin pfiivfitfiislfinsfi:* 

6. Silten antoi Farao samana p(U- 



61 



2 MOOS. 5. 6. 



%-Snfi kftskyn kansanpMdllysmichillc 
ja lyAniohtajille, snnoen: 

7. ..Alkflnt tdstiiinhin oikin uiiUiko 
kansalle tiilejn vaiien niinkuin en- 
ntn. Menk66{ ilse ja koolkool oikia. 

K. Kuilenkin vaalikaai hvlll^ stiiiia 
liililuku, minkn he liUiftn asli oval 
lehneet, nikAalkn siitii vaiicntak6; 
silla he oval laiskoja, senl;lh<len he 
huutavat, sanoen: ,mc tahiloiiime 
hicnnA uhraanKian mcidiln Jiiiiia- 
lallemme/ 

9. Tflylyy panna raskasta.tydliliirul- 
Icii ihmisten pftfillc. ettA hcilhl olisi 
jotain tekemislA, eivHlkft lavoillelisi 
valhepuheita." 

10. Niin kansan pDnilysiniehet ja 
ty6njohlajal nicnivfll ju ])uhuivat 
kansaIle,sanocn:,,ndinsanooFarao 
,enminniahdoeiiait(eilleolkiaantaa. 

11. MenkHAt ilse kokoamaan oIkia, 
mista sita idyciaite; mutia leidan 
lyOsianne ei picia miiaan \aheniiel- 
15 man?'* 

12. Niin kansa hajaantui ympSri 
kokoEgyptin maatahakemaaii ilseU 
iensa sankia, kfiyliadksensa sita ol- 
kieii asemcsla. 

13. Ja paailysmiehet vaalivat heita. 
sanoen: ,,tayliakaat paivaiyOnne, se 
mika joka paivdlleon maarativ, niin- 
kuin silloinkin, kun teillc olkia an- 
nelliin." 

14. Ja Israelin lasten tyOnjohlajat, 
joika Faraon paailysmiehet olivat 
asettaneet heidan paailensa. pi^stiin, 
ja heille sanoltiin: „miks*elle eilen 

eika tdnapdna tayiianeet maaraitya 

paivat^rdianne tiilein tekemisessa. 
niinkuin ennenkin?" 

15. Niin Israelin laslen tydnjohla- 
jal mcnivat ja huusivat Faraon ty- 
kO, sanoen: „miksi nain lect pal- 
velijoillesi? 

16. Ei anneta sinun palvelijoillesi 
olkia, jn kuilenkin sanovat he meil- 
le: ^saakaat tiilil valmiiksi.'* Ja 
kalso, sinun palvelijasi piesiaan, 
vaikka vika onkin oman vfikesi 
puolella.** 

17. Multa han sanoi: «,te olette lais- 
koja, niin, laiskoja te oletle; sentah- 
den tesanotte: ,menkaamme ja uh- 
ralkaammc Herralle.* 

18. Menkaat vaan ja tehkfifit tyMfi. 
Olkia ei lellle annetu; multa teidan 

f^ilfiA kuilenkin antaa se maarStty 
uku tiilifi.** 

19. Silloin Israelin lasten lyOnjoh- 
fajat huomasivat olevansa ahlaal- 
la, kun heille annelliinvaslaus: „tei- 
dari tiilimaarastanne el mita&n vA- 
hennetfi, mita on kullekin paivfiUe 
mftfiffilty/' 



20. Ja kun he laksix at Faraon Iyk6fl. 
kohtasivat he Mooseksen ja .\nroniii. 
jotka tulival heita \astaan; 

21. ja he sunoixat heilk': ,,Hcrr.i 
nahkddn \a tuomitkoon IcilA; silhi 
te oletle lehneet nieidai haisevaisfksi 
Faraon ja hAnen palvelijainsa Odes- 
sa, ja oletle antancel miekan liei<l;tn 
kAteensa surmala meilA.** 

22. Niin Mooses kAAnlyi Herran |>im». 
leen ja sanoi; ^.llerra, mik^i inin 
pahasli leet lAIA kansaa \astn:iii ^ 
Miksi olet niinun tAnne laheltriiivl? 

23. Silia siila lahiein kuin minA nic- 
nin Faraon lykdpuhuttclemaiin li:\ii- 
lA sinun ninies<^Asl. on hAn pahoiii 
tehnyt taile kansalle; ja sinA el ol 
Icnkaan ole pelaslanut kansaa'sK** 

6 LukiK 

Jiiinalnn uuUcl kiiikyt ja lupauksi-i. 
Mouseksen J.i Auionin sukuldulu. . 

Multa HerrasanoiMoosekselle..,ii> X 
saal sinA nAhdA. niilA niinA Fa- 
raollo teen, sillA minun viikexAn kA- 
ten! kaulta on hAn pAAstuvA heidai. 
niin, minun \Ake\An kAteni kaulta 
hAn pakoiletaanajamaan lieidAI ulos 
maastansa." 2.M»os. ii:i. I3.3;{ 

2. Ja Juniala puhui Mooseksclle. ja 
sanoi hAnelle. „mina olen Herra. 

3. MinA olcn ilmoiltanul iiseni A- 
brahamille, Isaakille ja Jaakobillo 
kaikkivalliaanaJumalana;mutta mi- 
nun nimessani .HEUKA* en olltit 
minfl heille lunnettu. iMuos. I7.i. 

'J\i:2l. 28 13. 3i.ll. 

4. Ja minA tcin my6s minun liitlo- 
ni heidAn kanssansa. anlaakseni heil- 
le KanaanmaanJieidAn vaelluksensa 
maan.jossaheovalmuukalaisetolleet. 

5. Ja nyl minA olon kuullul Israe- 
lin laslen huokauksen, joila Egvp- 
tiiaiset orjuudella vaivaa\al. ja olen 
minun liitloni nuiislanul. 

0. Seniaiiden sano Israelin lapsillc 
,mina olen Herra. ja minA johdainn 
leidai Egyplin kuornian alia ja f>e- 
laslan teidalorjuudeslanneja\npah- 
dan tcidat ojelulla kAsivarrella ja 
suurlen rangaislustuomioitlen kaul- 
ta. 

7. Ja mina otan teidai kansakseni, 
ja olen leidAn Jumalanne; ja te lu- 
ictte tieiamaan, etia mina olen Her- 
ra, teidan Jumalanne, joka johda- 
tan teidai ulos Egyplin orjuudesta. 

8. Ja mina vien leidAI sillc maalle. 
jonku ylitse minA nostin kAteni an- 
laakseni sen Abrahamille, Isaakille 
ja Jaakobille; sen mina lahdon an- 
taa leille omaksi. MinA olen Herra.** 

Het. aO:6kl. 



62 



2 MOOS. 6. 7. 



9. Nfiin puhui Mooses Israelin lap- 
sille; multa he eivdt kuulleet Moo- 
sesta heidan henkensft ahdisluksen 
ja raskaan orjuutensa t§hden. 

10. Silloin puhui Herra Mooseksel- 
le, sanoen : 

11. „Mene ja puhu Faraolle, Egyp- 
tin kuninkaalle, etiA hfin pAdslslisi 
Israelin lapset pois manslansa/* 

12. Mutia Mooses puhui Herran edes- 
sd, sanoen: ,,katso, Israelin lapset 
eivdl kuulleet minua, kuinka Farao 
sitten kuulisi minua, minua, jolla 
onympArileikkaamattomat huufet?" 

2 Moos. 4:10. 

13. Mutta Herra puhui Moosekselle 
ja Aaronille, ja kSski heiddn ilmoil- 
taa Israelin lapsille ja Faraolle, Egyp- 
tin kuninkaalle, ettS Israelin lapset 
oiivat johdatettavat ulos Egyptin 
maasta. 

14. Nflmft ovat heidftn perhekun- 
tiensa kanta-isfit. Ruubenin, Israelin 
esikoisen, lapset oiivat : Hanokja Pal- 
la, HesronjaKarmi. Nftmilovat Ruu- 
benin sukukunnat. 1 Moos. 46:988. 

4 Moos. 26:588. 1 Aik. 6:1 bs. 

15. Simeonin lapset oiivat: Jemuel, 
Jamin, Ohad, Jakin, Soar ja Saul, 
sen Kananealaisen vaimon poika. 
NSmS ovat Simeonin sukukunnat. 

16. Ja niUnft ovat Levin lasten ni- 
inet heidSn sukukunnissansa : Ger- 
son, Kahat ja Merari. Mutta Levin 
elamSn vuoaet oiivat sata ja seitse- 
mfin neljattfikymmentfl ajastaikaa. 

1 Moos. 46:11. 4 Moos. 3:17 ss. 26:57 ss. 

1 Aik. 6:1. 23:688. 

17. Gersonin lapset oiivat: Libni ja 
Siinei heidfin sukukunnisslinsa. 

18. Kahalin lapset oiivat: Amram, 
Jetsear, Hebron ja UsieL Mutta 
Kahatin elfim5n vuodet oiivat sa- 
ta ja kolme neljdttakymmentft ajast- 
aikaa. 

19. Merarin pojat oiivat: Maheli jn 
Musi. Ndmfi ovat Levin sukukunnat 
heidfin polviluvussansa. 

20. Ja Amram otti isSnsd slsaren 
Jokebetin vaimoksensa, jo'ka synny t- 
li hfinelle Aaronin ja Mooseksen. Ja 
Amramin elflmAn vuodet oiivat sata 
jaseitsem9nnelj9ttfikymmentfi ajast- 
aikaa. 4 Moos. 26:59. 

21. Ja Jetsearin lapset oiivat : Korah, 
Nepeg ja Sikri. . 

22. Csielin lapset oiivat: Misael, El- 
safan ja Sitri. 

23. Aaron otti vaimoksensa Elise- 
ban. Aminadabin tyttfiren, Nahas- 
sooln slsaren, joka nflhelle synnytti 
Nadabin, Abihun, Eleasarin ja Ita- 
marln. 

24. Korahin lapset oUval : Assir, EI- 



kana ja Abiasaf. NftmS ovat Kora* 
hilaisten sukukunnat. 

25. Multa Eleasar, Aaronin poika, 
otti Putielin tyllAristd vaimon, joka 
synnytti hAnelle Pinehaan. N5m9 
ovat l.,evilflisten huonekuntain kaii- 
talsfit heiddn sukukunnissansa. 

26. Ndin oli Aaronin ja 'Mooseksen 
laita, joille Herra sanoi: .,johdalta- 
kaat ulos Israelin lapset Egyptin 
maalla joukkoinensa.*' Ap. t. 7:36. 

27. NSmfi ovat ne, iotka puhuivat 
Faraon. Egyptin kunlnkaan.kanssa, 
ett§ heiddn pill johdattaman ulos 
Israelin lapset Egyptistfi. Ndmfi ovat 
Mooses ja Aaron. 

28. Ja sinfi pSivdnfl puhui Herra 
Mooseksen kanssa Egyptin maalla. 

29. ja sanoi hfinelle: ..Minft olen 
Herra. Puhu Faraolle, Egyptin ku- 
ninkaalle, kaikki, mil9 minfV sinul- 
le sanon!'' 

30. Niin vastasi Mooses Herralle: 
„katso, mind olen ympfirileikkaama- 
ton huulilta; kuinka Farao minua 
kuulisir* 

7 Luku. 

Mooses ja Aaron tekcvftt ibmeet Faraon 
edessft. 

Mutta Herra sanoi Moosekselle: 
„katso, mind olen asettanut si- 
nun Faraon Jumalaksi. Ja veljesi 
Aaron pitdd olemanslnunprofeltasi. 

2. Sinun pltfifl puhuman kaikki, 
kuin mind Kdsken slnulle; vaan Aa- 
ronin, sinun veljesi, tuleesitlen pu- 
hua se Faraolle, ettd hdn pddstdisi 
Israelin lapset pois maaslansa. 

2 Moos. 4:15 s.«. 

3. Mutta mind lahdon paaduttaa 
Faraon syddmmen, ja teen monta 
ihmoltd ja merkktd Egyptin maassa. 

4. Farao ei kuule teitd; multa mind 
nostan kdteni Epyptid tastaan, jn 
johdatan ulos mmun joukkoni, mi- 
nun kansani, Israelin lapset, Egyp- 
tin maalla suurten rungaistusluomi- 
oitten kaultu. 

.'>. Ja Egyptiidiset tulevat tietii- 
mddn, ettd mind olen Herra, ojeles- 
sani kdlldni Egyptin ylilse, ja joh- 
dattaissani ulos Israehn lapse! hei- 
ddn keskeltdnsd.'* 

6. Ja Mooses ja Aaron tekivdt niin- 
kuin Herra oli heille kdskenyt. 

7. Mutla Mooses oli kahdeksankym- 
menen ajastaikainen, ja Aaron kol- 
men ajastaikainen yhdeksdttdkym- 
mentd, kun he puhuivat Faraon 
kanssa. 

8. Ja Herra puhui Moosekselle ja 
Aaronille, sanoen: 

9. „Kun Farao puhuu teille, sano- 



63 



2 MOOS. 7. 8. 



en: ,tehkflfi joku ihme,* niin sano 
sinfi Aaronille: ,ota sauvasi ja heitfi 
Faraon eteen,* jaseluleekdrmeeksit' 

10. Niin Mooses ja Aaron menivSt 
Faraon tykO, jalekivfitniinkuinHer- 
ra oli kfiskenyl. Ja Aaron heitti sau- 
vansa Faraon ja hSnen palvelijoit- 
tensa eteen, ja se lull kflrmeeksi. 

11. Niin Farao kutsui tietfijftt ja 
noidat, ja Egyntin noidat tekivSt 
myOssamaa lieiafin noitumisillansa : 

211111.3:8. 

12. kukin heislfl heitti sauvansa 
maahan, ja ne tulivat kfirmeiksi. 
Mutta Aaronin sauva niell heidSn 
sauvansa. 

13. Niin Faraon sydfln paalui, eikll 
hfin kuullut heitft, niinxuin Uerra 
oli sanonut. 

14. Senjfilkeen sanoi Herra Moosek- 
selle: „Faraon syd3n bn kovettunut, 
eikfi hhn lalido pddstfia kansaa. 

15. Mene Faraon tyk6 huomenna 
varhain aamulla, katso, hfin kfive- 
lee velten tykdnfi, ja asetu hSnen 
tielleen virran reunalla. Ja se sau- 
va, jolca oli kflrmeeksi muuttunul, 
ola sinun kfiteesi. 

16. Ja sano hflnelle: .Herra, Hebrea- 
laisten Jumala, on minun Idhettfinyt 
sinun lykOsi, sanoen: laske minun 
kansani palvelemaan minua korves- 
sa.* Mutla katso, el ole tfihfin asti 
tahtonut kuuUa minua. 

17. Sentfihden sanoo Uerra nfiin: 
,tfistfi olet sinfi tunleva, eltfi minfi o- 
len Herra: katso, minfi Iy6n tfillfi 
sauvalla, joka on minun kadessfini, 
veteenjokavirrassa onjaseonmuut- 
Inva vereksi. 

18. Niin kalat, jotka virrassa ovat, 
kuolevat ja virta rupeaa haisemaan, 
niin eltfi Egyptilfiisifi ilieltfifi, kun 
he juovat vetlfi virrasta.^* 

19. Ja Herra sanoi Moosekselle : „sa- 
no Aaronille: ,ola sauvasi, ja ojenna 
kfttesi Egyptin velten ylitse, sen vir- 
tain, joklen, jfirvien, ja kaikkien sen 
vesilammikkoiensa ylitse, niin tule- 
vat ne vereksi ; koko Egyptin maas- 
sa on verta oleva sekfi puuastioissa 
eltfi kiviastioissa.*' 

20. Niin Mooses ja Aaron tekivfil 
niinkuin Herra oh kfiskenyl, ja hfin 
nosli sauvan ja lOi veleen, joka vir> 
rassa oli, Faraon ja hfinen palveli- 
joittensa edessfi ; ja kaikki vesi, joka 
oli virrassa, muuttui vereksi. 

P8. 79:44. 105:29: 

21. Ja kalat, jotka olival virrassa. 
kuolival. ja virta haisf. niin ellei 
Egyplilftlset saatlaneet juoda vetlfi 
virrasla. Ja verta oli koko Egyptin 
maalla. 



22. Malta Egypthi notdat tekivfil 
myOs samallaisia noitumisillansa. 
Mutta Faraon sydfin paatui,eikfi hfin 
kuullut heitfi, niinkuin Herra sano- 
nut oli. 

23. Ja Farao kfifintyi pois ja palasi 
kotiansa, eikfi otianul vaarin tfistfi- 
kfifin. 

24. Mutta Egyplilfiisel kaivoivat vir- 
ran ympfirillfi vetlfi juodalctensa; sil- 
Ifi eivfit he saatlaneet juoda virran 
vetlfi. 

25. Ja niin kului seitsemfin pfiivfifi, 
sitlekuin Herra oli ly6nyt virran. 

8 Luku. 

Sammakot, byttyset ja kftrpfts-parvet 

Silten sanoi HerraMoosekselle: ^me- 
ne Faraon tykO, ja sano hfinelle: 
,nfiin sanoo Herra: pfifistfi minun 
kansani palvelemaan minua. 

2. Vaan jos el sinfi lahdo heitfi 
pfifistfifi, katso, niin minfi rankaisen 
koko sinun maasi fifirel sammakoilla. 

3. Virta on kuohuva sammakoista, 
la ne astuvat ylOs ja luleval sinun 
huoneesesi, ja sinun lepokammioo- 
si ja sinun vuoteesesi, niin myOs si« 
nun palveliioittes huoneesen, ja si- 
nun kansasi sekaan, ja leipoma-uu- 
niisi, ja laikina-aslloihisi, 

4. ja sinun pfifillesi ja sinun kan- 
sasi ja kaikkien sinun palv^ijoittesi 
pfifille hyppelevfil sammakol.** 

5. Ja Herra sanoi Moosekselle : ^sa- 
no Aaronille: ,ojenna kfilesi sauvoi* 
nensa virtain, jokien ja jSrvien ylit- 
se,ia anna sammakkojennoustaylit- 
se koko Egyptin maan.*' 

P8. 78:46. 105'.30. 

6. Silloin Aaron ojensl kfitensfi E- 
gyptin velten ylitse, ja sammakot 
tulivat sieltfi ylOs ja peillivfit koko 
Egyptin maan. 

7. Mutta noidat tekivfil myOs sa- 
mallaisia noitumisillansa ja antoi- 
vat sammakkojen tulla Egyptin 
maan ylilse. 

8. Silloin Farao kutsui Mooseksen 
ja Aaronin, ja sanoi: „rukoilkaat 
Herraa, eltfi hfin ottaisi pois samma- 
kot minulta ja kansaltani, niin mi- 
nfi pfiftslfin kansan uhraamaan Her- 
ralle." 

9. Mooses sanoi: „sinun on salliltu 
m.'iarfitfi aika, milloin minun pilfifi 
rukoileman edestfisi, palvelijoillesi 
la kansasi edeslfi, eltfi sammakot 
nukutettaisiin sinulla ja sinun huo- 
neistasi , ja ainoaslansa virlaan jfli- 
sivfit. 

10. Hfin sanoi: „huomenna.*' Hfin 
vastasi : „olkoon sanasi jfilkeen, Ja 



64 



2 MOOS. 8. 9. 



tini tolet tietfimftan, etfei yksikfiftn 
ole niinkuin Herra, nieidui Juma- 
Uunme. 

11. Silloin sammakot pitfift otetta- 
man pofs stnuUa, fa sinun huoneis- 
tasi, ja sinon palvelijoiltasija sinun 
kansaltasi, ja ainoastansa virtaan 
Jflilmfin.'* 

12: Niin Mooses ja Aaron Ifiksivfit 
Paraon tykOfi. Ja Mooses huusi Her- 
lalta apua sammakkoja vastaan, lot- 
ka H§n Faraon pfifille pannut oU. 

13. Ja Herra teki Mooseksen sanan 
jilkeen: sammakot kuolivat huo- 
neista, kylistfi ja kedoilla. 

14. Ja ne heftettiin suuriin rouk-' 
kioihin, ja maa haisi siilS. 

15. Mulla kun Farao nfiki helpol- 
tuksen saaneensa, paadutti hfin sy- 
dimmensd,eikfi kuullut heitfi; niin- 
kiiio Herra sanonut oli. 

16. Senjfilkeen sanoi Herra Moosek- 
telle: ^sano Aaronille : ,ojennasau- 
vast, Ja lyO maan lomuun, niin se 
tnlee hyttysilisi koko Egyptln maas- 
la.*** 

17. Ja he tekivfit niin. Aaron ojensi 
kiteosft sauvoinensa ja lOi maan 
tomuun, ia hyttysifl tuli ihmisiin 
ja elflimifn. Maan torou muuttui 
hyttysiksi koko Egyptin maassa. 

fB. Ja noidat taliloivat tehdft silS 
samaa noitumisillansa hyttysifi mat- 
kaan saaltaaksensa ; vaan eivftt tain- 
neet Ja hyttyset olivat ihmisissfi ja 
dftimissi. 

19. Silloin sanoivat noidat FaraoUe: 
JOmft on Jqmalan sormi." Mutta 
Faraon sydfin paatui,eikfl hfinkuul- 
lot lieilS, niinkuin Herra sanonut oli. 

Lunk. U:20. 
2D. Sitten sanoi Herra Moosekselle: 
nOouse huomenna varhain, ja seiso 
raraoB edessfi, — kalso, hfin menee 
tiUoin vet ten tykO, — ja sano hfi- 
oelle: ,nflin Sanoo Herra: pfifistft 
minoa kansani palvelemaan mi- 
nua. 

21. Mutta Jos et sinfl pftfistfi minun 
kansaani, katso, niin minfi tahdon 
lihellfift sinuUe, sinun palveltjoille- 
si, sinun kansallesija sinun huonei- 
sisi kfirpSs-parvet, niin ettfi kfirpfis- 
parvet tSyttfivSt kaikkl huoneet E- 
gyptissfi, niin my6s sen maan, jonka 
pflllllfi he ovat. 

22. Ja minfi tahdon eroittaa sinS 

eivfinSGosenin maan. jossa minun 
nsani asuu.niin ettei siinfi yhtfifin 
kftrpfis-parvea tule olenlaan: niin 
tttlei sinfi tietfimfifin, ettfi minfi o- 
len Herra koko maan keskellfi. 
2S. Ja minfi lunastan kansani , ja 
(eeo ^roltuksen minun ja sinun kan- 



sasi vfilillfi. Huomenna on tftmft ih- 
me tapahtuva.*'* 

24. Ja Herra teki niin. Snuret kflr- 
pfis-parvet tulivat Faraon ja hSnen 
palvelijainsa huoneisiin: ja kaikld* 
alia Egyptissft turmelivat karpfis-par- 
vet maan. 

25. Silloin kutsui Farao Mooseksen 
ja Aaronin, ja sanoi: ^menkfifit ja 
uhratkaat teidfin Jumalallenne tfissS 
maassa.'* 

26. Mutta Mooses sanoi: „emme vol 
silfi tehdfi; sillfi me uhraamme Her- 
ralle, meidfin Jumalallemme, sem- 
moista, joka on Egyptilfiisiile kau- 
histus. Jos meEgyptilfiistensilmfiin 
edessfi uhraamme semmoista, joka 
heille on kauhistus, niin eivfitkO he 
kivittfiisi meitfi? 

27. Niin anna meidfin mennfi kol- 
men pfiivfikunnan matka korpeen 
uhraamaan Herralle, meidfin Juma- 
lallemme, niinkuin hfin on meille 
sanonut.** iMoo8.3:i8. 

28. Silloin Farao sanoi: „minSpfifis- 
tfin teidfin uhraamaan Herralle, tei- 
dfin Jumalallenne, korvessa ; filkfifit 
vaan kauas menkO. Rukoilkaat mi* 
nun edestfini.** 

29. Mooses vastasi: „katso, kun mi- 
nfi menen sinun tykOfisi, niin olen 
minfi rukoileva Herraa, ettfi Hfin 
kfirpfis-parvet ottaisi pois Faraolta, 
hSnen palvelijoiltansa ja hfinenlcan- 
saltansa huomenna. Ainoastansa fil* 
kOOn Farao minua enfifi pettflkO, 
niin ettet pfifistfi kansaa uhraamaan 
Herralle.**^ 

30. Ja Mooses Ifiksi Faraon tykOfi 
ja rukoili Herraa. 

31. Ja Herra teki niinkuin Mooses 
sanonut oli; Hfin otti pois Faraol- 
ta kfirpfis-parvet, hflnen pa velijoil- 
tansa Ja hfinen kansaltansa, niin et- 
tei yhtfikfifin jfifinyt. 

32. Mutta Farao paadutti sydfim- 
mensfi myOskin tfillfi kertaa, eikfi 
pfiflstfinyt kansad, 

9 Luku. 
BlUnten rutto, paisumat Ja ralceet 

Senjfilkeen Herra sanoiMoosekselle : 
„mene Faraon tykd ja sano hfi- 
nelle: ,nSin sanoo Herra, Hebrea- 
laisten Jumala, pfifistfi minun' kan- 
sani palvelemaan minua. 

2. Mutta ellet pfifistfi, vaan vielfl 
pidfitfit heitfi, 

3. katso, niin Herran kfisi sangen 
kovalla ruttotaudilla on oleva sinun 
karjasi pfifillfi, jotka ovat kedolla. 
hevosten, aasein, kamelein, hfirkfiin 
ja lammastcn pfifillfi. 



(Fimiisli] S 



66 



2 MOOS. 9. 



4. JaHerra tekee eroituksen Israeli- 
laisten ja Egyptilfiisten kaiian vftlil- 
Ifi, niin ettei mitflfin kuole niistfl, 
jotka kuuluvat Israeiin lapsiile.*' 

5. Ja Herra mfiArSsi ajan, sanoen* 
,,tfimfin tekee Herra huomennamaas- 
sa." 

6. Seuraavana pftivfinfl teki Herra 
niin, ja kaikki EgypHn kaija kuoli; 
vaan Israeiin lasten kaijasta ei yhtfi- 
kfiSn kuollut P6.78*.50. 

7 Niin Farao Ifihetti tiedustele- 
maan. ja katso, ei ollut Israeiin kar- 
jasta yhtfikfifin kuoHut. Mutta Fara- 
on syaSn paatui, eikft hSn pflSstfinyt 
kansaa. 

8. Sei^dlkeen Herra sanoi Moosek- 
selle ja Aaronille: „ottakaaf kfitenne 
Ifiyteen toton nokea, ja Mooses heit- 
t§kOOn sen taivasta kohti Faraon 
edessS, 

9. niinonsiitftkokoEgyptinmaassa 
luleva tomna, josta syn^ mdrkfi- 
pfiihin puhkeaviapaisumiaihmisiin 
fa elflimiin/' 

10. Niin he ottivat nokea totosfa, ja 
astuivat Faraon eteen; ja Mooses 
heitti sen taivasta kohti, niin tuli 
siitfi mfirkdpfiihin puhkeavia paisu- 
mia ihmisiin ja kaijaan. 

11 Ja noidatkaan eivdt voineet sei- 
soa Mooseksen edessft paisumain 
tfihden ; sillft paisumia oil niin noi- 
dissa kuin mulssakin EgyptilflisissA. 

1% Mutta Herra paaautti Faraon 
sydammen, eikfi han kuullut heitfl, 
nilnkuin Herra Moosekselle sano- 
nut oli. 

13. Senjfilkeen sanoi Herra Moosek- 
selle: „nouse huomenna varhain, ja 
ustu Faraon eteen, ja sano hfinelle: 
,n§in sanoo Herra, Hebrealaisten 
J u mala: p&fistfl minun kansani pal- 
velemaan minua. 

14. Muutoin mtnft tfill& kerfaa 1ft- 
hetftn kaikki minun rangaistukseni 
sinun, sinun palvelijaisf, ja sinun 
kansasi, ylitse, tietftfiksesi, ettei ku- 
kaan koko maan pftftUft ole nilnkuin 
minfi; 5Moo8.7:16. 

15. sillft minft olin jo ojentanut kft- 
teni, lyOdftkseni sinut ja sinun kan- 
sasi ruttotaudilla, niinettfl sinftoli- 
sit hukkunut maan pfiftltft; 

16. mutta sentShden olen minfi si- 
nua sfifistSnyt, ettft minfi osoittaisin 
sinulle minun voimani, la ettfi mi- 
nun nimeni julistettaisiin koko maan 
pfifillfi. Boom. 9^7. 

17. Jajosvielfikin panel esteitfikan-^ 
salleni, etkfi pftfisla heitfi, 

18. katso, silloin annan minfi huo- 
menna tfillfi alalia sataa sangen suu* 
ria rakeita, Jonka kaltaisia ei ole 



ollut Eg3rpfl88§9' hama^ta silfft pfif« 
vfistfi kum se penistettu on« tuna 
tfihfin asti. 

19 Lfihetfi, sils nyt Ja koijaa pois 
kariasi ja kaikki mitfi sinuUa on 
keoQlla. Sillfi rakeet lankeavat kaik- 
kien pfifille, ihmisten ja karjan 
pftftlle, jotka kedolla ovat, eivfitkH 
ole katon alle saatetut, ja tappaa 
heidfit/' 

20. Joka Faraon palvelijoista pel- 
kfisi Herran sanaa, se koijasi pal- 
v^l^ansa ja kaij^nsa huoneesen : 

21. vaan jonka sydftn ei tolellut 
Herran sanaa, se jfitti kedolle pal- 
velijansa ja kaijansa. 

22. Niin Herra sanoi Moosekselle 
„ojenna kfitesi tai^Euisen pfiin, ettft 
rakeita sataisi koko Egyptin maan 
pfifille, ihmisten, kaijan ja kaikkien 
pfifille, mitfi Egyptin maassa kedolla 
kasvaa." 

23. Silloin Mooses ojensi sauvansa 
taivaasen pfiin, jaT Herra antoi jy- 
lista ja rakeita sataa , ja pitkfiisen 
tuli leimahteli maan pfifille; niin 
antoi Herra rakeitten tulla Egyptin 
maan yli Ps. 78:4788. 105:32 ss. Viis. 16:16. 

24. Ja rakeita satoi ja rakeitten 
kanssa lankesi tuli tuon tuostakin 
maahan, ja niin raskaasti, ettei ikfi- 
nfi senkaltaista Egyptin maassa ollut 
tapahtunut, siitfi ajasla kuin kansa 
siinfi rupesi asumaan. 

25. Ja koko Egyptin maassa lOivfit 
rakeet maahan kaikki, mitfi kedolla 
oli, sekfi ihmiset ettfi karjan; niin 
myOs 16ivfit rakeet koko maankasvun 
ja sfirkivfit puut kedolla 

26. Ainoastaan Gosenin maakun- 
nassa, jossa Israeiin lapset olivat. ei 
satanut rakeita. 

27. Silloin Ifihetti Farao ja kutsui 
Mooseksen ja Aaronin Ja sanoi heille 
„minfi olen tfillfi kertaa syntifi teh- 
nyt. Herra on vanhurskas; vaan mi- 
nfi ja minun kansani olemme juma- 
lattomat. 

28. Sentfihden rukoilkaat Herraa, 
ettfi jo kyllfi olisi, ja ettfi Jumalan 
jylinfi ja rakeet laKkaisivat; niin 
minfi pfifistfin teldfin, eikfi teidfin 
tarvitse enfifi tfifillfi viipyfl.** 

29. Niin Mooses sanoihanelle: „kuh 
Ifihden kaupungista, niin ojennan 
minfi kfiteni Herran tykO ; ja jylinfi 
on lakkaava eik& fakehita enfifi ole 
satava, ettft tietftisit maan olevan 
Herran. x 

30. Mutta minfi sen kyllft tiedftn, 
ettet sinfi ^ikfi sinun palvelijasivielfi 
nytkfifin pelkfifi Herraa Jumalata.'* 

31. Niin muodoln pellavat ja oh- 
rat maahan lyOliin; sillfi ohra 



66 



2 MOOS. 9. 10. 



oU tfihkfipaflllft ja pellava oli kul- 
kolla; 

32. multa nisu ja kaura eivSt tur- 
meltuneet, siUft ne olivat myOhSistfi 

kylvdft. 

33. Ja Mooses meni ulos kaupun- 
gista Faraon luota, ja ojensi kStensd 
Herran tykO ; ja jylinft ja rakeet lak- 
kasivat, eikfl sadetta enfifl vuoda- 
tettu maan pftftUe. 

31 Kun Farao nftki, ettfi sade, ra- 
keet ja jylinfi lakkasivat, lisfisi hSn 
yh3 pahuuttaan, ja paadutti sydfim- 
mensd, sekfi h&n ettft hl^nen palve- 
lijansa. 

35. Niin paatui Faraon sydfia, eikft 
hSn paastdnyt Israelii! lapsia, niin- 
koin Herra Mooseksen kautta oli 
saoonut. 

lo Luku.* 

HdnSsirkat Ja aynkeft pimcfys^ ^ 

Ce^jfilkeen sanol JEf erra Mooseksel« 
^ le: „mene Faraon tyk6 ; sillftminft 
paadutin hfinen ja nSnen ^alveli- 
joittensa sydSmmet, tehdAkseni nS- 
inS minun ihineeni heiddn seas- 
sansa, 

2. ja ettfl sinfi voisit ilmoittaa lap- 
sillesi ja lastesi lapsille, mitS minS 
tehnyt olen Egsrpnssd, ja mitfi ih- 
meitft minfl olen tehnyt neidSn seas- 
sansa, niin ettfi te tietflisitte, ettfi 
mina olen Herra." 

3. Sflloin menivfit Mooses ja Aaron 
raraon tyk6, ja sanoivat nSnelle : 
yO^ sanoo Herra, Hebrealaisten 
Jomala; ,kuinka kauan sinft vas- 
Instat etkfi tahdo nOyryyftfifi itseftsi 
ounnn edessfini? Pfifistl minun kan- 
sani palvelemaan minua. 

^. SiUft jos sinft et tahdo pfifistftft 
^nun kansaani , katso , niin minfl 
hoomenna tuotan heinfisii'kat kaik* 
oin sinun maasi ftftriin. 
^•. Ja ne peittdvftt maan pinnan, 
i^ettei maata nfly; ja he sydvftt 
l^teet mitfi teilleonjfifinytrakeiUa,. 
^ syfiTfit kaikki vihoittayat puutkin 
kedoUa. 

6- Ja he tfiy ttSvftt sinuii ja kaikkien 
»Dan palvelijaisi huondet, ja koko 
E^tm huoneet, niin ettft senkal- 
taufa eivfit sinun isfisi eikfi isfiisi 
jfit ole nfihneet, siitfi pfiivftstfi kuin 
hemaanpfifillfi oUeet ovfitt tfihfin 
P^iivUn asti." Ja hfin kftfinsi itsensfi 
ja men! ulos Faraon tykOfi. 
7. Niin sanoivat Faraon palvelijat 
»^Ue: ,,kuii^ kauan sallittfimfin 
Ziehen olla meille paulaksi? Pfifistfi 
■ansa palvelemaan Uerraa Jumala- 
^ansa; etk6s vieift kfisitft, ettfiEgypti 
t^hivitetyksi? 



i*« 



8. Silloin Mooses fa Aaron kfiskef- 
tiin palaamaan jfilleen Faraon ty-> 
kO, joka. sanoi heille: „menkfifit ja 
paivelkaat Herraa, teidfin Jumala- 
tanne; vaan kutka ne ovat, joka me- 
nevfil?" 

9. Mooses vastasi: „me menemme 
meidfin nuorten ja vanhain kanssa, 
poikinemme ja tyttfirinemme, 1am- 
mastemme ja kaijamme kanssa ; sil- 
Ifi meillfi on Herran juhla." 

10. Silloin hfin sanoi heille: „ol- 
koon Herra teidftn. kcoissanne niin 
totta kuin minfi pfifistfln teidfit ja 
teidfin lapsennel Katsokaat vaan, 
ettei teilla olisi jotakin pahaa sy- 
dfimmessfinne t 

11. Ei.niin; mutta menkfiflt te mie- 
het ia paivelkaat Herraa, sillfi. sitfi 
te olette pyytfineetkini" Ja he i^oi- 
vat heidftt pois~ Faraon edestfi. 

12. Niin Herra sanoi Moosekselle *, 
,,ojenna kfitesi Egyptin maan ylitse, 
niin ettft heinftsirkat tulisivat Egyp- 
tin maahan, ja sdisivfit kaiken maan 
vihannon, kaikki mitfl rakehilta jfii&- 
ny4 on." . Joel 1:4. 

13. Silloin Mooses Ojensi sauvansa 
Egyptin maan ylitse, ja Herra antoi 
itatuulen puhaltaa yli maan koko 
sen pAivfin ja koko yOn; ja aamulla 
nosti itfituuu heinftsirkat. ' Ps. 78:45. 

106:8488. Yiis. 16:9. 

14. Ja heinftsirkat tulivat kokd Egyp- 
tin maan pfiftlle ja laskeutuivat Joka 

I laikkaan Egyptin maahan niin epfl- 
ukuisesti, ettei semmbista heinft- 
sirkkain paljoutta,ollut_ennen oUut, 
eikft tftstedes tule. • _ 

15. Ne peittivflt koko maan, ia maa 
tuli mustaksi. Ja ne sOivfit kaiken 
maan vihannon, ja kaikki puiden 
hedelmftt, jotka rakehilta jftftneet 
olivat, eikft jftftnyt mitftftn vihe- 
rifiistft puihin ja kedon ruohoihin 
koko Egyptin maassa. 

16. Silloin kutsui Farao kiiruusti 
Mooseksen jaAaroninJa sanoi: „mi- 
nft olen pahaa tehnyt Herraa, teidftn 
Jumalatanne, ja teitft vastaah. 

17. Niin anna nytminull&anteeksi 
minun rikokseni vieift -tflllft kertaa, 
ja rukoilkaat Herraa, teidftn Jumala- 
tanne, ettft hftn ottaisi minulta pois 
vieift tftmftn kuolemaiji." 

18. Ja hftn meni pois Faraon tykOft 
IA rukoili Herraa. 

19. Niin Herra kfifinsi tuulen alvan 
tuimaksi Iftnsituiileksi, ja se nosti 
heinftsirkat ja heitti heidftt Punai- 
seen mereeh, niin ettei yhtfikftftn 
heinftsirkkaa jftftnyt koko Egyptin 
maan ftftriin. 

20. Mutta Herra paadutti Faraon 



67 



2 MOOS. 10. 11. 12. 



syddmmen , eikft hftn pfifistfinyt Is- 
raelin lapsia. 

21. SenjSIkeen Herra sanoi Moosek- 
selle: ,,ojenna kdtesi taivaasen pftin, 
niin on Egyptin maahan tuleva sel- 
lainen pimeys, ettfi siihenkfislnvoisi 
ruvetd.^* 

22. Silloin Mooses ojensi kStensfi 
taivaasen pfiin, ja tuUsynkifi pimeys 
koko Egyptin maahan kolmeksi pdi- 
vSksi. Ps. 105:28. Vii8.17:2. 

23. Ihmiset eivfit toinen toistansa 
nShneet/eika kukaan liikkunut pai- 
Icaltansa. kolmena pfiiv&nA. Mutta 
kaikillalsraelin lapsllla olivalo siel- 
Id, jossa he asuivat. 

24. :SilIoin kutsui Farao Mooseksen, 
ja sanoi: „menkfifit ja palvelkaat 
Herraa; ainoastansateidSnlampaan- 
ne ja kaijanne jSdkOOt t&nne. Tei- 
dfin lapsenne menkddt myOs teidfln 
kanssanne.** , 

25. Mutta Mooses sanoi: ,,salli mei- 
dfin saada myOskin uhrit ja polt- 
touhrit, joita meiddn tulee uhrata 
Herralle, meiddn Jumalallemme. 

26. Meidftn karjamme on myOs me- 
nevft meid&n kanssamme, eika yh- 
t&kdfin sorkkaa saa jdftdfi ; sillfl siitd 
meidfin pitfiA ottaa ja tendft palve- 
lusta Herralle, meidan Jumalallem- 
me. Ja ennenkuin sinne tulemme, 
emme itse tiedS, mit& meidSln tulee 
uhrata Herralle^** 

27. Mutta Herra paadutti Faraon 
sydfimmen, eikft hdn tahtonut pft&s- 
tSfi heitfi. 

28. Ja Farao sanoi hftnelle: „mene 
pois minun tykOftni, ja varo, ettet 
enfifttuleminunkasvojenieteen,silIS 
jona pfiivfina sinS tulet minun etee- 
ni, pitdft sinun kuoleman.** 

29. Mooses vastasi: ,,niinkuin sinfi 
sanonut olet, en tule mind en&ft si- 
nun kasvojesi eteen.^* 

11 Luku. 
Viimeinen maanvaiva ilmoitetaan. 

CenjSIkeen sanoi Herra Mooseksel- 
^ le: „vieldmin9annan tullayhden 
maanvaivan Faraon ja Egyptin yli ; 
sitte hftn pftftstftft teidftt tftftltft, la 
kun hftn teidftt sitten pftftstftft, niin 
hftn ajamalla teidftt ajaa tftftltft ulos. 

2 Moos. 6:1. 

2. Niin sano siis nyt kansalle, ettft 
jokainen, oli se mies tahi nainen, 
anoisi IfthimmftiseltSnsft hopiaisia ja 
kultaisia kalleuksia.** 2 Moos. 3:21 ss. 

12:35 68. 

3. Sillft Herra oli antanut kansan 
saada suosiota Egyptilftisten edes- 

'sft. Ja Mooseskin piaettiin suuressa 



kunniassa Egyptin maassa sekft Fa- 
raon palvelijoitten ettft kansan kes- 
ken. Syr. 45:1 ss. 

4. Ja Mooses sanoi: „nfiin sanoo 
Herra : ,puoliy0n aikana minft vael- 
lan Egyptin maan Iftpitse. 

5. Ja silloin kaikkiesfkoiset Egyptin 
maassa kuolevat, Faraon esikoisesta, 
hftnen, joka hallitus-istuimellansa 
istuu, aina palkkapiian esikoiseen 
asti, joka myllyssft on, niin myOs 
kaiken karjan esikoiset. 2 Moos. 12:29. 

6. Ja suuri parku on kuuluva koko 
Egyptin maassa, jonka kaltaista ei 
ole ollut, eikft tule. 

7. Mutta Israelin lasten kesken ei 
koirakaanhaukahda ketftfinvastaan, 
ei ihmi^ift eikft elftimiftvastaan. Niin 
tulette tietftmftftn, ettft Herra tekee 
eroituksen Egyptin ja Israelin vfilillfi. 

8. Sjlloin kaikki nftmft sinun palve- 
lijasi tulevat minun tykOni, fa ku- 
martavat minua, sanoen : ,lfthde ulos, 
sinft ja kaikki kansa, joka sinua seu- 
raa.' Ja sitten minft Ifthden.'* Ja hftn 
Iftksi pois Faraon tykOft viholssansa. 

9. Mutta Herra oli sanonut Moosek- 
selle: „ei Farao kuule teitft, ettft pal- 
jon ihmeitftni tapahtuisi Egyptin 
maalla.** 

10. Ja Mooses ja Aaron tekivftt kaik- 
ki nftmft ihmeet FUraon edessft ; vaan 
Herra paadutti hftnen sydftmmensft, 
eikft han pftftstftnyt Israelin lapsia 
pois maastansa. 

12 Luku; 

Pft&siftis-juhla sftftdet&ttn. Esikoiset Egyp. 
tissft surmataan. Israelilaisten Ifthttt Bgyp- 

tist&. 

Herra puhui Moosekselle ja Aaro- 
nille Egyptin maalla, sanoen: 

2. „Tftmft kuukausi oikoon teillc 
tftrkein kuukausi; se oikoon ensim- 
mftinenkaikistavuodenkuukausista. 

3. Puhukaat koko Israelin seura- 
kunnalle, sanoen: ,tftmftn kuukau- 
den kymmenentenft pftivftnft otta- 
koon kukin perheenisftntft itsellensft 
karitsan, niin ettft jokainen huone- 
kunta saa yhden karitsan. 

4. Mutta ios huonekunta on liian 
vfthftinen Karitsata syOmftftn, niin 
ottakoon perheenisft likimmftn naa- 

Jurinsa kanssa yhdessft karitsan. 
okaista karitsaa varten tulee liittyft 
yhteen niin monta henkilOft ettft ka- 
ritsa juuri riittftft heille ruuaksi. 

5. Ja tftmft karitsa on oleva vir- 
heetOn ajastaikainen oinas. Lam- 
paista tahi vuohista tulee teidfin se 
ottaa. 

6. Ja teidftn tulee se tallella pitftft 



68 



a 



2 MOOS. 12. 



neyftnleentoisUl p&ivftan asU t&tft 
kuuta; Ja kaikkien Israelilaisten, 
koko Israelin seurakunnan, tulee se 
teurastaa iltahftrnftrissft. 

7. Ja heiddn tulee ottaa verta ja 
pyyhkfiista sillft molemmat pihtipie- 
let ja huonetten ovenpdftUinen siinfl 
huoneessa, jossa he sitft syOvSt. 

8. Ja heidfln tulee ^infi yOnfi syOdft 
tulella paistettua lihaa ja happama- 
toDta leipftft katkerain ruohojen 
kanssa. 

9. Alkfifi siitfimitd&n sy^kOraakana 
lahi vedessfi keitettynfl, mutta se on 
paistettava tulella pftftn, jalkain ja 
sisftllysten kanssa. 

10. Ja aikaa siua jattako mitfifin 

huomeneksi. Jos jotakln siitd jfiisi 
hoomeneksi, se tulella poltettakoon. 

11. Mutta n&in pitfiA teid&n syOmfin 
sitft: teidftn tulee olla vyOtetyt ku- 

Seista, ken^St jalassanne, sauva k3- 
essftnne; ia teiddn tulee syOdfl se 
niinkuin olisitte matkalle kiiruhta- 
vaiset. TftmS on Herran pSasidinen. 

12. SiUa sind yOnft mina kdyn Egyp- 
tin maan 1dpi tse, ja lyOn kaikkl esi- 
koisetEgyptin maassa, ihmisist&niin 
kaijaan asti; ja mind annan tuo- 
mioni kfiydfl kaikkien Egyptililisten 
epi^amalltten ylitse; mina olen Her- 
ra. 4MooB.83:4. Ps. 136:10. Hebr. 11:28. 
'IS. Ja veren pitSft oleman teille 
pelastuksen inerkiksi huoneissanne, 
kussa te olette, sillft kun minfi veren 
Bfleo, niin minft menen teidiln ohlt- 
senne; elkft rangaistustuomio ole 
Idtftkohtaava, kun min& lydnEgyp- 
tin maata. 

14. Ja* t&mft pfiivft olkoon teille 
muistoksi, ja teidSn tulee se pyhlt- 
Iftftjuhlaksi Herralle. Ijankaikkisena 
sftftntOnft tulee teidfin viettaa sitfl 
jiuvtista sukuun. 

15. Seilsemfin paivfift tulee teiddn 
sjMfi happamatonta leipSft, ja jo 
ciisinunfiisena p&ivfinft tulee teiddn 

Mblaa kaikkl napantaikina teidSn 
luoDcistanne. Silld jokainen, joka 
. otakin hapanta syO tflllfi ^alla, en- 
simmSisestA pfiivSstfi seitsemdnteen 
Pftlvfiftn asti, hfinen sielunsa pit33 
hoKutettaman Israelista. 2Moo8.23:i5. 

84:18. 6Moo8.16:3,16. 

11 EnsimmSisenS pftivfinfl olkoon 
teiUft pyhft kokous; ja myds seitse- 
mftoteoa pfilvfinfi olkoon teillfl pyhft 
kokous. £i yhtfikfiftn tyfitft pidS teh- 
tftmftn niina pftivinft; mutta mitft 
luikin ruuaksi tarvitsee, se ainoas- 
iuisa valmislettakoon. 

17. Ja teidfin tulee pitfifi happamat- 
toman leivfin juhlaa; sillfi sinft pfti- 
tftDftotoominflteidfinjoukkonQeJoh*^ 



dattanut ulos Egyptin maalta; ja 
teidftn tulee ijankaikkisena sftftntOnft 
suvusta sukuun pitftft tftmftn pftivftn 
viettftmistft. 

18. Neljftntenfttoista pftivfinft ensim- 
mftisessft kuussa ehtoona tulee teidftn 
syOdft happamatonta leipftftja sitten 
alna ehtoosenastiensimmftisenftpfti- 
vftnft kolmattakymmentft sitft kuuta. 

8 Moos. 23:588. 4 Moos. 28:16 88. Jos. 5:10. 

19. Niinft seitsemftnft pftivftnft ftl- 
kOOn mitftftnjiapanta taikinaa lOy- 
tykO teidftn huoneissanne ; sillft jo- 
kainenjoka hapanta leipftft syO, hftn 
on hukutettavalsisielin joukosta, oli 
hftn muukalainen tahi omainen. 

20. Sentfthden ftlkftftt syOkO mitftftn 
hapanta ; vaan happamatonta leipftft 
syOkftftt huoneessanne, jossa asuttet* 

21. Ja Mooses kutsui luokseen kaik- 
kl Israelin vanhimmat, ja sanoiheil- 
le: ,,menkftftt ja ottakooii kukin per- 
hekunta lampaan, ja teurastakaat 
pftftsiftiseksi. 

22. Ja ottakaat side isoppia ja kas- 
takaat vereen, joka on maljassa, la 
pyyhkftlskftftt sillft ovenpftftllinen ja 
molemmat plhtipielet; ja ftlkOOnku- 
kaan teistft menkO ulos huoneensa 
ovesta huomeniseen asti. 

23. Sillft Herra^tahtoo tuUa lydmftftn 
Egyptilftisift ; ja kun hftn saa nfthdft 
veren ovenpftftllisessft ja molemmis- 
sa pihtipielissft , mcnee Herra sen 
oven ohitse, eikft salli hukuttigau 
tulla teidftn huoneisinne. 

24. Nftin tulee sinun tehdft; se on 
oleva sftftntOnft sinulle ja lapsillesi 
ijankalkkisesti. 

25. Ja kun tc tulette siihen maa- 
han, jonka Herra teille antava on, 
niinkuin hftn on sanonut, niin pitft- 
kftftt tftmft jumalanpalveluksen tapa. 

26. Ja kun lapsenne kysyvftt teiltft: 
„mikftpalvelus-tapa tftmft teillfton?'* 

27. niin tulee teidftn vastata: „tft« 
mft on pftftsiftis-uhri Herralle, joka 
meni Israelin lasten huoneitten ohlt- 
se Egyptissft, kun hftn rankaisi Egyp- 
tilftisift, ja meidftn huoneemme va- 
pahtl.** Niin kansa kunnioittaen ku- 
martui maahan. 

28. Ja Israelin lapset menivftt ja 
teklvftt niinkuin Herra Moosekselle 
ja Aaronille oli kftskenyt. 

29. Ja tapahtui puoliydn aikana, 
ettft Herra 151 kaikkl esikolset Egyp- 
tin maalla, Faraon esikoisesta, hfi- 
nen, joka hallitusistuimella istuu, 
aina vankihuoneessa olevan vangin 
esikoiseen asti ja kaikkl karjan esi- 
koiset. Ps. 78:51. 105:36.il36:10. Viis. 18:1088. 

30. Silloin nousi Farao palveliioi- 
neen yOUfi ja kaikkl Egyptilfiiset ; 



69, 



2 MOOS. 12. 13. 



)a sunri parku kuului EgyptissS, 
sillA ei ollut huonetta, jossa ei kuol- 
lutta ollut. 

31 Ja hfin kutsui Mooseksen ja Aa- 
ronin yOllA, ja sanoi: „nouskaat ja 
menkftflt pois minun kansastani, se- 
k9 te ettd Israelin lapset; ja men- 
kast matkaanne ja palvelkaat Her- 
raa niinkuin olette pyytSneet. 

32. Ottakaat myOs myOtftnDe lam- 
paanne ja karjanne, niinkuiQ te ano- 
iieet olette, ja menkSfit matkaanne ; 
ja slunatkaat vay6s minua/* 

33 Ja Egyptiialset ahdistivat kan- 
5aa, ja vaativat heitS kiireesti me- 
nemSdn pois maasta, sillfl he ajat- 
telivat. „rouutoin me kuolemme 
jokainen.** 

34. Ja kansa kantoi taikinansa, en- 
nenkuJn se oil hapannut; ja he kfiS- 
ri vat taikina-astiat vaippaansa jakan- 
toivat ne olallansa. 

35. Ja Israelin lapset olivat tehneet 
Mooseksen sanan mukaan.ja olivat 
andneeJ^ EgyptiI9isiItS hopeaisia ja 
kultaisia kalieuksia sekd vaatteita. 

2Moo8.3:22. 11:2. P8.10&:37 

36. Ja Herra oli antanut kansan 
saada suosiota EgyptilSisten edessS, 
niin ettfl he antoivat heille mitd he 
anofvat. Niin heveivSt saaliinEgyp- 
tildisilta. 

37. Ja Israelin lapset laksivfit mat- 
kaan Rameseksesta ja tulivat Suko- 
tiin, Idhes kuusisataa tuhatta jalka- 
miestS, pailsi lapsia. iMoos. 47:11. 

4 Moos. 1:46. 2:32. 83:5. 

38. Ja koko Joukko muutakin vfi- 
ke3 men! helddn kanssansa, ja san- 
gen paljo eldimilt, sekSi lampaita 
ett2& muuta karjaa. 

39. Ja he leipoivat siitS uudesta 
taikinasta, jonka he olivat tuoneet 
Egyptistd, happamattomia leipiS; 
siUd ei se ollut vielS hapannut, kun 
he niin kiireelld ajettiin Egyptistd 
pois, eikS saaneet viipyft ; eivfit my63- 
kd9n olleet volneet itsellensa ev^tft 
valmistaa. 

40. Mutta Israelin lapset olivat asu- 
neet Egyptissd neljSsataa ja kolme- 
kymmentfl ajastaikaa. l Moos. 15:13. 

/tp.t7:6. Gal. 3:17. 

41. Ja juuri sinS pfiivftna, jolloin 
ne neljSsataa kolmekymmentft vuot- 
ta olivat kuluneet, 19ksi koko Her- 
ran joukko i:>ois Egyptin maasta. 

42. Sentfihden tfima yO on Herran 
juhlayO, kun hSn vei heidfit ulos 
Egyptin maasta : tdm9 on se yd, jo- 
ta kaikkien Israelin lasten tuiee py- 
hitt&S Herralle suvusta sukuun. 

4S, Ja Herra sanoi Moosekselle ja 
Aaronllle: ntfima on pfiftsiSisen viet- 



tfimisen sfifintO: yksikftfin muuka- 
lainen AlkOOn siita syOkO, 

44. mutta ostettu oija ymp&rilei- 
kattakoon, ja sitten syOkOOn siitS. 

45. Muukalainen ja pflivfimies fil- 
k06n siitfi syOkO. 

46. Samassa huoneessa on se syO- 
t3va. Alkd&t huoneesta viekO ulos 
sita lihaa, filkfi&tkd luuta rikkoko 
si i tfi. 4 Moos. 9:12. Job. 19:36. 

47. Koko Israelin seurakunnan pitfift 
ndin tekemfin. 

48. Jos joku muukalainen asuu si- 
nun keskeliasi, ja tahtoo pitfiH Her- 
ralle p99siaistfi, niin ympSrileikat- 
takoon hSnen perheensfi kaikki mies- 
puoletjasittenkaykoatsit&tekemaan 
ja oikoot niinkuin maan omaiseL 
Mutta aikCdn yksikSfin ympfirileiko 
kaamaton siitfi syOkO. 

49. Yksi ja sama laki olkoon omai- 
sella ja muukalaisella, joka asuu 
teidfin seassanne.** 

50. Ja kaikki Israelin lapset tekivfit 
niinkuin Herra oli Moosekselle ja 
Aaronille kfiskenyt. 

51. Niin Herra juuri sinS pfiivftnfi 
johdatti Israelin lapset joukkoinensa 
ulos Egyptin maasta. 

iS'Luku. 

Esikoiset pyhitetftftn Herralle. VaeUoB Pa- 
naista merta kohti. 

J a Herra puhui Moosekselle^ ja sa- 
noi: 

2. „PyhitS minuUe jokainen esi- 
koinen Israelin lasten seassa, kuka 
ikfinfinsfi fiitinsfi kohdun avaa, sekil 
ihmislstfi ettfi karjasia ; ne ovat mi- 
nun.** 2Moos.22:9. 34:19. 4 Moos. 8:13. 8:17. 

Luulc. 2:28. 

3. JaMooses sanoi kansalle: „muis- 
takaat tfitfi pfiivfifi, jona'te olette Ifth^ 
teneet Egyptistfi, orjuuden huonees- 
ta, kuinka Herra on teidSt tfiftltft 
johdattanut vfikevfillfi kfidellfi. Sen- 
tfihden filkOdn syOtfikO mitfifin ha- 
panta. 

4. Tfinfipfinfi Abib - kuukaudessa 
Qlette te Ifihteneet. 

5. Ja kun Herra antaa sinun tulla 
Kananealaisten, Hetilfiisten, Amori^ 
laisten, Hevilfiisten ja Jebusilaisten 
maahan, jonka hfin sinun isillesi on 
vannOnut antaaksensa sinulle sen, 
jossa rieskaa ja hunajata vuotaa, 
niin tulee sinun nfiin palvella Ju- 
malaa tfissfi kuussa: 

6. Seitsemfin pfiivfifi pitfifi sinun 
syOmfin happamatonta leipfifi, ja 
seitsemfinlena pfiivfinS -on Herran 
juhla. 1 Moos. 84:18. 

7. Sentfihden on syOIAvA happama* 



70 



2 MOOS. 13. 14. 



tonta leipftA seitsemftn pfiivfiS, Ja fil- 
kMnsinun tykOnftsiyhififinhapaDta 
taikinata nfintfikO, eikft hapanla lei- 
pftfi koko siniin maasi fidrissfi. 

8. Ja sinun pitda ilmoittaman po- 
jallesi sinfi pdivftnS, sanoen : „tSmfin 
minfi pid&n kiitoilisuudesta siitfi, 
mitft Herra teki minun kanssani, 
kun minfi Iflksin Egyptistfl. 

9. Sentfihden oikoon tfimS sinulle 
merkiksi kfidessfisi, Ja muistoksi sil- 
miesi vfilissfi.ettfi Herran kfisky ollsi 
sinun suussasi, sillfi Herra on vfike- 
vftliakfidellft sinun johdattanutEgyp- 

10. Sentfihden oikoon tfimfi sfifin- 
lAnfi sinulle mftftrfi-ajoin vuosi vuo- 
delta. 

11. Ja kun Herra on sinun vienyt 
iUnanealaisten maahan, niinkuin 
hfin sinulle ja sinun isillesi vanno- 
nut on, ja antanut sen sinulle, 

12. niinpitfifi sinun eroittaman Her- 
raUe jokalnen, joka avaa fiitinsA koh- 
dun; ja jokainen esikoinen sinun 
kaijassasi, jos se on urospuolta, on 
Herran oma. 2 Moos. 84:19 ss. 

4 Moos. 18:1588. 

13. Mutta kaikki aasin esikoiset 
tuleesinun liinastaakaritsalla; jollet 
sinfi lunasta sitfi, niin vfifinnfi siltfi 
niskat poikki. Ja kaikki ihmisten 
esikoiset sinun lastesi seassa pitfifi 
sinun lunastaman. 

14. Ja kun sinun poikasi kysyy si- 
nulta tfistedes: „mitfi tfimfi merkit- 
see?** tulee sinun sanoa hSnelle: 
„HeiTa on johdattanut meltfi vfike- 
vfiUfi kfidellfi Egyptistfi, oijuuden 
huoneesta: 

15. sillfi Run Farao kovuudessaan 
ei tahtonut meitfi pfifistQfi, nfin lOi 
Herra kuoliaaksi jokaisen esikoisen 
Egyptin maassa, inmisen esikoisesta 
aiiui kaijan esikoiseen asti. Sentfih- 
den uhraan minfi Herralle jokaisen 
miehenpuolen, joka fiitinsfi kohdun 
avaa, ja iokaisen «sikoiseh minun 
lapsistanf lunastan minfi. 

Id. Ja tfimfin pitfifi oleman sinulle 
niinkuin merkki kfidessfisi Ja muis- 
tokiijoitus otsassasi; sillfi Herra on 
johdattanut meldfit vfikevfiUfi kfidel- 



tt Eflvptistfi/* 
17. Kun 



iVin nyt Farao oli pfifistfinyt 
kansan, niin ei Jumala johdattanut 
heilfi sitfl tietft Filistealaisten maan 
Upitse, vaikka se oli suorin; sillfi 
Jumala aiatteli, ettS kansa, nfihdes* 
tittsft sodan syltyvfin, ehkfi katuisi 
Ja palajaisi Egyptiin. 
18. Sentfihden hfin johdattl kansan 
ki^rtotielfl korven Ifipi Punaisla 
nerta kohden. Ja Israelin lapset 



Ifiksivftt viisin joukoln Egyptin 
maasta. 

19. Ja Mooseft otti myOtftnsfi Josefln 
luut; sillfi Josef oil vannottanut Is- 
raelin lapsia sanoen : „Kun Jumala 
katsoo tefdfin puoleenne, niin viekfifit 
minun luunl tfifiltfi myOtfinne.** 

1 Mooe. 60:26. Jos. 24:32. Hebr. 11:22. 

20. Niin he Ifiksivfit Sukkotista , Ja 
sijoittivat itsensfi Etamiin, joka on 
korven fifiressfi. 4 Moos. 33:6. 

21. Ja Herra kfivi heidfin edellfinsfi 
pfiivfiUfi pilven patsaas!Mi,johdattaak- 
sensa heitfi tiellfi, ja yOllfi tulen 
patsaassa, valaistaksensa heidfin tie- 
tfinsfi ; ja niin voivat he vaeltaa sekfl 
ydllfi ettfi pfiivfillfi.4 Moos. 14:14. Neti.9:12. 

P8. 78:14. 105-.d9. yU8.18:3. IKor.lO:!. 

22. Pilven patsas ei hSvinnyt pfii- 
vfiUfi kansan edeltfi, eikfi 4ulen pat- 
sas yOUfi. . 

14 Luktt. 

YaeUusPunaisenmerenUlpi. EgyptilUsten 

hftYlO. . 

JaHerra puhulMoosekselle, sanoen : 
2. „Puhu Israelin lapsille, ettfi he 
Pali^aisivat Ja sijoittaisivat itsensfi 
i-Hahirotin kohdalle, Misdolin ja 
meren vfilille: Baal-Sefonin eteen 
tulee teidfin sijoittaa itseniie meren 

tykO. 4M008.83:7. 

3. Mutta Farao i^attelee Israelin lap- 
sista, ettfi he kfiyv^teksyksissfi maas- 
sa Ja ettfi korpi on heidfit sulkenut. 

4. Ja minfi paadutan Faraon sydfim- 
men, niin ettfi hfin ajaa heitfi takaa; 
la minfi voitan kunnian Faraosta ja 
koko hSnen sotavfiestfinsfi. Ja Egyp- 
tilfiisten pitfifi tietfimfin, ettfi minfi 
olen Herra.** Ja he tekivfit niin. 

5. Kun sitten kerrottiin Egyptin ku- 
ninkaalle, ettfi kansa oli paennut, 
kfifintyi hfinen ja hfinen palvelijain- 
sa sydfin kansaa vastaan, ja he sa- 
noivat: „miksiolemme niintehneet, 
ettfi me pfifistimme Israelin palve- 
lemasta meitfi?** 

6. Ja hfin valmisti vaununsa, ja otti 
sotavfikensfi myOtfinsfi; 

7. hfin otti kuusisataa parasta vau- 
nua, niin myOs kaikki muut Egyp- 
tin vaunut, ja taistelijat niihin kaik- 
kiin. 

8. Ja Herra paadutti Faraon, Egyp- 
tin kuninkaan , sydftmmen , ja hfin 
ajoi takaa Israelin lapsia, jotka kui- 
tenkin olivat korkean kfiden kautta 
Ifihteneet. 4 Mobs. 83:3. 

9. Ja Egyptilfiiset Ja Faraon vaunu- 
hevoset, hfinen rallsasmlehensfi, Ja 
hfinen soti^oukkonsn ajoivat heitfi 
takaa, ja saavuttivat heidfit meren 

I tykdnfi, johQn olivat pysfihtyneef 



7j| 



2 MOOS. 14. 15. 



Pihahirotln kohdalla Baalsefonin 
cdcssfi 

10. JakunFaraol&hestyiheitfi,nos- 
tivat Israelii! lapset silmansfi, ja kat- 
so. Egyptilfiiset tulivat heiddo pe- 
rfissdnsfi. Silloin Israelin lapsetjpel- 
jfistyivfit suuresti, ja huusivat Her- 
ran puoleen. 

11. Ja he sanoivatMoosekselle: ,,ei- 
kO hautoja ollut Egyptissd, koska 
rupesit ^eitft iohdattamaan korpeen 
kuolemaan? Miksi meille niin olet 
tehhyt,ettftineitajohdatitEgyptism? 

P8. 106:7. 

12. EmmekO me tfitfi sinuUe sano- 
neet EgyptissS? Mehfln sanoimme* 
,anna meiddn t>na, ettfi me palveli- 
simme Egyptilfiisift.' Sillfi meidftn 
olisi ollut parempi palvella Egypt!- 
laisia, kuin kuolla korvessa.** 

13. NiinMoosessanoikansalle ,,8I- 
kdfit pelj&tkd, olkaat vahvat, niin 
saatte nfihdfi, minkfi autuuden Her- 
ra tfinSpfinfi tekee teille ; sillfi nfiitfi 
Egyptildisift, Jotka te tfindpSnfi nS- 
ette, ette koskaan enfift nSe ijankaik- 
kisesti. 

14. Herra sotii teidfin puolestanne, 
olkaat te alallanne.*' 

15. Ja Herra sanoi Moosekselle: ^mi- 
tft huudat minun tykdni? Sano Is- 
raelin lapsille, etta he lahtevflt mat- 
kaan 

16. Mutta nosta sind sauvasi jaojen- 
na katesi meren ylitse, ja lyO se 
kahtia, niin etta Israelin lapset kS- 
visivatkeskeliamertakuivaamyOten. 

17. Ja katso« mina paadutan Egyp- 
tiiaisten sydammet, niin etta he seu- 
raavat teidan jaiissanne; ia mina 
voitan kunnian Faraosta ja kaikesta 
hanen sotajoukostansa» hanen vau- 
nuistansa ja ratsasmiehistansd. 

18. Ja Egyptiiaislen pitaa tietaman, 
elta mina olen Herra, Run mina olen 
kunnian voittanut Faraosta Ja hanen 
vaunuistansa ja ratsasmiehfstansa.** 

19. Ja Jumalan Enkeli, joka oli Is- 
raelin joukon edelia kaynyt, nousi 
ja meni heidan taaksensa;]a pilven 

f>atsas, joka oli kdynyt heiadn edel- 
ansa, siirtyi ja seisahtui heidftn 
laa ksensa 

20. ia tuli Ecfyptiiaisten ja Israelin 
joukkojen vaiilie, ja oli pimia pilvi 
noille ja valaisiyOn naille,niin etlei- 
vat koKO yOna toineo toistansa tai- 
taneet lahestyd. 

21. Ja Mooses ojensi katensa meren 
ylitse; ja Herra antoi vetten juosta 
pois vah valla itAtuulella koko sen 
yOn ja teki meren kuiville; ja vedet 
erkanivat. Jos. 4:23. P8.66H). 77:1688. 

78:13. 106:9. Jee. 68:1288. 



22. Ja Israelin lapset kavivfit kes- 
kelta merta kuivaa myOten, ja vesi 
seisoi niinkuin muurf heidan oiki- 
alla ja vasemmalla puolellansa. 

1 Kor. 10:1. HetM*. 11:29 

23. Ja Egyptiiaisel ^oivat heita ta- 
kaa ja seurasivat keskelle merta hei- 
dan perassansa, kaikki Faraon he- 
voset, hanen vaununsa ja ratsasmie- 
hensa. 

24. Kun aamuvartio tuli, katsahti 
Herra Egyptiiaisten joukon puoleen 
tulen patsaasta ja pilvesta, hukut- 
taaksensa Egyptiiaisten joukon. 

25. Ja han antoi pyOrien irtaantua 
heidan vaunuistansa, niin etta he 
tyOiaasti paasivat eteenpain. J^iin 
sanoivat Egyptiiaiset „paetkaamme 
Israelia.silia Herra sotii heidan puo- 
leslansa Egyptiiaisia vastaan." 

26. Mutta Herra sanoi Moosekselle. 
„ojenna katesi meren ylitse, etta ve- 
det juoksisi vat Egyptiiaisten, heiddn 
vaunuinsa ja ratsasmiestensfi ylitset' 

27. Niin ojensi Mooses katensa me- 
ren ylitse, ja meri palasi aamukoi- 
tolla alallensa, ja kohtasi pakenevat 
Egyptiiaiset, ja Herra syOksi heidat 
keskelle merta. 

28. Ja vedet palasivat ja kdvivat 
vaunuin ja ratsasmiesten. ja koko 
Faraon sotajoukon ylitse, Jotka hei- 
ta olivat seuranneet niereen, niin 
ettei yksikaan heista paassyt. 

Jos. 24:7. P8. 106:11. VUs. 18:6. 

29. Mutta Israelin lapset kavivat kui- 
vaa myOten keskelta merta, ja vedet 
olivat heille niinkuin muuri heidan 
oikialla ja vasemmalla puolellansa. 

30. Niin Herra vapahti Israelin si- 
na paivana Egyptiiaisten kadesta; 
ja Israel naki Egyptiiaiset kuolleina 
meren rannalla. 

31. Kun Israel naki sen suuren voi- 
man, jonka Herra oli osoittanut E- 
gyptiiaisten suhteen, niin pelkasi 
kansa Herraa , ja he uskoivat Herran 
ja hanen palvelijansa Mooseksen. 

15 Luku. 

KansAn kiitosvlrsl. Kaplna Maran luona 
Israelilaiset filimlBsft. 

Silloin veisasivat Mooses ja Israelin 
lapse! Herralle taman virren, ja sa- 
noivat: „minfi veisaan Herralle, silia 
Hfin on sangen korkea. Hevosen ja 
miehen hfin mereen syOksi. Vii8.i0:i9 
2. Herra on minun vfikevyyteni ja 
kiitosvirteni, ja Hfin on minun pe- 
lastukseni, Hfin on minun Jumalani, 
ja minfi kunnioitan hantfi; Han on 
minun isfini Jumala, ja mina ylis- 
tfin hfinta. Ps. 118:1488. Jee. 12:2 88. 



72 



2 MOOS. 15. 16. 



3. Herra on sotamies; «,HeiTa** on 
hSnen nimensS. Hos. 12:6. 

4. Faraon vaunut ja sotavSen sydk- 
si hfin mereen. H3nen valttut p!la- 
miehensd ovat upotetut Funaiseen 
mereen. • 

5. Vedet peittivdt heidSt; he vajo- 
sivat pohjaan, niinkuin kivi. 

6. Herra, sinun oikia kdtesi osoitti 
itsensS voimalliseksi vakevyydessa ; 
Herra, sinun oikia k&tesi on lyOnyt 
vihollisen ! 

7. Ja suuressa kunniassasi olet sinft 
sinun vihollisesi kukistanut, silia 
km sina lahetit vihasi tulen, kulutti 
se heid3t niinkuin korren. 

8. Sinun vihasi puhalluksesta ko- 
koontuivat vedel ; ja virrat seisoivat 
niinlcuin roukkioissa, syvftt vedet 
hyytvivSl keskelle merta. 

9. VihoUinen sanoi : ^rninS ajan ta- 
l(aa,saavutan heiddt, ja saalista ja*an, 
ja lieihin mieleni jdahdytHn ; mina 
vedAn ulos miekkani ja kSteni on 
Mdaf hukuUava.** 

10. Silloin sinun tuulesi puhaisi, ja 
meri peiiti heidfit; he pohjaan vajo- 
sivat,niinkuin1yijyvdkevissfivesissd. 

11. Herra, kuka on sinun vertaisesi 
junialten seassa ? Kuka on sinun kal- 
taisesi, joka olet niin korkiajapyha, 
peljaliava, ylistettSva ja ihmellen 
lekija? ^ 

12. Kun oikian kStesi ojcnsit, niin 
man lieidai nieli. 

13. Miitta laupiudessasi sina olet 
johdattanut tata kansaa, jonka pe- 
laslil; sina olet vienyt heidat vake- 
vyydessasi sinun pyhaanasumiseesi. 

14. Kun kansat sen kuulevat, vapi- 
sevut he; ahdistus kasittaa Filistea- 
laiset. Jos. 2:9. 

15. Silloin hamma^tyvat Edoniin 
ruhtinaat, ja vavistus tarttuu Moabin 
»nkareihin; kaikki Kanaanmaan 
asuvaiset raukeavat. 

H). Hammastys on tuleva heidan 
p^dllensa, ja pelko sinun vakevan 
kSsivartesi kautta; he vaikeneval 
niinkuin kivi, siihen asti etta sinun 
kansjisi, Herra, perille kay, siihen 
«sli etta perille kay se kansa, jonka 
olet itsellesi oltanut. 

17. Sina johdalat heita ja istutat hei- 
dSl sinun perimisesi vuorelle, jon- 
ka sina, Herra, asumiseksesi tehnyt 
old, sinun pyhyylesi tykd, Herra, 
jonku sinun katesi vahvistaneetovat. 

P8.44:3. 78:54. 80:9. 

18. Herra hallilsee alati ja ijankaik- 
kisesti.'* Ps. 93:i. 

19. Silia Faraon hevoset menivat 
mereen, vaunuinensa ja ratsasmie- 
hinensa, ja Herra palautti meren 



vedet heidan paailensa. Mutta Isra- 
elin lapset kavivat kuivaa niydten 
keskelia merta. 

20. Ja profetissa Mirjam, Aaronin 
sisar, otti kanteleen kateensa, ja kaik- 
ki vaimot seurasivat hanta kante- 
leilla ja hypyssa. 

21., Ja Mirjam vastasi heita vuoro- 
veisussa: „veisatkaal Herralle, silla 
han on sangen korkea; hevosen ja 
miehen han mereen syCksi." 

22. Senjaikeen antoi Mooses Israelin ^ 
lasten vaeltaa Punaisen meren tykda, 
ja he menivat Surin kerpeen ; ja he 
matkustivat kolme paivaa korvessa 
eivatka Idytaneel vetta. 4 Moos. 33:8. 

23. Niin he tulivat Maraan; mutta 
he eivat saattaneet juoda vetta Ma- 
rassa, silia se olLkarvasta. Siita on 
se paikka saanut nimensa Mara. 

24. Siina napisi kansa Moosesta vas- 
laan, sanoen: „mita me juomme?" 

25. Mutta han huusi Herran puo- 
leen, ja Herra osoitti hanelle puun, 
jonka han heitti veteen, ja vedel tu- 
livat makeaksi. Siina pani Han hei- 
dan eteensa kaskyn ja oikeuden, ja 
siina koetteli Han heita. 

26. Han sanoi: „jos sina kuulel Her- 
ran, sinun Jumalasi aanen ja teet 
mika oikeus on hanen edessansA, ja 
otat hanen kaskynsa sinun korviisi 
ja pidat kaikki hanen saatynsa, 
niin en mina pane sinunpaailesiyh- 
takaan vltsausta niista, jotka mma 
Egyptilaisten paaile pannut olen; 
silia mina olen Herra, sinun paran- 
tajasi." 

27. Sitten he tulivat Elimiin; siella 
on kaksitoista lahdetta ja seitseman- 
kymmenta palmupuuta. Ja sielia he 
stjoittivat itsensa vesiiahleilten aa- 
reen. 4 Moos. 33:9. Ps.23:2. 

1 6 Luku. 

Kansan naplua. Sinin korvessa. Peltokanat 
Manna. 

Senjaikeen kokolsraelin lasten jouk- 
ko matkusti pois Elimista ja tuli 
Sinin korpeen, joka on Elimin ja 
Sinain vafilia, viidenlenatoista pai- 
vana toisella kuuUa, siita kuin he 
Egyplin maalta lahtenget olivat. 

4 Moos. 33:10 ss. 

2. Ja koko Israelin lasten joukko 
napisi Moosesta ja Aaronia vastaan 
korvessa ; 

3. Israelin lapset sanoivat heille: 
„voi, joska olisimme Egyptin maal- 
la Herran kaden kautta kuolleet, kun 
sielia istuimme lihapalain aaressa, 
ja oli leipaa yliakylia syCda. Mutla 
te olette sentahden meidat johdatta- 



(Fianisb] S* 



73 



2 MOOS. 16. 



neet tfinne korpeen kuolettaaksen- 
ne nfitjailS kaikkea tfitS joukkoa/' 
2 Moos. 14:11. 4 Moos. 11:4 88. 

4. Sillo{n sanoi Herra Moosekselle: 
„katso, mind nnnan salaa teille lei- 
pAS taivaasta. Jakansan tuIeemennS 
ulos ja koota joka pdivA niin paljon 
kuin he tnnilsevat. Niin olen minfi 
heit& koetteleva, tnhtovatko he vael- 
taa minun kAskyssSni vai ei. 

5. Ja kun he kuudentena pfiivftnfi 
ottavat talteen sen, minkfi ovat ko- 
tiin tuoneet, on se oleva kahdenker- 
taisesti sen suhteen. mi(3 he muu- 
toin Joka pflivfl kokoavat.*' • 

6. Ja Mooses la Aaron sanoivat kai- 
kille Israelin lapsille: ,,tfinfi iltana 
tulette tietfimfidn, ettfi Herra on joh- 
dattanut teidfit ulos Egyptin niaalta, 

7. ja huomenna saatte nfthdfi Her- 
ran kunnian; sillft Herra on kuullut 
teidAn napinanne hSntd vastaan. Sil- 
Ifi mitfi me olemme, ettfi te napisette 
meitS vastaan?'' 

8. Ja Mooses sanoi vielfi: „Herra 
antaa teille tSnfi iltana lihaasyOdSk- 
senne, ja huomenna leipfid ravin- 
noksenne.sillS Herra on kuullut tei- 
dAii napinanne, kuinka olette na- 
pisseet hSntS vastaan. Sillfi mitkd me 
olemme? Teidan napinanne ei ole 
meltd, vaan Herraa vastaan/* 

9. Ja Mooses sanoi Aaronille: ,,sa* 
no koko Israelin lastenjoukolle : ,tul- 
kaat Herran eteen,sil]ft hftn on kuul- 
lut tekh*\n napinanne.*^ 

10. Kun Aaron sitten puhui nfimfl 
sanat koko Israelin lasten jouko}le, 
kfiAntyivat he korpeen pftin. ja kat- 
so, Herran kunnia nSkyi pilvessfi. 

2 Moos. 18:21. 

11. Ja Herra puhui Moosekselle, sa* 
noen: 

12. „Min9 olen kuullut Israelin las- 
ten naplnan, puhu heille, sanoen: 
Jllan suussa on teillS oleva llhaa 
sy5dnksenne, ja aamulla saatte lei- 
p39 ruvitaksenne itsenne; niin pitdfi 
teidAn tietAmfin, ettfi minfi olen Her- 
ra, teidfin Jumalanne.*'* 

13. Ja tapahtui illalla, ettfi peltoka- 
nat tulivat ja peittivfit leirin, ia seu- 
raavnna aamuna oli kaste leinn.ym- 
pfirillfi. 4 Moos. 11:31. Pa. 78:24 88. 105:40. 

Viis. 10:20. Joh. 6:31. 1 Kor. 10:3. 

14. Ja kun kaste nousi, katso, niin 
oli korvessa jotakin ympyrifiistfi ja 
hienoa, niinkuin Hfirmfifi maan 
pfifillfi. 

15. Kun Israelin lapset sen nfikivftt. 
sanoivat he toinentoisellensa: „man*' 
(niikfi) „tnmfion?** sillfi eivfit he tien- 
nect, niikfi se oli. Mutta Mooses sa- 
noi heille* ,,tftmfi on se leipfl, jon- 



ka Herra teille on antanut sylMUlk- 
senne. 

16. Tfimfi on se, josta' Herra on kfis- 
kenyt : ,kootkaan jokainen siitfi niin 
paljon kuin hfin itse syO; ia ottakaat 
vksi gomer jokaista kohtl sen hen- 
kiluvun mukaan, mikfi on hfinen 
majassansa.'' 

17. Ja Israelin lapset tekivfit niin, 
ja kokosivat, toiset enemmfin ja toi- 
set vfihemmfin. 

18. Ja kun he mittasivat sen gomer- 
mitalla, niin ei sillfi mitfifin liiaksi 
ollut, joka paljon oli koonnut, eikfi 
siitfi mitfifin puuttunut, joka vfihem- 
mfin kokosi; jokainen oli koonnut 
niin paljdn kuin hfin sy6dfiksensli 
tarvitsi. 2 Kor. 8:15. 

19. Ja Mooses sanoi heille: .,ei ke- 
nenkfifin pidfi siitfi huomeneksi mi- 
tfifin ifittfimfin.** 

20. Mutta he eivfit totelleet Mooses la, 
vaan iotkut jfittivfit siitfi jotakin huo- 
meneksi. Niin ilmestyi matoja sii* 
hen, ja se rupesi haisemaan. Niin 
Mooses vihastui heihin. 

21. Nfiin he kokosivat siitfi joka aa- 
mu, niin paljon kuin jokainen sy6* 
dfiksensfi tarvitsi. Mutta kun pfiivfi 
tuli palavaksi, niin se suli. 

22. Mutta kuudentena pfiivfinfi he 
kokosivat kaksinkertaisesll siitfi lei- 
vfistfi, kaksi gomeria kuDenkin. Ja 
kaikki kansan pfifimlehet tulivat ja 
ilmoittivat sen Moosekselle. 

23. Niin hfin sanoi heille: „tfimfi 
on Herran sanan mukaan ; huomen- 
na on sabbatti, Herran pyhfi lepo. 
Mitfi tahdotte leipoa, se leipokaat 
nyt,« ja mitfi tahdotte keittfifi, se nyt 
keittfikfiflt; mutta mitfi liiaksi on, se 
jfittfikfifit tallelle huomeneksi.'' 

24. Ja he ifittivfit siitfi huomeneksi, 
niinkuin ^fooses kfiskenyt oli; Ja se 
ei ruvennut ^aisemaan, eikfi mato- 
ja tullut siihen. 

25. Niin Mooses sanoi: „syOkfi8t se 
tfinfipfinfi, sillfi tfinfifin on Herran 
sabbatti: tfinfipfinfi ette mitfifin lOy- 
dfi kedolta. 

26. Kuusi pfiivfifi pitfifi teidfin ko- 
kooman, mutta seitsemfintenfi pfii- 
vfinfi on sabbatti , silloin ei lOyaclil 
mitfifin.*' 

27. Ja tapahtui, ettfi seitsemfintenfi 
pfiivfinfi Ifiksivfit muutamat kansan 
scasta kokoomaan, vaan eivfit lOytfi* 
neet mitfifin. 

28. Niin Herra sanoi Moosekselle: 
., kuinka kauan tahdotte vastaha* 
Koisia olla, ettekfi tot tele minun kfis- 
kyjfini Ja lakiani? 

29. Katsokaat, Herra on teille anta- 
nut sabbatin ; Ja sentfihden on hfin 



74 



2 MOOS. 16. 17. 18. 



antanat leille kuudentena pfiiv^nS 
kahdeii pfiivSn leiv3n. Niin pysy- 
k05n siis kukin kotonansa, ja SlK50n 
yksikSiln IfihtekO kotoansa seitse- 
mdntenS pHivAnS.** 

30. Niin lepfisi kansa seitsemSntenA 
pSivSnd. 

31. Ja Israelin lapset antoivat sille 
nimen: „inanna**;ja se oli valkiata, 
niinkuin korianderin siemeni5, ja 
maistui niinkuin hiinajalcipd. 

32. Ja Mooses sanoi : ,,n3in on Her-, 
ra kSskenyt: tdytil gomer siitH, knt- 
kettavSksi teid5n jalkeentulevaisil- 
fenne, ett9 he ndkisivdt sen ]eiv5n, 
jolla min§ olen teild ruokkinut kor- 
vessa, kun minA johdatin (eitil ulos 
Egyptin maalta.*' Hebr.9:4. 

S. Ja Mooses sanoi Aaronilie: ,,o1a 
astiaja pane siihen yksi gomcr-mit- 
ta mannaa; ja pane se Herran eteen 
tallella pidettSvaksi teidSn jaikeen- 
lulevaisillenne." 

34. Niin Aaron pani sen (odistus- 
arkin eteen tallella pidett5vSksi,niin- 
kuin Herra oli kAskenytMoosekselle, 

35. ja Israelin lapset s^^ivHt man- 
naa neljSkymmentd ajaslaikaa, sii- 
henasli kuin he tulivat sille maal- 
le, jossa heidUn pili asuman, sii- 
hen asti kuin he tulivat Kanaanmaan 
rajoille, sCivSt he mannaa. 

Jos. 5:12. Neh.;9:15. 

36. Malta yksi gomer onkymmcnes 
osa efaa. 

\^ Luku. 

Kansas napina veden t&hden. Sota Ama* 
lekilaisten kanssa. 

Cen j51keen koko Israelin lasten 
^joukko malkusti Sinin korvesia, 
\'aeltaen paikasta toiseen Herran kHs- 
kyn mukaan, ja sijoittivat itsensA 
Uafidimiin; mutta sielI5 ei ollut vet- 
ta kansalle juoda! 4 Moos. 33:12 ss. 

2. Ja kansa riiteli Mooseksen kans- 
^. ja sanoi: „antakaat meille vettH 
juodaksemmer* Mooses sanoi heille: 
..mitil te riilelette minua vastaan? 
Miksi te kiusaatte Herraa?'* 

4 Moos. 20:3 ss. 

3. Mutta kun kansa tielllt janosivet- 
tS, niin he napisivat Moosesta vas- 
taan, ja sanoivat : ,,mitil varten olet 
sin3 meidat johdattanut Egyptista 
I3nne kuolettaaksesi meita, meidiln 
lapsiamme ja nieidSn karjaamme 
janolla?" 

i Niin Moo'ses huusi Herran puo- 
leen, sanoen: „mitll minS teen tSlIe 
kansalle? Ei puutu paljon, etteivSt 
kivita minua/' 

5. Herra sanoi Moosekselle: „mene 
kansan edeliaja ota kaassasimuu- 



tamia Israelin vanhimmista ; ja ota 
sinun sauvasi, jolla siml 16it virtnn, 
kdteesi ja mene. 2 Moos. 7:20. I4:i6,2i 

6. Katso, minft seison siclhl sinun 
edessSsi Horehin kalliolla; ja sinun 
pitaa lyOmfin kalliota, ja siita pitAil 
veden juokseman, niin ettd kansa 
saa juoda.'* Ja Mooses teki niin Is- 
raelin vanhimpienedessS. 4Moos.20:li. 
Ps. 7815SS. 105:41. Jcs. 48:21. I Kor. 10:4 

7 Ja hAn antoi paikalle nimen Mas- 
sa ja Meriba, Israelin lasten riidan 
tahden, ja sentAhden, ettd he kiusa- 
sivat Herraa, sanoen : „lieneekG Her- 
ra meidan.keskeliamme vai ei?" 

5 Moos. 6:16. Ps. 81:8. 95:8 ss. 

8. Senjaikeen tuli Amalek ja soti 
Israelia vastaan Rafidimissa. 

5 Moos. 25:17 ss. 1 Sam. 15:2. 

9. Silloin Mooses sanoi Josualle: 
„valitse meille miehia, mene ja so- 
di Amalekia vastaan! Huomcnna 
mina seison mAen kukkulalla, ja 
pidan Jumalan sauvan kadessdni." 

10. Ja Josua teki niinkuin Mooses 
sanoi hanelle, ja soti Amalekia vas- 
taan. Mutta Mooses, Aaron ja Hur 
astuivat maen kukkulalle. 

11. Ja niin kauan kuin Mooses piti 
katensa ylhaaiia, voilli Israel; mut- 
ta kun han katensd laski alas, voittl 
Amalek. 

12. Mutta kun Mooseksen kadct tu- 
livat raskaaksi, niin ottivat he kiven 
ja ascttlvat hanen allensa, ja han is- 
tui sen paaile; vaan Aaron ja Hur 
pitivat ylhaaiia hanen kasiansa kum- 
pikin puoleltansa; niin pysyivat ha- 
nen katensa ojcnnettuna auringon 
laskemaan asti. 

13. Ja Josua kukisti Amalekin ja 
hanen kansansa miekan teralia. 

1-i. .la Herra sanoi Moosekselle: „kir- 
joita tamn muistoksi kirjaan, ja muis- 
tuta Josualle; silla mina py^hin 
kokonansa pois Amalekin muislon 
taivaan alia." 

15. Ja Mooses rakensialllarin,ja an- 
toi sille nimen: „Herra minun lip- 
puni." 

16. Ja han sanoi: „koska Amalekin 
kasi on Herran istuinta vastaan, niin 
on Herra aina sotiva Amalekia vas- 
taan suvusla sukuun/* 

1 8 Luku. 

Jetro antaa Moosekselle nenvon. 

J a Jetro, pappiMidianissa, Moosek- 
sen aopi, sai kuulla kaikkl, mita. 
Jumala Moosekselle ja Israelin kan- 
salle bli lehnyl, kulnka Herra oli 
johdattanut Israelin Egyplista. 
2. Silloin Jetro, Moo$eksen appi, pt- 



75- 



2 MOOS. 18. 19. 



fi Siporan. Mooseksen vaimon, jon- 
ka hftn oli kotiinsa lahettSnyt, 

2 Moos. 2:16, 21. 4:20. 

3. ja kaksi hdnen poikaansa, joista 
yhden nimi oli Gersom, sill§ hdn 
sanoi' „mirid olen muukalainenvie- 
raalla maalla,** 2 Moos. 2:22. 

4. ja toisen nimi Eiieser, „silia," 
sanoi hSn, „minun isdni Jumala on 
oilut minun apuni ja on pelaslanut 
minut Faraon miekasta.'^ 

5. Niin Jetro, Mooseksen appi , ja 
hdnen poikansa, ja hdnen vaimonsa 
tulivat Mooseksen tykC siilien kor- 
peen, jossa hHn oli sijoitlanut itsen- 
sft Jumalan vuorella. 

6. Ja antoi sanoaMoosekselle: „mi- 
n3, sinun appesi Jetro, olen tuUut 
sinun tykOsi, vaimosi ja hSnen mo- 
lempien poiliainsa kanssa.'' 

7. Silloin meni Mooses appeansa 
vastaan, kumarlui hdnen eteensA ja 
suuta antoi hdnen. Ja kun he olivat 
ter\'ehtineet toinen toistansa, meni- 
vfit he majaan. 

8. Ja Mooses kertoi apellensa knik- 
ki, mita Herra oil tennyt Faraolle 

1*a Egyptilflisille Israelin t5hden, ja 
Laikesta siitd vaivasta, mikH heillS 
tielia oli oIlut, ja kuinka Herra oli 
nuttanut heitd. 

9. Ja Jetro riemuitsi kaikesia siitd 
hyvyydesia, minkH Herra oli tehnyl 
Israeiille,kun hcin oli pelaslanut hei- 
dai Egypliiaisten kUclesta. 

10. Ja Jetro sanoi: „kiitetty olkoon 
Herra, joka teidfll on pelaslanut E- 
gyptiiaisten ja Faraon kadestd; Her- 
ra, joka on vapahlanut kansansa 
Egyptildisten kdden alta! 

11. Nyt minS tiedHn, ettfi Herra on 
suurempi kuin kaikki jumalat; sil- 
15 hi\n teki niin, koska he ylpeilivat 
t3t5 kansaa vastaan.*' 2Moos. I:i3ss. 
5:6 SB. 14:18,27 83. 15:11. Neb. 9:10. Ps. 86:8. 

-12. Ja Jetro , Mooseksen appi , toi- 
mitti polttouhria ja muuta teurasuh- 
ria Jumalalle. Niin tuli Aaron ja 
kaikki vanhimmatlsraelistasyOmdnn 
leipda Mooseksen apen kanssa Ju- 
malan edessa. 

13. Seuraavana p9ivSn9 istui Moo- 
ses oikeutta tekemSan kansalle; ja 
kansa seisoi Mooseksen ympSrillfi 
aamusta iltaan asti. 

14. Kun Mooseksen appi nSkl kaik- 
ki, milS hdn teki kansalle, sanoi hSn: 
,.mitd kaikkia asioita sinfi toimitat- 
kaan kansalle?! Miksi sinS istut yk- 
sinSsi, kun kaikki kansa seisoo si- 
nun edessasi, aamusta iltaan asti?'' 

15 Mooses vastasi appeansa: „kan- 
sa tulee minun tykOni ja kysyy Ju- 
malalta neuvoa. 



16. Kun heillfi on jotakln aslafa, 
tulevat he minun tykdni, ja minfi 
toimitan oikeutta heiddn vfilillSnsd 
ja heiddn lAhimm5isensft vfilillS; ja 
mind ilmoitan heille silloin Juma- 
lan oikeudet ja kdskyt.** 

17. Silloin Mooseksen appi sanoi hS- 
nelle: .,sind et menettele oikealla 
tavalla. 

18. Sind perdti vasytdt sekd itsesi 
ettd tdmdn kansan smun ympdrilld- 
si: silld tdmd asia on sinulle liian 
raskas, etkd sind taida sitd yksindsi 
toimittaa. 5Moos. 1:9. 

19. Niin kuule nyt minun sanojani; 
mind neuvon sinua, ja Jumala on 
oleva sinun kanssasi. Ole sind kan- 
san puolesta Jumalan edessd, ja kan- 
na heiddn asiansa Jumalan eteen. 

20. Ja muistuta sind heille oikeudet 
ja kdskyt; ja osoita heille tie, jota 
heiddn tulee vaeltaa, ja mitd hei- 
ddn tulee tehdd. 

21.Muttavalitseitsellesi kansan seas- 
ta kelvollisia miehid, Jumalata pel- 
kddvid, luotettavia miehid, jotka ah- 
neutta vihaavat, ja aseta ne heille 
pddmiehiksi, tuhanten, sadan, vii- 
dcnkymmcnen ja kymmenen pddlle. 
4 Moos. 11:16 SB. 5 Moos 1:13. 

22. Ndmd tehkCOt oikeutta kansalle. 
Jos joku tdrked asia tulee, niin tuo- 
koot sen sinun eteesi; m'utta kaikki 
pienemmdt asiat he itse ratkalskoot. 
Niin huojennat omaa kuormaasi,kun 
he kantavat sitd sinun kanssasi. 

23. Jos sind ndin teet, ja Jumala 
sen sinulle kdskee, niin sind taidat 
voimassa pysyd; niin myOs kaikki 
tdmd kansa voi mennd kotiansa rau« 
hassa.'' 

24. Ja Mooses kuuli appensa sano* 
ja, ja teki kaikki, niinkuin hdn oU 
sanonut. 

25. Mooses valitsi kelvolliset mlehet 
koko Israelista, ja asetti heiddt kan- 
san pddmiehiksi, tuhanten, sadan, 
viidenk:j^mmenen ja kymmenen pftfl- 
miehiksi. 

26. Nditten tuli aina antaa kansalle 
oikeutta. Tdrkedt asiat tuli heiddn 
jdttdd Mooseksen pddtettdvdksi; kaik- 
ki pienet asiat he itse ratkaisivat. 

27. Senjdlkeen Mooses antoi appen- 
sa Idhted kotiansa;ja hdnmeni omalle 
maallensa. 

1 9 Luku. 

Tnlo Sinain vuoren luo. Henra JuUstaa 
liittonsa. 

Sind pdivdnd, kun kolmas kuu- 
kausi Israelin lasten IdhtemisestS 
Egyptin maalta alkoi, tulivat he Si- 
nai n korpeen. 



76 



2 MOOS. 19. 20. 



2. Sfim he olivat Ifthteneet Rafidi- 
mista, ja tulivat sitten Sinain kor- 
peen, ja sijoitfivat itsensS korpeen; 
ja Israel sijoitti itsensS siihen vuo- 
ren kohdalle. 4 Moos. 33:15. 

3. Ja Mooses astui yI6s Jumalan (y- 
kd. Ja Herra huusi hdnelle vuorelta 
ja sanoi : „n9in sinun pita^sanonnan 
Jaakobin huoneelle, nfiin ilmoitta- 
man Israelii! lapsille: Ap. t7:38. 

4. ,Te olette ilse ndhneet, miia mi- 
naEgyptiiaisilletehnyt olen, ja kuin- 
ka niina olen (eitS^kantanut kot- 
kan siivilia, ja olen saattanut (eidAt 
minun tykOni. 5 Moos. 29:2 ss. 32:11 as. 

5. Jos te nyt minun 3dneni kuulette 
ja pidStte minun liittoni, niin tc olet- 
te minuUe kallis omaisuus, kalliim- 
pi kaikkia muita kansoja, s'lW'A koko 
maa on minun; 5 Moos. 5:2 ss. 

Ps. 24:1. 60:12. 1 Kor. 10:26. Tilt. 2:14. 

6. ja te olette minulle papillinen 
valtakunta ja pyha kansa.* NftmS 
oval ne sanat, jotka sinun pilM Is- 
raelin lapsille sanoman.'' 

2 Moos. 22:31. 6 Moos. 7:6. lPiet2:9. 

Ilm. 1:6. 6:10. 

7. Kun Mooses tuli takaisin, kutsui 
ti3n kokoon vanhimmat kansan se- 
asta, ja puhui heille kaikki sanat, 
jotka Herr^ hSnen kAskenyt oli. 

8. Ja kaikki kansa vastasi yhteen 
SSneen ja sanoi : ,, kaikki mitS Her- 
ra puhunut on, me tahdomme teh- 
dfi.'^aMooses palasi j&lIeen,sanoen 
kansan sanat Herralle. 2 Moos. 24:3. 

5 Moos. 5:27. 

9. Niin Herra sanoi Moosckselle: 
„katso, mind tulen sinun tyk5si pak- 
sussa pilvessd, niin etta kansa kuu- 
lee minun puhuvan sinun kanssasi 
ja uskoo sinua ijankaikkisesti.'' Ja 
Nooses ilmoitti Herralle kansan pu- 
heen. 

10. Ja Herra sanoi Moosekselle: 
„mene kansan tykO ja pyhit5 heitd 
t5naplln§ ja huomenna, ja kftske 
heitd pesemAdn vaatteensa, 

11. niin etta he olisi^t kolmante- 
na paivUna valmiit; silia kolmante- 
na pSivSna on Herra astuvaalaskai- 
ken kansan silmaineteen Sinain vuo- 
relle. 

12. Ja sinun tulee panna raja kan- 
san ymparille ja sanoa heille: ,kart- 
takaat vuorelle astumasta taikka 
nipeamasta sen rajaan! Joka siihen 
vuoreen sattuu, sen pitaa totisesti 
kuoleman. 

13. Ei yksikaan kasi saa siihen ru- 
veta, vaan han on kivitettdva tahi 
ammuttava kuoliaaksi. Oli se elAin 
tahi ihminen, on han menctiava hen- 
kensfi/ Kun aani rupeaa pitkaan ka- 



jahtamaan, silloin he vuorelle astu- 
koot.** 2Moos.24:l. Hebr. 12:20. 

14. Niin Mooses astui alas vuorelta 
kansan tykd«ja pyhitti heita; ja he 
pesivat vaatteensa. 

15. Ja han sanoi heille: ,,olkaat kol- 
manteen paivaan valmiit, ja aikaat 
laiiestykO vaimoja." 

16. Ja kolmantena paivanS senjai- 
keen, kun aamu koitti, niin alkoi 
ukkonen jylista ja salamat leimah- 
taa ; ja paksu pilvi asettui vuoren 
paaile, ja sangen vakevS pasunan 
aani kuului; ja kaikki kansa, joka 
leirissa oli, vapisi pelvosta. 

17. Mutta Mooses johdatti kansan 
lelrista Jumalata vastaan, ja he sei- 
.sahtuivat vuoren juurelle. 

18. Ja koko Sinain vuori suitsi sii- 
ta, etta Herra astui alas sen paaile 
tulessa; ja savu nousi siita niinkuin 
patsin savu, niin etta koko vuori l^o- 
vasti vapisi. 5Moos.4:il8s. Hebr.i2:i8ss. 

19. Ja pasunan aani koveni kovene- 
mistaan. Mooses puhui, ja Jumala 
vastasi hanta kuultavasti. 

20. Kun nyt Herra oli tullut alas 
Sinain Vuoren kukkulalle, niin Her- 
ra kutsui Mooseksen vuoren kukku- 
lalle. Ja Mooses astui sinne ylds. 

21. Niin sanoi Herra hanelle: ,,astu 
alas ja varoita kansaa, etteivat he 
kavisi rajanylitse nahdaksensa Her- 
ran, silia silloin moni heista Tan- 
keaa. 2 Moos. 33:20. 

22. Niin myOs papit, jotka Herraa 
lahestyvat, pyhiltakdCt itsensa, el- 
tei Herra heita hukuttaisi," 

23. Mutta Mooses sanoi Herralle: 
„kansa ei saa aslua ylOs Sinain vuo- 
relle; silia sina olet meita varoilta- 
nut ja sanonut : ,pane rajat vuoren 
ymparille, ja pyhita se.*' 

24. Silloin Herra sanoi hanelle: „me* 
ne sinne alps, ja palaja jaileen ja 
tuo Aaron sinun kanssasi. Mutta pa- 
pit ja kansa aikddt tungeilko astu- 
maan yl5s Herran lyk6, ettei han 
heita hukultaisi." 

25. Ja Mooses astui alas kansan ty- 
kO ja sanoi nama heille. 

20 Luku.> 

Jumalan kymmenen kSskya. Lakl 
alUarista. 

J a Jumala puhui kaikki nSma sa- 
nat, sanoen: 
2. „Mina olen Herra, sinun Juma- 
lasi, joka olen johdattanut sinut u- 
los Egyptin maalta, orjuuden huo- 
neesta. 3 Moos. 25:55. 5 Moos. 5:6 ss. 

Ps. 81:10 S9. 
3.AlkOon sinulla olko muita juinalia. 



77 



2 MOOS. 20. 21. 



4. Alfi tee itsellesi kuvaa eikS jon- 
kun muQtoa, ei niitten, jotka vlhS5Ufi 
(aivaassa ovat, eikfl niilten, jotka al- 
haalla maan p&fillfi ovat, eikd niit- 
ten, jotka vesissft maan alia ovat. 

8 Moos. 26:1. 6 Moos. 4: 15 ss. 27;15b8. 

5. Ala kumarra niita, dlSkd myOs 
niitS palvele ; silld minfi, Herra, si- 
nun Jumalasi, olen kiivas Jumala, 
joka rankaisen isfiin pahat teot lap- 
sissa kolmanteen ja neliSnteen pol- 
veen, kun he minua vihaavat; 

2 Moos. 34:7, 14. 3 Moos. 26:3968. 4Moo8.14:18. 

5 Moos. 24:16. Jer. 81:29 ss. Hes. 18:19 ss. 

6. mutta minS teen laupiuden tu- 
hansittain, kun he minua rakasta- 
vat ja pitltvdt minun kSskyni. 

6 Moos. 5:9 ss. 7:9 ss. Pb. 103:17 ss. 105:8. 

- Jer. 32:18. 

7. Alft turhaan lausu Herran, si- 
nun Jumalasi, nimed; sill§ ei Her- 
ra jfit& sits rankaisem'atta, joka hit- 
nen nimensA turhaan lausuu. 

3 Moos. 19:12. 24:16. Matt. 5:33 ss. 

8. Muista sabbatin pfiivad, niin ettfi 
sen pyhittdisit. 2 Moos. 23:12. 31:13 ss. 

34:21. 35:268. Jer. 17:21 ss. Hes. 20:12. 

9. Kuusi paivSa tulee sinun ty6tn 
tehd0 ja toimittaa kaikki askareesi ; 

2 Moos. 23:12. 34:21. 35:2. 

10. mutta seitsemSntend pSivgnS 
on Herran, sinun Jumalasi, sabbatti : 
silloin ei sinun pidfi yhtadn tydta 
tekemfin, ei sinun, eikS sinun poi- 
kasi, eik^t sinun tyttSresi, eikS si- 
nun palvelijasi, eikS sinun piikasi, 
eikfi sinun juhtasi, eikli muukalai- 
sen, joka sinun portissasi on. 

11. Silld kuutena pfiivfinfi on Her- 
ra taivaan ja maan ja meren teh- 
nyt, ja kaikki mitfi niissft ovat; mut- 
ta HSn leplisi seitsemSntenSi pM- 
vSnd. Sentfihden siunasi Herra sab- 
batin pdivSn, ja pyhitti sen. 

1 Moos. 2:288. 

12. Kunnioita isfiSsi ja aitifisi, ettfi 
kauan eldisit siinfi maassa, jonka 
Herra, sinun Jumalasi, sinulle antaa. 

6 Moos. 5:16. Syr. 3:4 ss. Matt. 15:4. 
Mark. 7:10 ss. Ef.6:2ss. 

13. Alft tapa. 5 Moos. 5:17. Matt. 5:21s. 

Room. 13:9. 

14. Alft tee huorin. .8 Moos. 20:10 ss. 
Matt. 5:27 ss. 19:9. Room. 13:9. Hebr.l3:4. 

15. Alft varasta. 5Moos.5:l9. 

Room.l3:9. £f. 4:28. 

16. Alft sano vftftrftft todistusta si- 
nun Ifthlmmftistftsi vastaan. 

San. 19:5. Room. 13:9. 

17. Alft himoitse sinun IfthimmSi- 
sesi huonetta. Aid himoitse sinun 
Ifthimmfiisesi vaimoa, eikft hftnen 

Salvelijatansa, eikft piikaansa, eikft 
ftnen hftrkftfinsft. eikft hftnen aa- 



siansa, eikft mitftftn mitft on .sinun 
Ifthimmftisesi omaat* Room. 7:7. 13:9. 

Jaak. 1:14,15. 

18. Ja koko kansa huomasi ukkosen 
jylinftn ja tulen leimaukset, ja pa- 
sunan ftftnen.sekft suitsevanvuoren; 
ja kun he sen huomasivat, niin he 
pakenivat ja seisahtuivat etempftnft. 

Hebr. 12:18 ss. 

19. Niin he sanoivat Moosekselle. 
„puhu sinft meidfin kanssamme. ja 
me kuulemme; ja ftlkOOn Jumala 
meidftK kanssamme puhuko, ettem- 
me kuolisi.*' 5Moo8.5:258S. 18:16. 

20. Mutta Mooses sanoi kansalle: 
„ftlkftftt peljfttkd: sillft Jumala on 
tullut teitft koettelemaan.jaHSn tah- 
too pitftft teitft pelvossansa, ett'ette 
syntift tekisi." 

21. Niin kansa pysyi etempftnft ; mut- 
ta Mooses meni Ifthemmftksi sitft 
paksua pilveft, jossa Jumala oli. 

22. Ja Herra sanoi Moosekselle : 
„niin pitftft sinun sanoman Israelin 
lapsillc : ,te olette itse nfthneet, ettft 
mmft olen taivaasta teidftn kanssan- 
ne puhunut. 

23. Alkftftt tehkO itsellenne jumalia 
minun rinnalleni; ftlkftftt tehkO it- 
sellenne mitftftn hopiaisia tahi kul- 
taisia epftjumalia.* 

24. Tee minullemaastaalttari, jonka 
pftullft sinun pitftft polttouhrisi ja 
kiitosuhrisi, sinun iampaasi ja kar- 
jasi uhragman. Mihinkft paikkaan 
ikftnftnsft mina sftftdftn nimenimuis- 
ton, sinne minft tulen sinun tykOsi, 
ja siunaan sinua. 

25. Ja jos sinft teet minulle kivisen 
alttarin, niin ftlft tee sitft vuoUuista 
kivistft ; jos siihen sinun veitsesi sat- 
tuu, niin sinft sen saastutat. 

5 Moos. 27:5. Jos. 8:31. 

26. Alft myOskftftn astu minun alt- 
tarilleni astuimilla, ettei sinun bft- 
pysi sen pftftllft paljastuisi.'* ' 

21 Luku. 

Laki orjista. Laki miestappajista. 

Nftmft ovat ne oikeudet, jotka sinun 
tulee asettaa heille noudatetta- 
vaksi : 

2. Jos sinft ostat Hebrealaisen or- 
ian, niin tulee hftnen palvella sinua 
kuusi vuotta; vaan seitsemftntenft 
on hftn pftftstettftvft vapaaksi lunas- 
tamatta. 3 Moos. 25:40. 5 Moos. 15:12. 

Jer. 84:14. 
8. Jos hftn naimatonna on ollut, 
naimatonna pitftft hftn myOs pftfts- 
tettftmftn vapaaksi; vaan jos hftn 
naineena tuli, Ifthtekftftn vaimoi- 
nensa. 



78 



2 MOOS 21. 



4. JoshftAenisAntftnsfiantoihfinelle 
vaimon, ja se onsynnyttflnythfinelle 
poikia taikka tytt&riS, niin hfinen 
vaimonsa ja lapsensa pitfifi oleman 
hfinen is9nt5ns5 omat, vaan hfin itse 
pdilstettSkddn ykslnfinsfl vapaaksi. 

5. Mutta jos orja julkisesti sanoo: 
Minind rakaslan isiVnlAAni, vaimoani 
ja lapsiani, enkft tahdo tuUa va- 
paaksi/* 

6. niin hfinen isfintansfiviekOOn hS- 
nen tuomarien tykO la asettakoon 
hftnen oveen taikka plhtipieleen, ja 
lAvist5k6dn isSntS hSnen korvansa 
naskalilla, ja oikoon ijSti hflnen or- 
jansa. 2Moo$. 18:l5ss. 5 Moos. 15:17 

7. Jos joku myO tyttfirensS orjaksl. 
niin ei nl&ntfi saa p&ftstfifi vapaaksi, 
niinkuin mies-oijat pflSstetfifin. 

8. Jollei hfin kelpaa isftnnailensd, 
joka ensin on liftnet kihiannut, niin 
saakoon toinen hSnetlunastaa; mut- 
ta muukalaiselle kansalle SlkOGn 
hanelin olko valtaa myOdfi hdntS, 
koska liftn on petollisesti menetellyt 
hdnen kanssaan. 

9. Mutta jos hfln sen kihlaa pojal- 
iensa, niin antakoon hflnen nauttia 
tytfirlen oikeutta. 

10. Jos h3n pojallensa ottaa toisen, 
niin ei hSnen pidA kieltdmfin edel- 
liseltH hUnen ravintoansa, vaatteitan- 
sa ja asunto-oikcuttansa. 

11. JoIIei hAii annu hflnen nauttia 
nilitd kolniea oikeutta, niin pfiSstettU- 
kGdn iKln vapaaksi limastamatta. 

12. Joka Iy6 ihmisen niin, ettA hSn 
kuolee, hdnen pitn& totisesti kuole- 
man. l Moos. 9:6. 3 Moos. 24:17. 

4 Moos. 35:16. Matt 26:52. 

13. Vaan jollei hSn ole hfintfl vSi- 
jvnyt, mutta Jumala on sallinut kll- 
cien varomattomuudessa sattua lid- 
neen.niin minSmaAri&finsinullepai- 
kxm, johonka tiSn pactkoon. 

4 Moos. 35:6,22ss. 5M0OS. 4:41 SS. 19:1 ss. 

Jos. 20:2 ss. 

14. Mutta Jqs joku tekee rikoksen ja 
tappaa IdhimmAisensfi kavaluudella, 
se on otettava kiinni, vaikka minun 
altlarini fi^reltS, ja kuoletettavu. 

lKun.2:28ss. 

15. J9ka lyO isAfinsS taikka flitinn- 
sS, hdn on rangaistava kuolenialla. 

16. Joka varaslaa ihmisen, joko hdn 
sitten myO hAnet tahi pUM haneii 
luonaan, hfln on rangaistava kuole- 
malla. 5 Moos. 24:7 

17. Joka kiroilee isfihn^a tahi Ai- 
Iidns3, hSn on rangaistava k-uole- 
malla. 3 Moos. 20:9. 5Moo8.2ll8— 21. 
27:16. Sao. 20:20. 30:17. Matt 15:4. Mark.7:10. 

18. Jos kaksi miestfi keskenSnsA 
riltelee, ja toinen ly6 toista kivellA 



tahi nyrkillA, ja hfin ei siitA kuole, 
vaan joutuu vuoteen omaksi, 

19. kuitenkin niin, ettA hAn para* 
nee ja kAvelee sauvansa nojalla, 
niin pAAsee lyOjA rangaistuksesta va< 
paaksi; ainoastansa korvatkoon hA* 
nelle vahinkonsa ajan suhteen, ja 
pitAkOOn huolta hAnen hoidostaan 
sairauden aikana. 

20. Jos joku lyO oriaansa tahi palk 
kapiikaansa sauvalla, niin etta hAn 
kuolee hAnen kAsiinsA, hAn on toti* 
sesti kaiketi rangaistava. 

21. Mutta jos hAn pAivAn taikka 
kaksi cIAA, AlkOOn hAntA rangais- 
tako, sillA se on hAnen rahansa. 

22. Jos miehet tappelevat keske- 
nAnsA, ia joku licistA loukkaa ras- 
kaan vaimon, niin ettA hAnen tAy- 
tyy hedelmAnsA kesken synnyttAA, 
eikA siinA muuta onnettomuutta ta- 
pahdu, liiin rangaistakoon hAn ra- 
nasakoilla sen mukaan kuin vaimon 
mies vaatii, ja asetettakoon asia ar- 
viomiesten pAAtettAvAksi. 

23. Mutta jos onnettomuus tapah- 
tuu, niin on annettava henki nen- 
gestA, 

24. silmA silmAstA, hammas ham- 
paasta, kAsi kAdestA, jalka jalasta, 
3Moo8.24:20s8. 5 Moos. 19:21. Matt 5:38 ss. 

25. poltto poltosta, haava haavasta, 
sinimarja sinimarjasta. 

26. Joka lyO orjaansa tahi palkka- 

Riikaansa silmAAn ja turmelee sen, 
Anen pitAA pAAstAmAn sen vapaaksi 
silmAn tAhden. 

27. Samoin jos joku lyO oijaltansa 
tahi palkkapilaltansa hampaan suus- 
ta, niin pitAA hAnen pAAstAmAn sen 
vapaaksi hampaan tAhden. 

28. Jos hArkA puskee jonkun kuo- 
iiaaksi, miehen tahi naisen, niin 
hArkA pitAA kivitettAmAn, ja Alkddn 
syOtAkO sen lihaa; mutta hArjAn 
omistaja oikoon rangaistuksesta va- 
paa. 

29. Mutta jos hArkA ennen on tot- 
tunut puskemaan, ja sen isAntAA on 
siitA todistajien kautta varoiteUu. 
eikA hAn kuitenkaan pitAnyt huolta 
hArjAslAan, vaan se tappaa miehen 
tnhi. naisen,, niin hArkA kivitettA- 
k&Oif ja sen isAntA kArsikddn myOs 
kuole man i Moos. 9:5. 

30. Mutta jos rahasakkoja hAnelle 
tarjotaan, niin suorittakoon hAn hen- 
kensA lunnaaksi niin paljon kuin 
mAArAlAAn. 

31. Jos henkilO, jota hArkA puskee, 
on poika tahji tyttO, oikoon lakl 
sama. 

32. Mutta jos hArkA puskee orjaa 
tahi palkkapiikaa, niin maksakoon 



79 



2 MOOS. 21. 22. 



sen omistaja pusketun isdnnfille kol- 
niekymmenta hopiasiklift, ja hfirkS 
pitda kivitettdmAii. 

33. Jos joku avaa kaivon, taikka 
kaivaa kaivon, eikd sit3 peitd, ja 
hHrkA tahi aasi siihen putoaa, 

34. niin tulee kaivon omistajan ra- 
halla korvata vahinko eldimenomis- 
tajane;niuHaeli\imenruumisolkoon 
hfinen omansa. 

35. Jos jonkun hdrkfi toisen miehen 
hdrjdn puskee kuollaaksi, niin on 
eiava liarkd myfitSva ja Nihal jael- 
tavat, ja kuolleen hnrjSn ruumis on 
niinikdan jaeltava. 

36. Mutta jos oli tunnettua,etta hSr- 
ka ennen on ollut puskija, eikfi hfi- 
nen isSntansS kuitenkaan siitShuol- 
ta pitSnyt, niin korvatkoon liSn hSr- 
jMn hfirjaiia, mutta kuolleen hftrjdn 
ruumis jaakOOti hSnen omakseen. 

22 Luku. 
Laki varkauksista y. m. 

Jos joku varastaa hdrjdn taikka 
lampaan, ja teurastaa tahi myO 
sen, hSnen pitSS antaman viisi har- 
kaa yhdesta hdrjSsta* ja neljft lam- 
masta 3'hdestll lampaasta.2Sain. 12:6. 

2. Jos varas saadaan kiinni huo- 
neesen murtautuessaan ja h^n ly6- 
dnnn kuoliaaksi, niin ei ole lydjfl 
vikapaa tapetun vereen. 

3. Mutta jos aurinko tapahtuman 
sattuessa jo oli noussut, niin on tas- 
sa verenvika. Varas maksakoon kaik- 
ki takaisin, mutta ellei hanelia mi- 
taan ole, niin mydtak6dn han ja 
korvattakoon, mita oli varastanut. 

4. Jos varastetlu eiain, oli se har- 
ka, aasi tahi lammas, lOydetaan eia- 
vana varkaan hallussa, niin pi- 
taa hauen se kaksikerlaisesti mak- 
saman. 

5. Jos joku syOttSa toisen pellon 
tahi viinimaen, taikka jos han paas- 
taa irti karjansa, niin elta se syO toi- 
sen peliossa,hanen pitaa korvata va- 
hinko antamalla mita parasta on 
hanen omassa pellossansa tahi vii- 
nimaessansa. 

6. Jos tuli paasee valloillensa ja 
sytyttaa orjantappurapensastot, niin 
etta siita elokuhilaat, leikkaamaton 
viija tahi muuta pelloUa syltyy pa- 
lamaan, niin maksakoon se vahin- 
gon, joka tulen irti paasti. 

7. Jos joku antaa lahimmaisellensa 
rahaa tahi muuta kalua katkOOn, ja 
se vairastetaan hfinen huoneestansa ; 
niin pitaa varkaan, jos han tavataan, 
se kaksikerlaisesti maksaman. 

8. Muttajos ei varasta lOydetfi, niin 



on talon isAnta tuotava tuomaritten 
eteen valalle, etta tulisi selville, ei- 
kd han ole kasidnsa satuttanut Mk^ 
himmaisensa tavaraan. 

9. Jos on joku vaarA asia kysymyk* 
sessa, koski se sitten harkaa, aasia, 
lammasta, vaatteita tahi muuta hft- 
vinnytta tavaraa, josta toinen vail- 
taa, sanoen: „tama se on,'' niin on 
heiddn molempain asia tuleva tuo- 
maritten eteen; jonka tuomarit vl- 
kapaaksi lOytavat, se lahimmaisel- 
lensa kaksinkertaisesti maksakoon. 

10. Jos joku antaa lahimmaisensH 
hoitoon aasin, hdrjan, lampaan taik- 
ka muun eiaimen, ja se kuolee, taik- 
ka saa jonkun vamman, taikka vu- 
rastetaan, kenenkaan nakematta, 
»11. niin otettakoon kumpanenkin 
valalle Herran kautta, ettei han ole 
satuttanut kattansd lahimmaisensft 
tavaraan; sen, jonka tavara oil, tulee 
siihen tvytya, ja toisen ei tarvitse 
sita maksaa. 

12. Mutta jos sehanelta varastetaan, 
niin tulee hanen suorittaa siita hin- 
ta omistajalle. 

13. Mutta jos se on kuoliaaksi raa- 
deitu, niin tuokoon sen esille todis- 
tukseksi, eika hdnen tarvitse mitftftn 
maksaa. 

14. Jos joku ottaa eiaimen lalnaksi 
lahimmaiseltansa, ja se tulee vialli- 
seksi tahi kuolee, eika sen omistaja 
ole lasna, niin hanen pitaa sen ko- 
konansa maksaman. 

15. Mutta jos sen omistaja on siina 
lasna, niin ei hdnen. tarvitse sita 
maksaa ; jos se palkalla oli, niin ol- 
koon palkka maksuna. 

16. Jos joku viettelee neitseen, joka 
ei vieia ole kihlattu, ja makaa ha- 
nen, sen pitaa antaman hanelle huo- 
menlahjan, ja ottaman hftnet vai- 
moksensa. • 5 Moos. 22:28 ss. 

17. Jos isa ei tahdo hanta antaa ha- 
nelle, niin pitaa viettelijan maksaa 
rahaa, niin paljon kuin neitseen 
huomenlahja on. 

18. Velhonaisen fiia salli eias. 

S Moos. 20:27. 

19. Joka jarjettOmainluontokappal- 
ten kanssa yhteyntyy, sen pitaa to- 
tisesti kuoleman.. SMoos. 18:23. 20:15. 

5 Moos. 27:21. 

20. Joka uhraa jumalille, eika 
ainoalle Herralle, hanen pitaa ki- 
rottu oleman. 

21. Muukalaiselle aifi tee vaaryyttfi, 
aiaka hanta sorra; silia te olette itse 
olleet muukalaisinaEgyptin maalla. 

2 Moos. 23:9. 3 Moos. 19:33. 6 Moos. 24:17 ss. 

22. Ala pahasti kohteie leskefi eika 
orpolasta. Sak. 7:io. 



80 



2 MOOS. 22. 23. 



23. Jos sina jotakuta heislfl pahasti 
kohtelel, niin mina tolisesli kuulen 
heidaii huutonsa, kun he huutavat 
minun tykOni, 5 Moos. 10:18. 

24. ja minun vihani on syllyvfi, ja 
minS tapan (eidSt miekalla, niin et- 
ta teidan valmonne tuievat leskiksi 
ja teidSn lapsenne orvoiksi. 

25. Kun lainaat rahaa iollekulle 
kOyhfille sinun tykOnfisi mmunkan- 
sastani, niin ei sinun pida oleman 
hSnlii kohtaan niinkuin koron ot- 
taja, eika korkoa hSnen pafillehsa 
paneman. 3Moos.25:36s8. 5Moo8.23:198S. 

Ps. 15:15. 

26. Jos sina Ifihimmaiseltdsi olet 
ottanut vaipan pantiksi, niin anna 
se takaisin h&nelle ennenkuin au- 
rinko laskee; 

27. selifin on hfinen ainoa peitteen- 
s|, ja sillfl hSn verhoaa ruumistansa. 
MiliS hfin muutoin maatessaan it- 
scnsa peitiaa? Ja jos hanen laylyy 
nuutaa minun lykOni, niin mina 
kuulea hdnta; sifta mina olen lau- 
pias. 

28. Tuomareita ei sInun pida kiroi- 
leman, Ja sinun kansasi ylimmaista 
ei sinun pidft sadatteleman. 

Ap. t. 23:5. 

29. Ala viivyttele kantamasta lah- 
jaasi uutisesta, joka tayttaa riihesi, 
ja siita mita viinikuurnasta vuotaa. 
Esikoisen pojistasi pitaa sinun an- 
laman minulle. 2 Moos. 13:2. 34:19. 

30. Samalla tavalla pitaa sinun te- 
kemfin harkiesi ja lammastesi kans- 
sa. Seitseman- paivaa anna lieidan 
ollaemainsa tyk6na ; kalideksantena 
pMvana pitaa sinun sen antaman 
minulle. 3 Moos. 22:27. 

31. Ja teidan tulee olla minulle py- 
k2 kansa; metsan petojen raat«Ie- 
maa lihaa aikaa syOkO, vaan heilta- 
kiUl se koirille. 2 Moos. 19:6. 3 Moos. 22:8. 

Hes. 44:31. 

23 Luku. 

Laki rehellisyydesta I&bimm&ista kohtaan, 
laopeudesia, juhlapftl vista y. m. 

Y&lhepuheita aia levittele, aiaka 
* aula sita, jonka asia on vaara,et* 
let tulisi vaaraksi todistajaksi. 
2Moos. 20:16. 3 Moos. 19:16. 5Moos. 1:17. 

2. Ala joukkoa seuraa pahuuteen, 
SiSkS missaan asiassa oikeuden edes- 
sS niin iodista, etta poikeat joukon 
mukaan oikeutta vaantamaan. 

3. AiaolepuoIueellinenkOyhaa koh- 
taan hSnen asiassa nsa. 

4. Jos kohtadt vihamiehesi harjan 
tahi aasin eksyksissa, niin johdata 
se hSnelle jaileen takaisin. 

5M008. 22:l8S. 



5. Jos naet vihamiehesi ^sin kuor- 
man alia vaipuneena, niin aia suin- 
kaan jata hanta, vaan aula miesta 
riisumaan kuormaa. .5Moos.22:4. 

6. Aia koskaan missaan asiassa kaan- 
na kOyhan oikeutta, joka talossasi on. 

7. Fysy kaukana vaarista asioista. 
Viatonta ja hurskasta ei sinun pi- 
da tappaman; silia en mina pjda 
jumalatonta hurskaana. 

8. Aia lahjoja ota; silia lahjat so- 
kaisevat nakevaiset» ji^ kaantavat 
hurskasten asian. 5Moo8. 16:19. 27*.25. 

Syr. 20:31. 

9. Aia solvaise muukalaisia; silia 
te tiedatte muukalaisen sydammen, 
koska itse oletle olleet muukalaiset 
Egyptin maalla. 2 Moos. 22.21. 

3M008. 19:33. 6 Moos; }0:19. 

10. Kuusi vuotta pitaa sinun kyl- 
vaman sinun maasi ja kokooman 
sen tulon, 8 Moos. 25:3 ss. 

11. mutta seitsemantena vuonna pi- 
taa sinun jattaa se lepaamaan, etta 
kOyhat sinun kansastasi siita syOda 
saisivat. Ja mita jaa, sen metsan 
eiaimet syOkOGt. Samoin pitaa sinun 
myOs tekeman viinlmakesi ja Oljy- 
makesi suhteen. 

12. Kuusi paivaa pitaa sinun ty6- 
tasi tekeman, mutta seitsemantena 
paivana pitaa sinun lepaaman, etta 
sinun harkasi ja aasisi saisivat le- 
vata, ja sinun palkkapiikasi poika 
ja muukalainen saisi nauttia lepoa. 

13. Kaikki, mita mina olen teille 
sanonut, pitaa teidan pitaman. Ja 
vierasten jumalien nimea aikaat 
muistako,aikddn niita suustasi kuu- 
luko. 

14. Kolmasti vuodessa pitaa sinun 
minulle juhlaa pitaman. 

2 Moos. 34:23. 3 Moos. 23:4 ss. 5 Moos. 16:16. 

15. Happamattoman leivan juhlaa 
tulee sinun pitaa; sinun tulee seit- 
seman paivaa sydda happamatonta 
leipaa, niinkuin mina sinuUe kas- 
kenyt olen, maarattyna aikanaAbib- 
kuuKaudessa, koska silia ajalla olet 
lahtenyt Egyptista; mutta aia tule 
tyhjin kasin minun eteeni. 

2 Moos. 12:14 ss. 34:18. 3 Moos. 23:5. 

5 Moos. 16:1. 

16. Elonkonuu-juhlaa tulee sinun 
myds pitaa, kun korjaal uutiset sii- 
ta mita peltoosi kylvanyt olet. Kor- 
juujuhlaa tulee sinun vieia pitaa 
vuoden lopussa, kun sina tydsi he- 
delmat kedolta korjannut olet. 

17. Kolmasti vuodessa pitaa kaikki 
sinun miesvakesi tuleman Herran, 
sinun Jumalasi eteen. 2 Moos. 34:23. 

5 Moos. 16:16. 

18. Aia uhraa minun uhrini verta 



81 



2 MOOS. 23. 24. 



happamen taikinan kanssa. Ja mi- 
nun iuhla-uhrini lihavuus AlkOOn 
jatcttakO ylitse yOn huomeneksi. 

2 Moos. 12:10,15. 34:25. 

19. Ensimmfllsetuutisetsinunmaa- 
si hedelmilstS tulee sinun viedftHer- 
rasi,sinun Jumalasi.huoneesen. Aid 
kcitfi vohlaa emSnsh rleskassa. 

2 Moos. 34:26. 5 Moos. 14:21. 26:188. 

20. Katso, minA IShetAn Enkelin si- 
nun edellcsi varjelemaan sinua tiel- 
la ja johdattamaan sinun siihen paik- 
kaan, kuin mind olen valmistanul. 
2 Moos. 32:34. 36:2. 5 Moos. 31:3 ss. Jes.C3:9. 

21. Ola vaaria itsestdsi hfmen kas- 
voinsa edessfl, jakuulehdnenddnen- 
sa, ai5kd hSncn mieltdnsH pahoita; 
silin ei hiin jfltd rankaisematta lei- 
dAn ylitsckSy mistSnne, koska niinun 
ninHeni on hdnessd. Jos. 24:19. 

22. Vaan jos sind ahkerasti kuulet 
hdnen ddnensd, ia teet kaikki mitft 
minil sinulle kdsken,niin min5 olen 
sinun vihollistesi viliollinen ja sinun 
vainooiiesi vainooja. 

23. Silld minun Enkelini kdy sinUn 
edellSsi ja johdattaa sinun Amori- 
laisten, Helildistcn, Fercsilaisten, 
Kauunealaisten, Hcvildisten ja Je- 
busilaisten i\k6: ja mind hdvitAn 
heiddt. 

24. Aid suinkaan kumarra heiddn 
jumaliansa, did my5s heitd palvele, 
didkd tee heiddn tekojensa jdlkeen ; 
mutUi sinun pitdd heidUn epdjuma- 
lansa hcittdmdn pois ja lyGmdn rik- 
ki heiddn kuvansa. 

25. Mutta Herraa, teiddn Jumala- 
tanne, pitdd teiddn palveleman, niin 
hdn siunaa sinulle sckd leivdn ettd 
juoman; ja mind otan sinulta pois 
kaikki sairaudet. 

20. Ei yhtakddn vaimoa silloin pi- 
dd oleman sinun maassasi, joka kes- 
ken synnyttdd tahi on hedelmdtOn. 
Ja mind tahdon tdyttdd sinun pdi- 
vdsi luvun. 5 Moos. 7:14. 

27. Mind Idhetdn pelvon sinun edcl- 
lesi, ja hdvityksen kaikkien kanso- 
jen kesken, joitten tykd.sind menet; 
ja mind ajan kaikki sinun vlholli- 
sesi pakoon sinun edestdsi. 

28. Mind ldh6ldn ampiaiset sinun 
cdellesisjotka ajavat pois sinun edes- 
iiisi Hevildiset, Kananealaiset ja He- 
tildisel.. 5MOos.7:20. Jos. 24:12. Vlis.l2:8. 

29. Kuitenkaan en mind samana 
vupnna aja heitd ulos sinun edes- 
tdsi, ettei maa- autioksi tulisi, eikd 
metsdn pedot enenisi^sinua vastaan; 

30. vaan vdhittdin mind heiddt a- 
jan ulos sinun edesfdsi, siihen asti 
ettd kasvat ja omistat maan. 

31. Ju mind asetan sinun maasi ra- 



jat Punaisesta meresld aina Filisteia- 
laisten mereen asti, ja korvesta nian 
virtaan asti ; silld mind annan mti^n 
asuvaisct sinun kdteesi, ja sind ajut 
heiddt ulos edestdsi. i Moo.s. i5:id. 
5 Moos. 11:24. 1 Kun. 4:21. Ps. 80:J2. 

32. Aid tee liittoa heiddn kanssansa, 
eikd heiddn jumaliensa kanssa. 

2 Moos. 34:12. 5 Moos. 7:2. Jos. 23:12 ss. 

Tuom. 2:2 ss. 

33. Ei heiddn pidd asuman sinun 
maassasi, eticivdt kehoittaisi sinua 
syntid tekcmddn minua vastas^n, niin 
ettd palvelet heiddn jumaliansa, sil- 
ld se on sinulle paulaksi. 

5 Moos. 7:3s., 16. Jos. 23:13. Tuom. 2:3. 

24 Luku. 

Jumftla tckce liiton. Mooses Sinain 
vuorella. 

J a hdn sanoi Moosekselle: „astu 
Herran lykG, sind ja Aaron, Na- 
dab ja Abihuja seitsemdnkymmcn- 
td vanhinta Israelista; ja oikaat kuA 
martuen rukouksissa etempdnd. 

2. Mutta Mooses IdhestykOdn yksi- 
ndnsd Herraa, vaan muut dlkOOt U- 
hestykd; dlk50n myOs kansa astuko 
ylOs hdnen kanssansa.** 

3. Niin Mooses tuli ja ilmoitti kan- 
salle kaikki Herran sanat ja kaikki 
oikeudet. Niin vastasi kaikki kansa 
yhteen ddneen.ja sanoi: ,, kaikki ne 
sanat, jotka Herra puhunut on, tali- 
domme tchdd. 2Moos. 19:8. SMoos. 5:27. 

4. Senjdikcen kirjoitti Mooses kaik- 
ki Herran sanat. Ja seuraavana na- 
muna varhain nousi hdn ja rakensi 
alttarfn vuoren juurelle ja kaksitoista 
patsasta, kahdcntoista Israelin su- 
kukunnan jdlkeen. 

5. Ja hdn Idhetti nuoria miehid Is- 
raelin lapsista, jotka uhrasivat polt- 
touhria, ja kiitosuhria mulleisla Her- 
ralle. 

6. Ja Mooses otti puolen verestd ju 
kaasi maljoihin; mutta toisen i)uo- 
len verestd priiskoitti hdn alttarillc. 

7. Ja hdn otti liitonkirjan ja luki 
sen kansan kuuUcn. Ja he sanoi- 
vat: „kaikki mitd Herra puhunut 
on, tahdomme tehdd jaolla hdnellc 
kuuliaiset.'* 

8. Niin Mooses otti veren ja priis- 
koitti kansan pddlle, ja sanoi : ,, kat- 
so, tdmd on sen liiton veri, jonka 
Herra teki teiddn kanssanne kaik- 
kien ndiden sanain perustuksella.'* 

Matt. 26:28. Hebr.9:19s8. lPietl:2. 

9. Ja Mooses ja Aaron, Nadab ja 
Abihu ynnd seitsemdnkymmentd Is- 
raelin vanhinta astuivat sinne yl5s. 

10. Ja he saivat nfthdft Israelin J u- 



82 



2 MOOS. 24. 25. 



malan: hllncn jalkufnSK allaoliniin- 
kuin teko safirin kivesifi ja niinkuin 
itse taivns kirkkaudessaan. 

11. MuUa h^nen kAiensS ef kosket- 
tanut Israelii! lastenpflilmiehifi,vaan 
kun he olivat n&hneet Jumalcin, niln 
he sOivftt ja joivat. 

12. JaHerrasanoiMoosekselle: ««as- 
tu ylOs minun tyk5ni vuorelle , ia 
ole siellfi, niin minfi annan sinulle 
kiviset taulut ja lain ja kdskyt, jot- 
ka minfl kirjoittanut olen heilleope- 
lellavaksi." 

13. Silloin Iftksi Mooses ja hSnen 
palvelijansa Josua; ja Mooses astui 
ylOs Jumalan vuorelle. 

14. Mutta vanhimmillc sanoi hfin: 
MOlkaat tftssfi siihen asti, kuin me 
palajamme teidiin tvkdnne. Katso, 
Aaron ja Hur ovat luonanne; jolla 
joku asia on, hAn tulkoon heidSn 
ctccnsfl." 

15. Niin astui Mooses ylOs vuorelle, 
ja pilvi peilli vuoren. 

16. Ja Herran kunnia asui SInain 
vuorella, ja pilvi peitli vuoren kuu- 
si pSivSft; mutta seitsem3nten9 p3i- 
v§Dft kutsui hdn Moose ksen pilven 
keskeltS. 

17. Ja Herran kunnia oli Israelin 
lapsille n5hda niinkuin kulutlavai- 
nen tuli vuoren kukkulalla. 

5 Moos. 4:24. Hebr. 12:29. 

18. Ja Mooses meni keskelle pilvcA, 
ja astui yl6s vuorelle. Sitten vlipyi 
Mooses vuorella neljakymmentfiplli- 
vftii ja neljakymmentA y5lii. 

2 Moos. 34:8. 5 Moos. 9:9, 18. 

25 Luku. 

Hem kiskee rakentamaan todistuksen 
mijan, Jossa on liiton arkki, pOyt& ja 
kyntumjalka. 

fa Herrapuhui Moosekselle, sanoen: 
*' 2. „Puliu Israelin lapsille, ettS he 
kokoovat minulle ylOnnysuhrin; jo- 
kaiselta, jonka sydSn hyvftstft tnh- 
dosUisenantaa,ottakaat minun yl5u- 
nysuhrini. 2Moo8. 36:6s8. 

3. Ja tSm§ on ylOnnysuhri, jonka 
leidSn pitfifi ottaman heiltft: kultaa, 
bopiata ja vaskea, 

4. sinisifi, purppuraisia ja tulipu- 
naisia villoja, niin myOs valkoista 
liinaa ja viiohen karvoja, 

5. punaisia oinaan nahkoja, hyl- 
Kennahkoja ja sittimipuuta, 

6. filjyft lamppuihin , ryyleja voi- 
dedljyksi ja nyvfinhajuUiseksi sa- 
vuksi, 

7. sekfl myfis onikinkivlfi olkavaat- 
i^n ia kilpeen ommeltaviksi. 

0. Ja beidfiQ tulee tehd& minulle 




, asuakscni hcidUn keskel- 
ansa. Hebr. 9:2. 

9. Teidan tulee tehda maja ja kaik- 
ki sen kapineet aivan sen muo- 
don jaikeen, jonka mina teilleosoi- 
tan. 

10. Tehkaat sittimipuusta arkki, jon- 
ka pituus on puolikolmatta kyyna- 
rata, leveys puolitoista k>'ynarata ja 
korkeus puolitoista kyynnrata. 

2 Moos. 37:1 88. 

11. Ja silaa se puhtaalla kullalla. 
sisaita ja ulkoa pitaa sinun sen si- 
laaman; ja tee kultainen vanne sen' 
ympflri. 

12. Javalasiihen neljakultaistaren- 
gasta, jotka asetat jalkojen kohdalle, 
niin elta kaksi rengasta ovnt yhdclia 
puolella, ja toisct kaksi rengasta toi- 
sella puolella. 

13. Ja tee korennot sittimipuusta, 
ja silaa ne kullalla. 

14. Ja korennot tulce sinun pistfla 
renkuisin arkin sivulle, ctta niista 
voidaan arkkia kantaa. 

15. Korentojen tulee aina olla arkin 
renkaissa; nlita ei saa vetna ulos. 

16. Ja arkkiin pitaa sinun paneman 
se todistus, jonka mina sinulle an- 
nan. 2 Moos. 40:20. 1 Kun. 8:9. 

17. Tee myOs armoistuin puhtaasta 
kullasta, puoltakolmatta kyynarata 
pitka ja puoltatoista kyynarata le- 
via. 2 Moos. 37:6. 

18. Ja sinun tulee tehda kaksi Ke- 
rubimia kullasta; sorvaamalla tulee 
sinun ne tehda ja asettaa ne moleni- 
piin paihin armoistuinta. 

19. Tee yksl Kerubimi toiseen pai\- 
han, ja toinen toiseen paahfln; mo- 
lempiin paihin armoistuinta yhtev- 
teen sen kanssa tulee teidan tehda 
Kerubimit. 

20. Ja Kerubimien tulee hajoittaa 
siipensa sen ylitse, niin elta he peil- 
tavat armoistuimen siiviliansa, ja 
heidan kasvonsa pitaa oleman toi- 
nen toiseensa pain; ja Kerubimien 
kasvojen pitaa oleman kaannetty- 
na alaspain armoistuinta kohti. 

Hebr. 9:5. 

21. Ja aseta armoistuin arkin paai- 
le, ja pane arkkiin se todistus, jonka 
mina sinulle annan. 

22. Ja siina ilitioilan mina itseni 
sinulle, ja armoistuimesta, kahdcn 
Kerubimin vaiilta, jotka ovat todis- 
tuksen arkin paaiia, puhun mina 
sinun kanssasi kaikista niista kas- 
kyista, jotka mina sinun kauttasi 
tahdon antaa Israelin lapsille. 

2 Moos. 20:42. 4 Moos. 7:89. 

23. Sinun tulee viela tehda p^yta. 
sittimipuusta;kaksi kyy naraa olkoon 



88 



2 MOOS. 25. 26. 



sen pituus, kyynflrft sen leveys ja 
puolitoista kyyn5rfi2l sen korkeus. 

24. Ja silaa se puhtaalla kullalla; 
ja tee sen ympftri kuHainen vanne. 

2 Moos. 37:10 ss. 

25. Tee kdmmentK korkea reunus 
p5ydfin ympSri ja kullainen vanne 
reunukseen. 

26. Ja tee siihen neljd kultaista ren- 
gasta, ja pane renkaat neljddn kul- 
maan jalkojen kohdalle. 

27. Juuri reunuksen alia pitSft ne 
renkaat oleman, ettfi niihin voidaan 
pistdft korennot, joista pOyl§ kanne- 
taan. 

28. Korennol ovat tehlSvat sittimi- 
puusta ja silatlavat kullalla; nfiistd 
on pOyld kanneltava. 

29. Ja sinun tulee myOs siihen teh- 
dd vadit, suitsutusastial, maljat ja 
pikarit, joisla juomauhri kandetaan ; 
puhlaasta kullasta plldS sinun ne tc- 
kemSn. 

30. Ja pfiydftlle minun eteeni tulee 
sinun aina asettaa nSyleleivilt. 

3 Moos. 24:5 ss. 1 Sam. 21 :6. 

31. Sinun tulee .myOs tehdd kynt- 
-tiiajalka puhtaasta kullasta; sorvaa- 

malla se kynttildjalka tehldkOOn, 
jalkoinensa, varsinensa ; siind Idyty- 
vdt kuvut, nuput ja kukkaset ol- 
koot kaikki yhdestd samasia kappa- 
leesta. 

32. Kuusi haaraa kfiykOOn ulos 
senkyljistd; kolmekvnttil&jalan haa- 
raa sen toisesta kyljestS, ja kolme 
kynllilftjalan haaraa sen toisesta kyl- 
jests. 

33. Olkoon kolme mantelikukan 
muotoista kupuanuppuinensa.kuk- 
kinensa jokaisessa naarassa, joika 
kyntilSjalasta kSyvStulos; se olkoon 
laita niissfi kuudessa haarassa, jot- 
ka kynttilSjalasla kfiyvSt ulos. 

34. Mutta Use kyntliiaialassa pitSS 
oleman neljft mantelikukan muo- 
toista kupua ynnfi siihen nuput ja 
kukkaset. 

35. Yksi nuppu, yhdestS samasta 
kappaleesta tentynS, on asetetlava 
ensimmdisen haaraparin alle, joka 
kSy ulos kynttildjalastajayksi nup- 
pu toisen haaraparin alle, ja yksi 
nuppu kolmannen haaraparin alle; 
niin on oleva niissS kuudessa haa- 
rassa, jotka kynttildjalasta ulos kdy- 
vat. 

36. Niiden nuput ja haarat pitSS 
oleman yhdesta samasta kappalees- 
ta, ja kaikki tyyni taitavasti tehty 
puhtaasta kullasta. 

37. Ja sinun pitaa tekemSn seilse- 
mftn lamppua siihen, jotka lamput 
pit&fl sytytett&mfin, niin ett& ne va- 



laisevat paikan kunkin lampun edes- 
sa. 4 Moos. 8:2. 

38. Ja kynltilfin niistimet ja sam- 
muttimet tee niinikaSn puhtaasta 
kullasta. 

39. Yhdestfitalentista puhdastakul- 
taa pitas sinun se tekemSn kaikki- 
ne sen tarpcineen. 

40. Niin ola vaarin, ja tee sen muo- 
don jaikeen, kuin sinS nait vuorella. 

Ap. t.7:44. Hebr.8:6. 

26 Luku. 

Pyh&k5n rakennus ja muoto. 

pyhakk5 tulee sinun lehda kym- 
^ menesta kangaskappaleesta ; val- 
koisista kerratuista liinalangoista, 
sinisista, purpuraisista ja tulipunai- 
sista villoista pitaa sinun se tekemSn. 
ja Kerubimit taitavasti siihen kuto- 
man. 2 Moos. 36:8 ss. 

2. Kunkin kankaan pituus pitaa ole- 
man kahdeksan kyynSrata kolmat- 
takymmenia, ja Icvevs pitaa oleman 
nelja kyynarata; ja kaikilla kangas- 
kappaleilla olkoon sama mitta. 

3. Viisi kangaskappaletta yhdistelta- 
kOfin toinen toiseensa, ja taas viisi 
yhdistettakOOn toinen toiseensa. 

4. Sinun pitaa my5s lekeman sil- 
mukat sinisista villoista ensimmai- 
sen kangaskappaleen reunaan, sen 
yhdistetyn kappaleen aareen;jasa- 
malla tapaa aarimmSisen kankaan 
rcunaan toisessa yhdistetyssa kap- 
paleessa. 

5. Sinun pitaa tekeman viisikym- 
mentasilmukkaaensimmaiseenkan* 
kaasen, niin myOs viisikymmenta 
silmukkaa sen kankaan aareen, jo- 
ka toisessa yhdistyksessa on ; ja sil- 
mukat pitaa oleman toinen toisen- 
sa kohdalla. 

6. Ja sinun pita& tekeman viisikym- 
menta kultaista koukkua, jakangas- 
kappaleet yhdistaman toinen toi- 
seensa niilia koukuilla, niin etia 
pyhakkfi tulisi kokonansa yhdeksi. 

7. Ja sinun tulee myOs tehda yksi- 
toistakymmenta kangasta vuohen 
karvoista pyhakOn peitteeksi. 

2 Moos. 36:14 88. 

8. Jokaisen kankaan pituus pitaa 
oleman kolmekymmenta kyynfirfitfi, 
ja leveys nelja kyynaraia. Kaikki 
yksitoista kangasta olkoot saman 
mittaiset. 

9. Viisi kangasta pitaa sinun toinen 
toiseensa yhdistaman eriksensfi, ia 
myOs kuusi kangasta eriksensfi; ja 
kuudennen kankaan tulee sinun 
kaantaa kaksinkertaiscksi pyh^On 
etuslvulla. 



84 



2 MOOS. 26. 27; 



10. Ja sinun pUfift tekem§ii viisi- 
kymmentft silmukkaa ensimmfifsen 
fcankaan reunaansen yhdistetyn kap- 
paleen fifirelle, ja myfis vitsikym- 
menft silmukkaa fifirimmSisen kan- 
kaan reunaan toisessa yhdistyksessft. 

11. Niin myOs pitSfi sinun tekemftn 
viisikymmentfi vaskikoukkua ia pa- 
neman koukut silmukkoihin, ja yh- 
distflmfin peitteet, niin eltfi se olisi 
yksi peite. 

12. Multa mild siihen liikaan tulee« 
mikA ylitse jdd pyhSkfin peitteestfi, 
niin pitfift puolet siitft kankaan 1e- 
veydestd, mikS liikaa on, riippuman 
vapaasti pyhfikfin perSpuoleila. 

13. Ja se kyynftrfi molemmilla puo- 
Illla, joka jaa liiaks! peilekanllaan 
piluudesta, se riippukoon pyhfikfin 
sivuilla molemmin puolin sitfi peit- 
t&nftssS. 

14. Mutia tfimfin ensimmSisen peit- 
leen pfifiUe sinun pitftS tekemSn toi- 
sen peitteen punaisisla oinaan na- 
hoisla, ja vielfi sitten pfidllimmSisen 
peitteen hylkeen nahoisla. 

2 Moos. 86:10. 

15. Pyhfikdn laudat tulee sinun teh- 
di sittimipuusta, ja aseta ne pystyyn. 

2 Moos. 36:20 88. 

16. Jokaisen laudan pituus on ole- 
va kymmenen kyynSrStft, vaan le- 
veys puolitoista kyynfirdtS. 

1/. Kaksi vaarnaa pitfifi jokaisessa 
laudassa oleman, niin eUd ne voi- 
taisiinyhdistfiStoinentoiseensa.Nfiin 
tolee sinun tehdfi kaikki pyhSkfin 
laadat. 

18. Ja pyhak(^n laudoisla tulee si* 
Dun a^ttaa kaksikymmentd lautaa 
etelft puolella. 

19. Ja neljfikymmentfi hopiajalkaa 
tulee sinun tehdS ja asettaa ne kah- 
denkymmenen laudan alle, niin et- 
tft jokafsen laudan alia on kaksi jal- 
kaa,hfinen kahden vaarnansa paflllS. 
J20. Samoin tulee sinun asettaa py- 
UUlOd toiselle sivuUc pohjail puo- 
lella kaksikymmentfl lautaa 

a. ja neUftkymmenta hopiajalkaa, 
aina kaksi jalkaa kunkin laudan 
aDe. 

tL HuttapyhSkOnperftpuolellelfin- 
leen pfiin tulee sinuQ asettaa kuusi 
lautaa. 

2S. Ja aseta kaksi lautaa pyhSkOn 
kalmalaudoiksi sen perfipuolelle. 

24. Nftmd olkoot kaksitahkoiset al- 
haalta alkaen, ja samalla eheSt ha- 
maan ylipfifthfin asti, ensimmfliseen 
rmkaasen saakka. Niin olkoot ne 
oMklemmat, kumpikin kulmassansa. 

25. Niin muodoin tulee olemaan 
ybteensfl kahdeksan lautaa, janlihin 

1 



kuuluvat kuusltolsta hop!ajalkaA« 
aina kaksi jalloui kunkin laudaa 
alia. 

26. Sinun tulee myOs tehdS salvat 
sittimipuusta« viisi niihin lautoihln. 
jotka toisella pyhfik5n sivulla ovaf. 

2 Moos. 36:31. 

27. ja viisi salpaa niihin lautoihin, 

totka pyhfikOn toisella sivulla oval, 
a viisi salpaa myOs niihin lautoi- 
lin, jotka pyhdkOn perfillS ovat, 
Ifinteen pSin. 

28. Ja keskimSinen salpa kSykMn 
keskeltfi lautoja toisesta kulmasta 
toiseen. 

29. Ja sinun pitaa laudat kullalla 
silaaman, ja kullasta tekemfin nii- 
hin renkaat, joihinka salvat piste- 
tdftn, ja silaa salvatkin kullalla. 

30. Ja aseta niin pyhakk6.pystyyn, 
sen muodon jaikeen, kuin sinft nflit 
vuorella. 2 Moos. 25:9,40. 

31. Esirippu on sinun myfis telilfi- 
vfi sinisista, purpuraisista, ja tuli- 
punaisista villoista,sekft valkoisista, 
kerratuista liinalangoista, ja Keru- 
bimit siihen tailavasti kudotut. 

2 Moos. 36:3588. 

32. Ja sinun tulee ripustaa se nel- 
jfiHe sittimipuiselle, kullalla stlatuUe 
patsaalle, joissa ovat kultaiset kou- 
kut ja jotka seisovat neljftn hopea- 
alustan pSfiUS. 

33. Ja ripusta esirippu koukuille, 
ja aseta todistuksenarkki sis§ puo- 
lelle esirippua, niin ettS esirippu olisi 
teille vfiliverhoksi, joka erolttaa py* 
hdn kaikkein pyhimmflstft. 

34. Armoistuimen pitdfi sinun pa- 
neman icdistus-arkin pflfille kaik- 
kein pyhimpfifin. Hebr.9:5. 

35. Mutta pfivta on asetettava ulko 

Euolelle esinppua, ja kynttil^^al- 
a pOydfin kohdalle etelfipuoliselle 
seindlle; Ja p6yta on siis asetet- 
tava pyh&kOn pohjan puoliselle sei- 
nflUe. 

36. Ja tee oviverho pyhdkOn oveen, 
sinisestft, purpuraisesta , tulipunai- 
sesta ja valkoisesta, kerratusta litna- 
langasta, taitavasti kudottu. 

87. Tfitfi oviverhoa varten pitSd si- 
nun tekemfin viisi patsasta sittimi- 
Euusta ja ne kullalla silaaman, ja 
oukut niihin pitfifi oleman kuUas- 
ta^ ja sinun pitfifi valaman niihin 
viisi vaskista Jalustaa. 

27 Luku. 

Polttoubrin alttari. PyhftkOn piha. 

J a sinun tulee my 6s tehdfi alttari 
sittimipuusta ; viisi kyynfirfilfiol- 
koon sen pituus, viisi kyynfirfitfi 9^n 



35 



2 MOOS. 27. 28. 



Icveys — nelikulmnincn on se $iis 
oleva — ja kolme 'kyynarflta sen 
korkcus. 2 Moos. 38:1. 

2. Sarvel pilSft sinun myOs tekemfln 
sen ncIjftSn Kulmaan ; yhdestn samas- 
ta kappaleesta siitd pitd&sensarvien 
oleman. Ja vaskella sinun pitdH sen 
silaaman. 

3. Tee m^6s siihen aslial, joihin 
tuhka kobjataan, ja lapiot, maljat, 
hangot ja hiilikattilat. Kaikki sen 
tarvekapineet pit55 sinun vaskesta 
lekemfin. 

4. Ja sinun pilH^ myfis tekem3n 
siihen verkontapainen rislikko vas- 
kesta Ja kiinniltnmnn rislikkoon nel- 
jA vaskirengasta sen neljdHn kul- 
maan. 

5. Sinun pitS3 paneman se alliaal- 
ta pQin alttarin ympflri, niin ettd 
rislikko ulottuu keskclle aittaria. 

6. Ja tee sittimipuisct korcnnot alt- 
tarille, ja silaa ne vaskella, 

7. ja pist5 korennot renkaisiin.niin 
elia korennol oval kahden puolen 
altlaria, niin ellA sil5 voidaan kanlaa. 

8. Ja laudoisla lulec sinun se teh- 
dS, ja ontevaksi. Niinkuin sinulie 
osoltettiin vuorella, niin se tehtd- 
mSn pitfiS. 

9. Sinun lulee myOs lehdA pyhfi- 
kfille. piha; eteldpuolella oikoon pi- 
han kangas-aila valkoisesla kerra- 
tusta liinasta; sata kyyndrdfi oikoon 
ISmSn sivun pituus. 2 Moos. 38:9 ss. 

10. Ja sen patsaita pitflfi oleman 
kaksikymmentd, kahdenkymmenen 
vaskijalan pSail3: mulla patsasten 
koukut ja seppelect pildS oleman ho- 
piasta. 

11. Samoin pitSH pohjan puolella 
kangasvaattcen olla pituudelleen sa- 
ta kyynfiras, ja kaksikymment5 pat- 
sasla kahdenkymmenen vaskijalan 
pdaild; mutta patsasten koukut ja 
seppeleet pitas oleman hopiasta. 

12. Mutta pihanlyhyclhl sivullalAn- 
si puolecUa pitfld kangas-aldan ole- 
man viisikymmentakyynSrSHpitkd, 
ja patsaita' tulec olla kymmenen se- 

:a kymmenen jalustaa. 

13. Japihanleveysctu puolella il5dn 
pain on olevii viisikymmenia kyy- 
n5r0a. 

14. Ja sen yhdellS puolella tulee 
kangas-aidan olla viisitoista kyyna- 
raa, seka siina kolme patsasta kol- 
men jalusfan paaiia; 

15. ja samoin toisella puolella vii- 
sitoista kyynaraa, seka siina kolme 
patsasta kolmen jalan paaiia. 

16. Mutta pihan sisaan-kaytavHssA 
pitaa oleman kangasverho kaksi- 
kymmenta kyynSraa levia, ja tai- 



i' 



dokkaasti kudottu siniststS, purpu- 
raisista, tulipunaisista, ja valkoi" 
sista liinalangoista, ja sita varten 
myds nelja patsasta neljan jalustan 

paaiia. 

17. Kaikissa patsaissa pihan ympAri 
pitaa oleman hopiaiset seppelect ja 
nopiaiset koukut; mutta jalustain 
tulee oUa vaskesta. 

18. Ja pihan pituus pitaa oleman 
sata kyynaraa, ja leveys joka koh- 
dassa viisikymmentd; ja kangas- 
aidan tulee olla viisi kyynaraa kor- 
kea, ja kalliista kerratusta liinasta 
tehty; mutta jalustat vaskesta. 

19. Kaikki pyhakOn tarvekapineet, 
joita tarviiaan t^^Ossa, seka Kaikki 
vaarnat ja kaikki pihan vaarnat o1- 
koot vaskesta. 

20. Ja sinun tulee kaskea Israelin 
lapsia tuomaan sinulie puhdasla 
Oljya survoluista 6ljypuun hcdel- 
mista kynttiiajalkaa varten, niin et< 
ta lamput aina palaisivat. 

3 Moos. 24:2 S8. 

21. Seurakunnan majassa ulkoisel- 
la puolella esirippua, joka on todis- 
tuksen edessa, tulee Aaronin poi- 
kinensa siita huolta pitaa illasta aa- 
muun asti Herran edessa. Tama on 
oleva ainainen saantO suvusla su- 
kuun, jota Israelin lasten tulec nou- 
datlaa. 2Moos. 80:8. 3 Moos. 24:3. 

28 Luku. 

Aaronin ja hane^ poikainsa puku. 

J a Ota tykOsi sinun veljesi Aaron 
poikinensa Israelin lasten seashi, 
etta ne olisivat minunpappini: Aa- 
ron itse ja hanen poikansa Nadab, 
Abihu, Eleasar ja Ilamar. 

2. Ja teetaveljellesiAaronille pyhSt 
vaatteet kunniaksi ja kaunistukseksi . 

2 Moos. 39:1 88. Syr. 4.5:9 ss. 

3. Sinun pitaa puhuman kaikkien 
niidcn kanssa, jotka taidokkaatovat, 
ja jotka mina taidon hengelia tayt- 
tanyl olen, etta he tekevat vaatteita 
Aaronille hanen pyhittamiseksensa, 
etta han olisi minun pappini. 

2M008. .31:2ss. 

4. Ja nama ovat vaatteet, jotka hei- 
()an tekemAn pitaa: kilpi,oIkavaate, 
vaippa,*ihopaita, hiippa ja vy5. Ja 
nain pitaa heidftn tekeman sinun 
veljellcsi Aaronille ja hanen pojil- 
lensa pyhat vaatteet, etta han mi- 
nun pappini olisi. 

5. Siihen pitaa heidan oltaman kul- 
taa, ja sinisia, purpuraisia, tulipu- 
naisia ja valkoisia, liinaisia lankoja. 

G. Olkavnate on taidokkaasti kudot- 
tava kullasta, ja, siaisislA, purpuras 



86 



2 MOOS. 28. 



lisia.Ja tulipunaisista villoista, ja 
valkoisesta kerratusta liinasta. 

2 Moos. 39:28s/Syr. 43:9,10. 

7. Kaksi yhdistavM oikatilkkua pi- 
tflS sillll oleman kummassakin pdas- 
sd, jolla sen etu-ja takakappale yh- 
dlsleiafln. 

8. Ja hSnen olkavaatteensa vyO, jo- 
ka sen pSailS on, pit^fi oleman yh- 
lil samaa kangasta ja tehty kullasta, 
sinlsistd, purpuraisista ja tulipunai- 
sista vilioista/ja valkoisesta, Kerra- 
tusta liinalangasta. 

9. Ja sinun pitdA ottaman kaksi 
onikin kived ja niihin kaivaman Is- 
raelin poikien nimet, 

10. kuusi ninieS toiseen kiveen, ja 
loiset kuusi nimed toiseen kiveen, 
siina jflijestyksessli kuin he synty- 
neet ovall 

11. Taidokkaasli,niinkuin sinettejS 
i^overretaan, pitfiS sinun kovertaman 
niihin kahteen kiveen Israeli n las* 
(en nimet. Kultakehflfln tulee sinun 
sulkea nimet. 

12. Ja sinun tulee aseitaa ne mo- 
lemmat kivet puvun olkakappalee- 
sen, niin ettd Israelin lapset pysyi- 
iivfit muistossa; Aaron on kantava 
heidSn nimensfi Herran eteen mo- 
lemmilla olillansa muistoksi. 

13. Ja sinun pitdA tckemSn kuitai- 
set nastat, 

14. seka kahdet punotut vitjat puh- 
laasta kullasta, taitavasti kiertftmdl- 
IS. Ne punotut vitjat yhdistd nas- 
loihin. 

15. Virankilpi tulee sinun niyOs 
telidfi toidokkaasti, ja samallaisesta 
kankaasta kuin olkavaate; kullas- 
la. ja sinisistfl, purpuraisista, tuli- 

Eunaisisia villoista, ja kerratusta val- 
oisesla liinalangasta tulee sinun se 
tehdtf. ^ 2 Moos. 39:8 8S. 

16. Neljflkulmainen se olkoon ja 
kaksikertainen , vaaksa sen pituus 
ja vaaksa sen leveys. 

17. Ja tSytl&sekivilld.jaasetanenel- 
jUn riviin. Ensinimllisessa rivissa 
olkoon: kameoli, topasijasmaragdi. 

lS.Toisessa rivissd: rubini, sanri, 
demaotti. 

19. Kolmannessa rivissS : hyasinlti, 
agattr ja ametisti. 

20' Neljflnnessfi riviss§: krysoliti, 
oniks ja jaspis. Aseta ne kukin pai- 
Itoillensa kuitakehdnympdrOim|lnil. 

21. Kivia pitfifi oleman kaksitoista 
IsraeliD lasten luvun mukaan ; kus- 
>akln kivess9 olkoon yksi kahden- 
loista sukukunnan nimi, koverrettu 
Wveen, niinkuin sinettejil koverre- 
(aan. 

22. Ja tee rinlakilpeen punotut vit 



jat taidokkaasti kiertSniAllfi puhtaas- 
ta kullasta. 

23. Ja tee vielS rinlakilpeen kaksi 
kultarengasta, ja aseta molemmat 
renkaat kahteen rintakilven kul- 
maan. 

24. Ja pistS ne kaksi kultavitjaa kah- 
teen renkaasen rintakilven kitlmiin. 

25. Mutta vitjojen toiset pSat pistfi 
kahteen nastaan^ja kiinnit§ ne niin 

f>uvun olkakappaleesen sen etupuo- 
elle. 

26. Ja tee sitten vieia Icaksi kultais- 
ta rengasta ja kiinnitfi ne rintakil- 
ven molempiin muihin kulmiin sil- 
Ic reunalle, joka onsisdSnpflinkfiftn- 
netty olkavaatetta vastaan. 

27 Ja tee vieldkin kaksi kultaista 
rengasta ja kiinnita ne olkavaatteen 
molempiin olkakappaleisin etupuo- 
lella alaspAin, jossa nAmd ulottuvat 
olkavaatteen vyOhOn. 

28. Ja rintakilpi isitfid yhdistettfi- 
mHn renkaistansa sinisellS langalla 
paailisvaalteen renkaisin, niin ettil 
se olisi olkaxaattecn vyfin yldpuo- 
lella. ettei rintnkilpi irtaantuisi ol- 
kavaatteesta. 

29. Ja Aaronin \y\\lki niinmuodoin 
kantaman Israelii! fasten nimet vir- 
kakilvessil syd3inmensd pfiiilltimen- 
nessftnsa sisAlIe pybdkkOon, muis- 
toksi Herran cdessd alituisesti. 

30. Ja sinun pililH paneinnn virkn- 
kilpeen u r i m j a ( u m m i m (val- 
keudet ja tnydellis\ydet) ctIA ne oli- 
sivat Aaronin sydamnicllA hdnen 
astuessaan Herran eteen Jn Aaronin 
tulee niinmuodoin aina kantaa Is- 
raelin lasten oikeudet sydammellAan 
Herran kasvojen ed^ssCI. 3 Moos. 8:8. 

4 Moos. 27:21. 5 Moos. ,33:8. 1 Sam. 28.G. 

Esr. 2C3. Nell. 7:05. 

31. Olkavaatteen liepeet tulee sinun 
tehdd sinisestn knnkaasta; 

2 Moos. 39:22 ss. 3 Moos. 8:7. 

32. ja sen keskelld olkoon Idpi pnn- 
la varten, ja sepelus sen ISven ym- 
parilld,pullistamalla tehty niinkuin 
pantsarin 1dpi, ettei se repidisi. 

33. Ja alhaulle liepeitten helmaan 
tulee sinun tchdS granatin omeni(Mi 
tapaiset sinisista, purpuraisista ja tu- 
lipunaisista langoista, ja aseitaa niit- 
ten v91iin ylt'ympdrinsa kultaiset 
kulku.seti 

34. niin etta siin3 on kultainen kul- 
kunen ja sen jfllkeen granalin-ome- 
na, ja niin taas kultainen kulkunen 
ja sitten granatin-omena ylt'ymp5ri 
liepcen reunassa. 

35. Ja Aaron pitftkfiOn t&tfi yI15ns5 
palvelusta tehaessfinsS, niin eltd sii- 
ta kilina kuuluu, kun hfin menee 



87 



2 MOOS. 28. 29. 



pyhdkk66n Herran «leen ja tulee 
sieltS ulos, sentUhden ettei-hdn kuo- 
lisi. Syr. 45:9, 11. 

36. Tee myfiskin levj^puhlaaslakul- 
lasta, ja kaiverra siihen, niinkuin 
sinettej^ kaiverrellaan, nHma sanat: 
„Herralle pyhitetty." 

3 Moos. 8:9. 39:30 ss. Syr. 45:14. 

37. Ja sido se siniselldlangalla,niin 
ettS se on hiipan pSSllA ; hiipan eti- 
sellS puolella on se oleva. 

38. Sen pit3ft oleman Aaronin ot- 
salla, niin elih Aaron kantaa niitten 
i^hrien viat, jotka Israelin lapset 
esiinluovat kaikissa pyhissS lah- 
joissa ; ja se olkoon alinomaa h^nen 
otsallansa heille mielisuosioksi Her- 
ran edessd. , 

39. Tee myOs ihopaita kalliista Hi- 
nasta, ja hiippa kalliista liinasta, 
seka taidokkaasti ommeltu vyO. 

2 Moos. 39:27 ss. 3 Moos. 8:9. 

40. Ja myds Aaronin pojille tee iho- 
paitoja, vOitIt ja hiippoja kunniaksi 
Ja kaunistukseksi. 

41. Ja pueta ne veljesi Aaronin ja 
hdnen poikainsa ylle, ja voitele hei- 
dUt, ja tSytS heiddn kdtensS, ja py- 
hita heitfi, ettS hb olisivat minun 
pappini. 

42. Ja tee l^eille liinaiset alusvaat- 
teet hdpylihansa peitteeksi, kupeis- 
ta aina reisille pit3d niitten ulottu- 
man. 2 Moos. 39:28. 

43. Ja Aaron ja h3nen poikansa pi- 
tSkfifit ne ylians3 mennessdSn todis- 
tuksen majaan tahi kun he iShesty- 
vdt alttaria palvelust^ tehddksensS 
pyli9kOssa, ettei heille kostettaisi 
heidfin vaSryyttSnsft ja he kuolisi- 
vat. Se olkoon ijankaikkisena siidn- 
tdna hSnellc ja hdnen siemenellen- 
s5 hdnen jdlkeensA. 

29 Luku. 

Mfiftr^ykset p^ijP^^^ yibkjmisestii ja 
jokapdivftisiRtH ubreista. 

J a tSmS on se, mita siiiun pitfia te- 
kemdn Jieilie, pyhittSdksesi heit3, 
ettS he olisivat niinun pappini : ota 
nuori mulli, ja kaksi \virheeldnt5 
oinasta,. 3Moos.8:2ss. 

2. ja happamattomla leipiS ja hap- 
pamattomia kakkuja, joitlen pdulle 
on OljyS kaadeitu, ja happamatto- 
mia ohueita, OlJyllS voideituja kak- 
kuja; nisuisistajauhoista pit^dsinun 
ne tekenidn. 

3. Ja pane ne yhteen samaan ko- 
riin, ja kanna ne edes korissa, 
kun tuot edes niuUin ja nc kaksi 
oinasta. 

4. Ja tuo Aaron poikinensa seura- 



kunnan majan oven eteen ja pese 
heitfl vedelld.2Moos. 40:12 ss. 3 Moos. 8:6. 

5. Ja ota vaatteet, ja pueta Aaronin 
ylle ihopaita, jaolkavaatteentiepcct, 
^a itse oikavaate rintakilven kanssa, 
ja vydtd hdn olkavaatteen vydllii. 

6. Pane myds hiippa h5nen pHii- 
hSnsH, ja laske pyhS kruunu hiipan 
pnaile. 

7. Ja ota voitelufiljy9, ja vuodala 
hSnen phdns§ pfilUle ja voitele hfln- 

ta. 3 Moos. 8:12. 

8. Ja anna hanen poikansa tulla 
edes, ja pueta heidAn yllensS iho- 
paidat. 

9. Ja vydta heidat vydllS, sekS Aa- 
ron ettd hdnen poikansa, ja pane 
hiipat heid.nn pdShdnsa. Ja heilia 
pitnn oleman pappeus ijankaikkise- 
na oikeutena. Ja tSyta Aaronin kH- 
det ja hanen poikainsa kSdet. 

10. Ja tuo slltcn mulli seurakun- 
nan majan ctcen, ja Aaron poikt- 
nensa pankoot klitensS mullin pfiulle. 

3 Moos. 1:3. 8:14. 

11. Ja teurasta muIIi Herran edes- 
sa s^urakunnan majan ovella. 

12. Ja ota mullin verta,ja sivuasor- 
mellasi alttarin sarviin; mutta kaik- 
ki sen muu veri vuodata alttarin poh- 
jaan. 

13. Ja ota kaikki rasva, joka sisftl- 
mykset peittii3, ja maksan kalvo ja 
molemmat munaskuut, ja rasva, jo- 
ka on niideii pSaild, ja polta aitta- 
rilla. 3 Moos. 3:3. ss. 

14. Mutta polla mullin liha ja ha- 
nen vuotansa ja rapansa tulella ul- 
kona leirista; silia se on rikosuhri. 

3M008. 4:12. 8:17. Hebr. 13:11. 

15. Ota niyos toinen oinas, ja Aa- 
ron poikinensa pankoot kdtens§ sen 
oinaan pihln paHlle. 3Moos. 8:i8ss. 

16. Ja teUrastn se oinas, ja ota ha- 
nen vercnsii, ja priiskoita alttarille 
ylta ymparinsa. 

17. Mutta leil^kaa oinas kappaleiksi, 

i'a pese hdnen sisalmyksensfi ja jal- 
Lansa, ja pane ne kappalten ja pUdn 
panile. 

18. Ja polta koko oinas alttarlUa; 
sills se on polltouhri Herralle. SeoTi 
otollinen haju ja tulfuhri Herralle. 

19. Ota my6s toinen oinas. ja Aaron 
. poikinensa pankoot kaiensd oinaan 

pdan pdnile. 3 Moos. 8:22. 

20. Ja teurasta oinas Ja ota sen -ver- 
ta, ja pyyhkdise Aaronin ja hftneii 
poikainsa oikian korvan lehteen ja 
dikian k3den peukaloon ja heidfin 
oikian jalkansa Isoon varpaeseen ; 
mutta kaada muu veri alttarille yl- 
ta ympdrinsd. 

21. Ja ota verestdt joka alttarilJa oa, 



88 



2 MOOS. 29. 80. 



!a volteludljyfi, Ja prifskoita Aa- 
ronin ja Mnen vaatettensa pfilkllef 
ja hflnen (k)ikainsa |a heidfln vaa- 
tettensa pfifllle, niin hfln tulee py- 
hSksi itse vaatteinensa, ja hSnen 
poikansa vaatteinensa. 

22. Sitten ota oinaasta rasva, ja sa- 
paro, ja se rasva, mika sisSlmykset 
peiltas, ja'maksan kalvo, ja molem- 
mat munaskuut, niin my6s se rasva 
kiuD niiden pSSUS on, ja oikia lapa; 
sUia se on tayttSmisen oinas. 

2. Ja Ota kakku lelpM, Ja yksi fil- 
jykakku, seka yksi chut kakku ko- 
rista, jossa happamaltomat leivflt 
ovat Herran edessS, 
.24. ja pane kaikki n9ma Aaronin 
ja hflnen poikainsa kStten pfiSlIe, ja 
nfiaiylfi ne hftfilylysuhriksi Herralle. 

25. Ja Ota sitten ne heidfin kSsistftn- 
si, Ja polta alttarilla polttouhriksi ja 
otolliseksi hajuksi Herralle; sillfise 
on luliuhri Herralle. 

26. Ja Ota rinta Aaronin tSyttflmisen 
oinaasta, ja hfifilytd se hflfilytysuh- 
riksi Herran edessfl; ja se olkoon 
sinun osasi. 

27. Ja pvhitfi haaiytysrinta ja ylOn- 
nyslapaooka hS&lytetty ja yletty on^ 
Aaronin ja hfinen poikainsa tayttfi- 
misen oinaasta. 

28. Ja se pitfta oleman Aaronille ja 
a^en pojiUensa annettu osci ijan- 
^kkisena oikeutena Israelin lap- 
suta; silia se on ylOnnysuhri. Ja 
jfifinnysuhri on ©leva Herran oma, 
uraelm lasten antama, heidAn kii- 
tojuhrissansa. 8 Moos. 7:3. 10:14. 

29. Mutta Aaronin pyhSt vaatteet 

pitsa tuleman hSnen pojillensa hfi- 

nen jKIkeensfi. etta he niissa voidel- 

taisiin, ja heidan katensa taytettai- 
siin. 

30. Joka hanen pojistansa tulee pa- 
piksi hSnen sijaansa, hanen pitaa 
pukeman ne yllensa seitseman pai- 
yU, mennessansa seurakunnan ma- 
jaan palvelusta toimittamaan pyha- 
k6ssfi. 

31. Ola mvOs layttamisen oinas, ja 
keitS sen liha pyhassa paikassa. 

32. Ja Aaron poikinensa syfikfiOt 
>cn oinaan lihan seka leivan, joka 
on korissa, seurakunnan majanoven 
Wtessfl; 3 Moos. 8:31 88. 24:9. 

33. heidan pitaa syfiman sen, joUa 
wvilus on tehty, etta heidan katen- 
^ tflytettaisiin ja he pyhitettaisiin. 
Ei maukalainen sita saa syOda; sil- 
« se on pyha. 

3i Jos jotakin tahteeksi jaa taytta- 
nusen lihasta ja leivasta aamuun 
ttti, sen pitaa sinun polttaman tules- 
*>; ei sita saa syOdfi, silia se on pyha. 



35. Naintuleesinuntehda Aaronille 
ja hanen pojillensa kaikissa asiois- 
sa sen mukaan, kuin mina sinullc 
kaskenyt olen. Seitseman paivaa pi- 
taa sinun heidan katensa layttaman. 

36. Ja joka paiva tulee sinun teu- 
rastaa muUi rikosuhrinasovinnoksi, 
ja puhdistaa alttari, kun sovintoa 
uhraat sen paaiia; ja sinun tulee 
voidella se, etta sen pyhiltaisit. 

37. Ja seitseman paivaa tulee sinun 
sovittaa alttari ja pyhittaa se; ja se 
alttari olkoon kaikkein pyhin. Mita 
ikanansa sllhen alttariin tarttuu, se 
on pyhitetty. 8 Moos. 6:18. 

38. Ja tama on se, jota sinun pitaa 
uhrata alttarilla: kaksi vuosikun- 
taista karitsaa aina joka paiva. 

39. Toisen karitsan pitaa sinun uh- 
raaman aamulla, ja toisen ilta-hama- 
rissa; 4 Moos. 28:3,4. 

40. ja ensimmaisen karitsan kanssa 
tulee sinun ottaa kymmenes osa efaa 
jauhoja, joitten seknan kaadetaan 
neljannes hinnia Oljya puserretuis- 
ta Oljypuun hedelmista seka ne^janr 
nes viinia juomauhriksi. 4 Moos. 28:&: 

41. Ja toisen karitsan pitaa sinun 
uhraaman ilta-hamarissd ; niinkuin 
aamullakin uhraa sen kanssa ruo- 
kauhri ja juomauhri Herralle otol- 
liseksi hajuksi ja tuliuhriksi. 

42. Tama olkoon jokapaivainen poll- 
touhrinne suvusta si)kuun seura- 
kunnan majan ovella Herran edessa, 
kussa mina ilmoitan itseni teille ja 
puhun sinulle. 

43. Sielia mina Israelin lapsille il- 
moitan itseni ; ja se paikka pyhite- 
taan minun kunniani kautta. 

2 Moos. 40:3488. 

44. Ja mina pyhitan todistuksen 
majan altlareinensa, ja pyhitan Aa- 
ronin poikinensa minulle papiksi. 

45. Ja mina asun Israelin lasten 
keskelia, ja olen heidan Jumalansa. 

3 Moos. 26:11 s. 2 Kor. 6:16. 

46. Ja heidan pitaa tietaman, etta 
Mina olen Herra, heidan Jumalan- 
sa, joka heidat johdatin Egyptin 
maafta asuakseni heidan keskelian- 
sa. Mina olen Herra, heidan Juma- 
lansa. 

30 Luku. 

M&&r&yk8et suitsutusalttarista, sovintora- 

hasta, pesoastiasta, voiteluSljystft, suit- 

Butuksesta. 

J a tee myOs suitsutusalttari suitsut- 
tamista varten; sittimipuusta si- 
nun se tekemdn pitaa. 2Moos. 37:25. 
2. Kyynara olkoon sen pituus, ja 
'kyynara leveys — nelikulmainen sen 
muoto— . ja kaksi kyynaraa sen kor- 



/- 



89 



2 MOOS. 30. 



heus; siilfl kftykMt my5s sen sarvet 
ulos. 

3. Ja tilaa se puhtaalla kullalla, 
sen laki Ja 8ein§t yltS ymp&ri, sekfl 
sen sarvet. Ja tee kultainen vanne 
sen ympfiri. 

4. Ja kaksi kultaista rengasta pitftft 
sinun tekemfin molempaln sivujen 
kahteen kulmaan vanteen alle, ettft 
korennot niihin pistettflisiin, Joilla 
se kannetaan. 

5. Tee myfis korennot sittimipuus- 
ta, ja silaa ne kuUalla. 

6. Ja aseta se esiripun eteen, Joka 
riippuu todistusarkln edessA, niin 
etta s6 seisoo armoistulmen edessd, 
joka on todistuksen pftfillft, jossa mi- 
nd ilmoitan itseni sinulle. 

7. Ja Aaronin pitfiS sen pflflUS polt- 
taman hyvAnhfOullista suitsutusta; 
joka aamu. kun hfin valmistaa lam- 
put, jpitfift n§nen suitsuttaman. 

8y Nlin .myfis pitftft Aaronin suit- 
suttaa, kun hfin ilta-hftmftrissfi sy- 
tyttSft lamput. Tftmfi suitsuttaminen 
olkoon jokapftivftinen utiri Herran 
edessft suvusta sukuun. 2Moo8.27:2i. 

9. Ei teidftn pfdfi yhtftfln muuka- 
laista sultsHtusta tekemftn sen pftfil- 
lft< ei polttouhrla. ei ruokauhria, ei- 
kft myOs Juomaunria uhraaman sen 
pftfilla. 8 Moos. 10:1 ss. 

10. Ja Aaronin pitftft sen sarvien 
pftftUA toimittaman sovinto kerran 
vuodessa; rikosuhrinverta pitftft hft- 
nen siilien pyyhkftisemftn kerran 
vuodessa sovinnoksi suvustasukuun* 
Se on kaikJcein pyliin Herralle. 

8 Moos. 16:1888. Hebr.9:7. 10:14. 

11. Ja Herra puhui Moosekseile, sa- 
noen: 

12. Kun lasketlsraelinlastenluvun, 
niin lieidftn pitftft tarlcastustilaisuu- 
dessa itsekunkin sielunsa edestft an- 
taman sovintolal^a Herralle, ettei 
heidftn pftftllensft loku rangaistus 
tulisi, kun he lueteliaan. 4 Moos. 1:288. 

13. Ja jokaisen pitftft, joka lukuun 
tulee, antaman puolen siklift, pyliftn 
siklin jftlkeen;-sikli pitftft kaksiKym- 
mentft geraa. Puoh siklift olkoon 
Herralle ylOnnysuhri. 2 Moos. 88:26. 
3 Moos. 27:23. 4Moos.8:47. 18:16. Hes.4&:12. 

14. Kaikki, jolka lukuun tulevat, 
kahdenkymmenen vuotiset la van- 
hemmat.antakoot sen Herralle ylfin- 
nvsuhriksi. 4 Moos. 1:3. 

15. Varallinen ftlkOOn antako enem- 
mftn eikft kfiyhftn vfthemmftn puol- 
la siklift Herralle ylOnnvsuhriksi tei- 
dftn sieluinne sovinnoKsi. 

16. Ja sinun pitftft sovintorahan ot- 
taman Israelin lapsilta ja antaman 
sen seurakunnan m^jan palveluk- 



seksi ; ia sen pitftft Israelin lapsille 
muisloksi oleman Herran eaessfi, 
ettft teidftn sielufine sovitettaisiin. 

17. Niin Herra taas puhui Moosek* 
selle, sanoen: 

18. Tee myOs vaskinen pesoasUa 
vaskijalan kanssa pesemistft varten, 
ja aseta se seurakunnan majan ja 
alttarin vaiheelle, ja pane siihen 
vettS, 2 Moos. 88:& 40:80 ss. 

19. ettft Aaron ja hftnen poikansa 
pesisivftt siitft kfitensft ja jalkansa. 

20. Kun he menevftt seurakunnan 
majaan, pitftft heidftn itsensft pese- 
mftn vedellft, ettei vfit kuolisi, taikka 
kun he Ifthestyvftt alltaria palvele- 
maan Herraa tuli-uhrilla. 

21. Ja heidftn pitftft pesemftn kftten- 
sft ja Jalkansa, ettei he kuolisi. Ja 
se pitftft heille oleman ijankaikki- 
seksi sftftnnfiksi, hftnelle ja hftnen 
siemenellensft suvusta sukuun. 

22. Ja Herra puhui Moosekselle, 
sanoen : 

23. Ota parhaita hyvftnhajuUisia ai- 
neita: kaikkein kalliimpaa mirha- 
mia viisisataa siklift. Ja pi^pli sen 
vertaa kanelia, kaksisataa ja viisi- 
kymmentft siklift. ja myfis hyvftnha- 
jullista kalmusta kaksisataa Ja vii- 
sikymmentft siklift, 2 Moos. 87:29. 

24. sekft vielft kassiata viisisataa 
siklift, pyhftn siklin painon Jftlkeen, 
ja O^ypuun OUyft ylcsi hin. 

25. Ja tee siita pyhft voiteluOljy, 
parhaalla taidolla tehty voide; se 
olkoon pyhft voiteluOijy. 

28. Sillft sinun pitftft voiteleman 
seurakunnan mi^an, niin myOs to- 
distusarkln, 2 Mooe. 40:0 ss. 

27. ja pOydftn kaikkine astioineen 
Ja kynttilajalan sen tarvekalulneen, 
nlin myfis suitsutusalttarin, 

28. polttouhrin-alttarin kaikkine sen 
tarvekalulneen, niin myOs pesoas- 
tian jalkoinensa. 

29. Ja sinun pitftft ne pyhittftmftn, 
la ne olkoot kaikkein pyhimmfit; 
kuka ikftnftnsft niihin tarttuu, se on 
pvhitetty. 

30. Aaronin ja hftnen poikansa pi- 
tftft sinun myOs voiteleman Ja pyhit- 
tftmftn heitft minulle paoiksi. 

31. Puhu myfis Israelin lapsille, sa- 
noen: tftmft OUy pitftft oleman tei- 
dftn puoleltanne minuUe pyhft voi- 
telus suvusta sukuun. 

32. Toisen ihmisen ruumiille • ei 
saa sitft vuodattaa, eikft teidftn pl- 
dft senkaltaista voidetta tekemftn. 
Sillft se on pyhft, Ja pyhftnft se pi- 
tftkftftt. 

83. Se joka tekee senkaltaista voi- 
detta, tahi Joka panee siitft muolui* 



90 



2 MOOS. 30. 31. 32. 



aisen p&AUe, se li&vitettftk6((n kan- 
sastansa. 

34. Ja Herra sanoi vielft Moosekselle: 
Ola byvfinhi^ulUsia aineita: simp- 
sukankuorta ja staktea, galbania, 
sekfi nftilten hi^uUisten aineitten 
kanssa puhdasta hi^upihkaa, yhtfl 
paljon kumpaakln, 

35. ja tee siitft siiitsutus» taidok- 
kaastt tehty,suolattu,puhdas ja pyhS. 

36. Ja survo se hienoksi , ja pane 
siitfi todistuksen eteen seurakun- 
nan majaan, jossa minfi ilmoitan 
itseni sinuUe. Se olkoon teiUe kaik- 
kein pyhin. 

37. Ja senkaltaista suitsvitusta Al- 
kaat itsellenne tehkO: mutta tftmfl 
olkoon sinulle pyhfi Herran edessA. 

38. Joka senkaltaista tekee nauti- 
lakseen sen hi^usta, se pitftft hftvi- 
tettAmAn kansastansa. 

31 Luku. 

Jnmala mftftrftA tyOntekiJftt Sabbattt- 
sftftntO teroitetaan. 

fa Herra puhui Moosekselle, sanoen: 
*' 2. Katso, minA olen kutsunut ni- 
meilAnsA Betsaleelln, Urin pojan, 
Hurin pojan-pojan, Juudan suvusta, 
2Moos.85a). 860. 88:22. Aik.2:20. 

3. ja olen tAyttAnyt hAnet Jumalan 
hengellA, viisaudella ja ymmArryk- 
sellA, tiedoUa ja kaikJdnaisella tai- 
doUa, 

4. taideteoksia keksimAAn, ja nlitA 
valmistamaan kullasta, hoplasta ja 
vaskesta, 

5. taidokkaasti kaivertamaan ja 
asetlamaan kivet, la taitavasti teke- 
masn uuusta kaikkinaista tyOtA. 

6. Ja katso, minA olen antaniit hA- 
nelle avuksi Oholiabin, Ahisamakin 
pojan, Danin suvusta, ja olen anta- 
nut kaikiUe teidAn taitaville mie- 
hille viisautta sydAmmeen. NAmA 
osaavat tehdA kaikki, mitA minA 
olen sinulle kAskenyt: 

7. seorakunnan migan ja lilton ar- 
kin, ja annoistuimen, joka sen pAAl- 
U on, ja kaikki mi^an 9stiat, 

2 H008. 35:1188. 89:3388. 

3. pAydAn ja sen astiat, ja kultai- 
sen kynttuajalan ynnA kaikki sen 
tarvekalut, ja suitsutusalttarin, 

1 polttouhri-alltarin ja kaikki sen 
tarvekalut, Ja pesoastian jalkoi- 
neosa, 

10. ja virkavaatteet, papin Aaronin 
pyhAt vaatteet, ja hAnen poikainsa 
virkavaatteet, 

11. voiteluOUyn ja suitsutuksen hy- 
yftnhi^uisista aineista pyhAkkOOn. 
Heidftn tulee kaikki nAmA tehdA 



sen mukaan kuin minA olen sinulle 
kAskenyt. 

12. Ja Herra puhui Moosekselle, sa* 
noen: 

13. Puhu Israelin lapsiUe, sanoen * 
teidAn pitftA pitAmAn minun sab- 
battini; sillA se on merkki minun ja 
teidAn vAlillAnne suvusta sukuun, 
ettA te tietAisitte minun olevan Her- 
ran, joka teitA pyhitAn. 1 Moos. 2:2. 

2M0O8. 20:888. Hes. 20:12. 

14. SentAhden pit AkAAtsabbatti; Sil- 
lA se on teille pyhA. Joka sen rik- 
koo, hAnen pitAA totisi^ti kuoleman; 
sillA kuka ikAnAnsA silloin tyOtA te- 
kee, sen sielu pitAA hAvitettAmAn 
kansastansa. 4 Moos. 16-32 ss. 

Matt 12:1 88. 

15. Kuusi pAivAA pitAA tyfitA teh- 
tAmAn, mutta seitsemAntenA pAivA- 
nA on sabbatin lepo, Herran pyhA- 
pAivA. Kuka IkAnAnsA tydtA tekee 
sabbatin pAivAnA, hAnen pitAA toti- 
sesti kuoleman. 2 Moos. 23:12. 

16. SentAhden pitAk6((t Israelin lap- 
set sabbattia, ettA he sen pyhittAisi- 
vAt suvusta sukuun ijankaikkiseksi 
liitoksi. 

17. Se on ijankaikkinen merkki ole- 
va minun ja Israelin lasten vAlillA; 
sillA kuutena pAivAnA teki Herra tai- 
vaan ja maan, mutta seitsemAntenA 
pAivAnA hAn lepAsi ja virvoitti it- 
sensA. 

18. Ja sittekuin Herra oli lopetta-, 
nut puheensa Mooseksen kanssa Si- 
nain vuorella, antoi hAn hAnelle' 
kaksi todistuksen taulua, jotka oli- 
vat kivestA ja joihin oil Jumala 
sormellaan kiijolttanut. 

2 Moos. 32:16. 5Moo8. i:13. 9:10. 

32 Luku. 

Kultalnen vasikka. Jumalan viha ja 
Mooseksen esirukous. Kansan rangaistus. 

Mutta kun kansa n^ki, ettA Moo- 
ses viipyi tulemasta ailas vuorel- 
ta, niin he kokoontuivat Akronin 
luo, ja sanoivat hAnelle : ,.nouse, tee 
meille jumala, joka meidAn edel- 
lAmme kAvisi ; sillA emme tiedA, mi- 
tA tAlIe Moosekselle on tapahtunut, 
joka meidAt Egyptin maalta joh- 
datti." Ps. 106:19. Ap.t7:40. 

2. Niin sanoi Aaron heille: „otta- 
kaat ne kultaiset korvarenkaat, jot- 
ka ovat teidAn vaimojenne, poikain- 
ne ja ty tArtenne korvissa, ja tuokaat 
ne minulle.'* 

8. Niin kaikki kansa riisul ne kul- 
taiset korvarenkaat, jotka oHvat hei- 
dAn korvissansa, ja toivat ne Aaix)- 
nille. 



91 



2 MOOS. 32. 



4. Ja hfln otti ne heidftn kftdeslSn- 
sfi, Ja muodosti sen taltalla, ja teki 
siila valetun vasikan. Ja he sanoi- 
vat: „tfimfi.on sinun jumalasi, Is- 
rael, Joka sinun Egyptin maalta joh- 
dalti ulos." 

6. Kun Aaron sen n§ki, rakensi 
hftn alltarin heidfin eteensfl, ja Aa- 
ron antoijulistaa,sanoeD: „huomen- 
na on Herran juhlapftivfl V 

6. Ja toisena pfiivfinft nousivat he 
varhain aamulia, Ja iihrasivat polt- 
touhria, ja kantoivat edes kiitosuh- 
ria. Ja kansa istui syOmflfin ja Juo- 
maan, ja sei^filkeen be nousivat hu- 
vitteleimaan. iKor. 10:7. 

7. SiUoin Herra puhui Moosekselle : 
„mene, astu alas; sillfi sinun kan- 
sasi, jonka sinfi Egyptin maalta joh- 
datit^ulos, on tehnyt pahoin. 

6 Moos. 9:12 B8. 

8. He ovat jo poikenneet pois siltfi 
tieltfl, jonka minfl heille kaskin. He 
tekivftt itsellensft valetun vasikan, 
ia kumarsivat sitfi, ja uhrasivat sil- 
le, ja sanoivat: ,tftmil on sinun ju- 
malasi, Israel, joka sinun Egyptin 
maalta lohdatti ulos.*' 

9. Ja Herra sanoi vielfi Mooseksel- 
le: „minfl nfien, ettfi tfimfi kansa 
on uppiniskainen kansa. 2Mooe. sss. 

10. Sentfihden anna nyt minun vi- 
hani syttyft heihin, niin ettfi minfl 
hukutan heidflt; ja minfi teen'sitten 
sinut suureksi kansaksi.** 

11. Mutta Mooses rukoili hartaasti 
Herran, Jumalansa edessfi, ia tonoi: 
„Herra, miksl sinun vihasl syttyisi 
sinun kansaasl, jonka Egyptin maal- 
ta johdatit ulos niin suurella voi- 
malla ja vfikevflllfi kfidellfl? 

6 Moos. 9:26 88. Pb. 106:23. 

12. PitfiisikO Egyptilfiislen puhu- 
man ja sanoman : ,neidfin vahingok- 
sensa hfln heidfit Johdatti ulos, tap 
paaksensa heitfi vuorilla, ja hfivit- 
tfifiksensfi heidfit maan pflfiltfi?' 
Kfifinny pois sinun vihast nirmui- 
suudesta, ja kadu sitfi pahaa, jota 
aiot sinun Kansaasi vastaan. 

4 Moos. 14:1688, Pb.86:4. 

13. Muista sinun palvelijoltasi Ab- 
rahamia, Isaakia ja Israelia, joille 
sinfi itse kauttasi vannoil ja sanoi t : 
,minfi enennfin teidfin siemenenne 
niinkuin taivaafl tfihdet, ja koko tfi- 
mfin maan, josta minfi sanoin, an- 
nan teidfin siemenellenne,ia heidfin 
pitftfi sen perimfin ijankaikkisesti.** 

1M<^B.12:7. 15:6. 22:16 e. 28:18. 48:16. 

Hebr. 6:138. 

14. Silloin Herra katui sitfi pahaa, 
Jonka hfin uhkasi tehdfi kansallensa. 

15. Ja Mooses kfifiosi Itsensfi Ja as- 



tui alas vuorelta, ia hftnen kfides- 
sSnsfi oli kaksi todistuksen taalua. 
Ja taulut olivat kiijoitetut molem- 
min puolin. 2 Moos. 34:29. 

16. Ja taulut olivat Jumalan tekoa; 
la kiijoitus siinfi oli myfis Jumalan 
kirjoitus, piirretty tauluihin. 

-- „ , • - .r*2Moo8. 81:18. 

17. Kun Josua kuull kansan huu- 
don, sanoi hfin Moosekselle: „sota- 
huutoja kuuluu leiristfiT* 

18. Mutta hfin vastasi: „ei se ole 
voittajien, eikfi voitettujen huuloa; 
minfi kuulen laulajaln fifinen.** 

19. Ja kun hfin Ifihestyi leirifi, nftki 
hfin vasikan ja hypyn. Silloin Moo- 
seksen viha syttyi, ja hfin h^itti pois 
kfisistfinsfi taulut, ja lOi ne rikki 
vuoren juurella. 6Moo8.9:i7. 

20. Sitten hfin otti vasikan, jonka 
he tehneet olivat, ja poltti tulessa, 
ia musersi sen aivan tuhkaksi; sen 
hfin sitten hajoitti veteen, ja antoi 
Israelin lasten Juoda. 6Moo8.9:2i. 

21. Ja Mooses sanoi Aaronille: „mi- 
tfi tfimfi kansa on sinuUe tehnyt, ettfi 
niin suuren rikoksen saatoit heidfin 
pfifillensfi?'* 

22. Aaron vastasi : „filkOOn herrani 
viha syttykO; sinfi tiedfit itse, ettfi 
tfimfi kansa on paha. 

23. He sanoivat minuUe: ,tee meille 

iumala, joka meidfin edellfimme 
[fivisi: sillfi emme tiedfi, mi tfi tfille 
Moosekselle on tapahtunut, jokamei- 
dfit Egvptin maalta johdatti.' 

24. sriloin minfi sanoin heille: Jol- 
la on kultaa, riisukoon sen pfifiltfin- 
sfi;* Ja he antoivat sen minulle. Ja 
minfi heitin sen tuleen, ja siitfi lull 
tfimfi vasikka.** 

25. Kun Mooses nfikl, ettfi kansa 
oil raivoissansa, sillfi Aaron oli hei- 
dfin in tohimonsa pfifistfinyt valloil- 
leen iloksi heidfin vihollisillensa, 

26. niin hfin aslui leirin porttiin, 
ja sanoi: ,Joka on Herran oma, se 
tulkoon minun tykOnil** Silloin ko« 
koontuivat hfinen tykOnsfi kaikki 
Levin poji^t. 

27. Ja hfin sanoi heille: „nfiin sa- 
noo Herra, Israelin J umala:Jokai- 
nen sitokoon miekan kupeillensa, ja 
vaeltakaat leirin Ifipi toisesta por* 
tista toiseen edes takaisin ja lyOkfifit 
kuoliaaksi kenen kohtaatte, oli se 
vaikka veli, ystfivfi tahi naapuri.*' 

6 Moos. 83:9. 

28. Niin Levin pojat tekivfit niin- 
kuin Mooses kfiski ; ja sinfi pfiivfinft 
kaatui kansasta liki kolmetuhatta 
miestfi. 

29. Ja Mooses sanoi: „pyhittfikfifit 
tfinfipfinfi teidfin kfitenne Herralle, 



92 



2 MOOS. 32. 83. 



itsekukin pojassansa ja veUessfinsft, 
etta hftn tftnfipftnft antaisi teille siu- 
nauksen/* 

30. Toisena pfiivfinA sanoi Mooses 
kansalle: „te olette tehneet suuren 
synnin; ja nyt minfi astun ylOs Her- 
ran tykO, jos mipfi kenties voisin 
soviltaa teidMn rikoksenne/* 

31. Niin Moose$ pala$i jfllleen Her- 
rantykfija sanoi: „minft rukoilen ; 
tftmfi kansa teki suuren synnin, ja 
he tekivAt itsellensA kultaisen juma- 
lan. 6M008.02S. 

32. Hutta anna njrt heidfin rikok- 
sensa anteeksi ; vaan jollei, niin pyy- 
hi minuf pois sinun Idijastasi, jon- 
ka kiijoittanut olet** Ps. e»29. 

Boom. 9:3. 

33. Mutta Herra sanoi Moosekselle : 
,Joka minua vastaan syntiA tekee, 
sen minA pyyhin pois minun Idr- 
jaslani. 

34. Niin mene nyt, ja jotidata kan- 
sa sinne, josta olen siriulle puhu- 
not; Itatso, minun enkelini kAy si- 
nun edellAsL Mutta minun etsikko- 
pAivAnAni kostan noinA heidAn ri- 
koksensa.** 2 Moos. 28:30. 

35. NAin rankaisi Herra kansaa sen- 
tAhden, ettA he olivat tehneet vasi- 
kan, sen, jonka Aaron teki. 

33 Luku. 

Kansan murhe. Mooses silrtftft majan. 

Heixa pobattelee hftntft, ja hftn tahtoo 

nfthdft Jumalan kuimian. 

fa Herra puhui Moosekselle: „lAh- 
^ de tAAltA, sinA ja kansa, jonka 
johdatit Egyptin maalta, sille maal- 
le, josta minarvannoin Abrahamille, 
Isaakiile ja Jaakobille, scnoen: ,si- 
nun siemenelles minA sen annan.* 

1 Moos. 12:7. 

2. MinA lAhetAn sinun edellAsi eh- 
kelin, ja ajan pois Kananealaiset, 
Amorilaiset. HetUAiset. FeresilAiset, 
HeyilAiset, Ja Jebusilaiset, 

2M008. 28:20. 82:34. 

3. ettA tulisit siihen maahan, jossa 
rieskaa ja hunajata vuotaa. SillA 
luMka sinA olet uppiniskainen kan- 
sa, niin en minA mene sinun kans- 
sad, etten sinua joskus tiellA hu- 
kuttaisl.*' 

4. Kun kansa kuuli tAmAn ankaran 
puheen, tulivat he surulliseksi, eikA 
ylcsikAAn pukenut koristuksiaan yl- 
lensA. 

5. Ja Herra sanoi Moosekselle: ,«sa- 
no Iiraelin lapsille : ,te olette uppi- 
niskainen kansa. Jos minA silmAn- 
npiyicsenkin kuljen sinun kanssasi, 
oiiD hukutan sinut; riisu siis nyt 



koristuksesi pAAltAsi, ettA minA tie- 
tAisin, mitA minA sinulle tekisin.** 

2 Moos. 82 A 6 Moos. 9:18. 

6. Niin riisuivat Israelin lapset ko- 
ristulcsensa Horebin vuoren luona. 

7. Mutta Mooses otti majan ja pys- 
tytti sen kauas leiristA, ja kutsui sen 
seurakunnan majalcsi ; j^ kuka ikA- 
nAnsA tahtoi kysyA Herralta, hAnen 
piti menemAn seurakunnan m^jalle, 
joka oli ulkona leiristA. 

8. Ja milloin Mooses meni mi^aan 
pAin, nousi kansa, ja itsekukin aset- 
tui majansa ovelle, ja katseli Moo- 
seksen jAlkeen siihen asti, ettA hAn 
meni majaan. 

9. Ja kun Mooses astui majaan, tuli 
pilven patsas alas, ja seisoi ma- 
jan ovella; ja HAn puhutteli Moo- 
sesta. 

10. Ja kun kansa nAki pilven pat- 
saan seisovan majan oven ed^jsA, 
niin he lankesivat kasvoilleen maa- 
han ja rukoilivat majansa ovella. 

11. Ja Herra puhutteli Mooses ta 
kasvoista kasvoihin , niinkuin jolni 
ystAvAtAnsA puhuttelee. Sitten hAn 
palasi leiriin; mutta hAnen paiveli- 
jansa, Josua, Nunin poika, nuoru- 
kainen, ei lAhtenyt mi^asta. 

4M006.12it. 

12. Ja Mooses sanoi Herralle : „katso, 
sinA sanoit minuUe. Johdata tAmA 
kansa,* etlcA sinA ilmoittanut minul- 
le,kenenkAsinA lAhetAt minun kans- 
sani; ja kuitenkin sinA sanoit mi- 
nulle: ,minA tunnen sinun nimel- 
tAsi, ja sinA olet myOs armon lOytA- 
nyt minun edessAni.' 

13. Jos minA siis olen armon lOy- 
tAnyt sinun edessAsi, niin osoita nyt 
minulle sinuki tiesi, ettA minA sinun 
tuntisin ja lOytAisin armon sinun 
edessAsi: ja muista kuitenkin, ettA 
tAmA vAki on sinun Icansasi.** 

2M008.19:6. P8.108.-7. 

14. Niin HAn sanoi: „minun kas- 
voni kAv sinun edellAsi, ja minA 
annan sinulle levon.** 5Moo8.4S7. 

15. Ja hAn sanoi HAnelle: ,Jollei si- 
nun kasvosi kAy edellA, niin AlA 
vie meitA tAstA pois. 

16. Ja mistA tassA tiedetAAn, ettA 
minA ja sinun kansasi olemme Ifiy- 
tAneet armon sinun edessAsi? £ik6 
siitA, ettA sinA vaellat meidAn kans- 
samme?niin ettAiheeroitetaan, minA 
ja sinun kansasi, kaikista kansoista, 
jotka ovat maan piirin pAAllA.** 

17. Ja Herra vastasi Moosekselle; 
„my6skin tAmAn, jota olet pvytAnyt, 
teen minA; sillA sinA olet lOytAnyt 
armon minun edessAni. ja minA 
tunnen sinun nimeltAsi.** 



93 



2 MOOS. 83. 34. 



18. Mutta hftn sanoi : ,,aniui mioun 
siis nfihdfl sinun kunniasi.** 

19. Ja Hftn vastasi: „miiift annan 
kaikki mimin hyvyyteni kflvdft si- 
nun edellftsi, la tahaon itse julistaa 
Herran nimea sinun edessflsi. Ja 
minft armatidan, ketfi minft tahdon 
armahtaa, ja olen laupias, jolle mi- 
nft tahdon laupias oUa. 2Mooe.34:5s8. 

Boom. 9:16. 

20. JaHftn sanoi vielft: .,etsinfttaida 
nfllidfi minun kasvojani; silift ei yk- 
sikftftn ihminen, joka minun nftkee, 
taida elftft/* 

21. Senjftlkeen sanoi Herra: ,,katso, 
tftssft on sijaa minun luonani ; siellft 
seiso sinft kalliolla. 

22. Kun nyt minun kunniani vael- 
taa oliitse^ annan minft sinun sei- 
soa kaliion rotkossa, ja minft peitftn 
sinut minun kftdellfini siksi kuin 
olen ohit$.e vaeltanut. 

23. Sitten kun minft otanpois minun 
kftteni, saat sinft nfthdft minuttalcaa: 
vaan minun kasvojani el kukaan vol 
nfthdft.** 

34 Luka. 

Uudet taolut Wuotiset Joblat Liitto uti- 
distetaao. Hooseksen kasvojen paiste. 

J a Herra spnoi Moosekselle : „vuole 
itsellesi kaksi Idvistft tauluii, entis- 
ten kallaista ; ja minft kiijoitan nii- 
hin tauluihin ne sanat, jotka ensim- 
mftisissft tauluissa olivat, jotka lOft 
rikki. 6 Moos. 10:1 ss. 

2. Ole siis huomenna valmis, ja 
aslu varhainSinain vuorelleja seiso 
siellft minun edessftni vuoren kukku- 
lalla. 

3. Vaan ftik60n yksikftftn astuko 
ylOs sinun kanssasi, ftlkfiOn myOs 
yksikftftn koko siUft vuorellanftkykO; 
alkfiOn myOskftftn lampaita tahi kar- 
jaa kftykO laitumella sen vuoren 
kohdalla.** 

4. Ja Mooses teki kaksi kivistft tau- 
lua, entisten Icaltaista. Ja seuraavana 
aamuna varhain hftn astui yl5s Si- 
nain vuoreile,niinkuin Herra oli hft- 
nen kftskenyt, ja kantoi ne kaksi 
kivistft taulua kftdessftnsfi. 

5. Silloin Herra aslui alas pilvessft, 
la seisoi hftneh kanssansa siellft. ja 
julisti Herran nimen. 2 Moos. 83:10. 

6. Ja Herra vaeisi Hftnenkasvojensa 
edessftf ja huusi: „Herra, -Herra! — 
Jumala, laupias ja armollinen, ia 
pitkftmielinen ja suuri armossa ja 
usifoilisuudessa, 4Hoos. I4a8. 
Neb. /a? 88. P8.86.1M08-.8. 145:& Joel 2:13. 

Jon. 4:2. 
.7. joka pitftft laupiuden tuhanteen 
saakkaja antaaanteeksi vAftryyden, 



.ylltsekftymisen jasynnin; jonka edes- 
sflei yksikftftn ole viaton, joka etsii 
isftiu vftftryyden lapsissa ja las- 
tenlapsissa kolmanteen ja neljftn- 
teen polveen asti.** 3Moo8.20£8s. 

6 Moos. 6:9. 7.'088. 24d6. Job. 9:2. 
P8.1432. Jer. 82:1888. Neh. 1:3. 

8. Silloin Mooses kilreesti lankesi 
maahan kasvoilleen rukoillen. 

9. Ja hftn sanoi : ,,Herra, jos minft 
olen saanut armon sinun edessftsi, 
niin kftykOOn Herra meidftn kans- 
samme.Tftmft tosin on uppiniskainen 
kansa; mutta sinfthan tahdot antaa 
anteeksi vftftryytemme ia syntimme 
ja omistaa meidfit itsellesi perimi- 
seksi.** 

10. Niin Hftn vastasi: .,katso, minft 
teenliitonkaiken sinun kansasi edes- 
sft, ja minft myOs teen Ihmeellisift 
tekoja, joidenka kaltaisia ei ikftnftn- 
sft ennen tehty ole missftftn maassa, 
•eikft missftftn kansassa. Ja kaiken 
kansan, joidenkeskellft sinft olet, pi- 
tftft nftkemftn, ettft Herran tyOt ovat 
ihmeelliset, joita minft teen sinun 
kanssasi. " 5 Moos. 6:2. 

11. Pidft ne kftskyt, jotka minft si- 
nulle tftnftpftnft annan. Katso, minft 
ajan ulos sinun edestftsi Amorilai- 
set, Kananealaiset, Hetilftiset, Feresi- 
Iftiset, Hevilftiset, ja Jebusilaiset. 

12. Varo tekemftstft liittoa sen maan 
asuvaisten kanssa, johonka tulet, 
etteivftt ne olisi paulaksi teidftn kes- 
kellftnne; 2. Moos. 23:32 ss. 6Moo8.72ss. 

13. vaan heidftn alttarinsa pitftft tei« 
dftn kukistaman, ja heidftn Kuvansa 
rikkoman, ja heidftn metsistOnsft 
maahan lyfimftn. 

14. Silift ei sinun pidft rukoileman 
muita jumalia ; silift Herran nimi 
on kiivoittelija, ja Hftn on kiivas Ju* 
mala. 

15. Alft tee mitftftn liittoa sen maan 
asuvaisten kanssa ; silift kun he hau- 
ristelevat jumaliensa kanssa ja uh- 
raavat jumalillensa , ' niin kutsuvat 
he sinun, ettft sfiisit heidftn uhris- 
tansa. 

16. ja ottaisit heidftn tyttftristftnsft 
sinun pojillesi vaimoja: ja nftmft 
hauristelevat heidftn jumaliensa 
kanssa, ja saattavat sinun poikasi 
myOs heidftn jumaliensa Kanssa 
hauristeiemaan. • 4 Mooe. 26d b. 

Tuom.8:6. 1 Kun. 11:2. 

17. Alft tee itsellesi valetuita juma- 
lia. 2 Moos. 20:428. 8 Moos. 19:4. 

18. Happamattoman leivftn juhlaa 
tulee sinun pitftft. Seitsemftn pftivfift 
pitftft sinun happamatonta leipfift 
syOmftn, niinkuin minft sinulle kfts* 
kenyt olen, mftftrfttyllfl i^alla Abib 



94 



2 MOOS. 34. 85 



kuussa; sillft sinftoletlfthfenytEgyp- 
tistft Abib kuHssa. 3 Moos. 12:16^2305. 

5Mooe.l6U8«. 

19. Kaikki, jotka ensin avaavat fti- 
tinsfi kohdun. ovat minun, myfiskin 
kaikki hfirkyiset kaijasta ja oinaat 
lampaista, jotka esikoiset ovat. 
2MooB.19:2|128B. 222988. 4 Moo8. 18:1688. 

Lank. 2:23. 

20. Mutta aasin esikoisen pitfift si- 
nun lunastaman lampaalla; Jos et 
sinit lunasta, niin vftfinnft hflnen nis- 
kansa poikki Jokaisen esikoisen si- 
nun pojistasi pitfift sinun lunasta- 
man, la filkMn ykslkfifin ty^in kft- 
sin tulko minun eteeni. 5Moob.16:16. 

871.86:6. 

21. Kuusi pfiivfifi pitfifi. sinun tyOtfi 
tekemfin, ja seitsemfintenfi' pfilvfinft 
pitfift sinun lepftftmfin ; sekft pellon 
kyntftmisesta ettft nilttftmisestft pitftft 
sinun lepftftmfin. 2M008. 23:12. 81:16.86:2. 

6MooBk6:1288. Lnnk. 18:14 88. 

22. Viikkojuhlaa sinun tulee pitfift 
eosimmftisestft nisun-elon uutisesta; 
samoin koijaamisen juhlaa vuoden 
lopulla. 

S. Kolmasti vuodessa pitfift kaikki 
niiehenpuolesi nftkvmftn kaikkival- 
tiaan Herran,lsraelln Jumalan edes- 
SL 2 M006. 23:17. 6 M008. 16:16. 

2i Sillft 'Minft ^an ulos pakanat 
sinun edestftsi. jalevitftn sinun maa- 
si fifiret; ja ei pidfi yhdenkfifin hi- 
moitseman sinun maatasi, kun sinfi 
menet ylOs nfiyttfimfifin itsesi Her- 
ndle. smun Jumalallesi, kolmasti 
vuodessa. 

25. Alfi uhraa minun uhrini verta 
happamen leivfin kanssa yhdessfi. 
Japfifisifiisjuhlan uhrista filkew^n mi- 
tSfin jfiSkd y6n ylitse huomeneksi. 

2Moo8.12:10. 23:18. 6 Moos. 16:4. 

26. Maasi kasvon ensimmfiiset uu- 
Uset pitfifi sinun tuoman Herrasi, 
tinun Jumalasi huoneesen. — Alfi 
keilfi vohlaa emfinsfi rieskassa." 

2 Moos. 23:19. 6 Moos. 14:21. 

27. Ja Heira saiioi Moosekselle: 
«,kirioita mulstiin nfimfi sanat; sillfi 
nSiden sanain mukaan olen minfi 
liiton tehny t sinun ja Israelin kans- 
sa.'' 2 Moos. 24:4. 

28. Ja hfin vilpyi siellfi Herran ty- 
kfinfi neljfikvmmentfi pfiivftft ja nel- 
jflkymmenta ydtft, ja ei syfinyt lei- 
M, eikfi juonut vettfi. Ja hfin kir- 
Joittl tauluihin liiton sanat, ne kym- 
menen sanaa. 2 Moos. 24:18. 

6M0OS. 4:18. 9:9,18. 

29. Kun Moose^ astui Sinain vuo- 
rdta alas, oil hfinellfi kaksi, lodistus- 
tauJua kfidessAnsfi, astuissansa alas 
vuoreJta; eikA Mooses tietfinyt, ettfi 



hfinen kasvonsa iho paistoi siitfi, 
ettfi Herra oil puhutellut hfintfi. 

2Kor.8:7. 
SOi Ja kun Aaron la kaikki Israe- 
lin lapset nfikivfit hfinen kasvonsa 
ihon paistavan, pelkfisivfit he hfintfi 
Ifih^^ft. 

31. Mutta Mooses kutsui heitfi, ja 
he kfifin^vfit hfinen puoleensa, sekfi 
Aaron ettft kaikki yUmmftiset kan- 
san seasta; ja Mooses puhutteli heitft. 

32. Senjftlkeenlfthestyivftt kaikki Is- 

ra:elin. lapset hftntft, la hftn kftski 

heiUip kaikki ne, mitfi Henra oil 

liftnelle llmoittanut Sinain vuorella. 

33. Jakun Mooses oil pfifittfinyt pu- 
heensa heidfin kanssansa, pan! hfin 
peitteen kasvoiensa eteen. 2Kor.8:i8. 

34. Mutta milloin hfin^istui Herran 
eteen puhuttelemaah Hfintfi, pani 
hfin peitteen pois siksi kuln hfinlfilfr 
si jfilieen ulos. Ja kun hfin tuli ulos, 
ilmoitti.hfin aina Israelin lapsille, 
mitfi hftnelle kSsketty oli. 

35. Silloin nftkivftt Israelin lapset 
joka kerta. kuinka hftnen kasvoien- 
sa iho paistoi. ja hftn veil jftlleen 
peitteen kasvbjensapftftlle, siksi kuin 
hftn uudelleen men! piAiuttelemaan 
Hftntft. 

35 Luku. 

KSsky sabbatin levosta. Majan ylOnnysutiri 
]a rakentajat. 

J a Mooses kokosi koko Israelin las- 
ten seurakunnan, ja sanoi heille: 
„nftmft ovat ne, iota Herra on kfls- 
kenyt teidftn tendft: 

2. Kuusi pftivftft pitftft tyOtft tehtfi- 
mfin, mutta seitsemfis pfiivfi on ole- 
va teille pyhfi, Herran sabbatin le- 
po. Kuka ikfinfinsfi silloin tyOtfi te- 
kee, sen pitfifi kuoleman. 

2 Moos. 20:988. 23:12,31:15. 

3. Alkfifit sabbatin pfiivfinfisytyttfikO 
tulta asunnoissanne, missfi asunette- 
kaan." , 

. 4. Ja Mooses sanoi kail/elle Israelin 
iasten seurakunnalle : „tfimfi on se, 
jota Herra on kfiskenvt, sanoen : 

5. Kootkaat keskuuaessanne yl5n- 
nysuhria Herralle: jokainen, jolla 
hyvfintahtoinen sydfin on, tuokoon 
yfohnysuhrin Herralle: kultaa, ho- 
piata Ja vaskea, 2 Moos. 26:2 ss. 

6. sinisifi, purpuraisia, ja tulipunai- 
sia villoja, kJallista liinaa'ja vuohen 
karvoja, 

7. puhalla painetuita oinaan nah- 
koja, ja hylkeen-nahkoja, ja sittimi- 
puila, 

8. Oljyfi lamppuihin, jahyvfinhajui- 
sia aineita voiteluOljyyn ja hyvfifin 
suitsutukseen, 



95 



2 MOOS. 35. 36. 



9. onikin kivifljakivi§omineltavik- 
si olkavaalteeseen ja rinlakilpeen. 

10. Ja kaikkl tailaval miehet teiddn 
seassanne tulkoot ja tehk60t kaikki, 
ixiitfi Herra kdskenyt on: 

11. majan vaatteinensa, peitteinen* 
sfif renkainensa. lautoinensa, koren- 
toinensa, patsainensa ja jalkoinensa, 

2M008. 31:788. 89:8388. 

12. arkin korentoinensa, armois- 
(uiraen ja esiripun, ' 

13. pOydSn korentoinensa sekfi kaik- 
ki sen kapineet ja katsomusleivSt, 

14. kynttilSialan tarpeinensa ja 
lamppuinensa , ja OljyS kynttil^al- 
kaa varten, 

15. ja suitsutusalttarin korentoinen- 
sa, voiteluOUyn ja hyvfinhajuisia 
aineita siiitsutukseen, ja vaatleen 
migan oven eteen, 2Moo8.S0:i. 

16. polttoulirin-alltarin vaskihSkin 
kanssa, korennot ja kai^jiki sen as- 
tiat, pesoaslian jalkoinensa, 

2M6o8.27:1. 

17. pihan kangasaidan patsainensa 
ja jalkoinensa, niin myos kankaan 
pilian kdytfivfin eteen, 

18. majan ja pihan vaamat kOysi- 
nehsfi, 

19. virkavaatteCi palvelusta varten 
pyh5kOssfi, ja papin Aaronin pyhfil 
vaatteet sekd hanen poikainsapapil- 
lis^t vaatteet.'' 

20. Silloin Ifiksi Israelin lasten seu- 
rakunta pois Mooseksen luota. 

21. Sitten tuHvat he takaisin, jo- 
kainen, jonka sydfin siihen kehoit- 
ti; ja jokainenjolla oil ante! as hen- 
ki, toi ylOnnysuhrin Herra le sen- 
rakunnan mman tarpeeksi, ja kaik- 
keen sen palvelukseen Ja pyhlin vaat- 
teisin. 

22. He tulivat sekfi miehet ettfi nai- 
set, kaikki, joilla oli antelias sydSn, 
ja toivat rannerenkaita, korvarenkai- 
ta, sormuksia ia solkia, ja kaikki- 
naisia kultaisiakalleuksia; jokainen 
toi minkfi lahjan kullassa hfin voi 
Herralle uhrata. 

23. Ja jokainen, jolla oli sinisifi, 

i>urpuraisia ja tulipunaisia villoja, 
a kallista liinaa, ja vuohen karvo- 
a, punalla painetuita oinaan nah- 
Lofa, ja hyllceen nahkoja, toi niitfi. 

24. Jokainen, jolla oli hopiata ja 
vaskea lahjoiltaa, hfin toi sen ylfin- 
nvsuhriksiHerralle.Ja jokainen Jolla 
oli sittimipuuta monellaisten tfiitten 
valmistamista varten, toi sitfi. 

25. Ja kaikki taitavat naiset kehrfi- 
sivflt kfisillfinsfi ja toivat kehr&yk- 
sensS sinisislfi. purpuraisista ja tuli- 
punaisista villoista, ja valkoisesta 
kalliisla liinasta. 



26. Ja ne naiset, jotka senkaltaisia 
tOitfl taisivat, ja joiden sydfin siihen 
kehoitti, kehrfisivfit vuohen karvoja. 

27. Mutta pfifimiehet toivat onikin 
kivifi , ja olkavaatteesen ja rintakil- 
peen ommellavia kivifi, 

28. la hyvfinhajuUisia yrttejfi ia Al- 
jyfi kyhttilfijalkaa varten ja voltelu- 
Oljyksi sekfi hyvfinhajuiselisi suit- 
sutukseksi. 2 Moos. 80:2388. 

29. Ja niin Israelin lapset toivat 
hyvfillfi mielellfi, sekfi miehet ettfi 
naiset, kaikkinaiseen tarpeeseen, 
niinkuin Herra Moosekselle oli kfis- 
keiiyt, ettfi tehtfimfin piti. 

30. Ja Mooses sanoi Israelin lapsil* 
le: „katsokaat, Herra on nimeltfi 
kutsunut Betsaleelin, Urin pojan, 
HDrin pojanpojan, Juudan suvusta, 

2 Moos; 81:288. 

31. ja on tfivttfinyt hfinen Jumalan 
hengellfi, taiaolla, ymmfirrvlcsenfi ja 
tiedolla kaikkinaiseen tyOnOn, 

32. sekfi keksimSfin taiaeteoksta et- 
tfi tvOskehtelemfifih kullassa, hopias- 
sa ja vaskessa, 

33. kaivertamaan livifi vaatteesen 
ommeltaviksisekfileikkaamaanpuu- 
hun, ja ylimaikain valmistamaan 
kaikelfaisfa taideteolcsia. 

34. Ja Hfin on antanut sekfi hfinelle 
ettfi Oholiabille, Ahisaniakin pojal- 
le, Danin suvusta, taidon opettaa 
muila. 2 Moos. 81:6. 

35. Hfin on tfiyttfinyt heidfinsydfim- 
mensfi taidolla tekemfifin kaikellaista 
veistotyOtfi sekfi kutomaan ja neu* 
lomaan sinistfi, purpuraista, ja tu- 
lipunaisia kangastajavalkoista kal- 
lista liinaa , niin ettfi he tekevfit ja 
keksivfit kaikkinaisia taitavasti. 

36 Luku. 

TodiBtnksen majan erl osat Talmistetaan. 

Niin Betsaleel ja Oholiab tekivfit 
tyOtfi, ja jokainen taitava mies, 
joille Herra oli antanut taidon ja 
ymmfirryksen tekemfifin kaikki ty6t 
pyhfikfin rakehnuksessa ; he tekivfit 
kaikki sen mukaan kuin Herra oli 
kfiskenyt. 2Moo8.8i:2. 

2. Ja Mooses kutsui Betsaleelin ja 
Oholiabin,ja kaikki taitavat miehet, 
joiden sydfimmeen Herra oli taidon 
antanut, kaikki, jotka mielellfinsfi 
tnrjoutuivat tyfitfi tekemfifin. 

3. Ja he ottivat Moosekselta kaikki 
ne uhrilahjat, jolka Israelin lapset 
olivattuoneetpyhfikfin rakennuksen 
tarpeeksi. Mutta he toivat vielfi joka 
aamu vapaaehtoisia lahjoja hfinelle. 

4. Niin tulivat kaikki taitavat mie- 
het, jotka tyOta tekivfit pyhfikdn ra- 



96 



2 MOOS; 88. 



kennuksessa, itsekukin siilS tyOStS, 
jota hdn leki, 

5. ja sanoivat Moosekselle: ,,kansa 
(uo yI5n paljon, enemmlln kuin tar- 
vitaan tSmAn rakennukseen, jonka 
Herra bn kSskenyt tehdd.'* 

6. Silloin Mooses kSski kuuIuUaa 
leirissS, sanoen: ^filkOfin kukaan, 
mies lahi nainen, enM tuoko uliri- 
lahjaa pyhSkfin tarpeeksi/* Ja niin 
kansa estettiin tuomasta. 

7. Silla jo oUaineita tarpeek&isiihen 
tydhdn kuin teht^mdn piti, ja vieia 
oli Hiaksikin. 

8. Niin valmislivat nSmS taitavat 
luiehet, jotka-siinfi ty5ss3 olivat, py- 
hakdn kymmenesta kankaanpituu- 
desta; kalliista valkoisista, sinisisU, 
purpuraisista ja tuljpunaisista lan- 
goistaheneiekivdt ja kutoivattaidok- 
Kaastiniihin Kerubini^a.2Mbos.26!l. 

9. Kunkin Icankann pituus dli kah" 
deksankolmattakymmentd kyynlirii- 
13, ja sen leveys neljS kyynHriKd; 
sama mitta oli kaikilla kankaiila. 

10. Ja he yhdislivSt viisi kangasta 
toinen toiseensa, ja taas viisi kan* 
gasta toinen toiseensa. 

11. Ja tekivSt my6s silmukat sini- 
sistS langoista ensimmgisen kankaan 
palteeseen, sekS myOs toisen kan- 
kaan Sdrimmdiseen reunaan. 

12. Viisi kym men td silmukkaaheic- 
kivStensimmgiseenkankaasenJavii- 
sikymmenta silmiikkaa toisen kan- 
kaan reunaan , joilla ne toinen toi- 
siinsa yhdistettiin, niin etlft silmu- 
kat olivat toinen toisensa kohdalla. 

13. Ja he tekivdt mv5s viisikym- 
menta kultaista koukkua, joilla he 
yhdistivat kankaat toinen toiseensa, 
niin ettS maja tuli yhdeksi koko- 
naisuudeksi. 

14. Ja he tekivAt kankaita vuohen 
karvoista, majan pSSllc peitteeksi; 
vksitoista semmoista kangaskappa- 
letta lehtiin. 2 Moos. 26:?. 

15. Jokaisen kankaan pituus oli 
kolmekymmentd kyynfir^ta, ja le- 
veys neQakvynSrlitA; sama mitta oli 
kaikilla yhdellStoisla kappaleella. 

16. Ja viisi kappal'etta yhdistelliin 
erikseen, ja sitten kuusi kappaletta 
erikseen. 

17. Ja he lekivSt viisikymmentfi 
silmukkaa adrimmSisen kangaskap- 
paleen reunaan ja niyds viisi kym- 
menl^ silmukkaa toisen kappaleen 
reunaan vastaavalle kohdalle. 

1& Ja he tekiviit viisikymmentii 
vaskikoukkua , joilla niajan neile 
yhdistettiin yhdeksi kokonaiseksi. 

19. Ja he tekivilt peitteen majnn 
pi^e punalla painetuista oinaan 



nahoisia, ja vielS sen pfiAlle peitteen 
hylkeen nahoista. 2 Moos. 26:14. 

2Q. Ja he tekivSt majan laudat sit- 
timipuusta pystyyn asetettaviksi. 

2 Moos. 26:1588. 

21. Jokaisen laudan pituusolikym- 
menen kyyndrStd, ja leveys puoli- 
toista kyyndiiitil. 

22. Jokaiseen lautaan tehtiin kaksi 
vaarnaa, joilla laudat toinen toiseen- 
sa liitettiin; niin tehtiin kaikkiin 
niajan laudoihin. 

23. Ja he asettivat majan laudoista 
kaksikymmentd laulaa etelft puo- 
lelle, 

24. ja tekivfit neljfikymmentft ho- 
pii^alkaa kahdenkymmenen laudan 
alle , joka laudan alle kaksi jalkaa, 
aina kahden vaarnan kanssa. 

/ 25. My5skin asettivat he majan toi- 
selle sivulle, pohjan puolelle, kak- 
sikymmentH lautaa, 
2Q. neljilnkyiTunenen hopiajalan 
kanssa, aina kaksi jalkaa kunkin 
laudan alle. 

27. Mutta pcrSlle majaa^ ISnteen 
pdin, asettivat he kuusi lautaa. 

28. Ja he tekivSt kaksi muuta lau- 
taa majan kulmia varten, molem- 
mille sivuille, 

29. ja ne olivat kaksitahkoiset al- 
haalta asti ja samassa eheSt, ensim- 
maiseen renkaasen saakka ylflpfiSs- 
sd; niin tehtiin molemmat, kum- 
paankin kulmaan. 

30. Niinmuodoin tuli olemaan kah- 
deksan lautaa ja kuusitoista hopia- 
jalkaa , aina kaksi jalkaa kunxin 
laudan alia. 

31. Ja he tekivat myds poikkipuut 
sitlimipuusta : viisi niihin lautoihin, 
jotka olivat yhdellft puolella majaa, 

2 Moos. 26:26. 

32. ja viisi poikkipuuta niihin lau- 
toihin, jotka olivat toisella puoien 
majaa, ja taas viisi poikkipuuta nii- 
hin lautoihin, jotka olivat majan 
perSpuolella ISnteen pdin. 

33. Ja he asettivat keskimtlisenpoik- 
kipuun niin, ett5 se kdvi poikittain 
keskeltS lautoja yhdestd p&5st5 niin 
ioiseen. 

34. Ja he silasivat laudat kullalla, 
ja niitten renkaat tekivAt he kullas- 
ta, joihinka poikkipuut pistettiin; 
ja poikkipuut silattiin myds kullalla. 

35. He tekivdt myds esiripun sini- 
sistS, purpuraisista, tulipunaisista 
ja valkoisista kerratuisia langoista; 
myCs^Kerublmit kudotMin siihen 
taitavasti. 2 Moos. 26:31 ss. 

3C. Ja he tekivflf sit3 varten neljS 
patsnsla sittimipuusiu , ja silasivat 
ne kullalla; ja niidea koukut teki« 



tntaOA] 4 



n 



2 HbOS. SB. 37. 



▼At h» kuUftsta, ja valoivat niill* 
BelJA iioplajalkaa. 

37. ia he valmistlvat kankaan ma- 
Jan oven eteen sinisistft, purpuvaisis* 
ia, tulipuoaisista ja valkoisista kerra- 
tulsta langoista«taitavasti neiilotan, 

38. ja tfttft varlc^iTitsi patsofctakouk*> 
kuinensa, ja silasivat niidenbfifttjd 
vanteet kullalla; ja niiden viisi ja- 
lustaa tehUiii'vaskesta. 

37Luku. 

Ar&U, irmoietuiij, poy^ kynUllftjalka 
, ja suitsbtuBalttari tebdft&n. 

J a Betsaleel t^d arkin silftihiteuU^- 
ta, puolikoharalka kyyhftrata pit«' 
kfln^ puolitoiatsi kyynArfttfl llsviSn Ja 
puolitoista kyynSrfttft ko^kian. 

9 Moos. 26:10 S8. 

2. Ja hfin silpsisen puhlaalla kul* 
lalla, sek5 sisftltfi ettfl ulkoa, ja teki 
seii ymp&rille kultaisen vatiteen^ 
■ 3. Ja valoi hcljfi kultarengasta seii 
neliaan kulmaan.kaksi rengasta yh* 
delie puoleQe ja kaksi rengasfa loi- 
selle puoldle. 

-44 Ja Mn tekl korennot siUimi- 
puiistB ja silasi ne kullalla. < 

5. Ja pisti ne korennot reokalsln 
drkln sivulle, niin ettlk arkki taidet- 
tiin kantaa. 

-6. Ja ban teki armoistuimen puh* 
taasia kullasta, puolikolmatta xyy* 
nSrAta pitkdn ja puolitoista kyynfit 
rflt& levifin. ^Mdo8.2&:i7. 

7. Ja hfln teki kaivertamalla kaksi 
Kerubimia kullasta ja asetti ne mo* 
lempiin pflihin armoistulnta; 
' 8. yliden Kerubimintbis^en pftAMn, 
ja toisenKerubimin toiseen pSdhfin. 
Vliteyteen armpislutmen'kanBsasen 
molempiin p9ihin hfin teM Keru- 
bimit, 

:9. Ja Kerubimil levittivftt siipensfl 
ja peittivflt armoistulmen silvillAn- 
sd, ja niitten kasvot olivatkadnn^tyt 
toinen toisensu puoleen ; armoistui- 
nieen pflinolivalKerQbfmein kasvot. 

10. Hen teki my6s pGydAn siltimi- 
puusta,. kaksi kyynArfitS pitkAksf, 
kyynflrftta leviftksl, ja puoltatoista 
kyynSrata korkiaksl, 2 Moos. 25:2388. 

11. ja silasi^sen pohtaalla kullalla, 
ja leki kultaisen vanteen sen yn^ 
pflrille. 

12. Ja hfln tekl rennuksen seti ym- 
pflrille kflmmentfl koirkean ; J a feki 
myds kultaisen vanteen reunuk^en 
ympfirille, 

13. ja valoi siihen neljfl kultoista 
fengasta, ja panf renkaat neljflfln 
kulmaan oeljun jalaii kohdalle. 
44» Jliuri ^^uouksf n Jiohdalla oli* 



vat rekikaat/'j<iitii lij^i^tlnbl ^ffftlii 
pistettflisiin, joilla pOytS kannetrflti. 

15. Ja Mn teki korenttot dittimi- 
puusta , ' ja sllasi ne^ - Iuitl41laf Wiii 
voitiln.poytfl kantaa. ' ' ' ' 

16. Hfln teki myOs p^yfflta^tiat pUh^ 
tai^ti kullasta, vadit, su{tsuiti$ostial. 
maljat ja pikarit» Jofsta Juomaulxtit 
kaddettiin. 2Mkk».^:29. 

17. Hiln teki myOB ky nttft^albn pvth* 
taasta kullasta. Kalv6rtdmalla tlii« 
dokkaasn hfln kynttllfijalan teki, sen 
ialnstanja varren; inliHat, nuput jii 
kukkaset siinfl olivat kaikki saniRsla 
kappaleestik. 2 Moos. 25:31 iTs. 
-18. Kuusi haaraa kflvl sen ky^ies-^ 
tfl, kohne haaraa kynttllfijalan yh^^ 
deltfl sivuifa, ja myfis kolihe hdaraa 
sen to^lta sivulta. • 

19< Kolme mantelikukan-niuiotois- 
ta n^ljaa oli se«i tolsessa haarassa, 
jd Vksi nuppu'ja kukkanen, niiix 
myos'1<o<!ine mantelin-kaltaista ntaK 

iaa tolsessa haarassai vksinuppuja 
Lufckanen: niin oti nilssA kuuaess» 
haarassa, jotka kynttilAjalastil kftvi- 
vfttkifos. 

20. MuttaitsekyntfitflJa)a$sa6Unel« 
jfl milntelin«muotoista maljaa, nup- 
pujehsa ja kukkitstensa kanssa, 

21. niin ettfl nuppu oli siinfl ensim- 
mflisen haaraparin alia, la taas nup^ 
pu toisen haaraparin alia, ja vieifl. 
liuppu kolmannen haaraparin allsi^ 
niin oli niitten kuuden haaran alia. 

jotka Siitfl kflVivfit Ulos. 2AfooS.2S:35.' 

22. Ja s^n nuput ja haaral olivslt 
kaikki yhtfl taidetekoa puhlaa^ 
kullasta. 

28. Ja hfln teki myOs siihen seiUe^ 
mfln lamppua; Ja niitten niistim^C 

ia sammultimet olivat puhtaastaf 
Lullasta. . I 

24. Ja hfln teki sen kaikkienastialn<.L 
sa kanssa yhdestfl talentista puhdfl($^^ 
ta kullaa. \ 

25. Hfln tekl myOs suitsutnsalttdriii^ 
sittimipuusta, yhtfl ky^Tifirfltfl pitkHn, 
ja yhtfl kyynflrfltfi levifin — aivaif 
nelikulpfiaisen — ja kahta kyynflr}!^ 
ta korkian ; sarvet tehUin y htey tcf^kf 
sen kanssa.^ 2 Moos. 30:^ ii. 

26. Ja hfln silasi sen puhtaalla lui'l-^ 
lalla, sen katon Ja seinflt ympfirln^,^ 
ja sen sarvet; Ja hfln teki sen ym^^f^. 
rille vanteen kullasta. . ' ' ; 

27. Ja hfln teki kaksi kultaista rekiJ 
gasta vanteen alle molemmin pkx6^^ 
lin, niin ettfl korennot voitiin xiflhttf 
pistflfl, Joisla kanneltiin. ' ,' ^ 

28. Ja korennot hfln teki si]ttl|ii|.^ 
puusta, ia silasi ne kullalla. /- 

29. Ja hfln valmisti myds pyhliti 
voiteiiK^Uyn Ja i^hlaoD, fe^AimiBgfal'*! 



i» 



t. 



'1 



2 MOOS. 37. 38. 



\iun sitUsutuksen, taidokkaasti fefaf- 
38 Luku. 

Polttoulixin-alttari Ja pesoasUa val- 
mistetaan. 

Ta hSn teki myds poUtouhrin-alt- 
** taria sttUmipuusta, viittfi kyynA- 
rilUl pitk3n ja viittfi kyynflrSiaievifin 
- aivan nelikiilmalsea '— ja kolmea 
kmftrfitfi korkian, 2Moo8.27:iii8. 

2. Ja hfin teki aeljfi sarvea sen nel- 
jttn kirimaan : yhtfl tekoa oUvat sar- 
▼et* ia hftn sliasi sen vaskella. 

3. Ja hfin teki kaikki alttarin tar- 
peel, tuhka-astiat, lapiot, maljat, 
UBgot, hiiliastiat; kaikki astiat te- 
ki hfin vaskeata. 

i Jft teki alttarin ympfirille vaski- 
Ukin niinkuin verkon, maasta puo- 
lea aittarin korkeuleem* ^Meos. 27;4. 
S. Ja Mn valb! neljA rengasta ^ ja 
asciti ne vaduliSkin nelj&fin kul- 
naan, ettft korennot niihia pistet- 

i Ja hSn teki korennot sittimi- 
PQQsta ja silasi ne vaskeUa, 
7. Ja hfin pafii korennot renkaisin 
•Utario sivulle. joi»ta se kannettiin. 
fiia teki $en landoista ja ontoksi 
sisaitft. 

}> Ja bfta leki pesoastian yaskesta, 
jaitD ^ustan myds vaskesta, nii- 
4^iUttsten peileistfi, jotka paiveli- 
vatseurakunnan majan oven edes- 
^ 2 Moos. 30:l$ss. 1 Sam. 2:22. 

iJahfin teki pihan etelfifinpfiin; 
japihankangasaidat teHtiin.valkias- 
ta kaTatu$ta liinasta, sata kyynArft- 

ttpiyOit, 2 Moos. 27:9. 

10. ja sitfi varten tehtiin kaksikym- 
neota pftlsasta Ja niihin kaksikym- 
Btitftjalustaa vaskesta; mutta niit- 
ten koukut ja vy5t hopiasta. 

11. Niiii my6$ pohjan puolella teh- 
Hhi $ata kyynftrdti^, ja sitfi varten 
kaksikymmenta patsasta kahden- 
kymmeaen jaluslan kanssa vaskes- 
ta; mutla niitten koukut ja vyOt ho- 
piaita. 

HJalfinnien puolella oli kangasai- 
>atvii$ikymmei}tfi kyynarfitfi, kym- 
aeaea patsaan ja kymmenen jalus- 
jan kanisa; mutta niitten koukut 
)■ vy5t Hopia^la ; 

If'ketupuolella itfifin p5in tehtiin 
TWiyoimaita kyynfiratfi, 
li niin ettfi kangasaitaa oli viisi- 
*«^ kyynfiWktfi yhdeimsivullQ, kol- 
jp^ patsaan ja kolmen jalustan 
•aana, 

1^ Ja samoin loisella siyulla — siis 
ykia palj^n rooleounin puoUn pi- 



han porttia * niilten viUitolsta kyy- 
nfirfitfi kolmen patsaan ja koknea 
jalustan kanssa. 

16. Ja kaikki pihan kankaaiympftr 
rinsfi olivat valkiasta kerratnata lii- 
nasta» 

17. ja patsasten jalat vaskesta* ja 
niitten koukut ja vyCt hoptasta, 
niin ettfl niitten nuput olivat silatiat 
hopialla; ja kaikki pihan paisant 
olivat vydtelyl hop!avy611fl. 

18. Ja porttiverhon pihan sisfiUei- 
kfiytfivAan teki hfin sinisistfi, purpu- 
raisista, tulipunaisista ja valKoisista 
kerratuista langoista, taitavasti neu- 
lotun , kahtakymmentfi kyynfirfitft 

Eitkfin, ja viittn kyynfirfttA korkian, 
ankaan leveyden mukaan pihan 
kangas-aidassa, 2 Meoa. 27:19. - 

19. ja sitfi varten tehtiin neljA pat- 
sasta ja neljfi jalustaa vaskesta, mut- 
ta Jiiitten koukut hopiasta, ja niitten 

Kfifit silattiin hopialla ja vyOlettiin 
opiavyOllfi. 

20. Ja kaikki vaamat nudaisa ja 
koko pihassa ympfirinsA olivat vas- 
kesta.' S Mooa» 27:10.' 

21. Tfissfi on luetlelo kaiklata kuin 
todistuksen majaan tarvittiin, joka 
luettelo oa tehty Mooseksen kftskyn 

ifilkeen, levllfiisten toimen kautta, 
tamarin.papin Aaronin pojan, joh- 
don alia, 

22. Ja Betsa^el, Urin poika, Hurin 
pojanpoika, Juudan suvusta. teki 
kaikki kuin Herra Moosekselle oU 
kfiskenyt. * 

23. Ja hfinen apulalsensa oli Oho- 
liab, Ahisamakm poika, Danin su- 
vusta , joka oli mies taitava Ja ym-- 
mfirtfivainen veistfimfiAn seku kiito- 
maun kangasta sinisistfi, purpura!- 
sisia, tulipunaisista ja valkoisista 
lanffoists 

24. Kaikki se kulta, jota tarvittiin 
tfimfin pyhfikOn torpeeksi , joka oli 
annettu yl5nnys-uhriksi, oli ]^hdek- 
sfinkolmattakymmentfi talenttia,seit- 
semfin sataa ja kolmekymmentfisik- 
lift, pyhfin siklin jAlkeea. , 

25. Mutta bopia, jonka yhteinen 
kansa siilien antoi, oli sata talenttia, 
tuhannen seitsemfinsataa viisikah- 
deksattakymmentfisiklifi, pyhfin sik- 
lin jfilkeen ; 

26. puoU siklifi , pyhfin siklin jfil- 
keen, tuli henkil6fi kohti kaikilta 
niiltfi, jotka olivat lasketut, kahden- 
kymmenen vuolisel ja sitfi vanhem- 
mat, kuusisatuatuhatta, kolmetuhat- 
la, viisisataa ja viisikymmenlfi hcn- 

kildfi. 2 Moos. 30:18 S8. 4Moot.l:4a. 

27. Sadasta talentista hopiata va)e(- 
liin pyhfikOn jalustal, ja esiripuo 



99 



2 MOOS. 38. 39. 



Jalustat, sata iaiustaa sadasta talen- 
tista, talentti kullekin jalustalle. 

28. Mutta tuhannesta, seitsemSstfi 
sadasta ja viidestSkahdeksattakym- 
menestS siklistft tehtiin koukut pat- 
saisin, ja niitten pSHt silattiin, ja ne 
yy61ia vyOtelliin. 

29. Mutta vaski, mikfi annettiin yldn- 
nysuhriksi, oli seitsemflnkymmenta 
talenttia ja kaksituhatta ja nelj£isa- 
taa siklili 

30. Siitfl tehtiin jalustat seurakun- 
nan majan oveen, ja vaskialttari ja 
vaskihftkki siihen ja myds kaikki 
alttarin astiat, 

31. sekfl my6s jalustat ympflrinsS 
pihan ympArillA ja jalustat pihan 
sisdllekftytSvdSn , ja kaikki majan 
vaarnat, ja kaikki pihan vaarnat 
ympSrinsS. 

39 Luku. 

Pappien voatteet valmistetaan. 
Todistuksen majan kappaieet luetellaan. 

Mutta sinisista, purpuraisista ja 
tulipunaisista villoista teki vSt he 
virkavaatteita palvelukseen pyhAkOs' 
s3; ja he tekivAt pyhifl vaatteita Aa- 
roniUe, niinkuin Herraoli kSskenyt 
Mooseksellc. 2 Moos. 28:2 ss. 31:10. 35:19. 

2. Ja he tekivSt olkavaatteen kul- 
lasta sekS sinisista, purpuraisista 
ja tulipunaisista villoista ja valkias- 
ta kerratusta liinasta. 2 Moos. 28:6. 

3. Ja he takoivat kullan kiskoksi, 
jonka leikkasivat langaksi, niin et- 
ti\ se taidettiin taitavasti kutoa si- 
nisten, purpuraisten, ja tulipunais- 
ten villain ja valkian liinan sekaan. 

4. He tekivdl siihen olkakappaleet 
yhdistetldviksi; kahdclta kulmalta 
se yhdistettiin. 

5. Ja vyO sen pAAlIS oli my6s teh- 
ty silld tavalla taitavasti kullasta,' 
sinisistft, (purpuraisista, ja tulipunai- 
sista villoista, ja valkiasta kerratus- 
ta liinasta, niinkuin Herra oli kils- 
kenyt Moosekselle. 

6. Ja he asettivat onikin kivet ja 
kiinnittivSt- ne kullalla; niihin oli- 
vat Israelin lasten nimet kaiverre- 
tut, niinkuin sinetti kaiverretaan. 

2 Moos. 28:9. 

7. Ja ne asetettiin olkapSille olka- 
vaatteeseen, ettfl ne kivet muistut- 
laisivat Israelin lapsille kaikki initA 
Herra oli kdskenyt Moosekselle. 

2 Moos. 28:12. 

8. Ja he tekiv^t rinlakilven siim ta- 
valla taitavasti, kuin olkavaatekinoli 
lehty: kullasta, sinisistd, purpuraisis- 
ta ja tulipunaisista villoista, ja kalliis- 
tu kerratusta liinasta, 2 Moos. 28:15 ss. 
'9. niin t{\& se oli nelikulinainen ja 



kaksinkertainen, vaaksa pituudelta 
ja vaaksa leveydeltii, kaKsinkertat- 
sesti. 

10. Ja he tfiyttivftt sen nelj^Ilfi ki- 
viriviim : ensimmSinen rivi oli kar- 
neoli, topasi ja smaragdi; 

11. toinen rivi: rubini, safiri ja de- 
mantti' 

12. kolmas rivi : hyasintti, agati ja 
ametisti; 

13. ja neljfis rivi: (urkosi, oniks ja 
jaspfs. Ne olivat kullalla ympfirOi- 
dyt ja kiinnijuotetut. 

14. Nait§ kiviS oli Israelin lasten 
luvun jdlkeen kaksitoista, yksi kul- 
lekin nimelle, kahdentoista suku- 
kunnan jdlkeen, kaiverretut samal- 
la tavalla kuin sinetti kaiverretaan. 

15. He tekivat my6srintakilpefivar- 
ten vitjat punomalla puhtaasta kul- 
lasta. 

16. Ja he tekivSt kaksi kultanastaa 
ja'kaksi kultarengasta, ja yhdistivSt 
ne kaksi rengasta kaht^en rinlakil- 
ven kulmaan. 

17. Ja he pistivfit ne kaksi kulta- 
vitjaa niihin kahteen renkaaseen rin- 
takllven kulmiin. 

18. Mutta vitjojen kaksi muuta pfifi- 
tft kiinnittiv£it he niihin kahteennas- 
taan, ja yhdistivftt ne olkavaatteen 
olkakappaleisin sen etupuolella. 

19. Ja he tekivdt kaksi muuta kul- 
tarengasta, ja yhdistivfit ne niihin 
toi^iin kahteen rintakilven kulmaan, 
siihen reunaan, joka on sisflSn{>fiin 
kdftntynyt olkavaatetta vastaan. 

20. Ja he tekivflt vielS kaksi muuta 
kultarengasta ja kiinnittflvflt ne kah- 
teen kulmaan olkakappalten alareu- 
naan etupuolella olkavaatteen vydn 
kohdalla. 

21. Ja he yhdistivfit rintakilven ren- 
kaistansa niihin renkaisin,' JQtka oli- 
vat olkavaatteessa, sinisellfi nauhal- 
ia, niin ettfi se oli liki olkavaatetta, 
eikfi erinnvt olkavaatteesta, niinkuin 
Herra kfislci Moosekselle. 

22. He tekivfit my6s olkavaatteen 
liepeet kokonansa sinisistft langols- 
ta Kudotusta kankaasta. 2Moo8. 28:3i. 

23. Ja keskelle olkavaatetta tehtihi 
Ifipi pfifitfi varten, niinkuin rauta- 
paidan Ifipi ; ja pfifinlSven reunaan 
ommeltiin sepalus, ettei se repiSlsi. 

24. Ja he tekivdt granatin omenat 
liepeitten alareunaan sinisistft, pur- • 
puraisista ja tulipunaisista kerra- 
tuista langoista. 

25. Ja he tekivfit kulkulset puhtaas- 
ta kullasta, ja panivat ne kulkulset i 
granatin omenain vdlille ylt'ympfiri ' 
liepeitten reunaan, 2 Moos. 28-33. 

26. niin ettfi kulkuinen ja granatin j 



100 



2 MOOS. 39. 40. 



omena oli vuoroin ympSrinsfi liepeit- 
tenreunassa.kanncttavaksipalveluk- 
sessa, niinkuin Herra oli kAskenyt 
Moosekselle. 

27. Ja he tekivfit myds ihopaidat, 
kudotut valkiasta kalliista liinasta, 
Aaronille ja hSnen pojillensa, 

2 Moos. 28:39 88. 

28. hiipan valkiasta kalliista liinas- 
ta, ja kauniit p§3hineet valkiasta 
kalliista liinasta, ia alusvaattect val- 
kiasta kerratusta liinasta,2 Moos. 28:42. 

29. ja taitavasti neulotun vy5n val- 
kiasta kerratusta, kalliista liinasta, 
sinlsistfi, purpuraisista ja tulipunai- 
sista villoista; niinkuin Herra oli 
kSskenyt Moosekselle. 

30. He tekivSt myds pyhSn otsa- 
kmuDun levyn puhtaasta kullasta, 
ja kaiversivat kirjoituksen siihen, 
niinkuin sinetti kaiverretaan : H er- 
ralle pyKitetty. 2Mo<^.28:36. 

31. Ja ne sitoivat siihen sinisen 
nauhan ja yhdistivdt sen hiippaan, 
niinkuin Herra oli kAskenyt Moo- 
sekselle. 

32. Ja niin kaikki scurakunnan ma- 
jan rakennus p33tettiin. Ja Israelin 
lapse! tekivSt sen; he tekiv3t kaikki 
sen mukaan, kuin Herra oli kSske- 
nyt Moosekselle. 

S. Ja he kantoivat majan Moosek- 
sen luo, todistuksen majan tarpei- 
nensa: sen koukut, laudat, koren- 
not, patsaat ja jalustat, 

34. peitteen punalla painetuista oi- 
naan nahoista, ja peitteen hylkeen- 
nahoista, ja esiripun arkin eteen, 

35. todistusarkin korentoinensa, ja 
myOs armoistuimen, 

36. pGvdiin kaikkein astiainsa kans- 
sa,.ja katsomusleiv3t, 2 Moos. 35:13. 
• 37. puhtaan kynttil{ijalan,valmiste- 
tun famppuinensa kaiken sen kans- 
sa miVk siihen tarvittiin, ja 51jy3 
lmittil3jalkaan,2Moos.31:8. 3 Moos. 24:4. 

3S. kulta-alttarin ja voitelu61jyn, ja 
byvSnhajuisen suitsutuksen, ja ma- 
jan oviverhot, 

39. vaskisen alttarin ja vaskisen hd- 
kiD korenloinensa ja kaikkine tar- 
peinensa Ja pesoastiaii jalustoincnsa, 

40. pihan kangasaidan palsainensa 
ja ialkoinensa, kankaan pihan si- 
tUfpkiytdvdn eteen, k6ysmensii ja 
vaajoinensa, ja kaikki seurakunnan 
majan palveluksen astiat, 

41.javibdoin virkavaattcet pyhfik5s- 
sS palvelemista varten, papin Aaro- 
Binpyhflt vaatteet, ja hSnen poikain- 
sa vaatteet, joissa heiddn piti papin 
virkaa toimittaa. 

41 Niinkuin Herra oli kftskenyt 
Moosekselle, aivan sen mukaan 1&- 



kivftt Israelin lapset kaiken sen 
tyOn. 

43. Ja Mooses katseli kaikkea tfilS 
rakennustyOtS ja nSki, ettS he oli- 
vat tehneet sen, niinkuin Herra oli 
kSskenyt. Ja Mooses siuuasi heitS. 

40 Luku. 

Mooses pystyttfifi majan Ja pybitt&ft sen. 

J a Herra puhui Moosekselle, sanoen: 
2. „Ensimmaisendp3ivan§ensim- 
m5isessa kuussa tulee sinun pystyt- 
tSd seurakunnan maja. 

3. Ja pane siihen sisSlle todistuk- 
sen arkki, ja peitft arkki esiripulla. 

^ Moos. 26:33 ss. 

4. Ja tuo myds sinne sisdlle pdytU, 
ja valmista se ja asela siihen kynt- 
tilSjalka, ja pane lamput sen pSIille. 

5. Ja aseta se kultainen savualttari 
todistusarkin eteen, jaripustaesirip- 
pu majan eteen. 2 Moos. 30:1,26:36. 

G. Mutta polttouhrin-alttarin pitaii 
sinun asettaman seurakunnan ma- 
jan oven eteen. 

7. Ja pane pesoastia seurakunnan 
majan ja alttarin vdlille, ja pane 
siihen vetia. 

8. Ja tee piha sen ympSrille, ja ri- 
pusta esirippu pihan portin eteen. 

9. Ja Ola voiteluSljy, ja voilele ma- 
ja ja kaikki ne kuin siinil oval, ja 
pyhitii se kaluinensa, ettd ne olisi- 
vat pyhai. 2 Moos. 30:26. 

10. Ja voitele poltlouhrin-alttari ka- 
luinensa, ja pyhild alttari; ja se 
alttari olkoon kaikkein p^hin. 

11. Voilele m^6s pesoastia jalustoi- 
nensa, ja pyhitA se. 

12. Ja tuo Aaron poikinensa seura- 
kunnan majan oven eteen, ja pese 
heiia vedelia. 2 Moos. 29:4 ss. 

13. Ja pueta Aaron pyhiinVaatteisin, 
ja voitele ja pyhita hSnet minun 
papikseni. 

14. Ja tuo myOs hSnen poikansa, 
ja pueta heiddn yllcns^ inopaidat, 

15. la voitele heidSt, niinkuin sinll 
heidAii isansa voitelit, minun papik- 
seni. Ja tafnan voidelluksen pilau 
oleman heille ijankaikkiseksi pap- 
peudeksi suvusta sukuun." 

16. Ja Mooses teki kaikki, niinkuin 
Herra oli hSnelle kaskenyt. 

17. Niin aseteltiin maja pystyyn toi- 
sena vuonna, ensimmSisena paiva- 
na ensimmaisessa kuussa. 

18. Ja kun Mooses pystytti majan, 
niin han asetli jalustat ja laudat ja 
poikkipuut, jaaselti palsaat,4Moos 7.1. 

19. Ja han levilti peitteen majan 
vlilse, ja pani katon s^npaaile, niin 
kuin Herra oli kaskenyt Moosekselle. 



101 



2MO^.40, 3 Mods. 1. 



^? J ft liiln oHi tocHstuksen ja pnxA 
arkkiin. ja asetti korennot arkrn 
pHtlHe, ja pani myOs armoistuimen 
arkin pfidlle. 2Moo{i.2S:i6. Hebr.9;4. 

21. Sitteti toi hfin arkin majaan, ja 
ripusti eslripun to'distusarkin et«en^ 
niinkuin Herra oli kfiskenyt Moosek- 
selle. 2 Mods. 35:12. 

2SU Ja hlin asetti myfis p6ydAn seu- 
rakunnan majaan, pohjan puoliselle 
sivulle, ulkopuolelie esirippua. 

23. Ja hfin asetti leivSt sen pSftlle 
jarJBstykseen Herran eteen, niinkuin 
Herra oli k^skenyt Moosekselle. 

24. Ja hdn pani myOs kynttil^alan 
seurakunnan majaan, «iivan pOydftn 
kohdalle, etel&n puoliselle sivulle 
m&jaa. 2M008.26:31. 

25. Ja hfin asetti lamput siihen 
Herran eteen, niinkuin Herra oli 
kSskenyt Moosekselle. 

26. Ja h3n pani my6s kultaisen alt* 
tarin seurakunnan majaan, esiripun 
elecn» 

27. la suitsutti hyvSnhaluisen suit- 
^utuksen sen pdAlld. niinkuin Herra 
oli kdskenyt Moosekselle. 

28. Ja hdn asetti esiripun majan 
oven eteen. 

29. Mutta polttouhrin-alttarin pani 
hftn seurakunnan majan oven eteen, 
ja uhrasi sen pSftlia polttouhrin ja 
ruokauhrin, niinkuin Herra oli kfis- 
kenyt Moosekselle. 

30. Ja pesoastian pani hAn seura- 



kutihan mijari Ja altfaiiit rSlllte, Jaf 
pani siihen velta pesemisfS varten. 

2Moog..3d:ld8d. 

31. Ja Mooses ja Aaron ja hftnen 
poikansa pesiv9rt kfitensfi ja jalkan- 
sa siitfi, / , ; 

32. sillftheidSn pHi pes^elnlttfit^i^ 
s&,kunhenieniv3t seurakunnan m^- 
iaan tahi kSvivftt alttaHfi tykO, niin- 
kuin Herra oli kftskenj^t Modsek* 
selle. \ 

33. Ja Mn pystytti plhan aidan vna- 

iari ja alttarin ymparille, ja* ripusti 
^angasverhon pihan^ sisalleltftyta- 
VfiSn. Niin Mooses piifttti koko sen 
tyfin. 

34. Silloln pilvi peitjti seuHikt^onatl 
majan^ ja Herran kunnia tftyW ma- 
jan." 4Mo08.da6.' IKttn. 8:iaiBV. 

35. Ja Mooses ei vbintrt mennfi sen* 
rakunnan mt^jaan, sillfl pilvi oli $en 

J>fidlia, ja Herran knnnia'tjftyttl nra-* 
an. 

36. Ja kun pilvi yleni majan plUlltfi, 
niin Israelin lappet vaelsi vat; nifn 
he tekivSt kokoheidfinmalkallansa. 

37. Mutta kun pilvi ei ylenriyt/nfin 
he eivfitlfthteneetmatkalle,ainii ^H-^ 
hen pdivafin asti, jolloln se taas yleni. 

38. ^ilHt Herran pilvi oH pSiVdllfl 
m^uan ylitse, ja y6119 oli siinS lulta; 
niin oli Israellh lasten silmSin edes- 
sft koko heidftn matkallansa. • 

2 Moos. 13*.2l88. 4M00S. 14:14. 6 Moos. 1:3$.' 
Neti. 9:19. Ps. 78:14. 105:59. 1 Kor. lOU.^ 



KOLMAS MOOSEKSEN KIRJA. 



LEVITICUS. 



I Luku. 

Laki polttouhrista. 



J a Herra kutsui Mooseksen ja pu- 
hui hfinelle seurakunnan majasta, 
sanoen : 

2. Puhu'Israelin lapsille, ja sano 
heille: kun ioku teisla tahtoo uhrata 
Herralle^ niin tehksat uhrinne eiai- 
mistS, joko kaijasta tahi lampaista. 

3. Jos h5n tahtoo Herralle poltto- 
uhria kaijasta tehdfi, niin uhratkaan 
virheettOmSn hSrkyisen; seurakun- 
nan majan oven edessA hfinsenuhrat- 
kaan, ettS se olisi Herralle otolHnen. 

4. Ja pankoon h9n kStensS sen polt- 
touhrin pnSn pfiSlle, niin se on OtolH- 
nen hflntd sovittamaan. 2Moo8.29:l0. 

5. Ja teurastakoon hSn hdrkyisen 
Herran edessfi ; ja papit, Aaronin 
pojat, tuokootveren ja kaatakootsen 



alttarille yirympSri, joka on 8eum«> 
kunnan majan oven edessft; ' 

6. Ja vuota polttouhrista on hyli 
jettavft ja kappaleiksi hakattava. 

7. Ja papin Aaronin pojat tehk^Ot 
tulen alttarille, ja pankoot'halot tu- 
len pfiaUe. 

8. Ja papit, Aaronin pojat; Sovitta*^ 
koot kappaleet, pS^n ja rasvan, halo 
kojen pSdlle, jotka ovat alttarilla til- 

len paniis. 

9. Mutta sisailykset ja jalat pitdft 
vedelia pestamfin. Ja papin pitfift 
kalkki ndmS polttaman alttaHlla 
polttouhriksi, ja otollisen hajurh In- 
liuhriksi Herralle. 2 Mobs. 29:25; 

10. Mutta jos hSn tahtoo- tehd£tp6lt- 
touhria pienistft elfiimist^f lampais- 
ta tahi vuohista, niin uhratkoon vir- 
heettOmfin oinaan tahi kauriin. 

11. Ja teurastakoon^ sen Uert*an 



le^ 



SII0OS.1.D. 



'«. Ja hta balatKkoon sett ^(pEeh 
lulid>tlK,-tiHtlenkmi"reiint9etnailfl 
BlliB Ml; i» pappi 'ikoltiBkoDn sen 
taHi«)cn^>Mirfi.}athD'()v<et ftltMrilla 
lakn BBilia THmfl OR' poltlouhH-, 
hdluM clotlHeksi hoi^sf HeirttHe. 

'-■■■/;2 ^ufru,:"''- ■ 

■"■.(.■'''■'iwlu"""*!* .. 

T* iu Johu iDHuw teMn Rerraiie 
•* mMnuhria, Mfftt«hkMr> sen hle- 
MiilB}aulMIsla. IK'vupdnllakoonOI' 
tyl Mn pOMIe. jtt'ipnnhoon juilsu- 

1 ft TMi(!M ^eA Mllen papein«, 
A>ronlnpojillc)'ja'''ftop|>l«ttahoon 
pjT«Ma Myteen jauhoisln Ja &l}y3tfi 
irimtiafWeTl sulMluKsen, Jb sm 
pblllnkMiti dlllaHIt* mulstoksf. Ta- 
mil «n^MHuhH trMltiieksl hajuhsl 
Hmtille;' 

S,SB|iniUnififirua>nuttrlsta;olkoon 
AamnfM Jfl-liflnen 'ptfikaFAsa amaa. 
- SB olkbon halhkcln pyhjn Herran 
WlMtrtitt ' 

4. HMajos slllff«(^dot rehdft ruo- 
Unhrta -ttltl mik»«nuiinh9a Ityp. 
•TMUyt -nfln oikoel Tie httppamal- 
lomia letpll hletMl^ jauHolsIa, jo> 
hoa oit-M]!^ sekoilettu. ]a hii,ppn- 
matlomhi «liBl[*4Hln lefpia, Oljylfo 



te hienolila Jauhf^sta,' Oljym 

koMdiva Ja happAmaisnia. 

<. TaEIn M kappaletkst |a 'vftodaia 



W. 



WaiH bynyMIIji*, Dttn 
noUla jauhofslB OIlyn h 

4. Ja M raohBlihrl, Jonka sinfl lah- 
dotsenkBllalsicte IchnD Hernilte, pl- 
IW Blnnnluofnan papjlte, jakaala* 
man sen alturin lykft. 

5. Japapln pilM ylOnlBman sea, 
mlkl ruakeuhHsiB on muiatokM. Ja 

Solttaman altlarilla. 8e on luliuhrl 
I tivyft haju Herratte. 
10, Tflhleet ruokauhrlsia pitOfl ole- 
man ABrOnin fa tiSnen polhatnsa 
omati Se on oisva Inlkkeifi pyhin 
Herran taliuhreUia. 
' 11. Kalken puoliauhriii, lonks M 
uhraatle HcrrD}le. ^tfift leldfln lehe- 



I, Dttn leo MliW 



ralle. 

IS. MiKlB uutis-ohrlsia ntiia uhral' 
lahoon Herrallej vaan el ne san 
lulla alHarille tnskiaksf haiukst. 

atmoe.nnT. 2Alk.3i«. 

IS. Kafkkl sinun'niokeuhrisipllllfl 
stnun sUolMmBD ; sinun ruokeuhrl- 
s{ BlkACn koskaan olkovaillBSlnun 
JumalBsl IHItosuolttD. KalkUaanli- 
reissasi pltao sinun auolaa uhraa- 
inan, lies. 43S4. Mark.t-.ti.- 

14. Mutla jos sinfl lahdot tehdft uu- 
llseslaTuokauhrifl Herralle, nlin si- 
nun, piiaa kulvsaman vibcrlfilsei 
inhkBpiiai lutella ja sui-vDman M 
pleiiiksi, ]d s[Hen uhraDmbQ rub- 

15. Ja sinun tuleekn'BtB««ihen(l1JyB 
Ja panVia suitsutusla sen panile. Se 
on ruokaulirl. 

16; Ju ptiplh piiail' oltaman nliirB 
survotuista jyvlsta. Ja OljystS, ynna 
kalken 9Q}taul«kaen ^ ]n poltluman 
sen mulstok^. Se on tulfufirl Her- 
ralle, • 

. 3 Luku, 
LulH uiuiBubritU. 

la jDiiOku'laliloo IchdB klllMuh- 
V rin k«rjL»ta. niin uhralkooif hflr- 
Jdn ttilil lehfnfln.Ja tuoKoon vli1t«et- 
lOrnnn' uhrin Hetnin eleen. 

2. Ja Win laskekoon hBlensfl uhrln- 
sa piian pffnile. Jn leuras[okoon sen 
setirukilniiiHi ' majan even edessB; 
ju papli, Aaroptn pojul. kealakoot 

■ illtarille ylfympflri. 



a koike 



, . It roi- 

in, niiKu sisnllyksjssfl on, 

. ja moleinniBl munoskuul sen 
3\an konssa. mika nliilen nflaiia 
I lanteisB», Ja- rbaksao Jiolvdii) J6- 



3 MOOS. 3. 4. 



ka on irroitetlavamunaskuidenkoh- 
dalla. 

5. Ja Aaronin pojat polttakoot sen 
alttarilla polttouhriksi puiden p§ai- 
la, jotka ovat tiilessa, tuliuhriksi 
ja hyvSksi hajuksi Herralle. 

2 Moos. 29:25. 3 Moos. 6:12. 

6. Mutta jos hiln tekee Herralle kii- 
tosuhria pienesta karjasta, koiras- 
tahi nsfaras-eldimistd, niin sen pitSft 
oleman ilman virheettS. 

7. Jos hdn uhraa karitsan, niin hS- 
nen pit3S sen tuoman Herran eteen* 

8. ja laskeman kStens§ uhrinsa 
pdSn pfiSUe, ja teurastaman sen seu- 
rakunnan msgan oven edessfi. Ja 
Aaronin pojat kaatakoot sen veren 
alttarille ylt'ympdri. 

9. Ja kiitosuhnsta tulee hfinen tU' 
liuhriksi Herralle uhraaman^enras- 
van, koko saparon, joka eroitetaan 
selk^piin kohdalla, ja sen rasvan, 
joka sisAllykset peittSd, ja kaiken 
sisSllysten rasvan, 

10. ja molemmat munaskuut sen 
rasvan kanssa, joka lanteissa niiden 
paaild on, ja maksan kalvon, joka 
irroitetaan munaskuiden kohdalla. 

11. Ja papin pitdft sen polttaman 
alttarilla tullruuaksi Herralle. 

12. Jos loku tahtoo uhrata vuohen, 
niin tuokoon sen Herran eteen, 

13. ja laskekoon kfttensd sen pdfin 
p3Slle, ja teurastakoon sen seura- 
Kunnan majan oven edessS. Ja 
Aaronin pojat kaatakoot sen veren 
koko alttarin ympdri; 

14. Ja siitS unratkoon hftn tuliuh- 
riksi Herralle sen rasvan, joka si- 
sAUykset peittfi§, ja kaiken sisdllys- 
ten rasvan, 

15. ja molemmat munaskuut sen 
rasvan kanssa, mikd niiden pfiSlld 
on lanteissa, ja maksan kalvon, joka 
irroitetaan munaskuiden kohdalla. 

16. Ja papin pi tdd polttaman sen alt- 
tarilla, tuliruuaksi, makiaksi hajuk- 
si. Kaikki lihavuus on Herran oma. 

17. Se olkoon teille ijankaikkisena 
sSdntdnSl suvusta sukuun,miss&asu- 
'uettekin: filkdfit syOkO yhtdiln ras- 
vaa eikS verta. 

1 Moos. 9:4. 3 Moos. 7:2388. 17:10 £s. 19:26. 
5 Moos. 12:16,2388. 15:23. Ap.t. 15:2a 

4 Luku. 

Laki rikosuhrista. 

J a Herra puhui Moosekselle,' sa- 
noen : 
2. Puhu Israelin lapsille, ja sano: 
jos joku rikkoo tietSm^ttSdn jota- 
kuta Herran kllskyS vastaan, jota 
ei hSnen pitdisi tekemfin, niin et- 



tft bfin tekee lotakin , joka on liel- 
letty; 

3. Jos pappi, joka voidelta on» rik- 
koo kansan pahennukseksi , niin 
hflnen pitftfi nkoksensa edestd, jon- 
ka hSn tehnyt on, tuoman virheel^ 
t6man nuoren hUrSn Herralle rikos* 
ahriksi, 

4. ja hdnen pitdd tuomai^ sen ha^ 
rfln Herran eteen seurakunnan ma- 
jan oven lao ja laskeman kfitensH 
hfirftn pftftii pfi&lle, ja sitten teuras- 
taman nftrdn Herran edess&. 

5. Ja pappi, joka voideltu on, ol- 
takoon harSn verta, ja kantakoon 
sen seurakunnan mmaan. 

6. Ja papin pitdd kastaman sor- 
mensa vereen ja priiskotttaman sita 
verta seitsemfin kertaa Herran ja 
pyhSkOn esiripun edess$. 

7. Ja papin pitaa pyyhkaistft sitS 
verta suitsutusalttann sarviin, joka 
on Herran edessfi seurakunnan ma- 

i'assa; mutta kaiken muun. veren 
Laatakoon hdn polttouhrin alttarin 
pohjalle, joka on seurakupnan ma- 
jan oven edessa. 3Moo8,5.-9. 9<). 

8. Ja kaikki rikosuhrin hdrdn ras- 
va annettakpon ylGnnysuhriksi, ni- 
mittain se rasva, joka sis^Uykset 
peitfaa, ja kaikki sisailysten rasva, 

9. ja molemmat munaskuut sen ras- 
van kanssa, joka niiden paaiia on 
lanteissa, ja maksan kalvo, joka ir- 
roitettakoon munaskuidenkohdalla; 

10. aivan niinkuin se otetaan kiitos« 
uhrin hardsta; ja papin pitaa ne 
polttaman polttouhrin-alttarilla. 

11. Mutta naran vuodan, kaiken 
lihan, paan jajalkain kanssa, |a 
sisailykset ja ravan, 2Moo8.39a4. 

4.M00B. I9:s. 

12. siis koko haran pitaa hanen 
leirista vieman ulos puhtaaseen paik- 
kaan, johonka tuhka heitetaan, ja 
se pitaa sielia poltettaman puiden 
paaiia tulessa; juuri siina paikassa, 
johonka tuhka heitetaan, pitaa se 
poltettaman. 3M0o8.9:ll. Hebr.i3:ii. 

13. Jos koko Israelin seurakunta 
eksyisi, eivatka itse sita l^uomaa, ja 
he tekevat jotakuta Herran kdskyS 
vastaan, jota ei heidan tulisi rikkoa, 
ja niin tulisivat vikapaaksi, 

4Mooa.l5:24ss. 

14. jasittemminhuomaisivat rikok- 
sensa, minka he tekivat, niin pitftli 
heidan tuoman nuoren haran nkos- 
uhriksi, ja asettaman sen seurakun- 
nan majan eteen; 

15. ja seurakunnan vanhimmat las« 
kekoot katensa haran paan paaiie 
Herran edessd, ja teurastakoot sen 
har^n Herran edessa. 



104 



8 MOOS. 4. 5. 



H Ja pappi, joka voideltu on, kaiv- 
takoon hM^a verta seurakunnan 
imgaan, 

17. ja papin pitftfi kastaman sor- 
mensa vereen, ja seitsemfta kertaa 
priiskoittaman sitS Herran eteen, 
esiripun edessS. 

18. Ja sitten pit&ft hfinenpyyhkSise- 
ffiSn sitfl verta alttarin sarviin, joka 
on Herran edessft seurakunnan ma- 
jasia; muRa kaiken muun veren kaa- 
takoon hfin polttouhrin alttarin poh- 
jaan, joka on seurakunnan ms^an 
edessd. 

19. Kaiken hftrfin rasvan pitfid hS- 
nen otlaman ja polttaman alttariUa. 

20. Ja hfinen pitftfi tekemftn tftlle 
hfir§lle, niinkuin hftn teki rikosuh- 
rin hftrfille. Niin pappi heiddt so- 
vittaa, ja se rikos annetaan heille 
anteeksi. 

21. Ja hftnen pitAft viemftn hftrfin 
iik>s leiristft, ja polttaman sen, niin- 
kuin hftn poltti sen edellisen hftrfin. 
Se ollcoon seurakunnan rikosuhri. 

22. Hutta jos pfifimies rikkoo ja te- 
kee tietftmftttftftn jotakuta Herran 
Jumalansa kftskyft vastaan, jota ei 
hftnen pitfiisi rikkoman, ja tulee vi- 
kapSftksi,' 

23. ja joku sitten osoittaa hftnelle 
hftnen rikoksensa, jotka hftn on rik- 
konat, niin hftnen pitftft tuoman uh- 
riksi virheettOn^ftn kauriin, 

2(. ja laskeman kfttensft sen kau- 
riin pftftn pfiftlle, ja teursetaman sen 
siinft paik^ssa, missft Herralle polt- 
toohna teuraste nan. Se olkoon hft- 
nen rikosuhrinsa. 

25. Sitten pitftfi papin ottaman rl- 
kosnluin verta sormellansa ja pyyh- 
kftisemftn sitft polttouhrin alttarin 
tarviin: mutta sen muun veren kaa- 
ttkootthfin polttouhrin-alttarinpoh- 
jaan. 

26. Ja kaiken sen rasvan pitftfi hftnen 
polttaman alttarilla, niinkuin teh- 
dftftn kiitosuhrin rasvan suhteeri. 3u 
niin pappi sovitlaa hftnen rikoksen- 
sa, ja se annetaan hftnelle anteeksi. 

27. Jos joku yhteisestS kansasta rik- 
koo tietftmftttflfin.niin ettft hftn tekee 
iotaknta Herran kfiskyfi vastaan, jo- 
lt ei hftnen pitfiisi rikkoman^ ja tu- 
ke niin vikapfifiksi, 

21 ia sitten saatetaanhuomaamaan 
rikoksensa, minkft synnin hftn on 
tehnjrt, hfinen pitftfi tuoman uhrik- 
ri virheettOmfin vuohen ' sen rikok- 
ten edeslfi, jonka hfin on tehnyt, 

2iL ia pilfifi laskeman kfttensft ri- 
kostuirin pfifin pSfiUe, ja teumsta- 
nian ten rikosuhria sillft pnikalln, 
jotia pottioohrfB-eUlio teurastetaan. 



SO. Ja papin pitfifi sormellansa ot- 
taman sen verta, ja pyyhkfiisemfin 
sitft polftouhrin alttann sarviin; 
mutta kaiken muun veren pitfifi hfi- 
nen kaataman alttarin pot^u^an. 

31. Ja kaiken sen rasvan pitfifi hfi- 
nen ottnman, niinkuin kiitosuhrin 
rasva otetaan; ja papin pitfifi sen 
polttamanalttarillaniaKiaksihi^uksi 
Herralle. Janiin pappi sovittaahfinen 
rikoksensa, ja se annetaan anteeksi 
hftnelle. 2 Moos. 29:18. 3 Moos. 3:14. 

32. Mutta jos hfin tuo lampnan ri- 
kosuhnksi, niin tuokoon virheettO- 
mfin uuhen. 

33. Ja laskekoon kfitensft rikosuhrin 
pfifin pfifille, ja teurastakoon sen ri- 
kosuhriksi siinfi paikassa, missft polt- 
touhrin-elftin teurastetaan. 

34. Jn papin pitftft sormellansa otta- 
man rikosuhrin verta , ja pyyhkfti- 
semfln sitft polttouhrin alttarin sar- 
viin ; mutta kaiken muun veren pi- 
tftft hftnen kaataman alttarinpohjaan. 

35. Mutta kaiken rasvan pitftft hfi- 
nen ottaman, niinkuin kiitosuhrin 
lampaan rasva otetaan, ja papin pi- 
tftft polttaman sen altlanlla Her- 
ran tuliuhriksi. Ja nitn pappi sovit- 
taa hftnen rikoksensa, jonka hftn on 
tehnyt, ja se hftnelle annetaan an- 
teeksi. 

5 Luku. 

Laki Yikauhrfsta. 

Jos joku rikkoo sillft lavalla, ettft 
hftn kuulee vannottajan sanat, ja 
voisi asian todistaa, joko hftn on 
sen nfthnyt tahi muuten saanut tie- 
tftft, eikft ilmoita sitft, ja hftn on niin 
vikapftft vfiftryyteen; 

2. tahi jos joku tietftmftttftftn sattuu 
koskemaan johonkuhun saastaiseen 
kappaleeseen, joko saastaisen met- 
sftn-elftimen raaloon, tahi saastaisen 
karjan raatoon, tahi saastaisen ma- 
telijan raatooft, ja hftn niin tulee 
saastaiseksi ja vikapftftksi ; 

3 Moos. 11:1 ss. 

3. tahi jos hftn sattuu tietftmftttftftn 
koskemaan saas>taiseen ihmiseen,oli 
hftn mistft syystft hyvftnsfi saastai- 
seksi tullul, ja hftn sitten saa sen 
tietftfi ja tulee vikapftftksi^; 

4. tahi jos joku vannoo, niin ettft 
hftn huomaamattansasuullansa van- 
noo jotakin, oli se hyvftft tahi pa- 
liaa, niinkuin ihminen joskus afat- 
telemattomuudessfi vannoo, kaikki 
kuin ihminen vannoohuoninitsemat- 
fa, ja sen sitten tulee huomaamaan 
ia niinmuodoin joutuu vikapftftksi 
jossakussa nftistfi asioista, han on 
vikapftft yhteen nftistS: 



fFlDDirii] 4* 



105 



C 



8 MOOSE'S; 6. 



5. tifln'hilee h§tt^ti; kbsln Mn'on' 
vik^pfflft johonkuhuil nfiistft, tunnu^- 
taa se; minkft hfin bn'riklkbiiiutv '' 

6.' Jar sen' rikoksensa vMn' edtotft, 
minkiiF hiln on ^kkocrat, lubkoon 
hflnflliuniBSla Herratte 'miheit tahi 
vudhen rfkosahriksi ; • ja papin pi- 
tAft $<ytit(anlan hfinen rikoksensa* ' 
- T.'Joll^i hfirtellS ole lammasta; liiin 
'tuokbon Herralle rikoksehsa edesRl, 
'mlnkfi h&n lehnyl ohf, kaksl metlls- 
la tahi kaksi ntM>Fta kyyhkydlfi, foi- 
^en ' rikosuhrik^i ja itoisfen ^Ittouh- 
Hltsi^, ' 8'Moof^.'l:14. Luiik.2:24. 

8. ia viekA6n ne papHle; ja tftmft 
<uhr«Hcodn ensisti sen ' riko^ukriksi 
mfifirfityn ja vfiflntfik<idn sen ni^at, 
tiaan mk05n kufitenkaan ■ pfililfl eHl- 
lensd revftrsk6; ■ 3Moq9. 1:15. 

'9i • japrii^koiMakOon rikosuhrin ver- 
ta'lilttarrii seinSlle; ja antakoon 
sen vtBTCMi, joka jfifi, vuotaa alltarin 
pohjaan. Se on rikosuhri. ■ 

iO". Toisen nftfift hfinen uhraaman 
polttouhriksi, niinkutn iiiift on mfifi- 
rfiuy; Ja niin piH&apapinsovittaman 
hinen rikoksensia, mtnkfi hftnon teti^ 
nyt; ja seannetaan hfineile anteeksi. 

11; Mutia jos ei hfinellA ole kahta 
meMlstfi tahi kahta ntloi^ta kyyhkysIS, 
nHntuokoonrikOkseilsa uhrak^ikYM- 
menennen osan efua hienoja Jaiihe^ 

ia rikosuhriksi. ' iMuUa filkOOn pan- 
LO dljyfl sei) pdfille eikfi suitsutustn, 
sillfi se on rlkosuhri. 
' fOc J«K :hftnen tfiieo se viedft 'p4piU^, 
ja papHipitAA sillfi otUmah |yivon 
ffi^ydeni muistoksi, jti poltldman^n 
alltarilla ilerralle fuliuhriksi. Tfimfi 
«n' rlkosuhri; 3Mbo8.4ia8. 

13. Ja papin pitftft niin sovittanofan 
hfineUe hfinen Hkoksensai , ' mhikfl 
hftn Bfiissft asioissa rikkontitoil^iii 
se annelaan anieeksi hftneller^ Ja 
jfifinnOs-olkoon papin bma niitrictiln 
ruokauhrissakini 

14. Ja Herra puhui MoosekseUe, sii- 
noen: :. • 

15. Jos joku velvollisuutensa rik- 
koo ia erhehdyksestfi svniifi ' tekee 
jossakus&a mikfi Herralle pyhitelly 
on, hfinen pitfiA Herralle luoman 
.virheettOmfin oinaan laumasta, 8i» 
nun arviosi jjklKeen hopiasikte^ssft, 
fwhfin siklin jfilkeen* vU(aUhr4ksi 

16. Ja mitft hfin on pitAnyilueaansa 
pyjiitetvstfi , sen pitfifi hfinen anUb> 
man taicaisin, ja sen lisfiksi vielfiam 
lamaa viidennen osaa^ ja antamaa 
sen papille. Kun pappi niiw sovitk 
laa tifinet vikauhnn oinaalla« niin 
se hfinelke annetaan anteeksi. ^ : • < 

17. Ja jos joku rikkoo ja tekee jo* 
tnkuta Hemin kfiskyA vaslaani J*ia 



ei Hfinen ' t^lfiUiyt rikkbnwo.'^iMUi 
eisitA' tietftnyt, hfin on ' vianalarfl- 
nen, ^Ub&ttii. 

18. ja hfiilen ' pitfifi 'tubnm liaptHe 
virheettOmfin binaan' laumasta; si- 
nun arvios jfiifkeeH/ vikauhHksK Hinfi 
pappi sitten sovittaa hfinen tietfinifib- 
tOttiyytensfi; kOskfi hfin s^ oil ti^h- 
^nyt tielfimfittfiinsfi^, niinse Mnello 
annetaan akiteeksi. ' • ><• " 

19. Se on vikanhri i eillfi hfinon joa(- 
tunut Yiaklalaisdksi tterrati edessfi.* 



f ' r ( t ' < . 



I ■ f 



I O' I 



I ! 



6Luku., ,. ' " 

PoUtor, iliqk;a- Ja y;il)kiip78fi^tti9t|t ,, 

J a Herra puhui Moosek^eH^, ia- 
noen'* ' * ' '' •■'» I'iM'i -'.<"■■-.! 

2. Jbs jokli tekee iyntift |^ tfkkbo 
veivOllisuuteneaHen^avastaan^l^fel- 
tSen Ifihimmfiiseltfinsfi senvhiMibfl 
hfin hfinen haltuunsa afltlimlt 6n, 
tahi sen, jonka'hfin hSnen' kfiteenlsfi 
on nskonut, laikka jofika hfiA vfikf> 
v&nalia' ottanut oh; tahi stiilfi ettfi 
hfin vfifiryydeUa annstaa-jbtdin Ift- 
■himmfiiscitfiRn ; 4 Wabi, 6«8^ 

8.'teki siinftr ettft hftnt on loytfiny't 
kadonneeh tavar^n; jii kidtfifi seh 
vfifirfillfi valalla, tahi mitft'faVVfinsi 
blisi, ^ossa ihminen'lfihimlm'fitstfinisft 
vttstaan rikkoo; ' i . •• i 

4. niin pitfifi sen» jokal niin Oariki. 
konut ja Uilkbt Vikapfifiksi^ lahtahilin 
takAisin, mitfi hfin "vfldciVailalia >ot- 
tanut on ja vfifiryydellft' sMltannt 
huostaansa, nfin* myOs sen^ IhikA 
hfinen haltutinso oil annettti ,' lahf 
kadotetun , jonka hfiil lOytfinyt'oHv 

5. tahi kaikki, Joftka iMideh hfin 
vftfirfin.valan lehnyt* on, sbn pitfifi 
Mnen kaikki tyyni aMIaman takfiiL 
sin'jft vielfi sitten viidennen osan 
pafillisek9L Hfinto p«tfifi atltba kalkL 
ki sille, Jonka oma se oli, saimma 
pfilvfitifi kuin hfin 'vikaa&Hiksd ttto. 

6. Mutla vikanhrin^a pitfifi hfiheh 
iuoman Herralle; virheelttfimfin bl*> 
naan iaumiasta.diBttnarvios jfilkeein 

eitfifihfioen luomlan- papin tykO vi- 
auhriksi^ . - - ' 

7. Kun pappi soviltaa hfinen HfelS- 
ran edessft^ nlln hftllelle atlAeftaaii 
anieeksi, oli teko itelkA hyrfinsfi; 
joesa hfin its^asfi vikapflfik^isaattoi. 
'%, J« Herrarpuhui Meoseksetle, iiii 
noen: - ■ • . 

9^ Kfiske AAronille*jfi' hfinen pojii* 
lensa« tanoen*: tfimflodpblttouhrin 
sAfintO: polttouhrtn pilafi paMman 
alttarilla kaiken yfilfi oiamuiirt a»tii 
Ja alttavin liiili paMkoofi ten pfiAHA. 

10. Ja pappi pukomukooa^napali 



IW 



3 MOOS. 6. 7. 



iMn Jfa vfeurkfliC^n HhiAiS6t alusvaat- 
tee( inonsa p5SIIe ; ja korjatkoon sit- 
t«iT mhkari hlttarilta, kun iM polt- 
touhiiti on kuluttanut, Ja panicoon 
sen alUarin viereen ; 

11. ja riisukoon sit ten vaatteensa, 
ja pukekoon itseniK foisfih vaattei- 
siin Ja viekdOn tuhkan ulos leiristfl 
puhtaaseeii paikkaan. 3 Moos. 4:12. 

\2. Mut(a tuli on aina palava alt- 
laHtla, eikS kioskaan saa sanfimua. 
Sti papin pitfiiH sytytlftmfln halot sen 
p9§n5 joka aamu, ja hSnen pitaS 
asettaapolttouhri sen p5fille,ja polt'> 
Uia kiitosuhrin rasva s^n pdalla. 

13. TuJen pitHfi alindmaa palaman 
altfarilla ; se ei saa koskaan sammua. 

14. Ja tdniS on riiokauhrin sS5n- 
10; Adronin poikajn tulee kantaa se 
tfttarfllis Herran eteen: 

3 Moos. 2:1 ss. 4 Moos. 15:4. 

15. Papin pilSd ottaman pivon tdy- 
den niista hienoista Jauhoista, iolka 
ufiiifn kuuluvaft, Ja Otjystd, sekfl kai- 
ken suitsdttiksen , joka ruokauhrin 
p3311S on, ja p6lttaman sen altta- 

S'lla hyvaksi hfjjukst ja nriulstoksi 
ermlle. ' 3 Moos 2:9. 

n: Ja mikfi siitfi tdhteeksi jns syO- 
kMn Aaron poikfnensa. Happama- 
tonna on se syOtflvfi p^ii9ss& si- 
las$a; seurakunnan' mfajail pihassa 
tolee heldUn se syGdfl. 

17. AlkOOiK sita leiY6ttako hhpatiik- 
iea kan$$fi V'sjlIS se ott lieidSn osan- 
sa, jonka minft heille minun tuli- 
u^ristani antanut olen. Se otkoon 
biikkeiii pyhin; nHnkui;i rikosuhri 
|a vikauhh^ 

18. Jbkafnen hilelfenpuoli Aaronin 
lapsista ^yOkO^^n sitQ. Se oikoon ai- 
nainen saSntd Herran tuliuhrista 
snvusta aijkkuiiti. Joka niihin rupee, 
h9n on pyhUaty. 4 Moos. 18:9 s. 

'2 Moos. 29:37. 

19. Ja He|T^ pt^liuiMoosekselle, sa- 
Doen: 

20. Tffmfl dtkOQA Aaronin ja hSncn 
poikafnsa tihH, Jonka heidfln pitdfi 
uhrsaman Herralle sind pdiv9n9, 
Jona he vdidellaanf kymmenennen 
osan efaa hienoja jauhoja JokapSi- 
vUiek^nlokauhr1ksi,puoIen aamul- 
faija puolen ehtoolla. 2Moos. 16.3G. 

21. Pannussa se valmistettakoon 01- 
J^ kahssa Ja lelvottufna'kappaleina 
tmee sinun se uhrata niinkuin ruo- 
kiuhrikin; hyv^iksi hajuksi Herralle. 

22. Ja pappi, joka hftnen pojistan- 
ii hlnen sijaansia voideltava on, 
MikMn sen. Tftmft on oleva ijan- 
kattkfnen slianfO. Herralle pitdft 
K kokonansa pdlt^ttaman. 

8. SOIfi papin ruokauhripitfta afna 



kokonafnsa poltMtantatf ; «i Mti saa' 
sv6da. 

24. Ja Herra puhnl Moo^sekseUe, 
sanoen: 

25. Puhu Aaronllle ja hSnen pojil- 
lensa, ja sano: tAmiion rtkbsuhriir 
s59nt(}: mhs5 polttouhri teuraste-f 
taan, siinfl paikass^ pilfifl m^'Os* rt^ 
kosuhri tcurastcttamnn Herran cdes- 
sfl. Se on kaikkiefri pyhln. 

26. Pappi, joka rikosuhrin uhraa« 
sy6k6dn sen; pyhflllO sijalla 6n sc 
syOlilva, seurakunnan majan pi-i 
halla. 

27. Kuka ik5n3nsn sen lihaan kos^ 
kce, se oikoon pyhilelly : Ja Jos ver-i 
ta roiskuu JohonRin vaattcesen, oh 
se pest&vS pyhflssfi sijassa. ' 

28. Ja se saviaslia , Jossa se keftc- 
ta^Ti,' pitflS ftkbltaman. Jos sii; on 
vjiskisessa padassa keitctty, niin s« 
pitas hivulellartan Ja veddWvifuJ 
fettanian. SMoos. ii^. 

29. Kaikki miehcnpuoYet papetsta 
sydk5dt sen. Se on kuikkcin pyhin. 

30. Mutta rikosuhrla, jonka- verl 
viedSUn seurakunnan majaan, so- 
vinnoksi pyhakkdOh, sitS aikOdri 
syOtakO, vaan tulella poltettakoon. 

3 Moos. 4 :5. HetMr. 13 :1 1 . 

7 Luku. 

Edelleen vikauhreista ja kiitosubreista. 
Rasvaa Ja vcren sydiuisen kielto* 

J a tam9 on Vikauhrin sSfintf^: S6 
on kaikkein pyhin. 
^. Siina paikassa, missfi polftouhri 
teurastctaan , piiaa myOs vikauhri 
teurastettuman, ja sen veri priis- 
koitettakoon alltarille yll'ymptiH. 

3. Ja kaikki rasva siitS pitflS lih* 
rattaman, sek3 sapafo e1l5 rasva, 
Joka sisailykset peittfiS, 

4. ja molemmat munaskuut sen 
rasvan kanssa, kuin niiden p551l(l 
6n lanleissa, niinmyds maksan kal- 
vo, joka on irroitettava munaskui- 
den kohdalla. 

5. Ja pappipolttnkoonsehaTtfarilla 
lulinhriksl Herralle. Se on vikauhri. 

6. Jokaincn miehenpuoli papeistn 
syOkOOn sitA; 'pyh5ss-a sijassa on se 
sv6iavil; siHA se on kaikkein pyhln. 

7. Mfta on rikosuhrisia m5fir{illy, 
sc koskce my6s viknuhria; sillft 
yhiaiaincn on molcmpain sflSntO; 
Se 6n oleva sen pnpin oma, joka 
sllfa sovinnon lolniitiaa. 

8. Joka pnppi polttouhrin uhraa, 
hftnen onianansa oikoon sen poll- 
tbuhirln vuola, Jonka hfln uhranJ 
nut on. 

9; Ja kaikkinaincn ruokauhH, jo» 



J07 



3 MOOS. 7. 



ka uunissa kypsyletty on, ja joka 
pannussa tahi kattilassa valmistettu 
on, pitfifi papin oman oleman, jo* 
ka sen uhraa. 

10. Ja ruokauhri, joka on dljylld 
sekoitettu, taikka kuiva on, sen pi- 
tflft kaikkein Aaronin lasten yhtei- 
nen oleman, yhden niinkuin toi- 
senkin. 

11. Ja tfimft on kiitosuhrin s53ntG, 
joka Herralle uhrataan: 

12. Jos joku tahtoo tehdd ylistys- 
uhria, niin heiddn pitdd uhraaman 
vlistysuhrin lisdksi happamattomia 
leipifi, sekoitettuja GljyllS, ja hap- 
pamattomia ohuKaisia kakkuia, voi- 
deltuna Oljyllfi, ja pannussa kypsy- 
tetyitft leipia Gljyllfi sekoitetuista 
hienoista jauhoista. 

13. Happamien kakkujen pfifillfiuh- 
ratkoon nfln lahjansa, kiitos-ja ylis- 
tys-teuraansa lisSksi. 

14. Ja yksi kaikista niistft pitfifi 
uhrattaman Herralle yldnn^^sunrik- 
si, ja se on oleva sen papin oma, 
joka priiskoittaa kiitosuhnn veren. 

15. Ja ylistysuhrin liha hdnen kii- 
tos-teuraassaan' pitsa sinS pfiivdnft 
syOtfimfin, jona se uhrattu on, eikS 
mitSfin pidH tShteeksi jStettfimSn 
huomeneksi. 

16. Mutta jos joku lupauksen joh- 
dosta uhraa taikka tuo vapaaehtoi- 
sen uhrin, niin se pitSS sinfl p&i- 
vAnS sy6tfim5n, jona se uhrattu on; 
mutta jos jotakin tShteeksi jSS uh- 
rista, niin on se toisena pfiivfinfi 
myOs sy(}tfivd. 

17. Mutta jos jotakin vielfi tShteek- 
si i&S siitfi uhrin lihasta, niin se 
kolmantena pfiivftnft poUettakoon 
tulessa. 

18. Mutta ios joku syO kolmantena 
pfiiv&nS kiitosuhrin lihasta, niin ei 
ole hfln otollinen, joka sen on uh- 
rannut, eikft sitS hSnelle hyvdksi 
lueta, mutta se on kauhistus. Joka 
siitfl syO, on vikap^fi pahaan tekoon. 

19. Sitfi lihaa, joka sattuu jbhonku- 
hun saastaisuuteen, ei pidd sy(}tft- 
mftn, mutta se on tulessa poltettava. 
Muulen joka puhdas on, hfin syO- 
kfiGn puhtaasta lihasta. 

20. Ja se joka oUessaan saastutuk- 
sen alaisena sy6 kiitosuhrin lihasta, 
siitft, joka Herran oma on, hSn on 
juurrutettava pois kansastansa. - 

21. Jos joku koskettaa johonkuhun 
saastaisuuteen, olkoon se saaslainen 
ihniinen tahi saastainen elfiin tahi 
mikS muu saastaisuus tahansa, ja 
hfin syO kiitosuhrin lihasta, siitfl mi- 
kfi Herran oma on, hSn on juurrutet- 
tava pois kansastansa. 3Moof.ua68. 



22. Ja Herra puhui Moosekseile, sa- 
hoen: 

23. Puhu Israelin lapsille, sanoen: 
ftlkflftt mitfiSn rasvaa syOkO hflrjistd, 
lampaista tahi vuohista. 

8 Moos. 8:17. 9:10. 

24. Raadon tahi revityn elfiimen 
rasvaa kfiytettflk66n kaikkinaisiin 
tarpeisin ; mutta dlkfi&t sitA missflftn 
tapauksessa sy6k6. 

25. Sillfl joka syO rasvaa siitft elfti- 
mestS, joka Herralle tulijuhriksi on 
annettu, hftn on juurrutettava pois 
kansastansa. 

26. AlkftAt myOskftfin syOkO verta, 
ei linnuista eikd elfiimistft, missfl 
paikassa asunettekin. 8 Moos. 8:17. 

17:10^14. 19:2«. 6 Moos. 12ae,28. 
Ap. 1 15:»)^29. 21:25. 

27. Jokainen joka syO verta, on 
juurrutettava pois kansastansa. 

28. Ja Herra puhui Moosekseile, sa- 
noen: 

29. Puhu Israelin lapsille, sanoen : 
joka Herralle kiitosuhrin uhraa, hft- 
nen pitftftuhriteuraastatuoman Her- 
ralle mi^ hftnelle tulee. 

30. Hftnen pitftfi kantaman sen kfi- 
dessfthsfl Herran tuliuhriksi ; rinnan 
rasvan hfin tuokoon rinnan kanssa 
hSfilytysuhriksi Herralle. 

31. Aiutta pappi polttakoon rasvan 
alttarilla, ia rlnta on Aaronin ja hft- 
nen poikainsa oma. 

32. Ja oikian lavan pitfifi teidftn 
antaman papiile lahjaksl teidfin kii- 
tosuhristanne. 

33. Ja se Aaronin pojista, joka uh- 
raa kiitosuhrin verta ja rasvaa, hftn 
saakoon oikian lavan osaksensa. 

34. Sillfl minfi olen ottanut Israelin 
lapsilta heidfin kiitosuhristansahftft- 
lytysrinnan ja lahjalavan, ja olen 
he antanut papiile Aaronille ja hfi- 
nen pojillensa ijankaikkiseksi oikeit- 
deksi Israelin lapsilta. 2 Moos. 29:27 as. 

35. Tfimfi on Aaronin ja hSnen poi- 
kainsa osa Herran tuliuhrista, se 
osa, joka annettiin sinfi pfiivftnfi, jol- 
loin he aseteftiin Herran papeiksi. 

36. Nfimfi Herra kfiski sinfi pfiivft- 
nft, iona hfin heidfit voiteii, annet- 
tavaksi heille Israelin lapsilta, ijan- 
kaikkiseksi oikeudeksi suvusta su- 
kuun. 

37. Ja tfimft on laki poltfouhrista, 
ruokauhrista, rikosuhrista, vikauh- 
rista, niin myOs tSytOsuhrista ja 
kiitosuhrista, 

38. tonka Herra Moosekseile kftski 
Sinaln vuorella sinfi pfiivfinfi, jona 
hfin sfifisi Israelin lapsille, ettfi hei- 
dfin piti uhraaman unrinsa Herralle 
Sinain' korvessa, 8 Moot. 26:4S. 27;94, 



109 



3 MOO$. 8. 



8 Luku. 
Papit vibita&n. 



fa Herra puhui Moosekselle, sa- 
" noen: 

2. „Ota Aaron poikinensnja hcidfin 
vaatteensa, ja voileluOljy, niin myds 
hdrkS rikosuhriksi ja kaksi qinas- 
la, ja myOs kori happamattomia lei- 
piS, 2 Moos. 28:2. 29:1 ss. 

3. ja kokoa kaikki kansa seura- 
kunnan majan oven eteen." 

4. Mooses teki niinkuin Herra hft- 
ncllc kaskenyt oli ja kokosi kan- 
san seurakunnan majan oven ^- 
Icen. 

5. Ja Mooses sanoi kansalle: y^iSiiSi 
on Herra kSskenyt tehda.** 

6. Ja Mooses otti Aaronin poikinen- 
sa, ja pesi heidat vedellfi. 

7. Ja hdn puetti hSnen yllensfl iho- 
paidan, ja vyOtti hSnen vyOllfl, ja 
puetti h9net vaippaan, ja pani olka- 
vaatteen hflnen paSUensft, niin my^is 
v^dtti hilnen olkavaatteen vy611fi, ja 
kiinnitti puvun silld. 

2 Moos. 28:31 ss. 29:5 ss. 

8. Ja pani hSnen pftdllensd rinta- 
kilven, ja pani rintakllpeen „urini ja 
tummim.'^ 2 Moos. 28:30. 

9. Ja hSn pani hiipan hfinen pdS- 
]i5nsfi; ja kiinnitti hiippaan hSnen 
otsalleiysa kultaisen otsalevyn, py- 
hAn kruunun, niinkuin Herra Moo- 
sekselle kllskenyt oli. 2 Moos. 28:36,39. 

10. Ja Mooses otti voiteludljyn , ja 
yoiteli majan ja kaikki mitft siinA oli, 
ja pyhitti ne, 2Moo8.90:258s. 4 Moos. 7:1. 

11. ja priiskoitti siitS seitsemSn 
kertaa afttarille, ja volteli alttarin 
ja kaikki sen astiat, ja pesoastian 
jalustoineen, ja pyhitti ne. 

12. Ja hfin kaasivoiteludljystA Aaro- 
nin pilSn pftfille, ja voiteli hSnen ja 
pyhitti. Syr. 45:18. 

13. Ja Mooses toi Auronin pojat, 
ja puetti heidSn yllensd ihopaidat, 
vydtti heidat vy(}im ja sitoi lakit 
neidfin padhansS, niinkuin Herra 
hfinelle kftskens^t oli. 

14. Ja han antoi tuoda haran rikos- 
uliriksi, ja Aaron poikincnsa pani 
kStensarikosubrin haran paan paai- 
le, 2 Moos. 29:10. 

15. ja Mooses teurasti sen, ja otti 
veresta, ja pyyhkaisi sormellansa 
alttarin sar\'iin yltympari, ja puh- 
disti alttarin, ja kaasi veren alttarin 
pohjalle, ja pyhitti sen sovitukseksl. 
.16. Ja han otti sisailysten rasvan 
ja maksan .kalvon, ja molemmat 
munaskuut niitten rasvan kanssa; 
ja Mooses poltti ne alttarilla. 

17. Mutta naran vuotinensa, lihoi- 



nensa ja sontinensa poUti han tules- 
sa ulkona leirista, niinkuin Herra 
Mooseksellc oli kaskenyt. 

2Moos.29:Uss. 

18. Ja han toi oinnan polttouhrik- 
si ; ja Aaron poikincnsa punivat ka- 
tensa oinaan paan paaile. 

19. Ja sitten se tcurastettiin, ja Moo- 
ses kaatoi sen veren alttarillc yll'« 
ympari. 

20. Mutta oinaan leikkasi han kap- 
paleiksi. Ja Mooses poltti paan ja 
kappalect ja rasvan, 

21. ja pesi sisailvksct ja jalat vc- 
delia; ja niin Mooses poltti koko 
oinaan alttarilla. Se on polttouliri 
hyvaksi hajuksi, se on tuliuhri Hcr- 
rane, niinkuin Herra handle oli 
kaskenyt. 

22. Ja han loi my6s toisen oinaan. 
tayt6suhrin oinaan, ja Aaron poiki- 
nensa pani katensa oinaan paan 
paaile. 

23. Sitten se teurastettiin, ja Mooses 
otti sen veresta, ja pyyhkaisi siia 
Aaronin oikiankorvan fehteen, niin 
myOs oiklan kaden peukaloon, ja 
oikian jalan isoon varpaasen. 

24. Senjaikeen Mooses toi my(}s 
Aaronin pojat, ja pyyhkaisi vcrta 
heidan oikian korvansa lehteen, ja 
heidan oikian katensa peukaloon, 
ja heidan oikian jalkansa isoon var- 
paasen; ja muun veren Mooses kaa- 
si alttarille ylfympari. 

25. Ja han otti rasvan ja saparon 
ja kaiken sisdUysten rasvan, ja mak- 
san kalvon, ja molemmat munas- 
kuut rasvoinensa, niin myOs oikian 
lavan. 

26. Ja korista, jossa happamatto- 
mat leivat olivat Herran edessa, 
otti han yhden happamattoman lei- 
van, ja (iljylia voidcllun kakun, 
ja ohukaisen leivan, ja pani ne ras- 
van ja oikian lavan paaile. 

27. Ja kaikki nama antoi Han Aaro- 
nin ja hanen poikainsa kasiin, ja 
haaiytti ne haaiytys-uhriksi Herran 
edessa. 

28. Ja sitten otti Mooses ne heidHn 
kasistansa, ja poltti ne alttarilla 
polttouhrin paaiia. Se on tAvtOsuhri 
hyvaksi hajuksi, se on tuliuhri Her- 
ralle. 

29. Ja Mooses otti rinnan ja haa- 
iytti sen haaiytys-uhriksi Herran 
edessa ; tay tdsuhrin oinaasta sai Moo- 
ses taman osakseen, niinkuin Herra 
hanelle kaskenyt oli. 

30. Ja Mooses otti siita voiteluOljys- 
ta ja veresta, joka oli alttarilla. ja 
priiskoitti Aaronin ja hanen vaatet- 
lensa paaile, niin myOs hanen poi- 



109 



3 MOOS. «. 9. 



kaimn jn hcitinn vanlcltcTfsa p<'»:llle, 
jti pyhftii iiiin Aaroiiin jn hrmeti 
vnaltocnsn. nlin myOs lifViicn poi- 
kniisa ja hcid;\n vhatlocnsa iKiiicii 
kans^aiisa. 2Mo(»s29 2i. 

31. J a Mooscs sanoi Aaron iUe jn 
hAiH'ii pojillcnsa.t : koitiaUzHil iiha 
scurakiinnan majaii oven cdessH, 
ja'^yOkclSl St? shna paikassa Iclvjln 
kanssa, joka on lAytosulirin korissa, 
niinkuin mina kAskin. sanoen. , Aa- 
ron poiliinnisa svokofti ric* 

32. Vaan mi la jiin tahtceksi Hhnsia 
ja Iclvftslii, sen Icidan pitaa pollta- 
man tuU'Ssa. 

33. Ja filkSal Ialiick6 scilscmantl 
pfiivtlnn seurakunnan majan ovesla 
pols, siksi kiiiincs tcidan laytosuh- 
rinno paiv;U taylelaau, silla seilsc* 
mllnA paivflna 'loidfln kAlcnnc lay- 

tctanr* 

31. Niinkuin st tnnApAni) Ihpahiii- 
nut on, niin on llerra kaskenyt leh- 
da, ellil fe sovifeUaisiin. 

35. Ja teidAn p?laa oleman scllsc- 
mfln paivAft seurakunnan majan 
oven edessA. paivAl ja \ot. ja leidan 
pilAA ottamnti vaarinllerran kas- 
kyislA.ell eile kuolisi, silln niin on 
niinulle knskelly ** 

3ti Ja Aaron poikinensa teki kai- 
ken sen, niilA llerra Mooseksen 
kautta oli kAskenyi 

9 Luku. 
Aaroiiiii ciisimniainea ubh. 

J a kahdeksanlena pAivAnA kutsui 
Mooses Aaroiiin ja hAneh poikan- 
sa, niin niy6s vanhininiat l.sraelisla, 

2. ja-sanoi Aaronille ,,Oia nuori 
vasikka rikosuhriksi ja oluas polt- 
touhriksi, molemmat virlieeitftniril. 
ja tuo Herran eleen 2 Moos 2*11. 

3. Japuhu Israehnlapsilte. sanoen 
otiakaat kauris rikosuhriksi, jn va- 
sikka ja karttsa, molemmat vuosi- 
kautisel ja virhecUOmAt, poltlouh- 
riksi, 

4. sekA myOs hArkA ja oinxis kiifos- 
uh riksi Herran edessA. ja tehkAAt 
ruoknuhri sekoitellu oljvlla. silIA 
lanApanA ilmeslyy Herraleille ** 

5. Ja he loival ne, milA Mooses oli 
kaskenyt, seurakunnan majan oven 
eteen, Ja koko kansa tuli , ja seisoi 
Herran edessA 

6 Nlin sanoi Mooses: ..lAtAonHerra 
kAskenyi teidiin tehdA, ja Herran 
kunnia'on ilmestyvA leille '* 

7. Ja Mooses sanoi Aaronille ..astu 
alttarin t3»'k5, ja tee rikosuhrisi ja 
poltlouhrisi, ja sovila ilscsi ja kan- 
sa, ja uhraa sUten kansan uhri ja 



sovita lieidAI, niinkuin Herra on 
kAskenyi.** 

8. Silloiii Aaron aslui alttarin luo, 
ja 1eur<:kstrvabiknn rikoifukpilisensa. 

9. Ja Aaronin pojat kantoivat JlA^ 
nelle veren, ja hAn kasti sormcnsa 
veroen, ja pyyhkAisi sitA altiariu 
sarvtin, mutta rauun vereii kansi 
hAii alttarin pohjaan. 

10. Ja rikosuhrin rasvan, munos- 
kuut, ja maksaii kalvoii poJtti hAn 
alitarilla. niinkuin Uerra oli Moo- 
sekselle kaskenyt. 

11. Mulla iihan ja nahan poltti hStti 
tulessn ulkonn k'iristA. 

12. Sitte han teurasti polltouhrin; 
jn Aarontn pojat kantoivat vercii 
hAnelle, ja hAn priiskottti sen alU 
tarille ylt'ynipAri 

13. Ja he'toivat niy6s polttouhnn- 
leuraan hAnHle« kappaleiksi leika- 
lun, ja sen pAAn, ja hAn poltti no 
alitarilla. 

14 Ja liAu pesi sisAllyksel ja jalat* 
ja poltti ne polltouhrin pAAllA, alt* 
tarilla. 

15. Senjalkeen toi hiin csille kan- 
san uhrin Han cUi kaunin, joka 
oli kanxin rikosuhrin- leu ras, ja 
teurasti sen, ja uhrasi sen rikosuh<» 
riksi siHiialla tavalla kuiase edelli- 
neii rikosuhri uhrattiin 

IG. Ja hAn toi myi^s polltouhrin, 
jn uhrasi sen saadetyllA tavalla, 

17 Ja loi ruokaulirin, ja otti siitsi 

f>ivonsa lAyden. ja poltti nealttaril- 
n. paitsi aamullista |)olttouhria. 

18. Sitlcn teurasti hAn hArAn ja oi- 
naan kansan kiilosuhrikst, ja Aaro- 
nin pojat kaiHoival veren hAnell«, 
ja hAn kiuisi sen alttarin pAalle yit- 
y 111 pan 

' 19 Ja liAriin rasvan, ja oinaan sa- 
|)aron. ja sistUlyslen rasvan, ja mu- 
naskuut, ja maksan kalvon, 

20. kaiken lAmiin rasvan panivat 
he riniain pAAlle, ja hAn poltti ras- 
vakappaleet alitarilla 

21 Mutta rinnal ja oikian lavan 
haalyiii Aaron haAlytysuhriksi Her- 
ran cdessa, niinkuin Herra oli k^ls- 
ken>l Moosekselle 

22 Ja Aaron nosli kAtensA kan^^n 
puoleen. ja siunasi heilA Ja silte- 
Kuin han oh uhrannut hkosuhrm. 
polltouhrin ja ktilosuhrin,aslui hAn 
alas 4 Moos. fK'j.1 *^. 

23. Ja Mooses ja Aaron men iva I seu- 
rakunnan majaan, ja kun he sielta 
tuli\at ulos. siunasivat hi kansan. 
Silloin nAkyi Herran kunnia koko 
kansalle 

24. Ja tuli tuli Hcrralta alas, ja 
kulutti polttouhrin Ja sen rasvan 



no 



3 MOOS. a» 10. 



rieimiitslval h«< <suur«sti, |a'laAke*: 

^' l'KQn.'18:9S«t^ 9 A4lci 9:1. 4!M**.oic<.2:l«. 



H<'< J.t> 



"i 



P; •-' ' I •-.)»! 



M 



ici Luktr; 

Amain poikien r^ffoU^ ,l^iUtnUS!J$ 

, jxipeuie.; ; 

uffft Aaron in 'pojM Nadab Ja Abi* 
boottiYBt kuin}>lkaniui<suiusas- 
iwmk, paiYi vat • tuHah iiiiliiiH 'ja pa- 
nivat' suitsuHista ^e|i.b&tiH^, ja^kan- 
tokat Yierasta firita^lierrani idteen, 
jota«i HAn hdlle )(i>l>dt'kftskeny<v 
2. Sl)k)in laksi tuHHerVailta* Jd ku- 
hrtti hekii4>« fiiWr ettfr-'h^ JtuotWat 
Herran edessa. 3 Moos, 10:1. 

4MoM.d:4^ ^M^ liAik.24:2, 

}. Niin sanoi Moose»AaronH4e > ,,k&- 
mS on se mitfi Herra puhiunul on, 
^imoen:'<niiIle4 Jo1^< minua Iflh&s^ 
ly^'il, osoitan Hseni pyhftksi, jb k6- 
ko kansalte Itthdon mton nAyl^ftS 
IraimNHii.Vi Ja Aaron oli fifineti. 

• eMbos.2§i4S; Pit. l8tMs8. 

4. MiiOa ' Mbosles kiltstti > M«sdeiln 
ja £lsaraninv»4Hi«lkiiiAan)niii s«- 
1^* po»at.|a sanoi h^illet ,,(iilkaat 
ja kaniakaat vdicnne pdH pyMkOs- 
lAJa viekAlU bei^tfitukis 3e4l>i&t|l/' 

' '' ' aMoos.J©{l4,a«i'4Moe8i8cl0r 

5. Silloin lie 1uliH/a« jo 'kUn4oiv»l 
neMM vaaUeiiswin uk>s4«iri»l», hiin- 
wuki Hooseif^Ii sanoriuL .> .. 

i Niin Ganoj Modsds* AaitonHie'ja 
htoen pojill^nsa EteasariHa Ja> Ila- 
marillet^^lUkaMipaljttslako p^Atiln- 
ne, filkAfi»kft/pavii$kO vaall<}itacurie< 
eUclle'kuolisiv'jlK eHei^vilia n>liii 
koko kansan pftAllei. Mull* teid&n 
^^kiMie« koko UraeHnhuone^titke- 
wm tfllfi piak)av i^nkaiHerra^sytyt* 
i*ayiion..., .. .;...• i;,, . 

7. Alkfiiit myds mcnkft cdumkunt 
lan majan o^iresta ulosi tlUtte-kuo- 
lItl;^Uft Herran voil«lttmjy «n4ei- 
din pftAlUlnne.'' Ja he tekivftlniin- 
luiiB Mooses sationut.oli. 

8. Ja Herra pufiui Aarpoillie, saitoen : 

9. ,«Viinift Ja. vAkieviti iuomaa* et 
wiA«i\*AAiai poikasi<saajuoda/<knn 
le^menetle seunakunnanmajaan, eltn 
«U« kuoUsij.jSe.piinAoIeniaji ikui- 
oen sfiSntO teille suvusta sukuuin. ..- 

/ m^w 44:2£.; 1 Tim^tUL. Tilt 1:7. 

10. TcidfinjUU^e tofadA.aroa pyhi&n 

jaepipyhfin,.yAlUlili .saastAisen ja 
puhiaan vSlillA; 

11. ia teidto.tuliQe.QpeifaaJsraelin 
lapsfUe kaikki QlkcMdet, mHkft Hert 
n kelUe. Moofieksen.kauUa pubu^ 
nul on." 

i2.Ja.MooAfA pubul.A^'^n^He^a 



hfin^n UikBeille po|iUensa,,Bleas»* 
rilleja Itamarille: MOttAkaatfloruor 
kauhri« joka tAhieeksi jAS^iy ton Her- 
ran tuliuhrista, ja syOkSftl se happAi 
maltomanaalttarin tykdnA ; siUA se 
on kaiklceia pybio. aJ4eo8.2S. 6:11.. 

13. Ja syOkSfit se pylifissfi-pailcassa;. 
sillA se x>n sihun ja .sinpn poikaisi 
osa Herran toliuhnsta; hiia Da:nii- 
nulle kaskelty. . , 

Ui'Jiliilta hfifiijrtysrinn^n. ja uhri- 
lavan ipitAfi skiun ia sinun . poikasi 
jfl'tyttAresi sinun.kanssasi syOmfia 
pulitaalla .paikaila^ sillA .tfimftiosa. 
on siiHille ia sinun pojillesi annet- 
tfi Israelin lasten kiilosubrista. 

... aMooe. 29:24.. 

15. Sillfi uhrilapa ja iiiilylysrinta^ 
ynnS tuliuhrien rasvan kanssa^ pL- 
UUl kannettamaa sisfiile hfi|ilylettft-< 
vfil4s4 hflMytys-uliriksi Herran. edes-j 
sAvsentiUKiea ovat ne sinun. jaisir; 
nun Jastesi omaAijankaikldbien sfi9n-r 
n6n fliukaan, niinkuin Herra; kfis- 
kefnyt on/* i 

16.. Ja I Mioses clsi ahkecaati riko&-< 
uhrin kaurista, ja kalso, se.oli pol- 
tetlu. SUloia lifin vihastui Eleasariin 
ia I4ainariiii» Aaronin jfl&neisin poi- 
kiin, sanoen: . aMooe.9t:3. 

17. ,<Mikse(te^ ole sy<^neel rikosuh- 
ria pyhissfi) paikassa? ^UA se lOn 
kaikkein pyliin. Ja hSn on.anlanul 
teille 's<n^ efctA leidia pilA|l> kanla- 
man Jcansan rikokset, ja sovlKamap 
heidfit Henran.i^essfi. 

18w Katso, sen veri ci ole tjuolu py- 
hfikkMn ; teiddn oUsl pitAnyl «yOdft 
liha pyhflssA paikas»a, AiinkuUi mU 
nA olen kflskehyt.**., . 9Moo9«.«^, 
.19. MiiUta Aaron sanoi MoQseksell^:' 
„kalso,.tfinApAnA ovat he uhranneet 
rikosu)irlnsa ja poltloulirinsa lier- 
ran edessA ; ja minulle on tapahtu-* 
put, niinkuin sinA tiedAt PiUUslk^ 
mipuQ l^ApAnA sy(Mn3n rikosul)- 
rista, olisiko se Herralle otollista?''i 
.20. iCun Mooses sen kuuli, tyylyi 
hAn siihen. 



t , 



II Luku* 



takl piAitalftta ja Baastalsiflta elAimlsUt. 

J a Herra puhui Moosekselle ja Aa- 
ropille, sanoen heille: 

2. Puhukaat, Israelin lapsille, sa- 
naen:.n^n%A ovat elAimet,, Joita te 
kaikista nelijalkaisistt^ maai^ pAAl- 
lAfSaatte syOdA. &moos, i4:4 8s. 

. . ' 4p,t.|0;H. 

3. Haikkla kaksisorkkaisia el&imiA, 
jotka sbrkkansa kokonansa liajpit- 
tavat Ja mArehtivAt, saalte te syOdA. 

i, Kuit^nki^an nAitA ette saa sy(>dA 
hiistft, jolka mArphMyl^.U? ftyP^lMHr, 



in 



^ MOOS. 11. 



sisorkkaiset, nimittHin : kameli, jo- 
k^ kyll§ mftrehtii, vaan ei hajolta 
sorkkiansa, se olkoon teille saas- 
tainen ; 

5. kanini , Joka mftrehtii, mutta ei 
olekaksisorkkainen; se olkoon teil- 
le saastainen: 

Q. ja jftnis, joka tosin mfirehtii, vaan 
ei ole kakslsorkkainen ; se olkoon 
teille saastainen; 

7. Ja sika, joka on kakslsorkkainen 
ju kokonansa hajoittaa sorkkansa, 
mutta ei mftrehdi; se olkoon teille 
saastainen. 5MooB. 14:8. l Mailck. VM. 

2Makk.6:18. 

8. Naiden lihaa ei teidfin pldfi syO- 
mfin, eikfi heiddn raatoihinsa kos- 
keman; sillli ne ovatteill6saastaiset. 

9. Nfiitfi' te saatte syddS kaikista 
niista, jotka vesissft ovat: kaikkia, 
joilla on uimukset ja suomukset ja 
jotka oleskelevat vesissd, oil se me- 
ressfi tahi virroissa, niitS te saatte 
syddd. 5 Moos. 14:9t. 

10. Mutta kaikki meressH ja vir- 
roissa olevat, joilla ei ole uimuk- 
sia ja suomuksia , kaikkien niiden 
seassa, jotka liikkuvat ja eldvSt ve- 
sissfi, — ne pitSS bleman teille iletys. 

11. Ne olkoot teille iletyksenfl; nii- 
den lihaa ei teidfln pidfi sydmlin, 
ja niitten raadot olkoot teille kau- 
histuksena. 

12. Silia kaikki vesissft elfijSt, ^il- 
ia ei ole uimuksia ja suomuksia, 
ne olkoot teille kauhistus. 

13. Linnuista olkoot nSmfi teille ile- 
tyksenfi; dlkSftt niitfi sy6k0, sillS ne 
ovat llettAviA: kotka, ja luukotka, 
ja kalakotka; . SMoos. I4:i26a. 

14r sSSski ja ilma-haukka li^ineen; 

15. ja kaikid kaameet lajineen; 

16. kamelikurki, tarhapOUO, kala- 
kaija ja haukka lajineen; 

17. huhki^a, merimetsfls jahyypift; 

18. ydkkO, ruovonpdristloa Ja pe- 
likani ; 

19. haikara ja papukaija lajineen, 
harjalintu ja nankasiipi. 5 Moos. 14:18. 

20. Kaikki ne silvelltset matelijat, 
jotka liikkuvat nelj311djalalla,olkoot 
teille iletys. 

21. Kuitenkin saatte siivellisten jou- 
kosta, jotka liikkuvat neljdllfi jalal- 
la, sydda niita, joilla jalkaln ylS- 

Euolella on kaksi sftSriS, joilla he 
yppelevflt maan pdSlia. 

22. Ja nSitft te saatte syOdft helstfi, 
nimitldin: arbe lajineen, ja soleam 
lajineen, ja hargol lajineen, ja ha- 
gab lajineen. 

23. Vaan kaikki muut, Jotka ovat 
nelijalkaiset sijvellisten joukossa, 
ne olkoot teille iletys. 



24. Ja ne pitflkfiflt saastaisenn; J<»- 
ka koskee niitten raatoihin, se ol- 
koon saastainen iltaanasUvS Moos. 5:2, 

25. Ja joka niiden raatbja kantaa, 
se pesk60n vaatteensa, ja olkoon 
saastainen iltaan asti. 

26. Kaikki ne nelijalkaiset elfiimet, 
jotka ovat kaksisorkkaiset, vaan ei- 
vftt kokonansa hajoita sorkkiansa, 
eivfltkfl mftrehdi, ne olkoot (eillo 
saastaiset; ja jokain^n, joka niihih 
koskettaa, pitftft oleman saastainen.. 

27. J9 kaDiki, jotka kftyvfit kftm- 
menillfinsft nehjalkaisten petojen 
seassa, ne olkoot teille saastaiset; 
jokainen, joka koskettaa heidfin raa- 
toihinsa, olkoon saastainen iltaan 
astii 

28. Ja Joka kantaa heidftn raato- 

i'ansa, se pesk66n vaatteensa, Ja ol- 
Loon saastainen iltaan asti; slllft 
kaikki nftmft olkoot teille saastaiset. 

29. Ja niiden elftinten seassa, Jotka 
matelevat maan pftftllft, olkoot teille 
saastaiset : myy rft , hiiri , maakro- 
kodili, jokainen lajineen, 

30. tftfaitilisko, kameleontU, sisilisko. 
sinisisilisko Jq salamandeiri. 

31. Nftmft olkoot teille saastaiset 
kaikkein niiden sei^sa^ jotka mate- 
levat ;-ja joka koskee niihin sitte- 
kuin ne kuolleet ovat, olkoon saas- 
tainen iltaan asti. 

32. Ja Jokainen kappaie,Jo'nka.pftftl- 
le sellainen kuollut elftin putoaa, 
tulee saastaiseksi, oil sesittenpuuas- 
tia, tahi vaate, tahi nahka, tatti sftk- 
ki, tahi joku ase, Jolla Jotakin teh- 
dftftn; Ja se on pantava veteen, ja 
oleva saastainen iltaan asti, niin se 
tulee puhtaaksi. 

33. Ja saviastiat, jolhinka senkal* 
tainen raato putoaa, ovat kaikki saas^ 
taiset Ja mita niissft on, Ja. astia pi- 
tftft rikottaman. 

34. Kaikki ruoka;JotasyOdftftn,jos 
se vesi tulee sen pftftlle, onsaastai-. 
nen, ja kaikki J noma, Jota Juodaan 
senkaItaisistaastioista,onsaa8tainen. 

35. Kaikki, jonka pftftlle senkal- 
tainen raato putoaa , tulee saastai- 
seksi. Jos se on uuni tahi kattila{ 
on se rikottava, sillft se on saaatai* 
nen. Ja teidftn tulee pitftft se saas* 
taisena. 

36. Kuitenkin lfthteet,kaivot Jalam- 
mikot ovat puhtaat; vaan Jokainen, 
joka koskee niitten raatoon,on saas- 
tainen. 

37. Ja jos senkaltainen kuollut e- 
Iftin lankeaa siemenen pftftlle, Joka 
kylvetty on , niin on se kuitenkin 
puhdas. 

38. Mutta jos vettft tulee siemenen 



112 



3 MOOS. 11. 12. 13. 



plille, ]a joku senkaltainen raato 
putoaasen pASlle» niinsiemen tulee 
saastaiseksi. 

39. Ja jos joku nelijalkainen elftin 
kuolee, lota teidfin on lupa syOdft, 
ja joku koskee sen raatoon, hftn on 
saastainen 6htooseen astL 

40. Joka syO senkaltaisesta raados- 
ta^ hSnen pitftA pesemdn vaatteensa 
ja oleman saastaisen iltaan asti, 
niin myOs se, joka kantaa sen- 
kaltaisia caatoja, pesk06n vaatteen- 
sa ja olkoon saastainen Htaan^ asti. 

4t Ja kaikkl elftimet, jotka tnate- 
levat niaan pftfillft, olkoot teille ile- 
tyksenH; niitft ei saa sy5da. 

42. Niista emimistfi, jotka joko vat- 
sallansa matelevat,: tahi kfiyvflt nel- 
jftllft tahi useammalla lalalla, kai- 
kellaisista, jotka matelevat maan 
pSailS, ei pida teiddn yhtftfln sy6- 
infto; sillft ne avat iletys. 

43. AlkSfit myOskftSn itsefinne il6- 
tykseksi tehkd semtnoisen elfiimen 
kauHa ja fllkdftt saastuttako itseftn^ 
ne niissS, niin ettS > te tulette saas- 
taiseksi. 

44. SiUft mina olen Herra, teidAn 
Jumalanne; sentfihden teidfin pitflfi 
pjhittSmfin itsenne, ettft te tansitte 
(>yhSksi; sillS minftkin olen pyhftv 
AlkS&t saastnttako itsefinne jonkun 
matelevaisen elSimen kautta, joka 
matelee maan pfiftllS. 

8M008. 192. 20:7. it^iet 1:16. 

45. SilU minS olen Herra, joka tei- 
dSn johdatin Egyptin maalta, ettft 
minft disin leidfin Jumalanne. Sen- 
tShden teidSn pitSS oleman pyhftt, 
slltt mina olen pyhft. 

46. TSmft on laki kalkista nelijal- 
kaisista elftimista ja linnijiista, ja 
kaikista, jotka vesissS liikkuvat, ja 
kaikkinaisista elfiimi^tfl, jotka maal* 
la matelevat, 

47. etta tietaisitte eroittaa puhtaat 
saastaisisla, ja mitS elfiimifi saa syd- 
d9, ja mita ei sovi sydda. 

12 Luku. 

Lapaen sypnytt&J&n puhdistoa. 

la Herra puhui Moosekselle, sa^ 
** riden: 

2. Puhu Israelin lapsille, ja sano: 
vaimo, joka siittaa ja synnyttaa pol- 
kalapsen, olkoon seitsemBn paivaa 
saastaisena, niinkuin karsiessailsa 
kuukaatista sairauttansa. 

8 Moo». 16:19. Ltink. 2:22. 

3. Ja kahdeksantena paivana pitaa 
lapsenesinahkaympaiileikatlaman. 

IMoos. 17:12. Lank.2:21. Job.7'.228B. 

4. Matta vaimon pitaa oleman ko- 



tona kolmeneQattakymmenli vif vftft 
puhdistuksensa veres8a;ei han saa 
koskea mihinkftan, joka pyM on, 
eikft hanen nida pyhakkOOn tule* 
man, ennen kuin fian^n puhdlstus- 

paivansa taytetaan. 

5. Mutta jos han synnyttaa tyttOlap* 
sen, niin olkoon saaslaisena kaksi 
viikkoa, niin kauan kuin hdn kar- 
sii sairauttansa; ja kuusiseitsemat- 
takymmenia paivaa pitaa hanen ko- 
tona oleman puhoUstnksensa veressa. 

6. Ja kun Mnen puhdistuspaivan- 
sa, oU se pojan tahi tyttaren syn- 
tymisen jalkeen, ovat taytetyt, niin 
tuokoon vuosikautisen karitsan poll- 
touhriksi, ja nuoren kyyhkysen tahi 
mettisen rikosuhriksi , papille seu- 
rakunnan majan oven eteen, 

' 7. ja hanen pitaa ne uhraaman 
Herran edessa, ia sovittaman haoen» 
niin han puhdistuu verensa juok- 
susta. Tama on laid lapsensynttyl* 
tajasta^ joka on pojan synnyttanyt 
ja jolui on tytOn synnyttanyt. 
8. Jos ei hanelia ole varaa karitsa* 
han, niin ottakoon kaksi mettista, 
tahi kaksi nudrta kyyhkysta, toisea 
polttouhriksi ja toisen rikosuhriksi. 
Ja niin papin pitaa sovittaman ha* 
nen, etta han puhdistettaisiin. 

8M008. 6:7. Iiuuk. 2:31. 

13 Luku. 

Laki spitalitautlslsta. 

J a Herra puhui Moosekselle ja Aaro* 
nille sanoen: 

2. Jos ihmisen ihoon tulee ajos, ta* 
hi rupi, tahi syhelma, niinkuin spi- 
falitauti tahtoisi tulla hanen ihoon- 
sa, niin han vietakOOn papin Aaro* 
nin luo, tahi jonkun luo pojistansa 
pappein seassa. 5 Moos. 24:8. 

S.Jajospappi,tarkastettuffiinsairaan 
paikan ihossa, huomaa etta karvat 
siina paikassa ovat muuttuneet val- 
kiaksi, ja haavah paikka on naky* 
vasti matalampi kuin muu iho ha- 
nen ruumiissansa, niin se on spita- 
litauti; ja tarkastettuaantuomilkoon 
pappi hanet saastaiseksi. 4Mooa.i2:io. 

4. Mutta jos hanen ihossansa on 
valkia syhelma, joka ei kuitenkuan 
nay olevan matalammalla muuta 
ihoa, ja karvat eivat ole muuttuneet 
valkiaksi, niin pitaa papin sulkea 
hahel huoneesen seitsemaksi pdi- 
vaksi. 

5. Ja seitsemantena paivana tarkas- 
takoon pappi hanta, ja jos haavat 
nakyvat hanessa olevan niinkuin 
ennenkin,' eivaika ole levinneet ha- 
nen ihossansa, niin papin pitaa vie- 



118 



■ Z MOOS. 13. 



Ifl sUHtHfr Itflnet h^ionees^n seltse- 
mitksit^Mvfiksi.' 

.0. Ji^jos pDiVpfi. tarkftstf^ssaan Mn- 
tfi'htas' uudcHeen s^ilst'in^n pdkfin 
peiil^(ft;'1uromiiti, ellrt hnavat otwil 
rauvenneel. eivAtkd lc\'miieet hiirren 
ihoisansa,i^inf'ju1istakoanpapplh3- 
twi puMaaksi: sitlii^e on tavallinen 
rohtii>m2i. Ja h^n'pesk<>On' vaan vaal- 
IC'ensa.nim on Ittin puhdas. 

7 Mu44«^'jos syhelina l^viiiii hfinen 
ihossarvsa, sine kuiti puppi on ha-« 
net lorkaslanuf j;i p<«nlnaksi julis 
ta<nt]t.' niifi on h.^it«uudellecnvi«luvft 
papin Vuo larkas»etlavakM; 

8. )o&{>a|>^i'nMk(»e.ettA sykelmilon 
)evinnyt hAnc^iiNos^sa'nsa. niin pi- 
IMpaj[kin luoini4scnian tiiinen snas- 
taiseksj'v stlkl-sc on Kpilall. 
.d.iJos"S^ita4in :haava tulee ihmi- 
$eeiv, niin hiin<on vi<^tavd pafxin luo. 

lOt Jajospapph tarkasliellUQan ban- 
li; huomao yulkian ajoksen -lulleek- 
siih&nen ihoonsa ja karvat vaaleeit^ 
tuneekst,* ja. ^IdvSn iihan otevan 
ajoksessa, . ' 

41. niin on vanha spitali hfinen 
ihossai>sa, Ja senl5hd€4» lulee papin 
tuomila hantft saastaiscksi, eik&e- 
ndfi iSulkea /hflntfi huonee^en, silld 
h5n on^o saaEilainep. .. 

il2, Ja.jos S4)ilali kovin Ievi9il hA- 
nen ihossansa. ja tA2r'ltu[t koko ihon. 
pSAstfl niin jalkpihin, kaiken sen 
jdlkeen. minkA verran pappi nSkee 
silmill^nsA; 

.13. ja ^un. pappi tarka&tf lee ja nS- 
kee spitalin peilinneeksi koko h5> 
nen ihonsa, niin julistakoon hfin 
hiVnel puhtaaHsi, sentftluien eUA ko- 
ko hftnen ruumiinsa on muultuiuit 
valklaksi; hAn on puhdas. 
i 14^ Mutta oiJdk>lnfiiavA liha hines^ 
5a> nakyy« on ban saasUinen. . . 
.Sa..Kun pappi nSkee eJAvftn Iihan. 
pilnftbdnen luomitscmanbdnetsaaS'' 
laiseicsiisilld se elAvAliha^n saas- 
lainen.se on .spilali. 

10. <Mulla |os elAvft.liha muuUuu 
jAlleien valkiaksi. niin pltAA bfinen 
luleman papin luo. 

17.' Ja jos pappi., tarkastetluansa, 
buomaa haavain muuttunoen val- 
kiakfet, niin l-ul«e p9pin julisiaa bAr 
net puhtaaksi ; sillA hAn.on pubdas. 
' 18.- Jos ionkun ibossa on oilut pai* 
Ruma, joka sitton on paranlunuU 

194 mutia slihcn tpaikknant missA 
paisuma oli, sitlen ilmeslyy valkea 
a^.'lahi vaaleanpunainen pilkku, 
niln'papin tulee sitA tarkastaa. 

20. . 'Jos pappi buomaa sen. paikan 
malalammoksi muuta ihoa.ja karval 
ovat mujuilai^c^liMallfkiksivaiiapar 



pin pitfiA liAnel tuomUs^man Mas*i 
taiseKsi; sil^A siitA patsumasia on, 
tHllut spitali. 

21. Mutta |os pappi huOmaa, eltei 
kanal oie silnA muuttuneet v;dkiak<: 
si.cikA'paikka oloniatalampiinUijitaj 
iboa, vaan on parantumaan > pAinv 
niifi papin pitAA sulken h&nel huo- 
neesen seitsemAksi |>AivA}vSi.> 

.22. Mutta jos vamma nakyy levene-, 
vAn bAnen ihossansa, niin pitAA.pao 
pin julislaman bAnel saastaiseksi;. 
sillA S€ on spitalin haava. 

23. Mutta jos yhelmA pysyy sijal- 
lansa, eikA levi>, niin se on paisu^ 
man arpi, ja pappi julislakoon hA- 
net puhtaaKsi. 

21. Mutta Jos jonkun ibossa on lu- 
len pplttama teaava« ja sen arpesen 
silten. syntyy vaaleanpunainen tahi. 
valkia pillcku, 

25. ja pappi tarkastettuaan paikaa«- 
buomaa kanal siinA muuttuaeeksi 
valkiaksi , ja ettA se tux malalnrnpii 
muula iboa, niin on spHali luUuti 
siiben paikkaan, missA poiyuohaava. 
oli , sentAbden pitAA papin julistai 
man bAnet saastaiseksi* siUA se on 
spiAali.' 

2$. Mutta jos pappi buomaa, eliiei 
karvat siinA paikassa ole muutlu-; 
neet valkiaksi, eikA se ole matalam* 
pi ipujuUi ihoa, ja ettA paikka oo, 
vaaleentunut, niin pitAA papin SMi.-. 
keman bAnet huoneesen seitsemAksi 
pAiv^ksi. 

27. Ja Jos pappi, larkastettuaQii. 
bAniA seitsemAntenA pAivAnA, ^n<h 
maa, ettA vamma ibossa onleviitf^>«i 
niin papin pitAA juUslarnan hQiijet 
saastaiseksi ; sillA s^ on spilaU. , 

28. Mutta jos vaalea pilkku on a^i«* 
lansa, eikA ole levir^nyt bAnen ihos- 
sansa, vaan pysyy yaaleana. niii) ?ie 
on palobaavan arpi, ja papin pit^A 
julislaman bAnet puhtaaksi; sii)a se 
on palobaavan arpi. . , 

2d. Jos miehessA tah^ paisess^ syi^ 
tyy joku robtuma pAAbAii tahi l^u- 
kaan. 

30. ja pappi, tarkastettuansa vam- 
maa, huomaa sen paikan matalamr 
maksi muula iboa, ja karvat siinA 
paikassa kcllerlAviksijabarvemm^lc, 
si, niin papin pilAA juUstamap son 
ibmisen saastaiseksi ; sillA se on spl; 
tali-robtuma* pAA-tahi leukaspitalij 

31. Mutta jos pappi, larkastettuaun 
paikkaa, missA robtuma on, huo* 
maa, etiei se losin o^e malalainpi 
muula iboa, mutta ettA karvat siinA 
eivAt ole roustat, niin pitAA papiq 
si\lkeman bAnet, jossa rofituma on, 
hMone«fieii.sfiitsep^A^?l.p^i.W(h?>; j 



au 



1 8 MOOS. 18. 



'H'Joi'pappiv kuft Mn' seitsctnAni> 
•«n§("fftfrflilft liHrUiidltfle^'ttQikkaas 
huomaa, ettei roHiu(i^ta'o>le lewiitnyl 
Hibstej J»<<atei' snnft '^leikcHaiUa 
Itbryojav )» citcfl rohnMia'ole<ma(la» 
teniiniltai ihuilta (hoQi, -f ><'i 
S3; Biin pitftft sairaan ajafnan par- 
lansa, ajanialta kuitenkaan rohlu- 
man peikkaa, ja ixipin pitQS hfinel, 
jessa rohtaina on.suikefnan huonee- 
9^n vielft seiKemilksi pfiivdksi. 

34. Ja jo9 pappi« tnrkastettaaaii 
faas sairasla seilsemftnlenh pdiv5nA, 
fiuomaa, cilei rohluma ole icvinnyl 
ihossa, ja cHei se poikka ok fiial'a- 
lampi munla thoa. niin popfn pilAu 
iolistamfin liAnet puhtaakM. )a hAn 
pesk66Ti vaafteensoj nitnon hAn 
putKlns; 

35. Mimajosrohlumaleveneeiho6&a 
'hftnen putulistuksensa jAtkeei>« 

30. ja pappi, tarkastaessanti hfintft, 
'huomaair<>htuinan levimH^eksi ihos- 
sa, niin ei papin enflfi larvitse sitfi 
'halsoa^ bvaiko knrval' siinft kellerlA- 
•vWscI; sHIA' hftn mi 'sanstaineri. 

37. Mutta jos rohtuma nfiyMftviyv 
omuthmratlomalla , 'ja imusiid kslr- 
voja alkaasiinfi paikassa kasvaa, 
niin on rohtuma parantmmt . j« 
bfinonptihdas; Ja papin pitAA hnnct 
puhlaaksi julistaman. " 

38. Jos mlehen lahi naisen IhoOn 
iulee rohtuma, nfinkuin vant«ila, 
pHkknja, ' ■ 

39. ja pappi, tarkastetluaan soira^tb 
pailckaa, huomaa, «ltA pilkut oval 
tfiysi-vaaleal , niin on sc tavalhn^n 
rontoma ihos!ia. ja hfln on puhdas. 

40. Jos mieheri' hiuksel . lahlevai 
|)i^5st3, niin on se tnvaiUsta' kaljn- 
paisyvttA; hAn tm puhdas.' ' 

41. Ja jos hiuksci llihievflt ot^an 
puolelta p&fttil, niin on se myOs 
vaan tavallista kaljupaisyyllA; M« 
on puhdas. 

42. Mutta jos joku valkian punot- 
tova pilkku syntyy paljaasen paik- 
kaan. oil se qtsan puotella tahl ta- 
karaivolhi, niin on ' spitfeH -siihert 
lullut ■ / • 

43. Jos sentfihden pa^pi, rarkastet- 
tuaan hitntA, huomaa; ettA i^lkian- 
punollava pilkku <Mi 5yn>ynvt pal- 
jaasen paikkaan otsan piiolelle lahi 
lakaraivolle, ja elrft se nAyttAA niin* 
■uhi muukin spitali iho^a. 

44. nlln hftn on spifallnen ja saas^ 
tainen mies . ja papin pitAA jutisi 
taman hAnet saastaiseksi, senkaltai* 
sen sairaudc'a tAhdeh hAnen pAus« 

45. Joka spitalinen oti, h^nen vaat- 
teensa olkoot revltyri ja pAft avoin, 



S4UI peiftetty^ijakAnen piUlfi hiHilOf 
man* ..saastaiiiien? saaslaincn *^' 
-46.. Niin kauaa kuio spitali JiA- 
nessiA on, piitr^.. hAnen ^ sa»$taisci> 
olcman, haii asukoon yksinaniiA.jA 
hAnen 'asAiinpAikluin30 plkooa ulko- 
na ileinislA., ] 4Moot.fi:25s. ZKun^ih-^ 

.47. Josjonlfun vaaileeacn UUcdspir 
talinmerkki.olkooiisc villaii^n ImIu 
Lunainen*.. , .. j . .. j ", 

>4S. JoinMwn.lahi kuleeseenu olkAOV 
se liinainea lahi vilUinen, lahi«iiiiU- 
knan, laikkn jol^onkuhiui .jiahko- 
vaallee&en, . , . .: « 

.49.1 >a jos se. nwrkkl nayltiivtyy .\> 
horiaisclta lain puiiaisclta \uat(ccssa, 
lahi nahassii. jl^jhi Ipimcssa, lahi 
kulcessa, tuni josstiKussa kappa- 
letssa; mfkti nrrha^ta lehry'oh.'' — 
seoa spitulin .merkki Ju t»e .ou nAy- 
tellavA papi^e. . ... < *- 

fio Ja kun pappi on. ia.^k;iMaiHMt 
scnkaltoison |)^ik2in* Jukilkoon. eril- 
lecD koko kappaleen seitsemAksi 
pAivAksL ,...,, 

&t I Ja jos . hAns . sei ISA!muii4en A. ! pA j- 
vi^nu..larkastaussaan paikkiiai, hiMP* 
maa, eilA luhra on. levinnyl .VAal* 
leessn^ loimessa...lahiikulees^. f\sx' 
has6a,.>iahi ja.ss;iliussfi Jkapipake^*t9. 
ioka nahasia tehiy on, niin pq>.S4C 
kuluAtavpinen spHalL m sc liU^r^ Qp 
saaslainen ... ...,i 

. 52. Ja nAniA. vnalieel.. Jo|me^tnhi 
kuleet« ol\ ne :liinai$^ii.tyJUi,yiilai>et> 
ja mikA hyvansA luiUaMa on .(e;hJLy, 
jossu . on, &enkaltauicii/ iMhra^ o>vut 
tules&a po|lellnval,.siUii s^ /f>ti,:hU" 
lutiaxaincn spiiiili...ikmkki ^mmQi- 
neu. on.tulossu.poltttUawa .;, . ,. i ,.' 

53 Al4Ula |os. pappi larkasiaessnap 
huomaa .cliei tahna. ole. levinnyt 
vaalleessa.. Joimcssa. luhi.,JfuteesSia, 
lahi ^sukih kappajees&a « jjoka.na- 
liasia on..Uihly. 1 ,. i ,>.,.: 

54. ni^n . Iuiskek66a. pappi., pese- 
loAAn kappciU^n., josss^ Aahnn «n, 
ja' lukilkoon.seu.siiton orii|eea tans 
seitscmAksi/ pAiwakbi.. . i. • . . , . ^ 

55. Jio& pappi, sitlckAiin.k^ppiure on 
pesly, larkaiblclUianKa luhran. .huo- 
maa, ellei sc olc muutlunui,.nau on 
se saaslainen. vaikkapat, l^ihva oi 
olisikaan leMnu>it«. sa on. Aulessa 
potlet4hv», siWii sc yiie> lyy , sy\ aile, 
ol4 f^e iilU'U oikealla Uhi .uurjaila 
puok'lla ' ' :.. i . . I. / 

50.' Mutta .JOS. p^appi nAkee, clta 
tahra on kadonnut,.sUtek4^in.se pes- 
liiTi. nim> hdoeik . pitAA: sbui repAiRc- 
mAn pois vaaileesla,.:nahasia, ioi- 
me^la lahi kuleeala../ . . > 

57 Ja jos taluraitvi.eia<s(ltea oAkyy 



115 



3 MOOS. 13. 14. 



vdfttteessd, lotmessa, kirteessa lahi* 
uahkavuatteessa, niin on se syOpH- 
spitali, ja se palkka ynni koko kap- 

{)ale, jossa tanra oh, poltettakoon lu- 
essn. 

58. Mutta Jos tahra 01:1 kadonnut 
vaatteesta, loimesta, kuteesta tahi 
nahkakappaleesta, joka pestiin,niin 
on se undelleen vielfi pestSvA ja on 
sitten puhdas. 

• 59. Tama on laki spitalisesta fah- 
rasta vaatteessa, joko liinaisessa ta- 
hi villuisessa, loimessa tahi kulees- 
sa, tahi nahkavaatfcessa, oli se mi- 
ka hyvSnsa, — laki, joka sanoo mi- 
kfi on puhdas ja niikaonsaastaincn. 

14 Lukii. 

Spltalisten pubdistamiiien ja sovittamincu. 

J a Herra puhui Moosekselle, sanoen: 
2. Tftma on laki siitn, kuinka spi- 
talinen puhdistelaan : 
Ildn on tuotava papin luo, 

Matt 8:4. Mark. 1:44. Luuk.5:14. 17:14. 

3. ja pnppi mcnkddn ulos Iciristd; 
ja jos nan, tarkastettuaan ^pitalista 
ilimista, huomaa, elta ban on pa- 
rantunut spitalistaan, 

4. niin pappi kaskekddn, etta hanta 
varten, joka puhdistetaan, tuodaan 
kaksi ciavata puhdasta lintua, se- 
dripuiita, tulipunaiseksi painettua 
lankaa ja isoppia. 3 Moos. 11:13. Ps.6i:9. 

5. J^ pappi kaskekOGn teurastamaan 
toisen linnun saviasfian paaiia, jos- 
sa on tuor^sla vetia. 

' 6. Sitten han ottakoon sen eiavan 
linnun ja sedripuun kappaleen, tuli- 
punalla painetun langan ja isopin, 
ia kastakopn ne sen linnun vereen, 
joka on tapettu tuoreen vedcn yli. 

7. Ja tata han priiskoittakoon spi- 
talisla puhdislettavan paaUb scitsc- 
man kertaa; ja kun han on niin 
hanet puhdistanut, antakoon sen 
eiavan linnun lentaa kedollc. 

8. Mutta puhdistettu peskiSdn vaat- 
teensa, ja ajelkoon kaikkihiuksensa, 
ja peskd()n ruumiinsa vcdessa, niin 
on han puhdas, ja mcnkddn leiriin. 
Kuitenkm asukoon ulkona majas- 
tansa seitseman paivua. 4Moo8.i2:i4ss. 

9. Ja seitscmantcna paivana pitaa 
hanen ajeleman kaikkihiuksetpaas- 
tansa, partansa ja karvat silmakul- 
mistansa, niin etta kaikki karvat o- 
vat ajellut. Ja hanen pitua peseman 
vaatteensa, ja kylpcman vcdcssa,niin 
on han puhdas. 

10. J a kahdeksantena mlivdna pitaa 
hanen ottaman kaksi virhectdnta 
karitsata, ja virheettOman vuosikau- 
tisen lampaan, niin myds kolme 



kymmenesosoa efaa hienoia jauhoja 
ruokauhriksi, dljylia sekoitettuja, ja 
yhden login Oljyft. 

11. Ja pitaa papin, joka puhdis- 
tuksen toimitti, asettaman sen puh- 
distctun ja taman kaikeii Herran 
eteen, seurakunnan majan oven e- 
dessa. 

12. Ja pappi ottakoon toisen karit- 
san, ja uhratkoon sen vikauhriksl, 
dljy login kanssa, ja haaiyttakOOn sen 
haaiytys-uhriksi Herran edessa. 

2 Moos. 29:24. 

13. Ja karitsa on teurastettava silia 
paikalla, niissa rikosuhri ja polt- 
touhri teurastetaan,pyhassa sijassa; 
silia rikosuhri, samonikuin vikauh- 
rikin, on papin onia; sc onkaikkciii 
pyhin. ' , SMoos. 7:6b8. 

14. Ja pappi ottakoon vikauhrin 
verta ja pyynkaisk5dn puhdistetun 
oikian korvan lehteen, niin myds 
oikian kaden peukaloon ja oikian 
jalaii isoon varpaasen. 

15. Ja pappi ottakoon dljylogista 
dljya, ja vuodattakoon vasempaau 
katecnsa. 

•16u Ja. pappi kastakoon oikian ku- 
teQsa sormen Oljyyii, mika hanen 
vas6mmassa kadcssSusa on, ja priis- 
koittakoon dljya sormellansa seitse- 
man kertaa Herran edessa. 
• 17. Vaan kaieensa jaanecsta dljystH 
pitaa papin paneniau puhdistetun 
oikian korvan lehtecn, oikiaan peu- 
kaloon, ja oikian jalan isoon var- 
paasen, vikauhrin vereii paaile. 

18. Kateensa jaaneen oljyn pappi 
pankoon puhdistetun paan paaile, 
ja pappi .sovittakoon niin hanet 
Herran edessa. 

19. J a papin pitaa tekeman rikos- 
uhrin, ja sovittaman puhdistetun 
hanen saastaisuudestansa, ja sen 
jaikeen tcurastaman polttouhrin. 

20. Ja papin pitaa unraaman polt- 
touhrin ja ruoKauhrin alttarilla, ju 
sovittaman hanet, niin han on 
puhdas. 

21. Jos han on kfiyha eika ole ha- 
nelia varaa, niin ottakoon ainoas- 
taan yhden karitsan vikauhriksi ja 
haaiyttakOdn sen, sovittaaksensa it- 
sensa, ja yhden kymmeneksen hie- 
noja jauhoja, sekoitettuna dljylia, 
ruokauhriksi, ja lo^in oljya, 

22. ja kaksi mcttista tahi kaksi 
nuorta kyyhkysta, jotka han voi 
saada, toincn olkoon rikosuhriksi 
ja toinen polttouliriksi. 

23. Ja kantakoon sen papille puli- 
distukseksi kahdeksantena paivSnA 
seurakunnan majan oven ctcen, 
Herran cdessS. 



116 



3 MOOS. 14. 



24. Ja papin pitfti oHaman vikauh- 
rin karitsan, ja siihen kiiuluvan lo- 
gin d^yjkt ja nfifilyttftmftn ne hftSly- 
tvs-QhriksI Herran edessft. 

25. Ja vikauhrin karitsa teurastet- 
lakoon, ja papin pitfift ottaman vi- 
kaohrin verestft, la pyytikfiisemftn 
puh^istettavan oikian korvan leh- 
teen, niin myOs oikian kfiden peu- 
kaloon ja oikian jalan isoon var- 
paasen. 

26. Ja papin pitfifl vuodattaman dl- 
jy} vasempaao kfiteensft, 

27. ja priiskoittaman oikian kfiden 
sormella siitft 61jystfi, kuin on hS- 
nen vasemmassa kftdessfinsfi, seitse- 
min kertaa Herran edessd. 

28. Ja hftnen kftteensft jSfineestft 01- 
jvstS pitSft papin pyyhkfiisemfin puh- 
distettavan oikian korvan lehteen, 
oikian kftden peukaloon ja oikian 
jalan isoon varpaasen, vikauhrin 
veren pftfiUe. 

29. Ja hftnen kftteensft jflfineen dl- 
jyn valakoon pappi puhdistettavan 
pAftn pftftlle, fa sovtttakoon hftnet 
Herran edessft. 

90. Ja sitten hSn uhratkoon ne met- 
tiset tahi nuoret kyyhkyset, jotka 
hfln on voinut saada; 

31. niistft, jotka bftn on voinut 
saada, uhratkoon hfin yhden rikos- 
uhriksi ja toisen polttouhriksi, mo- 
kaiihrin kanssa. Niin pappi sovitta- 
koon 'sen puhdistettavan Herran 
edessS. 

32. Tftmft on laki splitalisesta, joka 
ei vol sitft hankkia, mitft hftnen puh- 
distttkseensa oikeimmiten tarvitaan. 

33. Ja Herra puhui Moosekselle ja 
Aaronille, sanoen: 

34. Kun te tulette Kanaanmaalle, 
jonka minft annan teille omaisuu- 
deksi, ja minft johonkuhun sen 
maan huoneesen annan tulla spita- 
Ulaudin, 

35. niin pitftft sen tuleman, jonka 
hoone on, ^a ilmoittaman papille, 
sanoen : „minun huoneessani nftkyy 
spitalilaudin merkit.** 

36. Silloin tulee papin kfiskeft hei- 
d&n tyhjentfimftftn huoneen, ennen- 
kuin pappi siihen menee saaslaa 
tarkastaniaan»eltei kaikki, mitft huo- 
neessa on, saastutettaisi ; sitte pappi 
menkMn katselemaan hiionelta. - 

37. Ja kun hftn, tarkastettuaan saas- 
tatettua paikkaa , huomaa^, ettfi sei- 
Diss! on viheriftisift ja punertavia 
merkkejft, ja ne ovat nftkyvftsti ma- 
lalammat muiita seinftft, 

38. niin IfthtekMn pappi huoneen 
ovesia ulos, ja sulkekoon huoneen 
klliml feit9^ftk$i pftivftk9i» 



39. Ja jos pappi, palatessaan seit- 
semftntenft pftlvftofi, nftkee saastan 
levinneen huoneen seiniin, 

40. niin pitftft papin kftskemftn hei- 
dftn mhrtaa ^ulos ne kivet, joissa 
saasta on, ja heittftft ne kaupungisia 
ulos, saastaiseen paikkaan. 

41. Ja koko huone on sisfiltft kaa- 
vittava Joka paikasta, ja kaavittu 
savi on heitettavS kaupungista ulos, 
saastaiseen paikkaan. 

42. Ja toiset kivet ovat otettavat ia 
pantavat niitten kivien s^aA, la 
uusi saviruukki on tehCftvS |a-huone 
on sillfi sivuttava. 

43. Jos kuitenkin saasta tulee nftkyy 
vjin, sittenkuin kivet on murretta 
ulos, huone on puhtaaksi kaavittu 
ja uudestaan sivuttu, 

44. niin pitftft papin menen^n sen 
sisftUe, ja kun han nftkee saastan 
levinneen laajemmalle huoneessa, 
niin on syOpfi-spitali siinft huoneessa, 
ja se on sanstainen. 

45. Ja koko se huone pitftft puret- 
taman, ja huoneen kivet, puuaineet 
ia saviruukki, kaikki on vietftvft 
kaupungista ulos, saastaiseen paik- 
kaan. 

•46. Ja se, joka Icftv huoneessa niin 
kauan kuin se tefjetty on, hftn on 
saastainen illaan asti. 

47. Ja se, joka siinft huoneessa ma- 
kaa, pitftft vaatteensa pesemftn* ja 
se, joka syO siinft huoneessa, hftnen 
pitftft myOs vaatteensa pesen»ftn. 

48. Mutlaj6spappi,kftydessftfinkat- 
selemassa huonetta, nftkee, ettei saas- 
ta ole levinnyt huoneessa, sittekuin- 
se sivuttu on, niin julistakoon sen 
puhtaaksi ; sillft saasta on hftvinnyt. 

49. Ja hftnen pitftft ottaman hno- 
neen puhdistamiseksi kakst lintua, 
niin myOs sedripuuta, ia tuUpunal^ 
la painetuila lankoja, ja isoppia, 

50. ja teurastaman toisen Iranun 
savisen aslian yli, jossa onraikasta 
vettft. 

51. Sitten pitftft hftnen ottaman se^ 
dripuun, isopin, tulipunalla paine- 
tut langat, ja sen elftvftn linnnn, ja 
kastaman ne kaikki tapetun linnun 
vereenja raikkaascnveteenja priis- 
koittaman huoneen seinftft seitse- 
mfth kertaa. 

52. Niin on huone puhdislettava 
linnun Verelift, ja raikkaalla vedel*- 
1ft, ja sillft elfivfillft linnulla, sedri- 
puulla, isopilla ja tulipunalla pai- 
netuila. Fangalla. 

53. Ja sitte hfin pftftstftkOOn sen elft- 
vftn linnun lenlftmftftn kaupungista 
kedoUe. Niin sovittakoon hftn hup- 
neeo, ja se pn puhdas. 



117 



31IOOS.'H.>15. 



S4.- Tint ODilaltl kallwllaiteria ip\. 
talMa j»B}<0pfl4tiMumatl>,' 
6S. spl tal Ills vaaKef WB- j ti huoneessrt, 
eei aMisiSla.'niVesla in syhelmisTH, 
"$7. «lia Hedeilfililln, mlkfl on pub- 
AMv rnthfi (aaittlnen kunaliin pHf- 
vBdS. TUmI mi laki spftaHHa. 



'ia Hnrtt puhill'MiH^kseDe ]i Ao- 
"■roriirte; saWotn: 
2. Puhukoal Israeltn lapsllle, la 



3. Ja sllloin on-hSii saaBlalnen sll- 
M jubksuBlB-. jdko .&intn hBnen li' 
tiMnsa parfnrillnun vuolba, tahl on 
lukkeenlnnal, nlln Mn on taaiiaf- 

4. Vuode. Jossa se tcpBB. jolla on 
hiehsu; dh sanslaihen. ja ktiikki se, 
Jonha'pflBllfl ' hfln Istuii. iasstiit(> 

6.' Ju' Be, Joira lattuu hBfien vunlet^ 
sensa, pllflfl pesemfin vaBlteenin, j« 
l^lpemBn 'vedtssB; Ja'olkMin saas- 
tiring' niaan Asll. 

6. Joka isluuilllQteftiftnelfa, Jossa 
MDirfslmitrli Jolla jiioksu on, )A- 
lien 6ltM pestmBfi vaafleensa; ]i 
IcylpemBn vedessB, ja olkoob iaas- 
lainen lltann aslf. 

'J. Joka koskrtlaa salraan llhann, 
hBn peskflBn vaalleenSB, ja kylpu- 
-kMfi '^edessfi; Ja oikdon saailainen 
fllaan nin. 

ft-Jos 'sitras sylkee Jtankun pflfllle, 
Joka on puhdal, niln iBmB pCskMn 
TaalleensB. jii kylpeltMn' vcdrasB, 
jb otkobij saastainsn tltaan astt. 

9.'Jb' koko se ahls; jOnka pBBITS 
BBtTBs matkusiacasaBn Utuii, oikooii 
■aasialnen.'- 

ID. Joka salluu johonkuhuii sithen. 
Joka liflnbn atlania an ollul, oikonn 
mslaEnf^ lllnnn asM, ja joka ni<- 
tB kntilaa, peskaonvaalteensa jDkyl- 

EekMnf ea»xi,Ja olkoonMSslalnen 
taanaall. 

11. Ja se, Johonka sairas hoihee pe- 
semBllfl kSslfinsB vedesSB, peskOfln 
vBatlefenb'Jai kytptkbOn vedessfl. ja 
(illioim BBUstaFnen lltaan aill. 
ia. Se saVlB«tla. lohon sairas kos^ 
Uee,an rlkatiava;foaseonpuuasrfa, 
on se vedessB pestBTfl. giieos. i:iS. 
IS. J a MIIUailM puhlaakst Uhansa 
Jitohiusia , lulee frftnm lask«B xelt- 
semBn pBivBB puhdlsln-ksestansa, ja 
' peskMn sillrai vMUetns* ja kytpe- 



ldlUtn')uakievlbs«iMdeaU,-iliM HIn 
oh pulidas. ..'■■. 

14. Ja kahdeftibiltena pBlvlnfl pl>' 
tsn hBneii oltaman parin inettlsltt. 
fahi kflksl nuoria kyyhkyttB, ja tuo- 
man ne Herran eleeii seuiiakunnart 
majan ovelle, ja anlaman nepaplMe. 

15. Japappi nhhilkoonne'.lDisentl- 
hosuhrllul, Ja Mien polttouhriKsij 

ti sovlHakoon hBnet Hemn edeuB 
flnen juoksuslansa. ' i 

16. Jd9 Hiiehesti on iietiieU'VubtB. 
nil) unessBi'nfJn peskMnkofterUD'- 
miinsBvedessiiJa olkoon satstilncn 



»1kaon saastalhen iltiian ssll. 

IS. Jn ioi vaimo makaa niUh«h 
kanssa , jalta on sl(menvuol(>.''heli 
dBn piHB pcsemBR itsemU vedestS', 
Jn oleman saustaisel <ltean Bstl. 

19. Hun Vaimalla on hSnen flhkn- 
sa veren juoksu, plIDQ hnn'en t!ri' 
nRnsB oilman sellsetnfln,pfiivitB, Ja 
joka hBncen koskee, se olkodn saas- 
lainen illaan' aiifj. SMooi.tBnt. 20:18, 



ita paeim nan le- 
uin hBnen jMok- 
in laasMlntn, jli 
IB hBh Isliiu., ol- 



mAn vedessB. Ja tiien 
Etlaan asli. 

23. Ja jos joku kappale pannaail 
hflnen vuoleesehsd tahl 1Stuinten«; 
kussa hBn isluu. ja jpku silhcn kdsi 
h e e ,hfl n olkoort saaalalnenlllaanastl, 

24. Ja Jos joku mles nialtaa hflntii 
- isBnsB, ja jatakln laastasla tu- 

liehei) pBDIIe. nlln olhoon hSn 
saastalKena deilsemSn pBfvBn, ja hB- 
nen v^oleensajossnhfln on lev &nnyi; 
btkoon snastalnen. 

25. Jos jonkun valmon veren Juok- 
Bu kestBa kauemmin alksa, elkS se 
enSB ole kuukaU9-jut<hsuB, tahl l(/i 
juoksu keslflS yli kuukausjuoksun 
ajan, nliri hBn olhoon saastaineti 
rilln knuan ki|ln vuoto k^staa, ai- 
vnh nllnkuin tiSnen olklalla kuu- 
kausl-viiotonsa ajalla. 

'26. Kalkkl vuode, Joua hOn I^pSR, 
nifn hauAn kufii viioio kest^B, olr 
koon nlinkuin oiklan vuotonstl ejaa 



B<HOOS: IS/IS. 



«. A AarantH ptIU tNi>iii>rt Mrtti 
rlkoiuhlilUenM, Ja tovlmitnD il> 
•ensfl perheircnil, 

7. Ja lilleaottaman n« kaktikni- 
rlsla Bsettaaksensa Herran Bteta, 
lenrtakunnan majnn oi>etlni ' - ' ' 

8. Ja Aaronin pftAH tieillflmM ar- 
paa kahdnlD kaurlisla; ttfhtn ait 
van Herrallc, Ja lolsen vapaall« katf. 
rillJta. 

9. Ja Aaronin pitOfl uhrDaaian Mit 
kaiiTilti, lonka naoile Htlran nrpt 
laakesi. Ja vnlniistaman len rlkosl 
nhrlfcsi, . . I . 

10. Mulls sen kHurlln.JonkapMIH 
vapauden aiT>a lankesi. pIlIB htlneil 

Ifl sovinio lehniisiin sen kautu M 
ae pOasleUBtelln vBpaaksl Asasel'ille 

11. Aaronin pi tU sHi tnomah rK 
kbsuhiinsa 'hfirfln, ]a jovHlaman !!• 
seitsS la huoncensa.Ja leur^laihaa 
sen rlkosuhrin hftrBn edestflnM; '" 

12. Sllten oriakoon hfln astlan tavaf- 
nfi lullila Mtlie atltariltc, Joka on 
Herran edeasS, Ja ptvonia IDyden 
•urvotlua hyvlnhalulsls suiliunnia 
la kantakooD sen ulttpUn sIsDpno- 

telle, IMiKM. SD3t,B&. HetH-.SiTM 

13. ja pankoon HUB lulcH pflflUa 
Herran etecn,nltn ellB pyhBAsavun 
suli*u amiolslDlmen Hinsisl. idlia 
on lodlsluksen pflflllfllellel hBn fctto- 
liit. ■ . I ■ . 

11. Ja hfln trilakoon harfln'Teiin. 



men edesiB verU prilskofttamon. '■ 

15. Sllten plIAB hBnen leuraitarnan 
kansan rlkosuhf[n kauriln Ja kan- 
laman sen verla eiirlpun 'alsflpUolel'- 
le; Ja hBnen tnlee menelellB sen ve'- 
renttamsa, nUnkutn tiBn lekl hBrSn 
veren kanna, la prliskoiRaB itIR ar- 
molstnimen plBlle,]a armoislutinen 

edeUBJ BHcwi.<:<. H«br.1t:l3. 10:1. 

16. NBtn on hfln ■ovil'tava pyhSUAn 
biaelln Uislen rietlaudesta Ja kill- 
Khia bMdfin nnllensB vBBri-ydestfl. 
Niln pilBfl bfinen myOs tekemSii 
aeiirakunnan mta<nlle,^okB oii hei- 
dBn keskellBnsB, keskellB heldDn 



17. Ei ykslkSDn Ihmlnen («a olla 
seurakunnan majassn.kun hfln'mc 
nee pyhBkkOGn sovlriamaan, ^Iheif 
asit eltB han slellB kDy ulis. Ntlrf 

EitBB hBnen lovitlaman ttiensb.'Ja 
uoneenia, Ja koko Itraelf n kandin.' 
Louk. 1:10. Hrtr.**' 

IS. Jasitien1iiieak00ahflnuM>bn> 



3 MOOS. 16. 17. 



tarin luov joka on Herran' ediesstS, 
ja sovittakoon sen, ja ottakoon h5- 
rUn veria, ja kauriin verta, ja pyyK- 
kSiskddn sitd alttarin sarviin yltym- 
pSri, . 

19. ja priiskoittakoon sormellansa 
verta seitsemdn kcrtaa sen pASlle, 
ja puhdistakoon ja pyhittfikddn sen 
Israelin lasten saastaisuudesta. 

20. Kun hdn nain on pdSttilnyt py- 
hfikOn ja scurakunnan majan ja alt- 
tarin sovittamiscn, niin pit5ii hilncn 
luoman sen elSvan kauriin. 

21. Ja Aaronin pitaa paneman mo- 
lemmat kalcnsd sen emviln kauriin 
pS3n pfi&lleja tunnustamansen pdfil- 
i§ kaikki Israelin rikokset ja pahat 
teot, missA. vaan ovatkaan syntiS teh- 
neet; nc hdn pankoon kaurii-q pfidn 
pSallc, ja Id}ictt5k6dn sen sovcliaan 
miehcn saattamana korpeen. 

22. Kauris on niinmuodoin kanta- 
va kaikki hcidun pahat tckonsa era- 
maahan, ja se on jalottSvd sinne 
korpeen. 

23. Ja Aaronin pitu5 m^nemSn scu- 
rakunnan majaan, ja riisuraan liina^ 
vaalteet yltAnsd; jotka han ennen 
oli pukenut pASllensA menjaessSiin 
pyhSkkO^n, ja jdttilman ne sinne. 

^. Ja hdnen pitiid pes^mSn ihonsa 
vedel)§ pyhSssil sijassa, ja pukeman 
yllcns5 omat vaatteensa , ja mene- 
mdn ulos, ja tekemfin sekH omansa 
etta kansan polttouhrin, ja niin so- 
vittaman seka itsensS etth kansan. 

2.5. Ja^rikosuhrin teuraan rasvan 
polttaAvOon han alttarilla. 

26. Vaan joka vei kauriin Asaselil- 
le, hdncn tulee viruttaa vaatteensa, 
ja pestA ihonsa vcdessd, ja sitten tu^ 
la jaileen leiriin. 

27. Ja rikosuhrin hSrkS ja rikosuh^ 
fin kauris, joidenka yeri kannettiin 
sovinnoksi pyhSkkdOn^ ovat vietfi- 
vdt leiristfi ulos ja polte^tavat tules- ; 
sa, nahkoineen, lihoineen ja rapot* 
neen. SMoos. 4:11. 6:30. He& 43:21. 

Helwr. laai. I 

28. Ja se, joka niitS.polttaa, vinit- 
lakoon vaatteensa, ja peskD5n ihonr 
sa vedessd, ja palatkoon sitten lei- 
riin. 

29. TAmd olkoon teille ijankaikki- 
ncn sfifinto : kynimenenlen^ pi^ivdnS 
scitsemfitt5 kuukautta pitdii teidSn 
paastoaman eikSc mitStln tydtA teke- 
mSn, ei oma kansalajnen, eikS vie- 
ras, joka (eidSn keskellfinne muu* 
kalaiuQn on. 8 Moos. 23:27 ss. 4Moo8.29.'7. 

30. Sillil sinS p^ivelnA te sovitetaan^ 
niin cttd tulette puhtaaksi; kajkis* 
ta teidgn synneistdnne Herran edes- 
s& tulette te puhlaaksi. 3Moos«23:a7. 



31. Sentftliden ^e olfcoon Xhiile sun- 
rin sabbatti, ja teid§n tulee paastota. 
Se olkooB teille ikuinen sfifinld. 

32. Mutia sen sovinnon tehkOdn 
pappi, joka voideltu on, ja jonka 
kSsi on tSy telly papm virkaan hil- 
nenisAnsli sijaan; japukekoun hfin 
yllensfi liinaiset vaalteet^ jotka ovait 
pyhai vaalteet, 

33. ja sovittakoon niin kaikkein py- 
himmSn ja seurakunnan^ majan, ja 
alttarin, niin myds papit, ja koko 
kansan sovittakoon hSn. 

34. Tama olkoon teille ikuisena 
sddntdna , ettS te >SQvitatte israelin 
lapset kaikista heidstn synn^stfinsft, 
kerran vuodessa. Ja h&n teki nifn- 
kuin Herra oli Moosekselle kfiske- 
nyl., 2M60S. 90:10. 

ly Luku. 

Oikca uhripaikka. Vei^Bn sy6m)sen kielto. 

J a .Herra puhui Moosekselle, sa- 
noen: " 

'2. Puhu Aaronille ja hSn^n pojil^ 
lensa ja kaikille. Israelin lapsille, ja 
sano heille : tdmlin on Herra kdske- 
nyl, sanoen: 

*S. Jos joku Israelin huoneesta teu- 
rastaa hiirlin, karitsan, lahi vuohen 
leirissa, taikka leirin ulkopuolella, 

4. eilca kanna seurakunnan majan 
oven eteen sit3,-mika Herralle uh- 
riksl pit3d tuotamant Herran majan 
eteen, hSn on vereen vikap^, niin- 
kuin se, joka veren viiddatfanut on, 
ja se ihminen pitflii .hftvitettlin:]iftn 
kansastaiisa. 

5. Sentfihden pitSU; Israelin lasten 
tuoman uhrinsa, jonka he kedoUa 
tcurastavat, Herran eteen seurakun- 
nan majan ovella papille, ja siel- 
ISl uhraaman ne kiiiosuhiiksi Her- 
ralle. 

6. Ja papin pit&& priiskoittaman 
veren Herran alttarille seurakunnan 
majan oven edessd, ja. polttaman 
rasvan Herralle otolUseksi hajuksi. 

2 Moos. 29:18. 3Moo8.4:31. 
> 7. AlkdOt endft uhriansa uhratko 
mctsSnjumalille, joiden kanssa l&e 
huorin tehneet ovat. Se olkoon» hei^ 
le ikuinen sftSnlQ sukukuiuiasta su- 
kukuntaan. i 5Moo8.32:17. iKociozao. 
. 8. Ja vielfi pltM sinun sanoma^ 
heille: jos joku ihminen Israelin 
huoneesta, tahi vieras, joka teidftn 
keskelldnne on muukalaisena,:te- 
kee. teurasuhrin tahi polttouhrin, 

9. eikft silfi kanna seurakunnan ma- 
jan oven eteen; ettd h^ Herralle 
sen jlekisi, se ihminen pit&fi hAvitet- 
tamSn kansastansa. 

10. Ja JOS joku ihmiuen Israelis 



129 



3 MOOS. 17. 18. 



huoneesta, tahi muukalaisasta, jotka 
teidSn keskellSpne asvLvat» sy5 jota- 
kin verta , Mata vastaan mina ase- 
taakasvoni ja hSvitan hSnen kan- 
sastansa. 3Moo8.3:i7. 7:26 ss. 

6M008. 12:16,23 ss. 15:23. Ap.t 15:20.. 

11. Sillfl lihan sielu on veressS , ja 
roinS olen sen teille antanut alttani- 
le, etta sie^unne sen kautta sovitet- 
taisiin; siUft veri on sielun sovinto. 

Hebr.922. 

12. SenUh()en mJnS olen sanonut 
Israelin lapsille: lUkOdn yksiksian 
teidfin seassanne sy0k5 verta, eikfi 
yksik&an muukalamen, joka teidfin 
keskell^ne asuu, saa verta sy6d3. 

13. Ja jos joku ihminen Israelin 
lapsista taikka muukalainen teidan 
seassanne saa sydt^vfin metsSn elfii- 
men taht linnun pyydykselll^hanen 
pitaa vuodattaman senverentjapeit- 
ISmSn sen multaan. 3Moo8.ii:i3. 

14. Silia kaiken lihan sielu on hSi- 
nen verensd , niin kauan kulQ se 
elflS. Sentdhden mind olen sanonut 
Israelin lapsille: ei teiddn pidfi yh- 
dcnkflan lihan verta syOmSn. Sillfi 
kaiken Uhan sielu on hfinen veren- 
s3; kuka ikanansS sen syO, se pitdft 
nukutettajnan. lMoo8.9:4. 

15. Ja joka syft Itsekuollulla lahi 
kuoliaaksi raadeltua elSinta, olkoon 
nan kotolainen tahi muukalainen, 
Mncn piiaa pesemSn vaatteensa, ja 
kylpenian vedessS, ja oleman saas- 
taisena Utaan asti; niin hfin tulee 
P"n*aaksi. 2Moo9.i22:31. i3Moo8. U:40. 

lo. JoUei hanpeseitseansSjaihoan- 
sa virut^, niin hSm itse kantakoon 
vMryylfnsa^ 

1 8 Laku. 

Kidtetyt iK)lvet ja sekaannukset 

I« Hcrra puhui Moosekselle, sa- 
" no«i: 

2. Ptthu Israelin lapsille* ja sano 
nedlc: minS olen Herra, leidSn Ju- 
malanne. 

3. Alkfiat tehkd niinkuin tehUin E- 
Kyptin maassa , jossa lea^itte, 31- 
kaatkS tehHd niinkuin Kanaanmaas- 
sateiKlSAn.jobonka mind teiidvien; 
iukftftt niy(^kndn heiddn sfidnnOis-* 
sSnsfi vaeltako. 

4. Vaan tehkSSt minun oikeuteni, 
Jft PitfikdSt minun sdantOni ^ vael- 
(wsenne niissS. MinU ol^ H«rra» 
teidfln Jumalanne. 

5. Sentftbden tulee teidSn pitdft 
minon sASntOni ja oikeuteni, sill^ 
se ihminen, joka niitd tekee, h&n 
elift ni|ssfi. Mind olen Herra. 
9e^99, Hei^20:U« Rooid^10:5w qa|.3d2. 



6. £i kenenkfliSn pidA veribeiroo- 
laistaan Idhestym^n ndnen hfipyftnsft 
paljastamaan. Minft olen Herra. 

7. Sinun isdsi hfipyS ja fiitisi hSpyfi 
mli paljasta. H5n on sinun Sitisi, &ii 
siis h^nen hapy&ns& paljasta. 

Hes. 22:10^ 1 Kor. 5:1. 

8. Aid paljasta sinun isdsi vaimon 
hdpyd; sillfi se on sinun isfisi hfipy. 

1 Moos. 49:4. 3 Moos. 20:11. 
5 Moos. 22:30. 27:2a 

9. Alft paljasta sisaresi hdpyfi, isfisi 
tyttfiren, tahi fiitisi tyttfiren, kotona 
tahi ulkona syntyneen; filfi paljasta 
heidfin hfipyfinsfi. 3 Moos. 20:17. 

2 Said. 13:11-14. 

10. Alfi paljasta sinun poikasi tyt- 
tfiren tahi tyttfiresi tyttfiren hfipyfi; 
sillfi se on sinun hfipysi. 

11. Alfi paljasta fiitipuolesi tyttfiren 
hfipyfi, joka isfillesi syntynyt on; 
sillfi se on sinun sisaresi. 

12. Alfi paljasta sinun isfisi sisaren 
hfipyfi; sillfi se on isfisi veriheimoa. 

3 Moos. 20:19. 

13. Alfi paljasta fiitisi sisaren hfi- 
pyfi; sillfi se on sinun fiitisi verihei- 
moa. 

14. Alfi paljasta sinun setfisi hfipyfi, 
filfikfi IShesty hfinen vaimoansa; 
sillfi se on sinuu setfisi vairao. 

3 Moos. 20:20. 

15. Alfi paljasta sinun minffisi hfi- 
pyfi; sillfi hfin on sinun poikasi vai- 
mo, sentfihden filfi hfinen hfipyfinsfi 
paljasta. ' i Moos. 38:16. 3 Moos. 20:12. 

16. Alfi paljasta sinun veljesi vai- 
mon hfipyfi; sillfi se on sinun vel- 
jesi hfipy. 3 Moos. 20:21. Mark. 6:18. 

17. Alfi paljasta vaimon ja hfinen 
tyttfirensa hfipyfi; filfi ota vaimoksi 
hfinen poikansa tytfirtfi tahi tyttfiren 
tytfirtfi paljastaaksesi heidfin hfipyfiiv 
sfi; sillfi ne ovat veriheimolaisia, ja 
se on kauhistus. 

18. AJ^ Ota vaimosi sisarta, hfintfi 
vaivataksesi ja hfinen hfipyfinsfi pal- 
jastaaksesi, vielfi vaimosi elfiessa. 

19. Alfi Ifihfisty vaimoa hfinen hfi- 
pyfiqsfi paljastamaan niin kauan 
kuin hfin saastaisuutensa sairautta 
kfirsii. . 3Mods. 20:18. 

20. Alfimakaalfihimmfiisesi vaimoa, 
filfikfi itsefisi sillfi saastuta. 

3 Moos. 20:10. 2 Sam. 11:4. 

21. Ei sinun pidfi antaman lap- 
siasi Molekille uhriksi, ettes hfipfii- 
sisi sinun Jumalasi nimefi ; minfi olen 
Herra. 3MoO9.20:28S. 5Moo8.18:10. 

2 Kun. 23:10. Jer. 32:35. 

22. Alfi makaa miehenpuolta niin- 
kuin vaimon kanssa maataan; sillfi 
se op kauhistus. i Moos. 19:7* 3Moo8. 

20:13. ^0001.1:27, 



121 



3 MOOS. 18. 19. 



S. AU BfvAahUn elBlnia makaa. 
silMflsI sen knnsxu sanxtullnlsl. 
Ja nikOftn yhslkjinii nnlncn pltfikfi 
vHleyllfl elnimen konisa ; silia se on 

■2*. El leidfln pidll yhdessQkiinii 
rtOrssfi llieAime saaslutlaman : sillfi 
nfllsii kaiklssaovarpakanal ItseoaB 
sbastultaneet, Jolka minS ajaii pols 
t«ldOn eileslDnne. 

'35. Sen houriB on maa saastutetla, 
})t rnJnil elsJskelen sen pahal leot, 
Mln elin sc maa on asujsnaa oksen- 
lava. 

M. Senldhdenpiiakaill minunsSan- 
Mnl la oEkeulenl. Js fllkftlll nUlra 
kfitlHlsluksIa (ehkO, el omalnen, el- 
ka vierns. Joku Icldan lenssaiine 
rtitiukaliiinen on. 

■TTv Sillfl kaikklu nflllft hauhislukiia 
oval Iflmlln ninaii kansul tchneet, 
jUlkn Iddiln edetianne otival. jo 



lanul sen kansan, joku leldflnedel- 

29. Slim' kuka Iklnfi atHi kuuhls- 
liiksia tekee. ' pHOIt hnvilellflmlln 
knnsaslnnsa. 

% Senrflhden plinknai minun kfls- 
kynl. ellelte 9eura[sl niiin knuhlsla- 
vullln lapolo, Jolla he lekNfll, joiku 



Her 



', teidnti 



ig Luku. 

JaHerrapuliufMoosek«ell«,SBnoen: 
-2:Puhu koko Israelln lastenjoa- 
hollejasano heille: 
'Olkaiii pyhM, slim mlna elen pyhS, 
Herra, teiUan Jumalanne. 

3Moa9.]M1,45^30:T, 
3. Jokalnen pelJIItkAOn.ailiansB Ja 
isaflnsS. Pitakaoi mlnun sabballini. 
MiriR olen Herru, leldDn Jumalanne. 

Jj*. 31:13. 

nlien ty- 



ina pai- 

loUeno 
tksl jfla 
I luiella 
l<»^T:ie. 



7. Jot lohu stl» kattenkiR syS Mi' 
msntena i>elvana, nlln se on kau- 

hJltus.elkAo)eotolllnen. 8Moo«. 7;K. 

8. Ja ]oka aHlS syfl. hfinen pltBO 
kaniaraan vallryytensB: slllfi Ma 
on seii SBastullanul, mlkB on Hi^- 
ralle pyhiletly,]B han hBvlleltllkaOii 
kaniailansB. 

9. Kun le elon lelkkaalle oiaaalail' 
ne, nihi BIB tarhkaan leikkaa pel^ 
tosi reunoja myOlen. BIH mySskitan 
noukf tBhklB leikkuun JBIkeen^ - ' 

SMooi. 13:72, &Maas,tl:i9Ba,' 

10. Ja vllnimBHsBsi BIB lolinftu 
JBIklkoriuula. aiBka nouki varisv 
ndta marloja, vaan jBia ne valvul' 
sllle ia muukalaisine. MtnB olen 
Herra. teidfln Jirnialanne. 

11. Bi teldan p[da varustaman, d- 
kR vnlehleleman, eikK petlQlnSn toti 
nen tolstsnne. •zMoof.SOMat. 

El.4^.1&. tTera.4«: 

12. ElteldBnpidnvflBflnvannomnn 
mlnun nimeenf, la hBpQisemBii sl- 
nun Jumalasl nlmeS. MlnB ^cn 
Herra. sMooileo:?. (Mooa.B:ii. 

Milt 8:33,91. jKBJc.kR.' 

13. El sinun pldB lekcmftn IBhtm- 
mBiiellesI vflfiryytlB.eikB ryOslBmfln 
liBnellfl miiBBn, PBivamieliesI pulkka 
BIkflOn olko sinun tykflnBst buo- 
mHeen asti, &Mi>a9.l4:lta. Tob. 4;isJ 

Syr.Wfil, jMk.5r*. 

14. EiilnunpidBkuuroJahlrooman, 
elkn puiMman soklan eteen kont* 
pnilusla. Viinn sinun pltflB pelkSII' 
mnn ainun Jumolalasl. MlnB t^eil 
Herro. SMotrtJaTrW, 

15. Bi teidnn pidft vBnr^yttn teke- 
mnn luomlossa; nift vBRryytMIII 

f>id9 kOytiBn puolta, BIflkB puolueel- 
Isesli kunnlotta voimallisla, mullu 
tuomiise lilhlmmBrslBsl olkein., 
!M(»i.23:3. SMooa. 1:17. I6:l». Sao..2«SI. 
Juk. M. 
10. El stnun pIdB olemai) panel- 
leiijana kansati kesken. El sinun 
pldB myOt aicilaman Itsesi IBMm' 
mBisesi verla vaslaan. MlnB olen 
H«rra. tMao».a:i. Pi.ias. 

IT. El sinun pidB vthaaman vel- 
JeBsi ilnun sydfimmessasl ; mulln 
sinun lulee kyllfi nuhdelia IShlm- 
maisinsl, ellei vlkapBBkil lulial h&- 
nen inh1ensB.Sfr.l»:13>9. Ht[ka:£2jI8!n. 
Lauk.lTA lJoli.39,11. S:ia. 
IS. El stnun pidB koaiaman, eikll 
vlhaaman sinun kansesi lapsin.' 
Sinun pitaa rakasliimunlOhlmmBlB- 
tasi, ntlnkuin llseBsl. MlnB olen 
Herru. MMt.fi:43u.2!:». Rooai.nM, 
M:». 0>].6:U. ITcH.C:!^ lPiet.3». 

10. Mlnun sMftWnipltOkBM. AU, 



^ialtMjMbfllttlcsi CFriHUiN elBln. 
livMHil mieflna; «a kylvl pellooU 
Mlt«TiUli(a slemenlA; BlkUnka 
tM» *H«tl hahdetta ertlaf^a a^- 
kkM, vHltdMitfr Jh IlinaHeslR lan- 
nUL tehty vMte; BMoM^wnL 

A Jovmlei'iiMkaA tnlmoh, IMw 
oHOrJa ]■ lo loiselle mtebeUe mu 
KfM, nUDlcUllviiltnn «l«lefBn«k- 



a. Multa ,_ r 

Bcmlle vtfcanM «deiU bInMn ii- 

kanKrikM; 



mleb^n nllM lutunlin 



A Bl leidRn pldS mllBSa syamSn 

moi kantsa. Ei ItfUfln pfdl' M- 

"«nwo aavliluhBfa elkft Kilkiiufciie. 

' 8U«n.B:11. 7;M. trnOH. 

n. Ei leldln pldB kerltsemBit pal- 
JMkil kofeo pfilnhe lake*, clkaly]'^ 
■11 itidenum lekHM pnrttunnti. 

"■laT- 

1 !ni. 



^Sl. quni 1<ftiMykS tieUiillen ty- 
U.]b IlklSi kysyks velholllH, «t- 
Mte faeisM ^astolal; HIna olen 
Bimi, teidtn Jumalanne. 

(Mmi.»«^. ISan.K^H. Jit.S:l«. 
B. HarnnapflSti edeMB pii9A xi- 
■■Bn nDuMmani'-Jk knnDittlttaitian 



vMlida,}a.p«nfMiMilnAMii-Jutn» 
iBlail. MtRSolen Herrs. .. i . >- -i 

S3. Jo« Mu munkalalnmiMMilvu 
kftaM- l«MI« m^alUuine^ntlHMtUti 
sMiBko hftaifi.' -. *uo6t.nMiXit. 

U. NlMkuin omalnen oikoon lellle 



-___- hamft/ nHnknln rtltoi 

Hilt MIA teslUla myO*- n)«uk«i>t-< 
M* Bgy^Hn ntfaltaj" MM! ' ataai 
Ham, teldanJumaJanBa.:'. :: 
J6j'A(kiai tchkO TCBniyttt'LtUH- 
mdsam, cl byynarilla, 4M*il«Hiir 
nriUUa. KMi>iM:»!ltNJi|lw]mi.tld 

■ ■ ■■' -II. aM*. Mk.'VllOlKI 
BSwOlkUvaaka. olMat<|tu«nlMiliel|l 
otkia em, oikita hin-mllla olkooa 
MIIIB. MUd olen Heirai taidfai j!(f- 
' 'M*ic. toka tcidM Olan jofedatta.l 

BgypHn imialM. : i 

KUnjtaldim «R1I Noadallamant 



3,Luku. ' 



J a Herra puhulU6l>iekselIe,nti(»*;l 
2.<S*ilo myai I>^BHin lapsille: 
Jo»)«ku IaraBltn<ln|i«Cj«i'talit*hi*f- 
kalBIalita, }<ilkB liT«tltoi>tBslea.ka»>' 
kH10adu*BI,laatianu>!aiMaiUaleMlti 
le.< hSnon ku^ltmalln rdngatUaudU 
maan katMan plUtt MDta hlvilUn 
mnrt kMIIAuksfiBliWakMini Vt.l»at.> 

5. Ja-BHtnaaEcMn 'tnlnuh'kalvoili 
Sltfl thmiua TMMm.Ma MuilBDM-; 

. nen kankatLansa, kosko han.dn.pnii 
tanut' tepfflainfea M^ktUel ja'. sen 
kautta pyhnkhOnt ' saaaluttanul,' M 
mlnun pyhan nlmeani hlhlUtiMFl; , 
4.'^a'](M mean ksma BUnUHDiUft 
sBasiUhJialinkiptlaiiiaonBiilaiuaUliM 
lekillG.niinellelvathehanlUtsrntMb 
'6.' nHn'nilnD'koHGnhiaiaelailkit- 
v<onl' Eia nifnlsta VoMaaii iti Unen 
lultilanM VBBlaan, ia- M*fil^ 1ifi»T 
ssstaius tilnei ia kidkiri,- JoUifi 
bSnen ^tfrSMftiNib 'MolfcHi> jkaniu) 
huortn lehnect «vati . . ..-ti../,.! 

6. Jos lokUikDAnlyyinolUiin jaili«t 
iBJirten pttotaen, MiaTln.tekamARn 
heldBn kanssansa. niin niinft asetan 
ka^onl 'hBnID vastaan, jB liAvllItn 
hand kansatlanui. SMvca-iSiftu 

7. Sentdhdea pyhiiifikBii itteaan 
Ja oikaal pyhOl: lillB J-'-' ~'-- 



t. Ja pftUttfil minuo sMbUHiI. Ja 
lehhaat iilita, Mlaa olen Uclra, }€■• 
ka teilB pyhttM .; ... . .. , 



3 MOOS. 20. 21. 



9. Joka isftflnsfi tahi ftitiftnsa kiroo, 
hftnen pitftS totisesti kuoleman ; hfin 
on kiroDBUt isfidnsfi ja Aitifinsa, hft- 
nen verensfio]koon hfinen pfifiUdnsfl. 

2Moos.21:17. 6Moo8r27:16, San. 20:20.30:17. 

Matt. 15:4. 

10. Jo8 joku buorin tekee toisen 
mielien aviopuolison kanssa, se, joka 
Ifthimmfiisensft vaimoQ kanssa huo- 
rin tekee^ pitfiA totisesti liuoletelta- 
man^ sekA nuorintekijfi^ ettft huora. 

2 Moos. 20:14. Matt.'5:27. Job.8:48d. 
. 11. Jos iokift makaa isftnsfi vaioion, 
niin pal|astaa hftn isftnsiS hSvyn, ja 
he molemmat ovat kuolemalla ran- 
gaistavat; heidfin verensfl oikoon 
heidftn pftfillfinsfi. 8Moo8.i8:& 

6 Moos. 2230. 2720. 

12. Jos joku makaa miniAnsfi, niin 
he molemmat pitftft totisesti kuole- 
man ; he ovat kauhistulcsen tehneet, 
heiddn verensft oikoon heidfln pSftl- 
Iftnsft. SMoos. 18:15. 

13. Jos joku miehenpuolen kanssa 
makaa, niinkuin jonkun vaimon 
kanssa, niin tekevSt he kauhistuk- 
seTi; heidSn pil9fi molemmat toti- 
sesti kuoleman; heidSn verensS oi- 
koon heidfin pSfiliflnsfi. 

1 Moos. 19:7. 3MOOB.1822. 

14. Jos joku otlaa vaimokseen nai- 
sen ja hflnen fiitinsfi samalla ker- 
taa, fafin dn kauhistuksen tehnyt; 
hftn on tulella poltettava ynnft ne 
molemmat, ettei yhtftftn kauhistusta 
olisi teidftn scassanne. 3 Moos. 18:17. 

15. Jos joku makaa elftimen, hftnen 
pi tl^ft totisesti kuoleman, jaseelftin 
tappakaat. 3 Moos. 1823. 

16. Jos jokii nainen pitftft yhteyttfi 
jonkun elftimea. kanssa, niin sinun 
pitftft tappaman sekfi naisen, ettft 
elftimen ; neidftn pitftft totisesti kuo- 
leman, heidftn verensft oikoon hei- 
dftn pftftUftnsft. 

17. Jo» joku ottaa vaimokseen sisa- 
rensa, isftnsft tahi ftitinsft tyttftren, 
ja hftnen hftpynsft nftkee, ja se nft- 
kee hftnen hftpynsft, niin on se hft- 
piftllinen teko , ja ne ovat kuoletet- 
tavat heidftn sukunsakansanedessft; 
hftn on sisarensa hftvyn paljastanut, 
hftnen pitftft pahuutensa kantaman. 

3 Moos. 48:9. 

''id. Jos joku nUies. makaa jonkun 
vaimon hftnen salrautensa aikana, 
ja paljastaa hftnen hftpynsft, ja avaa 
hftnen Ifthteensft, ja vaimp paljas- 
taa verensft Ifthteen; niin ne -molem- 
mat pitftft hftvilettftmftn heidftn kan- 
sastansa. SMoos. 18:19. 

19. Slnun ftitlsi sisaren hftpyft ja 
slnunlsftsi sisajren hftpyft ei sinun 
pidS palijastaman: Jolui niin tekee, 



on veriheimolaisensa palja^lanut, ja 
heidftn pitftft pahuutensa kftntaman. 

SMoos. 18:1288. 

20. Josjokumakaasetftnsft vaimon, 
hftn on setftnsft hftvyn paljastanut; 
ne pitftft heidftn rikoksensa kanta- 
man. Lapsittomina heidftn pitftft 
kuoleman. SMoos. 18:14. 

21. Jos joku veljensft vaimon ottaa, 
se on hftpiftlllnen teko; heidftn pi- 
tftft lapsittomina oleman, ettft hftn 
on verensft hftvyn paljastanut. 

SMoos. 18:16. 

22. Niin pilftkftftt nyt kaikki minun 
sftftntOni, ja kaikki minun oikeute- 
ni, ja tehkftftt ne. ettei maa teitft 
oksentaisi, johonka minft teidftn 
vien asumaan. 3 Moos. 1825,28. 

23. Ja ftlkftftt vaeltako niitten paka- 
nain sftftnndissft, jotka minft teidftn 
edeltftnne olen ajava ulos; sillft 
kaikkia n^itft he ovat tehnee.t, ja 
minft olen kauhistunut heitft. 

24. Mutta'teillesanon minft: teidftn 
pitftft omistaman heidftn maansa; 
sillft minft annan teille sen perin- 
nOksi, sen maan, jossa rleskaa ja 
hunajata vuotaa. Minft olen Herra, 
teidftn Jumalanne, joka olen teidftt 
eroittanut muista kansoista. 

25. J^ teidftn pitftft myOs eroitta- 
man puhtaat elftimet saastaisista, ja 
saastaiset linnut puhtaista, ftlkftfttkft 
saastuttako itseanne niitten elftin- 
ten, lintujen ja kaikkien kautta, 
kuin maalla matelevat, jotka minft 
teille eroittanut olen, ettft ne ovat 
saastaiset - SMoos. li2ss. ^Moos. 14:4. 

26. Olkaat siis minulle pyhftt, sillft 
minft, Herra, olen pyhft, ja olen tei- 
dftt eroittanut muista kansoista ole- 
maan minun omani. 

27. Jos joku, mies tahi nainen, 
noituutta tahi tietftjftin tointa har- 
jolttaa, hftn on rangaistava kuole- 
malla ; hftn on kivitettftvfi kuoliaak- 
si, verenvika on hftnen pftftUftnsft. 

2M003. 22:18. 3Moo8.19:3L 5 Moos. 18:10 ss. 

1 Sam. 28:7. 

21 Luku. 

S&ftntOjft papeille. 

J a Herra sanoi Moosekselle: puhu 
papeille, Aaronin pojille, ja sano 
heiUe: pappi ftlkd6n saastuttako it- 
seftnsft yhaessftkftftn kuolleessa kan- 
sastansa, 4 Moos. 6.6 ss. Hes. 4425. 

2. vaan ainoastaan hftnen Ifthini- 
mftssft suvussansa: niinkuin hftnen 
ftitinsft, isftnsft, poikansa, tyttftrensft 
ja veljensft; 

3. ja myds sisaressansa, jos hftn 
neitsyt on ollut ja asunut hftnen t^'- 
kOnftnsft, eikft yhdenkftftn miehen 



124 



3 MOOS. 21. 22. 



vairoona ole ollui, saa hfin itsensft 
saastuttaa. 

4. Koska hSn on esiniies kansas- 
sansa, niin HlkdOn h&n saastuttako 
itsefinsa, eik5 halventako itsefinsfi. 

5. Papit SlkdOt ajelko pflfilakiansa 
paljaaksi, eivfitka k^ritkO partansa 
Kulniia,eik5 leikatko ihoonsa merk- 
kia. 3 Moos. 19:27. 5 Moos. 14:1. Hes. 44:2a 

6. HeidSn pitsa Jumalallensa py- 
nSt oleman, eikS hfipniseman Ju- 
malansa nimea; sillfi he uhraavat 
Herran tuliuhria, Jumalaosa leipflft, 
sentahden pitaa heiddn oleman 
pyhSt. 

7. Alkddn kukaan hcistd ottako 
vaimokseen porttoa, eika hfivdistya 
eika mfehensA liylkanmas vaimoa; 
silia hftn on pyhS Jumalallensa. 

8. Sinun tulee pitiA hftntd pyhflnS, 
silia hfin uhraa sinun Jumalasi lei- 
paa; hfin olkoon sinulle pyhfi, sillfi 
minfi, Herra, olen pyhfi, joka teidftn 
pvhitfln. 

9. Jos papiYi tylfir rupeaa salavuo- 
teiseksi, hfin pitfifi tulessa poltetta- 
nian; sillfi han on hfivfiissyt isfinsfi. 

10. Joka on ylimmfiinen pappi vel- 
jeinsfi seassa, jonka pfifin pfifille 
voilelufiljy on vuodatettu, ja kfisi 
Ulytetly on, ettfi hfin pa pin pukuun 
puetetaan, hfinen ei pidft paljasla- 
man pfifitfinsfi, eikfi repfiisemfin 
vaalleilansa , 3 Moas. 10:6. 

11. ei yhdenkfifin kuolleen ruu- 
miin tykO tuleman, eikfi saastutta* 
man itsefinsfi isfissfinsfi tahi fiidis- 

sansa. 4 Moos. 6:7. 

12. AlkOdn hfin IfihtekO pyhfikdstfi, 
ettei hfin saastuttaisi Jumalansa py- 
liakkdfi; sillfi hfinen Jumalansa voi- 
'du-dljyn vihkimys on hfinen pfifil- 
ISnsfi. Minfi olen Herra. 2 Moos. 28^5. 

13. Hfinen pitfifi ottoman neitsen 
vaimoksensa. H^. 44:22. 

14. Leskefi, tahi hyljfiltyfi, tahi hfi- 
vaistyfi, taikka porttoa filkdCn hfin 
ottako; vaan neitsen omasta kansas- 
lansa ottakbon hfin vaimokseen, 

15. ettei hfin saastuttaisi siementfin- 
sS kansansa seassa ; sillfi minfi olen 
Herra, joka hfinen pyhitfin. 

16. Ja Herra puhui Moosekselle, sa- 
noen: 

.17. Puhu Aaronille, ja sano: jos 
ioku virhe on jossakussa sinun sie- 
menessfisi teidfin suvussanne, fil- 
kWn hfin IfihestykO uhraamaan Jii- 
malansa leipfifi. 

IS. Sillfi ei kukaan, jossa joku vlrhe 
on saa astua esille, oli hfin silten 
»okia, tahi ontuva, oU hfinellftjoku 
yamma kasvoissa tahi joku jfisen 
Hika suuri, 



19. oli hfin vlrheelUnenJalasta tahi 
kfidestfi 

20. tahi kytt)*rftselkA tahi kfiftpi5- 
kasvuinen, vikainen silmilsli tahi 
pisamainen, rupinen tahi rivinoma 
rauhaisista. 

21. Jos jossakin papin Aaronia sie- 
menessfi virhe on , ftlkMn hfin lib 
hestykO uhraamaan Herran tuliuh** 
ria ; hfinellfi on virhe, sentfihden fil- 
kddn hfin lfihestyk6 Jumalansa lei- 
pfifi uhraamaan. 

22. Kuitenkin saa hfin sy6dfi Ju- 
malansa leivfistfi,.sekft siitfi pyhfls- 
tfi, ettfi kaikkein pyhimmSstfi. 

23. Mutta ei hfin kuitenkaan 59a 
tulla esiripun tykO, eikfi Ifihescyfi 
alttaria, koska hfinessfi on virhe, et- 
tei hfin saastuttaisi minun pyhfifini; 
sillfi minfi olen Herra, Joka heldfin 
pyhitfin. 

24. Ja Mooses puhui nfimfi Aaronil- 
le ja hfinen pojillensa , ja kaikilie 
Israelin lapsille. 

22 Liiku. 

Vielfi 8aantOJ& papeille. Laki uhrin 
syOmisestfi. 

J a Herra puhui Mobsekselle, so- 
noen : 

2. Puhu Aaronille ja hfinen pojil- 
lensa, ettfi he karttavat niitfi pyhifi 
Inhjoja, joita Israelin lapse! mniulle 
pyhittfivfit, etteivfit he hfipAisisi mi- 
nun pyhfifi nimefini. Miofi olenHerra. 

3. Sano siis heille : jos joku jfilkeen- 
tulevaisianne kaikesta siemeneslfin-. 
ne Ifihestyy pyhitettvjfi lahjoja, joi- 
ta Israelin lapset pyhittfivfit Herral- 
le, ja hfinen saastaisuutensa on hfl- 
nessft, hfin on hfivilettftvfi pois mi- 
nun kasvojeni edeslfi. Minfi . olen 
Herra. 

4. Kuka ikfinfi Aaronin sfemenestfi 
on spitalinen tahi vuotavainen, hfin 
ei saa syOdfipyhitetyistfi,ennenkuin 
hfin pundistetaan. Ja jos joku kos- 
kee johonkuhun saastaiseen ruu- 
miisen, taikka siihen, joka sieme- 
nensfi vuodattaa unessa; . 

3Moo^l5:2,t6. 

5. taikka jos {oku koskee johonku- 
hun matelevaiseen,jokahinetlesaas- 
tainen on, taikka ihmiseen, joka 
hfinet saastuttaa, olkoon hfinen saas- 
taisuutensa mikfi hyvfinsa; 

6. se, joka koskee johonkuhun nfils- 
tfi^ olkoon saastainen illaan asti, fil* 
kOOnkfi syOkO ntisAft pyhitetyistfi, 
vaan hfinen pitfifi ensisti pesemfin 
ruumiinsa vedellft. 

7. Mutta kun aurinko on laskenut, 
ja hfin on puhdistettu. nlia syOkOdn 



125 



^uoos^n. fss. 



nen ruokansa. 

-«i<llsdca4milla( l«hl j^edbn ralit^Ie- 
ttlali elMntft dUcIMn hfin S!ti^(S\ ettel 
iifitf i^&siaasituisL Sfllnftden H«rrf|. 

2 Moos. 2231. Hist. UtAU 
H. Sentfllfden tiil«eAiiclftiipitftAnii- 
ftum sfidnlSiiii, eUelvflt saattaisi syis- 
4m jiO&llensft jaktioHsi Siitft,k6skli 
He f|i^lifia *tsaastiittava4. Minfi olea 
fli^rra«!J4ifca heWk i^yhiCfim ! 

10. Mutta ftlkOOn yksikSftn lAnuka' 
iaincil syekA riii^ pyhitetyislfi; ei 
-pafiHi iiia9amies,,6iK&ipiilkollineii 
saa syOdft^pyhiteityfi. ' 
' It. Mutta jQS pappii iostaa jonkun 
polkoldsen .raliallabsa^ se sydkOdn 
^Utft; ]a/ joka hiVneA tiaoneessansa 
^ntynyt on, se myOs syOkfidn hft^ 

12. Ja jos papin tytfir tulee jonkun 
-MutnkiAaiiseh \«ifihoksi< niln ei hSn 
istiit^syddA.siUA pyhitqtystft yl&nnyk- 
sestS. 

13. Mutta jos papin tytfir tulee les- 
keksi talii hy|[ft^yic9ii eik& hSnellfl 
ole sjlemenia, ja hfin tulee jAlleen 
kotra TsffU^g huoueesen, hlin liSn 
saa sy5dfl isSnsfi leivftstd, niinkuin 
iSlloi«iikln;fcuR hfiiuieilqenft oil; Mut- 
ta ei yksikfifln muukalaineo saa sH- 
Hr<S2r<Jd*; ' 1 3 Moo*. 10:14. 
r (14 /ila^os joku lietftfrfSliinsS sy0 niis- 
ua- pyltifeiyistft, hfin^n pilftft lisfift- 
-mSn siihen-'Viidehnen osan, ja an- 

lamanpapilie pykitetyn. 8 MM0. 5:16. 

t6i Papit 4|lkdOt ^aastottako niitft 
-pyhlA Jffhjojav Jolta Israelin lapset 
ftfilavat Herralle, 

16; eldeivAt saattaisi rikosta ja vi- 
-kaa pAAllensA, svtvdessfinsfl heidfln 
-pjshltettyjft labjojansa ;^ sillft minfi o- 
•leipHerra, joica heit& pyliitfin. 

17. Ja Herra puliui Moosekselle, sa- 
»rt<w»r': •■ ■ '■■-.* 
i S&.i^uhu Aaronille ja hfinen po- 
JiUensa; ja kaikiiJe Israelin lapsil- 
•le;{ja seno heilie: jos joku Israelin 
-huoneestB tahi muukaloinen Israe- 
-llssa^talUlKx^uhralu , ol kdon se lupa u k- 
sesta taiklflB vapaasta talidosta« Jota 
he' taihtovU 111 h rata Herralle polttouh- 
-riksi/' = » . ' ' / - ■ . • ' - 
' 1^ niln:tehkftflt se niin, ettd se tu- 
iiiii. olottiseksi, ja uht-attokoon vir- 
-beelOff* hflrkytnea karjasia, oinas 
karilsoislar, Ia4ii kauris vuobista. 
- 2Dr Mufliv(klk06iotlakoyht&Anelfiin- 
-lA,l6ssn virlie on: siiiA ei se o\e Hfi- 
.neueotdSNnen teilld.eM<M>«. i&:2t. i7:i. 
f.Si. Jos^ jbku lalilod qtirata Herralle 
kiitosutiria karjasia 'tahi lampaisla. 
Jotao ^homaisenlupaukscn jotidos- 
aaHiikka vapaasta tahdasta^ niin ol- 



koon se vlirheetOnv Mfft fte fAisido)* 
linen; ei siinft saa olla vhtflftn vitw 
liettfi. ' . . > : r Mjji^ tti,$B, 

22. Jos se on sokia^ taikka nni(|a*' 
rikko, taikkajftsenpuoli, taikka koi«> 
vetlunut, tajkka rupinen, taikka kfih- 
nflinen« niin. el sehkaltaista pidft 
Herralle ulu'aaman, ftlkftfttkfi tunuh* 
ria nilstA antako ^erran alttariUe. 

23. Hflrfth tahi lampaan, ioUa joku 
jAsen on liian suuri tal Itian pleni; 
saat sentflfln uhrata vapaa-tahdon 
uhriksi; mutta ^i se ole otolllnen 
lupauksen uhriksi. 3Moos.2]f:i». 

24. Alkfiat sits uhratko Herralle, jo« 
ka muserrettu, ruonellu, r^vltty, tk- 
hi haavoitettu on; ei teid3n pidfi si* 
ta teidfin maassanne tek«k)An. 

25. AlkSftt myOskfiAn jonkun muli- 
kalaisen kfidestfiottakouhrataksenne 
sellaista Julnalaiuae leivftksl. silift 
ii^ ovat tumieltuiieitajavirh^lisift ; 
eivfit lie* tee teitft otolllslksi. 

26. Ja Herra puhui Moosekselle, 
sanoen: ' 

27. Kun vasikka, karitsa, tahi voh'^ 
la on syntynyt, niin olkoon seemflnt 
sA tykOnA seitsemAn pAivAA; mutta 
kahdeksantena pAivAnA ia sen jAl« 
keen on se <>t611inen tuliuhriksi Her* 
ralle. 

'2S. AlkAAt nautaa tahi lammasta 
teurastako sikidinehsA samana pAi- 
vAnA. l(Mo(>S.22Aft8i 

29. Kun ieuli'raatte Herralle kiitos- 
uhria, pHAA teidAn sen niin uhraa"* 
man, ettA se otolllnen olisi. 

30. Se pitAA syOtAmAn sinA pAivA- 
nA, ja AlkOOh mitAAn jAtettAkO tAh- 
teieksi huomeneksi. MinA olen Her* 
ra. ^8 Moos. 705. 

31. PilAkAAt minun kAskyni ja teh* 
kAAt ne. MinA oyn Herra. 

32. AlkAAt hAvAlsHA minun pyhAA 
nimeAnl, slIlA minA tahdon tulla 
pyhitetyksi Israelin lasten keskeUA. 
MinA olen Herra, joka teitA pyhitAs, 

8Moos.i0d. 

33. ja joka olen teidAt johdattamtt 
Egyptin maallu.^ettA minA olisin fei- 
d&» Jumalailine.^ MinA olen Herra. 

«3 Luku. 
VvotisteD:JubUplUTjmv s^itnooi* 

J a Herra puhui Moosekselle, sa- 
noen: 

2. Pnhu Israelin lapsllle, ja >ano 
heilie : nAmA ovat Herran juhlat. jo|u 
ka teidAn pitAi julistaa pyhiksi ko- 
kouksiksi; ne ovat mtnun juhlanf. 

3. Kuusi pflivAA tulee teidAn tehdA 
ty5lA, vaan seftsemAntenA pAivAnA 
on suuri sabbatti, pyhA kdktHDi. J0k> 



196 



-2 HOOS. 2S. 



Dt d feidin pldifyhtftin tydlA tekfc- 

miln. St fla Herran sabfaafU missQ 

paikassa asnnettekm. 2iMoo8. 20:9. 

23:12. 51IOOS.6U38S. Luuk. 13:14. 

4. Ntoil ovat Herran juhlapftlvftt, 
pyhlt Icokoukset, totka teidfin pltM 
pitflmSn mfiftrfityliA ajallansa: 

5. Ensimmfiiscn kuukauden ne|- 
jflntenfitoista pfiivlnft illan suussa 
onHerranpfiftsiftinen. 2M008. i2aS88. 

.aSdS. 4 Moos. 28:16 cs. 5Moos.l6:l« 
<». Jasaman kuukauden viidentenft^ 
toista pfiivftn& on Herran happamaN 
toman leivfin juhla; siltoin pitflfi 
teklfia ftyOmftn happamatonta leipfift 
seitseiiiln pftivftfi. 

7. BnsimmAisena pfiivfinfi olkcMMi 
teillfi pyiUk kokous, eik& yhtflfin 
raskasta ty6Ul pidA teidftn ailloin te- 
kemtn. 

8. H. teidfln pitAA uhraaman Her* 
reUe tuliuhria seitsemftn pftivfifl. 
SdtsemanlenA pftivftnfi on myOs py* 
hftkokous: silloin ei tddilnpidfiyh* 
tiUUian raskasta tyOtfi tekerafin. 

9. Ja Herra puhui Moosekselle, sa- 
Doen: 

W. Puhtt Israelln lapsille, ja sano 
hdUe: kun tetttlettesiihenmaahan, 
jonka minft annan teUle, ja te leik* 
kaatte sielia elon, niin teidffin pitfifi 
^rididn papille sen lyhteen , joka 
on uutinen teidfin eldstanne. 

U. Ja sen lyhteen pitAS hfinen hftfi- 
lytiamfin Herran eaessfi , ettft te tu- 
liaitte otblUseksi; pfiivfift jAlkeen 
nbbaiin pitflft papin sen liAftlyttft- 
Biln. 

12. Ja tefdfin pitflfi sinfi pfiivfinfi, 
Jona teMfin lyfateentoe hfifilytetfifin, 
ahraaman virneeltOaifinvuosikauti- 
sea karllsan polttouhriksi Heralle, 

13. ja ruokaunriksi fcakd kymme* 
nesosaa daa 6|jyllfi sekoitettujahie- 
ii<4a jauhola. tuliuhriksi ja otoUi- 
MksihajuksiHerfalle^sekftjiionMiuh- 
rikd neljinne^ hinniA viinift. 

a Ja Alkfifit syOkOuutisleipfifl^kui- 
vattnja tfthkfipftitfi tahi luorefta 1y- 
vift ennenkuin olette kant^neet iu^ 
■lilallenneUhrin. Se olkoon I kolnen 
sttniA teille snvusta sukuun, mfosfi 
asnettekid. 

,16. Sitten lukekaat siitft tolsestasab* 
katin afiivistfi^ jona te kannbitte 
esiUehafily tyslyhteen, seitsemfin Ifiy- 
naaistfi vUkkoiW ' iMoos. 16:10. 

16. toiseen pfilvfifin asti; seitsemfin- 
o<n vilkon jftlkeen, se on, lukekaat 
^^iirikyinipentfi pAivAA, ja sitten uh- 
'•ikaat Uemlle ruolMiuiiria uul|- 
lesta. 

17* AknnaslfoislAihiei jossft asutte, 
taokaat kakfhfifilytysleipfiA, jotka 



dtal leitrolut kahdedlk kymnDeiiek- 
osaa efasta hienoja jaulioja ja tiapa»> 
tetut, Herralle utitiseksl. 

18. Ja luokaatynnfi leipfinne kaas«> 
sa seitsemfin vuosikautista ja vir^ 
heetOntfi karitsaa« yhden nuoren'hA* 
rfin ja Icaksi oinabta nkridlavaksi 
Herralle polttouhriksi siihen ftuu^ 
Ittvine ruokauhHneen jfi juomkuh- 
rineen; se on tuliuhri hyvftk^i ha« 
juksi Herralie. 

19. Niin mvOs pitfifi teidfin valmlS'i 
taman kauri in rlkosuhriksi^ja kaksi 
vuosikautista karitsaa kiilosuhriksi. 

20. Ja papin pitfifi hfiftlyttaniin he 
uutisleivfin mukana hfialytyksektl 
Herran edessfi kahden karitsan kans^* 
sa. Ne oikoot Herralle pyhfit, ja pa- 
pin omat. r 

21. Ja teidfin pitfifi kuuluttaman sh> 
nfi pfiivfinfi pynfin kokouksto pidet-i 
tfivfiksi; ei teidfin pidfi siiioirt tyfitft 
tekemfin. Tfimfi olkoon ikuinen'sflfin^ 
to teille suvusta sukuun, missft asu- 
nettekin. 

22. Kun te leikkaatte eloh tefdfin 
maaslanne,ei stnun pidfi aiviinfark^ 
kaan i>eltosi kulmia leikkaaman, ^ 
kfi tfinkfipfiitfi noukkiman, vaan jfi-i 
tfi vaivaisiile ja muukalaisllle. Minft 
olen Herra, teidfin Jumalanne. 

3MO08. 19:988. 6MoOfl.24tl9.' 

23. Ja Herra puhui Moosekselte^sa^ 
noen: 

24. Puhulsraelin lapsille, ja sano ^ 
seitsemfinnen kuukauden enslmmfii- 
senfi pfiivfinfi pitfikfifit mutstoksf 
soittamisen saboatti, pyhfi kokous. 

4N008.29:1. 

25. Silloin filkflfit mitfifin raskasta 
tyOtfi lehkd, ja teidfin tulee uhrata 
tuliuhri Herralle. 

26. Ja Herra puhui Moosekselle, sa- 
noen: 

27. Multasamanscitsemfinnehkuu* 
kauden kvmmenentenfi pfiivflnl on 
sovinlopfiivfl,se olkoon teiilepyhfiko- 
kous; silloin vaivatkaat teidfin sielu^ 
janne, ja uhratkaat Herralle luliuhrf. 

.'3M008. I6i30. 23:0. 4 Moos. 29:7 89, 

28. Ja ei pidfi teidfin yhtfifin tyOtfi 
tekemfin sinfi pfiivfinfi; sillA se on 
sovintopfiivfi , joUoin te sovitetaan 
Herran, teidfin Jumalanne edessfi. ' 

29. Ja jokainen, joka ei sinfi pAivA-' 
nfi vaivaa sieluansa, hfin on hfivi* 
tettfivfi kansastansa. 

30. Ja jokainen, joka sinA pfilvAnA 
jotakin tyOtA lekee, hAnen minA hu- 
kulan kansastansa. 

31. Sentfihden ei pidA teidAn silloin' 
milfifintyMfltekemAn.Seolkoonikui- 
nen sAAntd teille suvusta sukuun, 
missA asunettekin^ 



]^i 



3 MOOS. 23. 24. 



82. Suuri sabbatti on se oleva teil- 
le, ja teidSn pitlia vaivaaman teidan 
sielujanne. Kuukauden yhdeksdnte- 
nS pfiivdna ehtoona tulec teiddn pi- 
tdfi tftma sabbatti, iHasta iltaan 
saakka. 

33. Ja Herra puhui Mooseksclle, sa« 
noen : 

34. Puhu Israelii) lapsille, sanoen: 
tSinSn seitse'mSnnen kuukauden vii- 
dentendtoista pdivdnA on Herran leh- 
timajan* juhla, seitsem5n p3ivd3. 

2Mo08* 23:16. 4 Moos. 29:12 ss. 5Moos. 16:13. 

Job. 7:2,37. 

35. Erisinim3isen& pfiivSnll pitSd 
oleman pyh§ kokous; el teiddn pi- 
dd yhtfiUn tydta silloin tekemdn. 

36. Seitsemdn pSivSS pitfiS teidan 
uhraaman tuliuhria Herralle; kah- 
deksantena paivSnS olkoon tellld 
pyhft kokous, ja teiddn pitSS teke- 
mSn tuliuhri iierralle, silld se on 
juhlakokous : ei pidd teidSn yhtSSn 
tydtd silloin tekem&n;. 

37. N3ma ovat Herran juhlapf&ivHt, 
jolloin teiddn pitAfl kuuluttaman 
pyhdt kokoukset, ja uliraaman iier- 
ralle tuliuhria, polttouhria, ruokauh- 
ria, juomauliria, joka pSivfi siksi 
pSivdksi mddrattyjd uhreja, 

38. paitsi Herran sabbattia«ja pait- 
si teiddn lahjojanne ja paitsi lupnus- 
uhrianne ja paitsi kaikkta vapdxieh- 
loisia uhrianne, joita te tuotte Her- 
ralle. 

39. Viidentenutoista p&iviinfi seitse- 
mSkttS kuuta, koottuanne vuoden tu- 
lon maalta, tulee teidSn juhlaUisesti 
vlettdft Herraii riemujuhlaa, seitse- 
in§n pSivftd. Enstmmilisenfi pAivS- 
nli on sabbatti, ja kalideksantena 
pSivftnd on myds sabbatti. 

40. Ja teiddn pita§ ensimm^isenfi 
pdivdn^ ottaman hedelmiSparhaim- 
mista puista, palmun vesoja, ja ok- 
sia tuuheista puista « ja pajulehvi£i 
ja oleman iloiset seitsemdn pSlvSa 
Herran, teiddn Jumalannc edessd. 

Neh 8.14 ss. 

41. Ja tuts riemujuhlaa tulee tei- 
dan pitdd Herralle vuodessa seitse- 
m3n pfiiv33. Se olkoon ikuisena 
siiSntdnS teille suvustn sukuun, ett3 
teidSn pit33 pyhcid riemujuhlaa pi- 
tSmdn seitsemSntenS kuukautcna. 

42. Seitsemfin paivd3 pitSa teidan 
asumaii lehtimajoissa , jokaoniainen 
on Israelissa, h3nen pitSd asuman 
lehtimajoissa, 

43 ettd j3Ikei3isenne tietHisivSt, 
kuinka mm3 oien antanut Israelin 
lasten asua majoissa , kun johdatin 
hetdSt Egvptin maalta Mind olen 
Ucrra, tcidiin Jumalannc. 



44. Ja Mooses puhui nfiistfl Herran 
juhlapfiivista Israelin lapsillfe.. 

^4 Luku. 

MttArHyksm kynttimjalasta ja nftyteleivistit 
Herran nimen pilkkaajan rangaigtus. 

J a Herra puhui Moosekselle, sanoen : 
2. Kiiskc Israelin lasten tuoda si- 
nulle selkiii(3, oljypuun hedelmistd 
puserrettua oljyli kynttilujalkaa var- 
ten , ettS lamput voidaan joka pdi- 
v3 sytyttdn paiamaan, 2 Moos. 27:20 ss. 

3. Ulko-puolella todistuksen esirip- 
, pua seurakunnaiiTnajassa pitS3 Aa* 

.ronin sita alati hoitaman ehtoosta 
niin damuun asti, Herran kasvojen 
edessft. Se olkoon ijankalkkinen 
sUftntd teille suvusta sukuun. 

4. Jah3nenpita3 aina valmistaman 
lamput puhtaaseen kynttilltjalkaan 
Herran edessd. 

5. Ja sinun pitSd ottaman hienoja 
jauhoja ja leipoman niistfi kaksitoista 
kakkua; kaksi kymmenes*osaa efaa 
pitSd oleman joKa kakussa. 

2 Moos. 25:30. Matt. 12:4. 

0. Ja sinun pitfiS paneman no kah- 

teen Jdjiian, kuusi kumpaUnkin 

iaj33nv puhtaalle pdyddlle Herran 

eteen. 

7. «Ja sinun pit33 paneman niideir 
pualle puhda^ta pyhdfi savua ole- 
maan niuisto-uhrina leivftn sijasta ; 
se on tuliuhri Herralle. 

8. Joka sabbatin pSivand ovat ne 
valmistettavat Herran eteen; se on 
Israelin lasten lalija ijankaikkiseksi 
liltoksi. 

9. Ja ne olkoot Aaronin ja hdnen 
poikainsa omat; heidSn piiSkSt ne 
sydmdn pyh3ss3 sijassa; sill3 se on 
kaikkeiii pyhin ja hdnen ikuiscna 
oikeutena Herran tuliuhreista. 

2 Moos. 29:82. 3 Moos. 8:31. ISam. 2l:a 

10. Ja yksi mles, Israelilaisen vai- 
mon, mutta Egyntildisen miehen 
)oika . 13ksi ulos Israelin lasten se- 
laan ja riiteli leirlssft toisen Israeli- 
aisen miehen kanssa. 

11. Ja fsraeliiaisen vaimon poika 
pilkkasi Herran nimed ja kirosi. 
Niin toivat he h3nen Mooseksen 
eteen Ja fa3nen SitinsS nimi oil Se- 
lomit, Dibrin tytSr, Danin sukukun- 
nasta. 

12 Ja he panivat hSnet vankeuteen 
niin kauaksi, ettS heille olisi sel- 
kiSk paat6s annettu Herran suusta. 

4Moos. 15;34. 

13 Ja Herra puhui Moosekselle, sa- 
noen: 

14 Vie han'leirista ulos, joka kl- 
rojllut on, ja anna kuikkein, jotka 



128 



S MOOS. 24. 25. 



sen kuulivat, laskea kfitensft hftqen 
pSinsfl pftSlle, ja koko seurakunta 
kivittSkMn hflnet. 5Moo8.l7:7. 

15. Ja puhu Israelii! lapsille , sa- 
Doen: kuka ikfinft Jumalatansa ki- 
roilee, b§nen pitftfi kantaman syn- 
tinsS. 

16. Ja joka Herran nimefi pilkkaa, 
ten pitftfi totisesti kuoleman : koko 
lansan pitfifl hdnet kuoliaaksi ki- 
vittflroftn. Oil se muukalainen tahi 
oma kansalalnen, ken pilkkaa Her- 
no nimei, hfinen pitfia kuoleman. 

2 Moos. 20:7. 

J7. Jos joku lyd jonkun ihmisen 
kuoliaaksi, hflnen pitftft totisesti 
kuoleman. 2 Moos. 21 d2. 4 Moos. 35:15 ss. 
18. Vaan joka jonkun naudan ly6 
kuoliaaksi, hSnen pitfift sen maksa- 
oian, bengen hengestft. 
.19. Jajokasaattaa Ifihimmftisellensa 
jonkun vamman, hfinelle pitflfl niin 
tehtSmSn, kuin hfinkin tehnyt on, 
2Moo8.2ini4. 5M008. 1921. 

20. haava haavasta, silmS silmftstfi, 
bamtnas hampaasta; niinkuin liftn 
00 jonkun ihmisen vahingoittanut, 
ulin pitas myOs htnelle jalleen teh- 
«niSn. Matt 5:38 ss. 

21. Joka lyO kuoliaaksi naudan, 
ran sen maksakoon ; vaan joka tap- 
PjMi ihmisen, sen pitft§ kuoleman. 

22. Sama laki vallitkoon teiddn 
>cassanne niin muukalafsen kuin 
omaisenkin suhteen; sillfi minft 
olen Herra, teidftn Jumalanne. 

2 Moos. 12:49. 
a. Kan Mooses oli nfiitfl puhunut 
ivaelin lapsille, niin veivftt he sen 
miehen, joka kiroillut oil, ulos lei- 
ruUi ja kivittivfit h§net kuoliaaksi. 
inielin lapse! teklvSt niinkuin Herra 
<Mi Moosekselle kSskenyt. 



25 Luku. 
Lepovuosi ja riemavuosi. 



J 



a Herra puhul Moosekselle Sinain 
VQorella, sanoen : . 

2. Puhu Israelin lapsille, ja sano 
peine: kun te tulette siihenmaahan, 
jonka minft teille annan, niin maa 
pitftkMn Herralle lepoa. 2Moo8.23:io ss. 

S|Knusi vuotta pitSfi sinun peltosi 
kybftm&n, ja kuusi vuotta viini- 
julkesi leikksemman, ja sen hedelmSt 
kokooman, 

4. mutta seitsemfintenfl vuonna pi> 
ttkMn maa Herralle sen suuren lepo- 
P7hftn,jona ei sinun pidfi kylvfimfin 
sraunpeltoasi eikft leikkaaman si- 
nun vflnimilkefisi. 

&• Ja mitfi itsestftnsfl kasvaa laihos- 
^ iitft cd sinun pldfi leikkaaman, 



ja viinimaHoja, jolka leikkaamatto- 
missa viinipuissa oval kasvaneet, 
ei sinun pidfi noukkiman, sillfi se 
on maan lepovuosi. 

6. Mutta mitfi maan levAtessfi kas- 
vaa olkoon teille ruuaksi, sinulle, 
sinun palveliiallesi , la piiallesi, 
niin myOs pfiivfimiehellesi, huone- 
kuntaisellesi ja muukalaiselle sinun 
tykOnfisi. 

7. Ja sinun kaiiallesi ja elfilmiile 
maallasi olkoon kaikkl. mitfi siinfi 
kasvaa, ruuaksi. 

8. J a sinun pitfifi laskeman seitse- 
mfin lepovuotta, niin ettS seitsemfin 
vuotta pitfifi seitsemfin kertaa luet- 
taman : ja seitsemfin lepovuoden ai- 
ka tekee yhdeksfin vuotta vlidettfi- 
kvmmentfi. 

9. Niin sintin pitfifi antaman soit- 
taa pasunalla ylitse koko teidfin 
maakuntanne, seitsemfinnen kuu- 
kauden kymmenentenfi pfiivfinS ; 
juuri sovintopfiivfinfi antakaat pasu- 
nan kfiydfi yfi koko teidfin maakun- 
tanne. 8 Moos. 23:27 ss. 

10. Ja teidfin pitfifi sen viidennen- 
kymmenennen vuoden pyhittfimfin 

ia julistaman vapautta maassa kai- 
cille niille, jotka siinfi asuvat, sillfi 
se on teidfin riemuvuotenne; silloin 
pitfifi kunkin saaman takaisin oman 
perintOmaansa , jokainen sukunsa 
omaisuuden. 

11. Sillfi viideskymmenes vuosi on 
teidfin riemuvuotenne; ei teidfin 
pidfi kylvfimfin, elkfi leikkaaman 
itsestfinsfi kasvanutta, elkfi noukki- 
man, mitfi leikkaamattomissa viini- 
puissa on kasvanut. 

12. Sillfi se on rlemuvuosi, se ol- 
koon teille pyhfi. Mutta pellosta 
syOkfifit mitfi se kasvaa. 

13. Tfimfi on riemuvuosi, jona ku- 
kin teistfi saa palata omaan perintO- 
osaansa. 

14. Jos jotakin myOt Ifihimmfiisei- 
lesi, tailcka ostat jotakin hfineltfi, 
niinfilkOOn loinen toistansa pettfikO. 

ITess. 4:6. 

15. Vaan vuosien luvun jfilkeen 
riemuvuodesta pitfifi sinun ostaman 
Ifihimmfiiseltfisi, ja vuodentulon lu- 
vun jfilkeen pitfifi hfinen sinulle 
myOmfin. 

16. Jota useammul vuodet ovat, si- 
tfi enemmfin korota hinta, ja mitfi 
harvemmat vuodet oval, sitfi enem- 
mfin alenna hinta; sillfi vuoden I ulo- 
jen luvun jfilkeen myOpihfin sinulle. 

17. Alk06n kenkfifin peltfik6 Ifihim- 
mfiistfinsfi, vaan pelkfifi Jumalalasi, 
sillfi minfi olen Herra, teidfin Juma- 
lanne. 



tFImddi] 5 



129 



S MOOS. 25. 



18. Sentfihden noudattakaat minun 
sfifiotdni ja pitfikdfit minun oikeu- 
tenija tehkfifit niitten mukaan ; sil- 
loin saatte turvaliisesti asua maassa. 

19. Ja maa on antava teille hedel- 
mdnsa« ja teilia pitflfi oleman kylia 
sy()tfiv2tfi , ja te asutte pelkfi&m&tta 
sjinS. 

20. Ja jos te ky^yttc: mitd me sy()m- 
me seitsemdnten§ vuonna. jos em- 
me saa kylvfifi, eik& vuoden tuloa 
koota? 

21. Niintietakfidt,eU&minfikSsken 
siunaukseni tulla kuudentena vuo- 
tena teidfin vlitsenne, niin ettil se 
antaa teille kolmen vuoden tulon. 

22. J a te kylvStte kahdeksantena 
vuonna, Ja vanhasta vUoden kas- 
vusta sydtte yhdeksfinteen vuoteen 
asti, nim ettft sy6tte vanhasta uuti- 
seen asti. 

23. Sentfihden el teid&n pidfi maata 
ainaiseksi myOmftn; sillfi maa on 
minun, ja te olette muukalaiset ja 
vieraat minun edess&ni. 

1 Alk. 29:15. Ps. 89:13. 

24. Ja koko teidfin omistamassa 
maassanne olkoon maa takaisin lu- 
nastet ta va 

25. Jos veljesi k6yhtyy, ja myO si- 
Qulle omaisuuttansa , ja h&nen Ifi- 
himmfiinen lankonsa tulee hSnen 
tykOnsS, ja tahtoo lunastaa, niin 
hdn lunastakoon sen, minkfl hSnen 
veljensfi myOnyt on. Ruut. 4:1 ss. 

•26. Ja jos ei olisi IShimmfilsta, joka 
sen lunastaisi, ja hfin itse voi saada 
kokoon, mita sen lunastukseksi tar- 
vitaan 

27. niin pitftS laskettaman vuodet 
slits kuin hfin mOi^ ja annettaman 
lunnaat jfi^ellS olevista vuosista hfi- 
nelle, jolle h&n m()i, ettft hftn saisi 
omaisuutensa jSlleen. 

28. Mutta jos ei hftnellfi ole niin 
paljon varoja, ettft hftn voisi sen 
maksaa, niin jftftkOOn mitft hftn 
my6nyt on ostalan kftteen riemu- 
vuoteen asti. Mutta riemuvuonna 
on se vapaa, ja hftn saakoon omansa 
jftlleen. 

29. Joka myO asuttavan huoneen 
muurilla varustetussa kaupungissa, 
hftnellfi olkoon oikeus lunastaa se 
takaisin vuoden sisftllft; sen ajan 
kuluessa hfin saa sen lunastaa. 

30. Mu4ta jos ei hftn lunasta sitft 
vuoden kuluessa, niin jftftkOOn se 
huone kaupungissa ainaiseksi osta- 
Jalle la hftnen suvullensa; sitft ei 
pidfl luovutettaman riemuvuotena. 

31. Mutta jos huone on maakylfts- 
sfi, missA ei ole muurla ympftrillft, 
niin se pitfift luettaman peltomaak- 



si; se lunastetaan, ja tulee riemu- 
vuotena vapaaksi. 

32. Levilftiset saakoot kuitenkin 
aina lunastaa huoneensa niissft kau- 
pungeissa, joihin helUft on omistus- 
oikens. 

33. Jos joku Levilftisistft lunastaa 
huoneen, olkoon mydty huone siinft 
kaupungissa, johon hftnellfi on o- 
mistusoikeus, vapaa riemuvuonna; 
sillfi huoneet Levilfiisten kaupun- 

f;eissa ovat heidftn omaisuutensa 
sraelin lasten seassa. 

34. Ja maata heidftn kaupunkeinsa 
ympftriltft ei pidft myOtftmftn ; sillfi 
se on heidftn ainainen omaisuutensa. 

4 Moos. 85:2. 

35. Jos sinun veljesi kOyhtyy ja 
joutuu rapploUe sinun tykOnSsi.niin 
sinun tulee hftnestfipitfiahuolta, hfin 
elftkOOn muukalaisena tahi huone- 
kuntalaisena sinun luonasi. 

36. Alft Ota korkoa eikft voittoa hfi- 
neltfi, vaan pelkfifi Jumalatasl, ettfi 
veljesi saisi elftft sinun kanssasl. 

2M00B. 22:2o. 6 Moos. 23:19. San. 28:a 
Ps. 15:5. Hes. 18:8.22:12. 

37. Ei sinun pidft antaman rahaasi 
hfinelle korkoa vastaan, eikft anta- 
man viljaasi kasvolle. 

38. Sillft minft olen Herra, teidfin 
Jumalanne, joka teidftn johdatin 
Egyptin maalta, antaakseni teille 
Kanaanmaan, ja oUakseni teidftn Ju- 
malanne. 

39. Jos sinun veljesi kOyhtyy sinun 
tykOnfts, ja myO itsensft sinulle, niin 
ei sinun pidft hftntfi pitftmftn niin- 
kuin orjaa. 2M008.21:2. 5Moo8.15:12. 

Jer. 34:14. 

40. Mutta hftnen pitftft oleman sinun 
tykOnftsi pftivftmiehenft tahi huone- 
kuntalaisena, palvellen sinua riemu- 
vuoteen asti. 

41. Silloin hftn kftykOOn ulos va- 
paana sinun tykOftsi lapsinensa, ja 
tulkoon sukunsa tykO jftlleen , ja pa- 
latkoon isftinsft perintOosaan. 

42. Sillft he ovat minun palvelijani, 
jotka minft Egyptin maalta johdat« 
tanut olen; sentfihden ei pidft heilfi 
oiian tavalla mydtftmftn. 

43. Alfi ankarasti heltft hallitse; pel- 
kftft sinunJumalatasi. Ef.6;9. Kol. 4:i: 

44. Jos sinft tahdot pitftft mies-tahi 
nais-prjaa, niin osta ne pakanoiitu, 
jotka teidftn ympftrillftnne ovat. 

45. Ja huonekuntalaisiIta,jotkamuu- 
kalaiset ovat teidftn seassanne, voitte 
te niitft ostaa, ja heidftn sukulaisil- 
tansa, jotka he teidftn tykOnfinne 
maassanne synnyttftneet ovat; ne 
olkoot teidftn omanne. 

46. Ja pitftkftftt heidfit omananne, 



130 



8 MOOS. 25. 26. 



it antakaat lapsiUenne teidAn jfil- 
keenne ainaiseksi perimiseksi ; nii- 
den pitfta iSti oleman teidfin orjanne. 
Mutta teidfin veljenne, Israehn lap- 
set, lUkOdt toinen toislansa kovasli 
kohdelko. 

47. Jos muukalainen tahi huone- 
ktintalainensinun tykOnftsi tulee va- 
ralUseksi ja sinun veljesi kOyhtyy 
hiaen tykfinfinsfi, niin ettfi hfin myo 
ibensS muukalaiselle , joka huone- 
kuotalaisena sinun tykOnftsi on, tahi 
joUekuIIe muukalalsen suvusta, 

48. niin. pitSS hflnellfi oikeus ole* 
man tuUa jfilleen lunastetuksi, sitte- 
kuin bin on itsensfi mydnyt, ettfl 
joktt h§nen veljistdnsfi saa li§nen 
loDastaa vapaaksi ; 

49. h§nen setfinsfl tahi setftnsft pot* 
ka lunastakoon hfinet, taikka joku 
hinen liUiimmfiisestS suvustansa, ta- 
hi jos lifin ilse taitaa niin paljon 
koota, niin lunastakoon itsensd. 

50. Ja bSnen pitfifl lukua laskeman 
osUgansa kanssa, siitft vuodesta jona 
kin mOi itsensfi riemuvuoteen asti, 

femyOmSraha laskeltakoon vuosien 
vun iftikeen; ja palkka koko^jalta 
onlaskettava samaksi kuin pftivA* 
miehen. 

51. Ja jos vielfi monta vuotta on 
riemovuoteen, niin hfinen pitfifl sitfi 
coemminantamanlunastuksestansa, 
sen rahamfifirfin suhteen, joUa hfin 
on ostettu. 

52. Mutta jos ainoastaan muutamia 
vtuttiaonjfilellfi riemuvuoteen, niin 
kskekoon lukua hfinen kanssansa, 
ia maksakoon lunastuksensa niitten 
vuosien mukaan, jotka on palvellut. 

53. Hftnen palkkansa on pfiivfimie- 
ken vuosipalkan mukaan laskettava 
vQosi vuodelta; ja filkdOn kukaan 
sinun silmfiisi edessfi kohdelko hfintfi 
koTuudella. 

Si Mutta jos ei hfin nfiin lunasta 
itseftnsfl,niin kfiykOOn riemuvuonna 
nmaana ulos lapsinensa. 
5a. Sillft Israelin lapset ovat minun 

Eveiyani; he ovat minun palveli- 
ijjotka minfi olenEgyptin maalta 
oattanut ulos. Mini olen Herra, 
tcidftQ Jnmalanne. 

26 Luku. 

JuBaUttnideD ja Jumalattomouden palkka. 

ilkiil tehkO itsellenneepfiiumalia, 
^llkftfit pysty ttfikO ku via, eikft myOs 
Malta, Inuuit myOskfifin kivikuvia 
ttett«ko maahanne kumartaaksen- 
of Qiitfi; siUft minft olen Herra, tei- 
din Jnoialanne. 2 Moos. 20:4 as. 

»Mooi.&:88a.,l6Utt. Ps.8ia08a. Fa. 27:7. 



2. Pitfikfifit minun sabbatHni, Ja 
peljfitkfiSt minun pyhfikkOfini. Minfi 
olen Herra. 2Moo8.20:8. SMoos. I9:d0. 

3. Jos te minun sfifintdjeni mulcaan 
vaellatte, ja minun kfi^kyni kfitkette 
ja teette niitfi, 6Moo8.li:i389., 28.-1 sa. 

4. niin minfi annan teille sateen 
^jallansa, ja maa antaa kasvonsa* 
ja kedon puut antavat hedelmfinsfi. 

5. Ja riinen aika ulottuu viinin 
uudseen asti, ja viinin uuUnen ulot- 
tuu toukoaikaan asti, ja teillfi pitfifi 
oleman leipfifi viljalta, ja saatte asua 
levollisesti maassanne. 

6. Ja minfi annan rauhan maallenne, 
ja te saatte levfitS, eikfi kenkfifin 
teitfi peUfitfi. Minfi ajan pahat pe- 
dot maaltanne pois, eikfi mikftfin 
miekka kfiy teidfin maanne Ifipitse. 

7. Te igatte vihollisianne takaa, 
ja he kaatuvat miekkaan teidfin 
edessfinne. 

8. Viisi teistfi karkoittaa sata, ja 
sata teistfi karkoittaa kymmenen tu- 
hatta, Ja teidfin vihollisenne kaatu- 
vat teidfin edessfinne miekkaan. 

J08. 23:10. 2 Aik. 14:9,12. 

9. Ja minfi kfifinnyn teidfin puo- 
leenne. ja teen teidfit hedelmfilli- 
seksi ja lisftfin teitfi, Ja vahvistan 
Hi ttoni teidfin kanssanne. Hea. 37:26 aa. 

10. Ja te saatte sy6dfi tallella ollutta 
vanhaa, ja vanhat viedfifin pois uu- 
den edeltfi*. 

11. Ja minfi asetan asumasijani tei- 
dfin keskellenne, ja minun sieluni 
ei hyljfifi teitfi. 2Mooa.2»:4S. 2Kor.6:l«. 

12. Ja minfi vaellan teidfin keskel- 
Ifinne ja olen teidfin Jumalanne, ja 
te olette minun kansani. 

13. Sillfi minfi olen Herra, .teidfin 
Jumalanne, Joka Johdatin teidfit ulos 
Egyptin maalta, ettei teidfin tarvin- 
nut oUa oijina siellfi. Minfi olen 
murtanut poildci teidfin ikeenne, ja 
olen antanut teidfin kfiydfi pystyssfi 
pfiip. 

14. Mutta jos ette kuule minua, et- 
tekfi tee kaikkia nfiitfi kfiskyjfi, 

6 Moos. 28:15 as. Val. v. 2:17. Mai. 2:288. 

IS.vaan suutu tie minun sfifint6ihini« 

ja teidfin sielunne hylkfifi minun ol- 

keuteni, ettekfi tee kaikkia minun 

kfiskyjfini, ja rikotte minun liittoni, 

16. niin minfi teen teille nfimfi: 
minfi rankaisen teitfi onnettomuu- 
delta, kuivataudilla, ja poltetaudilla, 
josta teidfin kasvonne raukeevat ja 
sielunne nfifintyvfit; ja te kylvfitte 
siemenenne turhaan, Ja teidfin vi- 
hollisenne syOvfit sen. 

17. Ja minfi asetan kasvoni teitfi 
vastaan, ja viholliset lyOvfit teidfit, 
vihamiehenne hallitsevat teitfi. tei- 



131 



8 MOOS. 26. 



dfin pitas .paeta, vaikka ei keokdfin 

teitd aja takaa. 3Moos.l7:io. 

Job. 36:12. Jes. 1:20. San. 28:1. 

18. Jollette vielS sittenkfifin kuule 
minua, niid mind lis53n sen seitse- 
mftn kertaa, rangaistakseni teitS tei- 
ddn synteinne tShden. 

19. Ja minft s&rjen teidSn ylpey- 
tenne uppiniskaisuuden, minS teen 
taivaanne raudan kovaksi, ja teidSn 
maanne vasken kaltaiseksi. 

20. Ja voimanne kuluu hukkaan, 
niin ettel teidSn maanne kasvoansa 
anna, eikA puut kedolla anna hedel- 
mStfinsd. 

21. Ja jos te vielS minua vastaan 
vaellatte^ettekfitahdo kuulla minua, 
niin minfi vielS sitten lisSSn ran- 
gaistuksen teidSn pfiSllenne seitse- 
mftn kertaa, teid&n synteinne t&h- 
den. 

22. Ja minSlShetdnteiddnsekaanne 
metsS^n pedot sy()mSSn teiddn lap- 
siarine ja karjaanne raatelemaan, ja 
yahentdmdfin teitd, niin ettS tienne 
tulevat autioksi. 

23. Jollette vieia nSitten kautta an- 
na kurittaa itsednne, vaan kfiytte 
minua vastaan, 

24. niin minSkin kSyh teitS vas- 
taan, ja lydn teitd vield seitsemlln 
kertaa enemmin teiddn synteinne 
tfihden. 2Sain.22;37. Ps. 18:27. 

25. Mind saatan teiddn pdSllenne 
kostomiekan,joka minun liittoni kos- 
taa; ja te kokoonnutte kaupunkei- 
hin; mutta siellil minS IdhetSn tei- 
dfin sekaanne ruttotaudin ja annan 
teidfit vihamiestenne kdtecn. 

26. Ja minfi hukutan teiltd leivfin 
aineen, niin ettd yhdessd pdtsissS 
kymmenen vaimoa voi teidfin lei- 
panne kypsentdd, ja teidfin leipSnne 
punnitaan teille vaalla; ja syOtydn- 
ne ette tule ravituksi. 

•27. Ja jollette vielS sitten kuule 
minua, vaan vaellatte minua vas- 

taan» 

28. niin minft ihyOs hirmuisuudes- 
sani tulen teitd vastaan, ja mind 
rankaisen leitd seitsemMn kertaa 
enemmin teidSn synteinne tfihden, 

29. ettfi teidSn pitSfi sy()mdn teiddn 
poikainne ja tytdrtenne lihaa, 

5 Moos. 28:53. 2Kud.6.29. Jer. 19:9. 

Vai. V. 4:10. 
'30. ja minfi kukistan uhrikukku- 
lanne ja hSvitdn teiddn kuvanne, ja 
panen teidSn raatonne teidSn epfi- 
jumalienne raatojen pSdlle, ja mi- 
nun sieluni kauhistuu teitS, 

2Aik. 34:7. Hes. 6:488. 
SI. Ja teen teidSn kaupunkinne au- 
tioksi, Ja teid&n pyhdkkdnne h&vi- 



tdn, enka enfift pidft uhrisavuanne 
otollisena. Jes. 1:18. 

32. Ja min§ tahdon hSvittSfi maan, 
niin ettS vihollisenne, jotka siinft 
asuvat, siitS hdmm9styvfit. 

2 Aik. 36:1988. Jer. 19:8. 25:9. 

33. Ja mind hajoitan teidSt paka- 
noitten sekaan, ja veddn ulos mie- 
kan teiddn jdlkeenne, ia maanne on 
tuleva kylmille, ja kaupunkinne 
raunioiksi. 

5 Moos. 28:64 ss. Jer. 9:16. 16:7. 

34. Silloin kelpaa maalle sabbat- 
tinsa, niinkauan kuin se autiona on 
ja te olette vihollisten maalla. Niin, 
silloin vasta maa lep3S ja pyhSft 
pitdd. 2Alk.36:21. 

35. Niinkauan kuin se autiona on, 
saa se levfttS, koska ei se saanut 
pyhfiS pitftS teidSn sabbattivuosi- 
nanne, kun te asuitte siellS. 

36. Ja niillej jotka jS^vIlt teistS, 
teen mind vapisevan sydSmmen he!- 
dSn vihollistensa maalla, niin ettft 
kapisevan lehden dfini karkoittaa 
heiddt, ja he pakenevat, niinkuin 
pakenisivat miekkaa, ja kaatuvat 
siinS, missS ei kenkfi&n heitd aja 
takaa. Jes. 30:17. 

37. Ja he lankeevat toinen tdisensa 
pasile, niinkuin miekan edestii, vaik- 
ka ei yksikfidn karkoitaheitS.Teette 
tohdi seisoa vihamiehifinne vastaan. 

38. Ja te hukutte pakahain seassa, 
ja vihollisten maa teidfit nielee. 

39. Ne, jotka jSfivfit tetstfi, nfifinty- 
vfit omaan pahuuteensa vihoUistenne 
maalla. Isfiinsfi pahoihin tekoihSn 
he nfifintvvfit. 

40. Silloin he tunnustavat pahat te- 
konsa ja isfiinsfi pahat teot, Joilla 
he ovat minun mieleni rikkoneet ja 
vaeltaneet minua vastaan. 

Ps. 106:6. Dan. 9:4 88. 

41. Sentfihden minfi myOs vaellan 
heitfi vastaan, ja vien heidfit vihol- 
listensa maalle, ettfi edes silloin hei- 
dfin ympfirireikkaamaton sydfim- 
mensa nOyryttfiisi itsensfi; silloin 
m:y'()s heidfin pahan tekonsa ran- 
gaistus heille kelpaa. 

42. Ja silloin minfi muistan liittoni 
Jaakobin kanssa, niin myOs minun 
liittoni Isaakin kanssa, ja my6s mi- 
nun liittoni Abrahamin kanssa muis- 
tan minfi, ja muistan myOs maan. 

43. Ja maan ovat he jfittfineet, ja 
sille kelpaa lepopfiivfinsS, niinkau- 
van kuin se autiona on, ja heidfin 
pahan tekonsa rangaistus heille kel- 

)aa; sentfihden, juuri sentfihden. ettft 
le hyljfisivfit minun oikeuteni, ja 
heidfin sielunsa ylenkatsoi kninuQ 
sfifintOjfini. 



132 



3 MOOS. 26. 27. 



4L Ja vielft vaikka ovatkin vihol- 
tistensa maalla, en minft kuitenkaan 
hdtft hyljfifi, enkfi heitfi ylOnanna, 
niin etta perftti hukuttaisia heidnt 
ja tekisin liittoni heidfin kanssansa 
brhjftksi, sills minfi olen Herra, hei- 
d&n Jumalansa. 6 Moos. 4:30 n. 

Jes. 61:20 S8. ' Room. 11 :26 ss. 

45. Ja minfi muistan liittoni heidfin 
esiisfiinsfi kanssa, jotka minfi joh- 

Idatin Egyptin maalta pakanoitten 
/silmAin edessfi, ollakseni heidfin Ju- 
malansa. Minfi olen Herra. 

46. Nftmfiovat nesfifinnOt, oikfeudet 
ja Uskyt, jotka Herra mfifirfisi it- 
sensfija Israelin lasten vfilille, Si- 
nain vuorella Mooseksen kfiden 
kautta., 

27 Luku. 

LaU InpankBista ]a kymmenyksisti. 

J a Herra puhul Moosekselle, sa- 
noen: 

2. Puhu Israelin lapsillej Ja sano 
hdlle: 

jos joku tekee Jonkun erinomaisen 
lapauksen, niin olkoot sielut, sinun 
arviosi Jfilkeen, Herran omat. 

3. Ja olkoon sinun arviosi tfimfi : 
kahdenkymmenen vuotisen miehen- 
paolen kuuteenkymmeneen vuoteen 
fsti, pitfifi sinun arvaaman viiteen- 
lonnmeneen hopiasikliin, pyhfin sik- 
lin jfilkeen. 

4. llutta naispuolen pitfifi sinun 
tfvaaman kolmeenkymmeneen sik- 

5. Mtttta viiden vuotisesta kahden- 
kymmenen vuotiseen asti, ios se on 
Hridienpuoli, niin arvaa se kahteen- 
kymmeneen sikliin, vaan naispuoli 
muneneen sikliin. 

6. Jos se on kuukautinen tahi van- 
nempi, alna viidenteen vuoteen as- 
ti* ja on miehenpuoli, arvaa se vii- 
teen hopiasikliin , mutta naispuoli 
kolmeen hopiasikliin. 

7. Muttajos'seonkuudenkymmenen 
▼notinen tahi sen pfifille, ja on mie- 
aeopuoli, arvaa se yiiteentoista sik- 
liiii, mutta naispuoli kymmeneen 
tikliin. 

4. Jos hfin on yUSn kOyhfi senkal- 
Wseen arvioon, niin menkOOn papin 
cteen; ja papin pitfifi arvaaman hfi- 
M. SenmuKaan, kuin se, loka lu- 
ptuksen tehnyt on, voi saada kokoon, 
Irttlft papin nfinen arvaaman. 
t. Jos se on kaijasta.' iota Herralle 
tkbmtaan, niin on kaikki, nnitfi Her- 
ndle siinfi annetaan, pyhfi. 
10. Ei sitfi saa vaihfaa eikfl muiit- 
tat, d hyvfifi huonoon, eikft huonoa 
"nUnf Jos Joku kumnrinkin valh- 



taa yhden elfiimen toiseen, niin mo- 
lemmat olkoot pyhfi I. 

11. Jos elfiin on saaslainen, jota ei 
saa uhrata Herralle, niin pitfifi se 
vietfimfin papia eteen, 

12. ja papin pitfifi arv'aaman sen, 
kuinka hyvfi tahi kuinka huono se 
on; niinkuin sinfi, pappi, sen ar- 
vaat, siinfi on se pysyvfi 

13. Jos joku tahtoo lunastaa elfii- 
men, hfinen pitfifi antaman viiden^ 
nen osan sinun arviosi pfifille 

14. Ja jos joku pyhiUfifl huoneensa 
Herralle pyhfiksi, niin pitfifi papin 
arvaaman sen, kuinka hyvfi tahi 
kuinka huono se on; ja papin ar- 
viossa pitfifi sen pysymfin. 

15. Mutta jos se, joka on huoneensa 
pyhittfinyt, tahtoo sen lunastaa, niin 
pitfifi hfinen antaman viidennen osan 
enemmfin rahaa, kuin sinun arviosi 
on; ja niin olkoon se hfinen omansa. 

16. Jos joku pyhittfifi H^rratle kap 
paleenpeltoa perintdmaastansa,niin 
pitfifi sinun se arvaaman sen jfil-' 
Iceen, kuin siihen kylvetfifin ; jokai- 
sesta homerin kylvdstfi on makset- 
tava viisikymmentfi hopiasiklifi. 

17. Jos hfin pyhittfifi peltonsa rie- 
muvuodesta alkain, nfin olkoon sen 
hinta sinun arviosi jfilkeen. 

18. Mutta jos hfin on pyhittfinyt pel- 
tonsa riemuvuoden jfilkeen, niin las- 
kekoon pappi hfinelle raha-arvon 
sen mukaan, kuinka monta vuotta 
on seuraavaan riemuvuoteen, ja se 
on sinun arviostasi vfihennettfivfi. 

19. Jos se, joka pellon pyhittfinyt 
on, tahtoo sen lunastaa jfilleen, niin 
pitfifi hfinen antaman viidettfi osaa 
enemmfin rahaa, kuin se minkfi si- 
nfi olet arvoksi pannut; ja niin on 
se hfinen oleva. 

20. Jos ef hfin tahdo lunastaa pel- 
toa, mutta myO sen toiselle« niin ei 
sitfi enfifl saa lunastaa, 

21. vaan pelto, kun se riemuvuonna 
tulee vapaaksi, olkoon pyhfi Herralle, 
niinkuin valallisella lupauksella 
eroitettu pelto; olkoon se papin pe- 
rintO-osa. 

22. Jos joku pyhittfifi Herralle pel- 
lon; jonka hfin on osianut, ja joka 
ei ole hfinen perintdmaansa, 

23. niin pitfifi papin laskeman hfi- 
nen edessfinsfi sen hinnan, sinun 
arviosi jfilkeen, riemuvuoteen asti, 
ja hfinen pitfifi sen samana pfiivfinfi 
antaman ulos, sinun arviosi Jfilkeen, 
ettft se Herralle pyhfi olisi. 

24. Mutta riemuvuonna pelto tulee 
hfinen omaksensa jfilleen, jolta hfin 
sen ostanut on, ja jonka perintfi- 
maata se on. 8Moo8.25:io. 



133 



3 MOOS. 27. 4 MOOS. 1. 



25. Kaikki sinun arviosi pitfid ta- 
patxtuman pyhSn siklin jSlkeen; 
mutta sikli tekee kaksikymmentfi 
geraa. 2 Moos. 30:13. 4 Moos. 3:47. 18:16. 

Hes. 45:12. 

26. Mutta elSinten csikoista, joka 
esikko-oikeuden jaikeen Herran 
oma muutoinkin on, ei pidfi kenen- 
kfign pyhittSmAn, olkoon se harka 
tahi lammas; sillfl se on jo Her- 
ran. 2 Moos. 13:2. 4 Moos. 3:13. 8:17. 

Luuk.2:23. 

27. Mutta jos se on saastaisia eldi- 
mid, niin se pitsa lunastettaman si- 
nun arviosi j&lkeen, ja siihen lis3ksi 
annettaman vi^des osa: jos ei sitS 
lunasteta, niin se myOtSkdOn sinun 
arviosi jfilkeen. 

28. Ei kuitenkaan mitSSn valal- 
lisella lupauksella eroitettua, jota 
ioku valallisesti lupaa Herralle 
kaikesta mitS hSnellS on« oli se 
sitten ihminen, elMn tahi perin- 
Idpelto, saa my6dd eikd lunastaa; 
silia kaikki valallisella lupauksella 



eroitettu on kaikkein pyhin Herral- 
le. 5 Moos. 7:2. Jos. 6:18 ss. 

29. Ei yht3dn kiroukseen annettua 
ihrnistS saa lunastaa, vaan hSn pi- 
tfiS totisesti kuoletettaman. 

18am. 15:3,911^. 

30. Kaikki maan kymmenykset, se- 
kS maan siemenestll ettfi puiden 
hedelmistS, ovat Herran; se on Her- 
ralle pyhitettyd. 6 Moos. 14:22 ss. 

31. Jos joku tahtoo lunastaa kym- 
menyksens5« hSnen pitftft anlaman 
viidennen osan lisfiksi. 

32. Ja kaikki kymmenyksetkarjasta» 
ja lampaista, ja kaikista mitkft vit- 
san alia kSyvfit, ne ovat pyhfit kym* 
menykset Herralle. 

33. Ei pida kysyttfimfin, onko se 
hyvd vai huono, eikfl myOs pidft sitft 
vaihettaman. Jos joku vaihtaa sea, 
niin olkoot ne molemmat pyhftt; 
sit^ ei saa lunastaa. 

34. NSma ovat ne kflskyt^ jotka 
Herra antoi Mooseksen kautta Israe- 
lin lapsille Sinain vuorelia. 



neljAs mooseksen kirja. 

NUMERl. 



I Luku. 

Isnelin kausan luku lasketaan. 

J a Herra puhui Moosekselle Sinain 
korvessa, s^urakunnan majassa, 
toisen kuukaudenensimmflisenfipdi- 
vdnlt, toisena vuonna heidSn Ifih- 
dOstdSn Egyptin maalta, ja sanoi : 

2. ,,LaskeKaat koko Israelin lasten 

ioukon luku, heidfin sukujensa, ja 
leidAn huonekuntainsa jSlkeen, jo- 
ka nimi erikseen laskettu, kaiUd 
miespuolet, mies mieheltS, 

2 Moos. 30:12. 4 Moos. 26.-2. 

3. kahdenkymmenenvuotisetjasen 
ylitse, kaikki, jotka kelpaavat Idhte- 
mftSn sotaan Israelissa: lukekaat 
heitd joukkojensa jfilkeen » sinft ja 
Aaron. 

4. Ja teidfin kanssanne olkoon ^ksi 
mies jokaisesta sif kukunnasta, joka 
on isfinsfi huonekunnan pfifimies. 

5. Ja nfimfi ovat niiden pfifimiesten 
nimet, joitten tulee aiittaa teitfi: Ru- 
benista, Elisur Sedeurin poika; 

6. Simeonista,SelumielSurisadaain 
poika ; 

7. Juudasta, Nahesson Amminada- 
bin poika; 

8.Isaskarista,Netaneel Suarin poika; 
9. Sebulonista, Eliab Helonln poika; 



10. Josefin pojista: Efralmista, Eli- 
sama Ammihudin poika; Manasses- 
ta, Gamliel Pedatsurin poika; 

11. Benjaminista, Abidan Gideonin 
poika ; 

12. Danista, Ahieser Ammisaddain 
poika ; 

13. Asserista, Pagiel Okranln poika ; 

14. Gadista,EljasafDeguelin poika ; 

15. Naftalista, Ahira Enanin poika. 

16. Nfimfi olkoot kansan edustt^at, 
heidfin isfiinsfi sukujen esimiehet, 
Israelin sukukuntain pfiftmiehet.'* 

17. Niin Mooses ja Aaron ottivat ne 
miehet tykohsfi, jotka nimeltftnsft 
nimitetvt olivat, 

18. ja kokosivat koko kansan, toi* 
sen kuun ensimmfiisenfi pfiiv&nfi, ja 

iokainen ilmoitti polviluKunsa , su- 
Lukuntainsa ia isfiinsfihuonekuntain 
ifilkeen, kukin nimensfi jfilkeen, 
kahdenkymmenen vuotisesta ja sen 
ylit.«e, mies mieheltfi, 

19. niinkuin Herra oil kfiskenyt 
Moosekselle ; ja hSn laski heidftn lu- 
kunsa Sinain korvessa. 

20. Rubenin, Israelin esikoisen, lap* 
sista olivat heidfinpolviluvuissansa, 
sukujensa ja isfiinsfi huonekuntain 
jfilkeen. kukin nimensfi mukaan, 
mies mieheltfi kaikki miehenpuoli* 



134 



4 MOOS. 1 



kahdenkymmenen vuotisista Ja sen 
ylitse, kaikki kelvolliset sotaan me- 
nemilftn, 

21. luetut Rubenin sukukuntaan 
kuosi viidettftkymmentft tuhatta ja 
viisi sataa. 

22. Simeonin lapsista heidfin pol* 
vilukuinsa, sukufnsa ja isflinsS huo- 
nekuntain jSTkeen lasketut, kukin 
nimensft mukaan, mies mieheltfi, 
kaikki miehenpuoli kahdenkymme- 
nen vuotiset ja sen ylitse, kaikki so- 
taan menem&dn kelvolliset, 

23. luetut Simeonin sukukuntaan, 
yhdeksdn kuudettakymmentfi tuhat- 
ta ja kolme sataa. 

24. Gadin lapsistar, lasketut heidfin 

Eolvilukuinsa , sukuinsa ja isfiinsS 
uonekuntain jdlkeen, kukin nimen- 
^ mukaan kandenkymmenen vuo- 
tisista ja sen ylitse, kaikki sotaan 
menemSSn kelvolliset, 

25. luetut Gadin sukukuntaan, viisi 
viidettakvmmentfi tuhatta, kuusi sa- 
taa ja vilsikymmentS. 

26. Juudan lapsista, polvilukuinsa, 
sQkuinsa ja isflinsfi nuonekuntaln 
jfllkeeo, kukin nimensfi mukaan, 
kahdenkymmenen vuotiset ja sen 
ylitse, kaikki sotaan menemadn kel- 
volliset, 

.27. luetut Juudan sukukuntaan, nel- 
|9 kahdeksattakymmentfi tuhatta ja 
kuusi sataa. 

28^ Isaskarin lapsista, polvilukujen- 
sa, suki^ensa la isSinsft hiionekun- 
tainjilkeen,kuKin nimensS mukaan, 
kahdeDkymmenen vuotiset ja sen 
yUtse, kadkld sotaan menem32ln kel- 
volliset, 

29. luetut Isaskarin sukukuntaan, 
D^ kuudettakymmentft tuhatta ja 
DeQA sataa. 

30.Sebulonin lapsista.polvilukujen- 
la. sukuinsa ja isainsfi nuonekuntaln 
iukeen, kukin nimens§ l&lkeen kah- 
denkymmenen vuotiset Ja sen ylitse, 
kaikki sotaan menemdSn kelvolliset, 
31. luetut Sebulonin sukukuntaan, 
seitsemfin kuudettakymmentfi tuhat- 
ta ja neys sataa. 

S. Josefin lapsista : Efraimin lap 
>ista polvilukujensa , sukuinsa ja 
Isflinsahuonekuntain jSlkeen, kukin 
nimensfi mukaan, kahdenkymme- 
nen vuotiset ja sen ylitse, kaikki 
sotaan menemfifin kelvolliset, 
31 luetut Efraimin sukukuntaan, 
ne^fikyjnmentfi tuhatta ja viisi sa- 
taa. 

31 Manassen lapsista, polvilukujen- 
tt» sukuinsa la isfiinsfi huonekun- 
Maiftlkeen,kukin nimensfi mukaan, 
woenkymmenen vuotiset ja sen 



ylitse. kaikki, jotka sotaan mene- 
mfifin kelpasivat, 

35. luetut Manassen sukukuntaan, 
kaksi neljfittfikymmentfi tuhatta ja 
kaksi sataa. 

36. Benjaminin lapsista, polviluku- 
jensa, sukuinsa ja isfiinsfi huone- 
kuntain ifilkeen, kukin nimensfi mu- 
kaan, kandenkymmenen vuotiset ja 
sen ylitse, kaikki, jotka sotaan me- 
nemfifin kelpasivat, 

37. luetut Benjaminin sukukuntaan, 
viisi neljfittfikymmentfi tuhatta ja 
neljfi sataa. 

38. Danin lapsista, polvilukujensa, 
sukuinsa ja isfiinsfi huonekuntain 
ifilkeen. kukin nimensfi mukaan, 
kahdenkymmenen vuotiset ja sen 
ylitse, kaikki, joka sotaan menemfifin 
kelpasivat, 

39. luetut Danin sukukuntaan, kak- 
si seitsemfittfikymmentfi tuhatta ja 
seitsemfin sataa. 

40. Asserin lapsista polvilukujensa, 
sukuinsa ja isfiinsfi huonekuntain 

ifilkeen, kukin nimensfi mukaan, 
kahdenkymmenen vuotiset ja sen 
ylitse, kaikki, jotka sotaan kelpasi- 
vat, 

41. luetut Asserin sukukuntaan, yk- 
si viidettfikymmentfi tuhatta ja vii- 
si sataa 

42. Naflalin lapsista, polvilukujen- 
sa, sukuinsa ja isfiinsfi huonekun- 
tain jfilkeen,kukin nimensfi mukaan, 
kahdenkymmenen vuotiset ja sen 
ylitse,kaikki, jotka sotaan kelpasivat, 

43. luetut Naflalin sukukuntaan, 
kolme kuudettakymmentfi tuhatta 
ja neljfi sataa. 

44. Nfimfi ovat ne luetut, jotka Moo- 
ses ja Aaron ja ne kaksitoistakym- 
mentfi Israelin pfifimiestfi lukivat, 
joista aina yksi edusti jokaista hei- 
dfin isfiinsfi huonekuntaa. 

45. Ja kaikki Israelin lapset yhteen 
lasketut, heidfin isfiinsfi nuonekun- 
taln jfilkeen , kahdenkymmenen 
vuotiset ja sen ylitse, kaikki, jotka 
olivat sotaan kelvolliset Israelissa, 

46. kaikkien yhteinen luku oli kuu- 
si kertaa satatuhatta ja kolmetuhat- 
ta ja viisisataa ja viisikymmentft. 

2 Moos. 12:37. 38:26. 4Moo8. 2:32. 

47. Mutta Levilfiiset, heidfin isfiin- 
sfi sukukunnan jfilkeen, eivSt olleet 
heidfin sekaansa luetut. 

48. Ja Herra puhui Moosekselle, sa- 
noen: 

49. Levin sukukuntna el sinun pidfl 
lukeman , eikfi yhdistfimfin niitten 
lukumfifirfifi muihin Israelin lapsiin, 

50. vaan aseta Levilfiiset todistuk- 
sen m^jan palvelukseen, huolta pi- 



135 



4 MOOS. 1. 2. 



1 



tfinififin kaikesta mitft siihen kuu- 
luu. HeidSn pitfift kantaman majan 
ja kaikki sen asliat, Ja heidfln pitsa 
ottaman vaarin siitfi, ja sijoittaman 
itsensS majan ympfiri. 

51. Ja kun todisluksen majaa siir- 
retSdn, tulee LevilSisten se purkaa, 

a kun maja jdUeen sijoitetaan, tu- 
ee heidfln se asettaa pystyyn. Jos 

joku muukalainen Iflhestyy sit§, sen 

pitSfi kuoleman. 

52. IsraeHn lapset sljoittakoot itsen- 
sfl kukin leirinsft ja joukkonsa li- 
pun tykO, 

53. mutta Levilftiset syoittakoot it- 
sensil todisluksen majan ympflrille, 
ettei viha tulisi Israefin Lasten jou- 
kon pdAUe. Sentflhden pilSkOOt Le- 
vilfiiset vaarin todistuksen majan 
vartiosta. 

54. Ja Israelin lapset tekivfit sen; 
kaikki mita Herra Moosekselle kAs- 
kenyt oil, sen he tekivftt. 

2 Luku. 

HIi&r&tSto Israelin lasten J&rjestiys leixiS8& 
ja matkalla ollessa. 

J a Herra puhni Moosekselle Ja Aa- 
ronille, sanoen: 
2< Israelin lapset s^joittakoot itsen- 
sS iokainen lippunsa ja-isftinsft huo- 
nekuntain merkkien kohdalle; ym- 
pSri seurakunnan migaa. tulee nel- 
dfin sijoittaa itsensfi. 

3. EtupuolelleitaanpdinpitfiftJuu- 
dan lippunsa ja joukkonsa kanssa 
itsensft siJoittaman: heidftn pflSmie- 
hensfl , Nahesson Amminadabin 
poika, 

4. jahAnen joukkonsa lasketut«nel- 
jfl kahdeksattakymmentft tuhattaja 
kuusi sataa. 

5. H&nen viereensft sljoittakoon it- 
sensfi Isaskarin sukukunta: ' hei- 
dSn pfiamiehensfl, Netaneel Suarin 
poika, 

6. ja hfinen joukkonsa laskefuf,nel- 
jft kuudettakymmentft tuhattaja nel- 
jft sataa. 

7. Sen jAlkeen Sebulonin sukukun- 
ta: heiddn pdfimiehensfi, Eliab He- 
lonin poika, 

8. ja hfinen joukkonsa lasketut, 
seitsemSn kuudettakymmentfl tuhat- 
ta ja neljfi sataar 

9. Kaikki lasketut, Jotka kuuluvat 
Juudan leiriin, ovat siis yhteensft 
sata kuusi yhdeksfittfikymmentfi tu- 
hatta ja negfi sataa, jaetut eri jouk- 
koihin. Heidftn pitfifl ensihnfi vael- 
taman. 

10. Etelfin pnolelle s^oittakoon Ru- 
ben itsensft lippunsa ja joukkonsa 



kanssa: heidfin pfifimlehensft-. EU- 
sur Sedeurin poika, 

11. ja hfinen joukkonsa lasketut, 
kuusi viidettfikymmentft tuhatta ja 
viisi sataa. 

12. Hfinen viereensfi pitfift Simeo- 
nin sukukunnan itsefinsfi sijoitta- 
man : heidfin pfifimiehensfi, Selumiel 
Surisaddain poika, 

13. ja hfinen joukkonsa lasketut, 
yhdeksfin kuudettakymmentft tuhat- 
ta ja kolme sataa. 

14. Sen jfilkeen Gadin sukukunta : 
heidfin pfifimiehensfi, Eljasaf Regue- 
lin poilca, 

15. ja heidfin joukkonsa lasketut, 
viisi viidettfikymmentfi tuhatta, kuu- 
si sataa ja viisikymmentfi. 

16. Kaikki lasketut, jotica Rubenin 
leiriin kuuluvat, ovat yhteensft sata 
yksi kuudettakymmentfi tuhatta, nel- 
ift sataa ja viisikymmentft, jaetut eri 
joukkoihin. Ja heidftn pitfift toisena 
vaeltaman. 

17. Sitten on seurakunnan mi^a 
Ifthtevft matlialle, Levilftisten leiri 
keskellft muita leirejft. Ja niinkuin 
he itsensft sijoittavat,nilnpitftftniyOs 
heidfin vaeltaman, jokainen omalla 
paikallansa lippunsa alia. 

18. Lfinsipuoiella sijoittakoon Ef- 
raim itsensfi lippunsa ja joukkonsa 
kanssa: heidfin pfiftmiehensfi, £11- 
sama Ammihudin poika, 

19. ja hfinen joukkonsa lasketut, 
neljfikymmentft tuhatta ja viisisa- 
taa. 

20. Lfthinnft hfintft pitfift Manassen 
sukukunnan itsensft sijoittaman: hei- 
dftn pfifimiehensfi, Gamliel Pedasu- 
rin poika, 

21. ja hfinen joukkonsa lasketut, 
kaksi neljfittfikymmentfi tuhatta ja 
kaksi sataa. 

22. Senjfilkeen Benjaminin suku- 
kunta: heidfin pfifimiehensfi Abidan' 
Gideonin poika. 

23. ja hfinen joukkonsa lasketut, 
yiisi neljfittfikymmentfi tuhatta ja 
neljfi sataa. 

24. Kaikki, jotka Eifraimin leiriin 
kuuluvat, ovat siis yhteensfi satakah- 
deksan tuhatta ja sata, jaetut eti 
joukkoihin. Ja heidfin pitfift kol- 
mantena vaeltaman. 

25. Polxjoispuolelle asettukoon Da-' 
nin lippu joukkojensa mukaan* Da- 
nin lasten pfifimies, Ahieser Amml- 
saddain poikli, 

26. ja hfinen joukkonsa lasketut, 
kaksi seitsemfittfikynunentft tuhatta 
ja seitsemfin sataa. 

27. Hfinen viereensfi pitfift Asserin 
sukukunnan itsensft sijoittaman: As* 



136 



4 MOOS. 2. 3. 



serin lasten pdftmies, PagielOkranin 
potka, 

28. ja hfinen joukkonsa lasketut, 
yksi viidctlSkymmentfi tuhatta ja 
viisi sataa 

29. Sit&likin Naflalin sukukunta: 
Naftalin lasten pddmies, Ahira Ena- 
nin poika, 

90. ]a hfinen Joukkonsa lasketut, 
kolme kuudettakymmentS tuhatta 
ja neljS sataa. 

31. Kaikki lasketut, jotka kuuluvat 
Danin leiriin, ovat yhteensfi sata seit- 
semSn kuudettakymmentfi tuhatta 
ja kuusi sataa. Ja heidfin pitdS vii* 
meisenft vaeltaman lippunsa alia. 

32. Tama on Israelin lasten luku 
heidSn isSinsfi huonekuntain mu- 
kaan. Ja kaikki leireissSnsS laske- 
tut oHvat sotajoukkojensa mukaan 
yhteensfi kuusisataa kolme tuhatta, 
viisisataa ja viisi kymm en tfi miestS. 

2M008. 12-.37. 3826. 4 Moos. 1:46. 

33. Mutta LevilfiisiS ei laskettu vh- 
teen Israelin lasten lukuun , niin- 
koinHerraMoosekselle dlikfiskenyt. 

34. Ja Israelin lapset tekivSt niin; 
aivan sen jSlkeen, kuin Herra oli 
Moosekselle kSskenyt, sijoittivat he 
itsensS lippuinsa alle ja matkusti- 
vat itsekukin sukukunnassansa, i- 
sSinsft huonekunnan mukaan. 

3 Luku. 

Lerilftisten Ja esikoisten luku lasketaau. 

MflmS ovat Aaronin Ja Mooseksen 
^^ sukukunnat siihen aikaan kun 
Herra puhui Moosekselle Sinalnvuo- 
rella. 

2. Ja nfimfi ovat Aaronin poikain 
nimet: Nadab, esikbineii,.sittenAbi- 
hu, Eleasar ja Itamar. 2 Moos. 6:23. 

lAik.6:3. 

3. N&mS ovat Aaronin poikain ni- 
Jjct. iotka olivat papiksi voidellut 
javinityt papinvirkaa toimittamaan. 

, ^ 3 Moos. 8:2 ss. 

4. Mutta Nadab ja Abihu kuolivat 
Heniin kasvojen edessd, kun he uh- 
rasivat vierasta tulta Herran edessft 
Sinain korvessa; ja ei heillS oilut 
Ppikia. Mutta Eleasar ja Itamar te- 
nvftt papin virkaa isdnsS Aaronin 
edessS. 3Moos.lO:2. 16:1. 4 Moos. 26:61. 

lAik.24:2. 

5. Ja Herra puhui Moosekselle, sa- 
noen: 

6. Tuo edes Levin sukukunta ja 
•jeta heidflt papin Aaronin eteen, 
rjuvelemaan hSntfi. 

7. Ja he pitftkOOt vaarin hfinen var- 
nostansa ja koko seurakunnan var- 
uotta, seurakunnan majan edessfi, 



toimittaessaan virkansa majan pair 
vel u ksessa 

8. Ja he pitfikOOt huolta kaikista 
seurakunnan majan tavaroista, ja 
ottakoot vaarin siitfi mitfi Israe* 
lin lasten tulee vaarinottaa, toimit- 
taessaan virkansa majan palveluk* 
sessa. 

9. Ja niin sinun pilfifi antaman Aa- 
ronille ia hfinen pojillensa Levin 
lapset: he ovat heille lahjaksi an- 
netut israelin lapsista. 4Moo8.8:i3ss. 

18:6. 

10. Mutta Aaronin poikinensa pitfi& 
sinun asettaman pitfimfifin huolta 

f>apinvirastansa. Jos joku muuka- 
ainen siihen Ifihestyy, .sen pitfifl 
kuoleman. 4Moos.i:5i* 

11. Ja Herra puhui Moosekselie, sa- 
noen: 

12. Katso, minfi olen ottanut Le- 
vilfiiset Israelin lapsista kaikkein esi- 
koisten edesta, jotka ensisti fiitinsft 
kohdun avaavat Israelin lasten seas- 
sa, niin ettfi Levilfiiset ovat minun. 

4 Moos. 8:16 ss. 

13. Sillfi kaikki esikoiset ovat mi- 
nun ; sinfi pfiivfinfi, kuinnninft IMa 
kaikki esikoiset Egvptin maalla, py- 
hitin minfi itselieni kaikki esikoi- 
set Israelissa, ihmisistfi niin karjaan 
asti, ettfi ne olisivat minun. Minft 
olen Herra. 2 Moos. 12:29. 13:2. 84:19. 

3 Moos. 27:26. 5 Moos. 16:19. Luuk. 2:23. 

14. J a Herra puhui Moosekselle Si- 
nain korvessa, sanoen: 

15. Laske Levin lasten luku heldfin 
huonekuntainsa ja sukukuntain^ 
mukaan; kaikki miehenpuolet, kuu- 
kauden ikfiiset ja vanhemmat, pitfiA 
sinun lukeman. 

' . 16. Ja Mooses laski heidfin lukunsa 
Herran sanan jfilkeen, niinkuin hfi- 
nelle oli kfisketty. 

17. Ja nfimfi olivat Levin pojat ni? 
miensfi jfilkeen: Gerson, Kahat ja 
Merari. l Moos. 46:11. 2 Moos. 6:16 ss. 

4 Moos. 26:57 ss. 

18. Mutta Gersonin poikain nimet 
heidfin sukukuhnissansa olivat Libni 
ja Simei. 

19. Kahatin pojat heidfin sukukun- 
nissansa olivat: Amram,- Jetsehar,' 
Hebron ja Ussiel. * 2 Moos. 6:18. 

20. Merarin pojat heidfin sukukun- 
nissansa olivat: Maheli- ja Musi. 
Nfimfi ovat Levin sukukunnat hei- 
dfin isfiinsfi huonekuntain jfilkeen. 

21. Nfimfi ovat Gersonin sukukun- 
nat: Libnilfiiset ja Simeilfiiset. 

22. Heidfin lukunsa, kaikki miehen- 
puoli,kuukauden ikfiiset ja sitfi van- 
hemmati pli sellsemfintubaHa ja vii- 
sisataa. 



(Ffooish] 5* 



187 



4 MOOS. 3. 4. 



23. Ja Gersonilaisten sukukunnat 
pitfia sijoittuman takapuolelle ma- 
jaa, Ifinteen p9in. 

24. Ja heidSn pftSmiehensli olkoon 
Eljasaf, Laclin poika. 

25. Ja Gersonin lasten tulee seura- 
kunnan majassa pitdS huolia it^e 
majasta, sen peitteista, ja pSSUys- 
peitteistd, Ja s^urakunnan majan 
oviverhosia, 

26. ja niinikftfinpihankangasaidas- 
ta ja pihan porttiverhosta, joka 3^m- 
piirdi majaa ja alttaria, ja kOvsistcl 
ja kaikista« mitfi majan palvelukseen 
tarvitaan. 

27. Ndmfi ovat Kahatin sukukun- 
nat: Amramilaiset, Jetseharilaiset, 
Hebronilaiset ja Usielilaiset. 

28. Kaikki miehenpuoli. kuukauden 
ikdiset ja sild vanhemmat, oHvat 
luvultansa kahdeksan tuhatia ja kuu- 
sisataa; nfiiden tuli pitfiS huolta py- 
histft esineistd. 

29. Ja he sijoittukoot majan sivulle, 
eteldSn p&in. 

30. J a hcidSn paSmiehensS olkoon 
Elitsafan, Usienn poika. 

31. Ja heiddn tulee pitdd huoita ar- 
kista, p5ydflstd« kynttilSjalasta ja 
kaikista pyhislfl esmeistS, joita ju- 
malanpalveluksessa kSytet33n« sekS 
esiripusta ja kaikista, mitd palveluk- 
seen tarvitaan. 

32. Mutta kaikkein Levildisten pSA- 
miesten ylimmdincn olkoon Eleasar, 
papin Aaronin poika, niitten pSd- 
niies, jolka pitAvSt huolta pyhistS 
esineisld. 

33. NSmd ovat Merarin sukukun- 
nat : Mahelilaiset ja Musilaiset; 

34. joiden luku oil kuusituhatta ja 
knksi sataa, laskettuna kaikki mie- 
henpuolct, kuukauden ikfiiset ja sitft 
vnnncinmat. 

I{5. Merarin sukukuntain pSSmies 
olt Sunel Abihailin poika, ja he 
sljoittivatitsensd majan sivulle.poh- 
jan puolcHc. 

3C, Ja hcidan virkansa oli pitdd 
hublla majan laudoista, salvoista, 
putsaisla ja jaloista, ja kaikista esi- 
neisld, jotka sen palvelukseen tar- 
viinan. 

37. niinmyds patsaista pihan ym- 
pdrillii. ja sen jaloista ynn5 vaar- 
noista ja kdysistH. 

38 Mutta scurakunnan majan etu- 
puolelle it53n plilnsijoittakootitsensd 
Mooses ia Aaron ja hAncn poikansa, 
|a he valvokool pyhttkOn palvelusta, 
ja kaikkia, joista Israelin lasten tu- 
lee huolta pitSfi. Jos joku muuka- 
lainen siihen Ifthestyy, sen pitAft 
kuoleman. 



S9. Kaikkein Levilfiistenlul(uJotika, 
Mooses ja Aaron laskivat heidfin su- 
knkuntiensa mukaan Herran sanan 
laikeen, kaikki miehenpuolet, kuu- 
kauden ikAiset ja sitS vanhemmat, 
oli kaksikolmattakymmentS tuhatta. 

40. Ja Herra puhui Moosekselle: 
lue kaikki esikoiset, jotka miehen- 
puolet ^ovat Israelin lasten seassa, 
kuukauden ikdiset ja sitfi vanhem- 
mat, ja laske heiddn nimiensA luku. 

41. Ja Ota LevilAiset minulle — sillft 
minA olen Herra — kaikkein Israe- 
lin lasten esikoisten cdestS, ja niin- 
myds Levildisten karjat, kaikkein 
Israelin lasten karjan esikoisten 
edesta. 

42. Ja Mooses luki, niinkuin Herra 
hiinelle kSsken^t oli, kaikki Israe- 
lin lasten esikoiset. 

43. Ja kaikki miehiset esikoiset, 
heiddn ninieinsd luvun jdlkeen, las- 
ketut kuukauden ikAiset ja sitS van- 
hemmat, olivat luvultaan kaksi kol- 
mattakymmentd tuhatta, kaksi sataa 
ja kolme kahdeksattakymmentft. 

44. Ja Herra puhui Moosekselle, 
sanoen : 

45. Ota Levildiset kaikkein Israelin 
lasten esikoisten edestd, ja Levildis- 
ten kaija heiddn karjansa edestfi; 
ja Levildiset pitdd oleman minun, 
silld mind olen Herra. 

46. Mutta lunastukseksi niiden kah- 
den sadan ja kolmen kahdeksatta- 
kymmenen edestd, jotka jddvdt Is- 
raelin lasten esikoisista Levildisten 
luvun ylitse, 4Moos.i8:l5ss. 

47. tulee sinunottaa viisi siklid joka 
hengeltd: pyhun siklin jdlkeen pi- 
tddsinunse ottaman, ja sikli maksaa 
kaksikymmentd geraa. 2 Moos. 30:13. 

3Moos.27:25. 4 Moos. 18: IC. Hes. 45:12. 

48. Ja anna raha Aaronille ja hdnen 
pojillcnsa, ylilukuisten lunastuk- 
seksi. 

49. Niin otti Mooses lunastusrahan 
niitten edestd, jotka ylitse olivat I..e- 
vildisten kautta lunastetuista. 

50. Israelin lasten esikoisten edestft 
otti hdn rahat, tuhannen kolme sa- 
taa javiisi seitsemdttdkymmentd sik- 
lid, pyhdn siklin jdlkeen. 

51. Ja Mooses antoi lunastusrahat 
Aaronille ja hdnen pojillensa Her- 
ran sanan jdlkeen , niinkuin Herra 
oli Moosekselle kdskenyt. 

4 Luku. 

Levll&istcn tehtftv&t 

J a Herra puhui Moosekselle ja Aaro- 
nille, sanoen: 
2. Lue Kahatin lapset Levin poi- 



138 



4 MOOS. 4. 



kain seasta, heidfin sukukuntainsa 
ja huonekuntajnsa mukaan, 

3. kolmenkymmenen vuotisesta ja 
sen ylitse, viidenkymmeneo vuoti- 
seen asti, kaikki, jotka tyOhdn ky- 
kenevSt oval, seurakunnan majassa 
palvelusta lekemSfin. 4 Moos. 8:2488. 

4. Ja tdmfl olkoon Kahatin poikain 
virkatehtfivS todistuksen majassa, 
se on kaikkein pyhin. 4 Moo8.3'3i ss. 

5. Kun leiria siirr^tsan, niin pitfift 
Aaronin poikinensa tuleman ja ot- 
taman esiripun alas, ja ki&firimfin 
iodistuksen arkin siihen, 

6. la paneman peitleen sen pSSlIe 
hylkeen-nahoista, ja levittftman ko- 
konansa sinisen vaatteen sen ylitse, 
ja paneman korennot paikoiliensa. 

7. Niin myOs pitsa held An levittfi- 
min n3ytefeipftin p6ydfin ylitse si- 
nisen vaatteen, ja paneman sen 
p3aile vadit, lusikat. maljat ja kan- 
nut, joista kaadetaan, ja ne alino- 
nuUsetleivfitpitfifisenpd&lIfi oleman. 

2 Moos. 25:29,30. 

8. Ja heidfin pitfift hajoittaman nii- 
den pflftUe tulipunaisen vaatteen, ja 
peittflmfin hylkeen-nahkaisella peit* 
teellft, ja paneman korennot pai- 
koilleen. 

9^ Ja heidfin pitfifi ottaman turn- 
man sinisen vaatteen, ja peittftmAn 
sillfi kynttilfijalan , ja sen iamput, 

SnS niistimitten ja sammuttimien 
nssa,ja kaikki 6ijyastiat,joita pal- 
veluksessa kfiy tetaSn. 2 Moos. 26:31 88. 

10. Ja tfimfin ja kaikkein nfiiden 
tavarain ympAri pitSft heidfin pane- 
man peitteenhylkeen-naliasta,ialas- 
keman ne korentojen pfiaUe. 

11. Niin myOs pitAfi heidftn levittft- 
mSn kultaisen alttarin ylitse tum- 
man sinisen vaatteen, ja peittAmfln 
sen liylkeen-nahkaisella peitteellfi, 
Ja paneman korennot paikoiliensa. 

12. Kaikki astiat, jotka kfiytetftfin 
palveluksessa pyhfikOssA, pitSfi hei- 
dSQ ottaman ja levittftmfin hiiden 
ylitse sinisen vaatleen, ja peittftmfin 
sen hylkeen-nahkaisella peitteellfi, 
jatittenlaskeman ne paarein pfi&lle. 

13. Heidfin pitAfl myOs lakaiseman 
pois tulian sQttarilta , ja levittftmfin 
purpuraisen vaatteen sen ylitse, 

14. Ja paneman sen pSdlle kaikki 
•stiat, Jotka kAytetftfin jumalanpal- 
veluksessa, hiilipannut, hangot, la- 
Piotja maljat, kaikki alttarin astiat; 
neidln pitSA inyOs levittfimfin sen 

Jlilse hylkeen-nahkaisen peitteen, 
I paneman korennot paikoiliensa. 

15. Kun Aaron ja hAnen poikansa, 
leiriS siirrettaissA , ovat nfimS toi- 
mittaneet, ja peittAneet kaikki pyfaftt 



esineet, niin menkMt sitte Kahatin 
lapset kantamaan niitS, mutta dl- 
koAt koskeko pyhiin esineisin, sillft 
silloinhekuolevat. Nfimd seurakun- 
nan majan Esineet olkoot Kahatin 
lasten kannettavat. 

16. Ja Eleasarilln, papin Aaronin 
pojalla, olkoon virkana: huolenpito 
Oljystft kynttilSjalkaan, suitsutuk- 
sesta , jokapdivAisestS ruokauhrista 
ia VoiteluOljystA, niin ettA hAn pitAA 
huolta koko todistuksen majasta ja 
mita siinA on, pyhAk6stA ja sen 
esineistA. 2 Moos. 9034. 

17. Ja Herra puhui Moosekselle ja 
Aaronille, sanoen: 

18. AlkAAt antako Kahatilaisten su- 
kukunnan hAvitA LevilAisten seasta. 

19. Vaan tehkaat ndin heidan kans- 
sansa, ettA he elAisivAt eivAtkA kuo- 
lisi, lAhestyessAAn kaikklen pyhim- 
piA esineitA: Aaron poikinensa men- 
kOOt sisAlle ja mAArAtkOOt itsekuUe- 
kin,mitAhAnen tuleetehdAja kantaa; 

20. vaan AlkOOt he itse menkd sinne 
sisAlle, ei edes silmAnrApAykseksi 
katsomaanpyhAkkOA,etteivAtkuolisi. 

1 Sam. 6:19. 

21. Ja Herra puhui Moosekselle, sa- 
noen: 

22. Lue Gersonin lapset, heidAn 
isAinsA huonekuntain ja sukukun- 
tainsa mukaan. 

23. Kolmenkymmenen vuotiset ja 
sitA vanhemmat, viidenkymmenen 
vuotiseeh asti, tulee sinun ottaa las- 
kuun, kaikki ne, jotka toimeen kel- 
volliset ovat tekemAAa tyOtA seura- 
kunnan mt^assa. 

24. Ja tAmA olkoon Gersonilaisten 
sukukunnan tehtAvA, mitA heidAn 
tulee tehdA ja mitA kantaa : 

25. heidAn tulee kantaa todistuksen- 
majan kangaskappaleet , seurakun- 
nan maja ja sen peitteet, ia hylkeen- 
nahkaisen peitteen, joka on sen 
pAAllA, ja myOs seurakunnan majan 
oviverhon; 

26. niinmyOs pihan aidan kankaat, 
ja portin verhot pihassa, joka ym- 
pAr6i todistuksen majan ja alttarin, 
sekA myOs kOydet ja kaikki tarveka- 
pineet; ja kaikki, mitA tAssA tarvi- 
taan, tulee heidAn tehdA. 

27. Aaronin ja hAnen poikainsa sa- 
nan mukaan pitAA kaikkein Gerso- 
nin poikain virka tehtAmAn, kaikki 
mitA heidAn on kannettava ja mitA 
tehtAvA; ja teidAn tulee jAttAA hei- 
dAn huostaansa kaikki heidAn kan- 
nettavansa. 

28. TAmA olkoon Gersonin lasten 
sukukuntain virka seurakunnan ma- 
jassa; ja kaikissa heidAn toimissan- 



JW 



4 MOOS. 4. 5. 



sa oikoot Itamarin, pappi Aaronin 
pojan, johdon alaisina. 

29. Merarin 1apset,heid5nsukukun- 
tainsa ja isdinsfi huonekuntain jfil- 
keen, pitHfi sinun myOs lukeman. 

30. Sinun tulee laskea heiditn lu- 
kunsa kolmenkymmenenvuoUsel ja 
sitfi vanhemmat, viidenkymmenen 
vuotiseen asli, kaikki toimeen kel* 
voUiset miehet« palvelemaan seura- 
kunnan majassa. 

31. Nftitfi kaikkia tulee h^dSn kan- 
taa, joka kuuluu heidfin virkaansa 
seurakunnan majassa:majan laudat, 
ja salvat, ja patsaat, ja ja1at« 

2 Moos. 26:1588. 

32. niin myOs pihan patsaat yltym- 
pdri, ja jalaf, ja vaarnat, ja kOydet, 
ynnS kaikki esineet ja tarvekalut; 

ta teidHn tuiee iokaiselle luetella mitii 
leidAn pitM kantaa. 

33. Tdnift olkoon Merarin lasten 
sukuin virka kaikista, josta heid&n 
pitdil ottaman vaarin seurakunnan 
majassa, Itamarin, papin Aaronin 
pbjan, johdon alaisina. 

34. Ja Mooses ja Aaron, ynnft kai- 
ken Icansan pndmiesten kanssa, las- 
kivat Kahatilaisten lasten luvun, 
heiditn sukujensa ja IsSinsS huone- 
kuntain jSlkeen, 

35. kolmenkymmenen vuotiset ja 
sits vanhcmmat viidenkymmenen 
vuotiseen asti, kaikki toimeen kel- 
volliset, palveiusta tekemddn seura- 
kunnan majassa. 

36. Ja heiddn lukunsa oli, sukuinsa 
mukaan, kaksi tuhatta seitsemSn 
isalaa ja viisikymmentd. 

37. TfimS on Kahatilaisten suku- 
kuntnin luku, joilla kaikilla oli toi- 
mittamista seurakunnan majassa, 
jotka Mooses ja Aaron lukivat, Her- 
ran sanan multaanMooseksen kautta. 

38. Niin laskettiin myOs Gersonin 
lasten luku, heidHn sukukuntainsa 
ja isi\insA huonekuntain mukaan, 

39. kolmenkymmenen vuotiset ja 
sit*'l vanhemmat, viidenkymmenen 
vuotisiin asti, kaikki toimeen kel- 
volliset, palvelusta tekem&Hn seura- 
kunnan maj.nssa. - 

40. Ja heidiln lukunsa, heiddn su-. 
kuinsa ja isflinsft- huonekuntain mu- 
kaan, oli kaksituhatta kuusi sataa 
ja koimekymmentn. 

41. Tftmfl on Gersonin lasten suvun 
luku. joilla kaikilla oli tekemistS seu- 
rakunnan majassaJotkaMooses jaAa- 
ron lukivat, Herran sanan mukaan. 

42. Luettiin myOs Merarin lapset, 
sukuinsa ja isSinsd huonekuntain 
mukaan, 

43. kolmenkymmenen vuotiset ja 



sitfi vanhemmaf, viidenkymmenen 
vuotisiin ast|. kaikki toimeen kel- 
volliset, palvelusta tekemfitn seura- 
kunnan majassa. 

44. Ja heidAn lukunsa oli, heidSn 
sukuinsa mukaan, kolmetuhatta ja 
kaksisataa. 

45. Tilmfi on Merarin lasten suvun 
luko. jotka Mooses ia Aaron lukivat, 
Herran sanan j&lkeen Mooseksen 
kautta 

46. Kaikkien Levilfiisten luetut, jot- 
ka Mooses ja Aaron vnnA Israelin 
pSHmiesten kanssa lukivat, heidSn 
sukuinsa ja IsSlnsfi huonekuntain 
mukaan, 

47. kolmenkymmenen vuotiset ja 
sitil vanhemmat , . viidenkjrmmenen 
vuotiseen asti, kaikki ne. jotka me- 
nivdt sisftlle palvelusta tekemdfln 
seurakunnan majassa ja kuormaa 
kantamaan, 

48. nAmfi luetut olivat kahdeksan* 
tuhatta, viisisataaja kahdeksankym- 
menta. 

49. Herran sanan mukaan asetettiin 
Mooseksen kautta Itsekukin virkaan- 
sa ja kuormaansa, ja jokainen sal 
tehtitvAnsS, niinkuin Herra oli Moo- 
sekselle kdskenyt. 

5 Luku. 

Laki saastaisuudesta Ja l&hlmm&iseile teh- 

dyn vfillryyden sovittamisesto. Epftluulon 

alia olevan vaimoQ soviitamisesta. 

JaHerrapuhuiMoosekselle,sanoen : 
2. K&ske Israelin lapset lAhettan 
kaikki spitalisetleirist5 ulos.ja kaik- 
ki, joiden siemen vuotaa, ja kaikki 
ne, jotka ovat johonkuhun kuollee- 
seen itsens£i saastutlaneet. 

3 Moos. 13:46. 15:2. 21:1. 

3. Sekil mieliet etta vaimot pitftft 
teid3n lAhettSmSn ulos ; leirin ulko- 
puolelle pitaa teidAn lahettnn hei- 
dat, ettcivSt leirillns& saastuttaisi, 
jossa minS heidl\n keskellflnsd asun. 

4. Ja Israelin lapset tekivftt niin, 
ja lahettivdt ne leirista ulos; niin- 
kuin Herra oli Moosekselle sanonut; 
niin he tekivAt. 

5. Ja Herra puhui Moosekselle, sa- 
noen: 

6. Puhu Israelin lapsilIe:'jos joku, 
mies tahi nainen, tekee jotakin syn- 
tiS, niinkuin ihminen saattaa tehd5, 
ja hSn rikkoo Herraa vastaan, ja 
saattaa itsensft vianalaiseksi, 

3 Moos. 5:1588. 6:2 S8. 

7. hfinen pitAS tunnustaman rikok- 
sensa, minkS h9n tehnyt on, ja pi- 
tdft tdysin kor\'aaman vahingon, 
jonka on tehnyt, ja vielA lisflfimftn 



HQ 



4 MOOS. S. 6. 



viidennen osan siihen , ja antaman 
sille, jota vastaan h&n on rikkonut. 

8Moo8.<S:15. 
.8. Joseisilldihiniselinole perillislH, 
jolle korvaus olisi maksettava, niin 
pilSa se Herralle annettaman, ja 
oleman papin oman, paitsi sovinto- 
oinasta, jonka kautta syyllinen so- 
vitetaan. 8Moos.6:«. 

9. Kaikki yldnnys-uhrit, jotka Is- 
raelii! lapset pyhiltdvfit Ja tuovat 
papille, oikoot hSnen omansa. 

2 Moos. 29:28. 3 Moos. 10:13 88. 

10. Jos joku jotain pyhittfifi« sen 
piUkA oleman papin omana, ja milfi 
lokuantaa papille, sen pitdfl oleman 
hftnen omansa. 

11. Ja Herra puhui Moosekselle, sa- 
noen: 

12. Puhu Israelin lapsille, ja sano 
heille: jos joku vaimo irslailee ja 
on uskoton miehellensd, 

13. niin ettft joku loinen hftnet ma- 
kaa,ilmanetia hfthen miehensft siitfi 
mitii§n tietaa. ja ilman ettfi asia il- 
mi tulee, vaikka hftn todella on it- 
sensS saastuttanut; jos siis ei ole 
todlstusta hilntfl vastaan eikft hfintft 
ole pahassa teossa tavattu, 

14. ja epSilyksen henki lulee mie- 
heen,niin eltfihfin epSilee vaimoansa, 
ja tftmft on todellisuudessa itsensfi 
saastuttanut; tahi jos hdn epftilee 
vaimoansa, vaikka ei tfimfi ole saas- 
tuttanut itseSnsfi, 

15. niin pilfiS miehen viemfin vai- 
monsa papin eteen , ja tuoman uh- 
riksi hanen edestllnsfi kymmenen- 
nen osan efasta ohraisia jauhoja; 
mutta ei sen pSSIle 61jyfi saa vuo- 
dattaa, eikfi'myOs pyhaA savua sen 
pflSlle panna, silld se on epftilyksen 
ruokaunri ja muistuttamuksen uhri, 
joka tuo pahan teon muistoon, 

16. ja papin pitAfi tuoman hfinen 
edes, ja asettaman Herran eteen, 

17. ja otiaman pvhSft vettS savias- 
iiaan, ja lomua pyh^kOn permannol- 
ta ja paneman siihen veteen. 

18. Ja papin pilfiS asettaman vai- 
mon Herran eteen, ja paljastaman 
vaimon pAdn, ja paneman hSnen 
Uttensfi pftfille muisiuttamus-uhrin, 
joka on epiiilyksen ruokauhri, joka 
on kiivausuhri, ja papin kAdessd ol- 
Koon ne katkerat kirousvedet 

19. Ja papin pitAft vannottaman vai- 
nMMi,ja sanoman hftnelle: ,Joseiyk- 
sikSfln mies olesinuamaannut, ja jos 
et sinft ole poikennut sinun miehesi 
iykOfl, etkfi ole itsefisi saastuttanut, 
^iin filkdta tfimfl karvas kirousvesi 
tuottako sinuUe mitfian vahinkoa. 

V. Mutta jos sinft olet poikennut 



sinun miehesi tyk6fi, niin ettfl olet 
saastuttanut itsesi, ja joku on sinun 
maannut, paitsi omaa miestSsi,'* 

21. — nSin pitflfl papin vannotta* 
man vaimoa kirouksen valalla, ja 
sanoman hSnelle: — „HeiTa anta- 
koon sinun tulla kiroukseksi ja sa- 
datukseksi sinun kansasi keskellfi, 
niin ettS Herra sallii sinun lanteesi 
lakastua, ja vatsasi ajettua! 

22. ja menkOOn nyt tSmS kirous- 
vesi sinun sisftllyksiisi, niin ettS si- 
nun vatsasi ajettuu, ja lanteesi la- 
kastuvat." Ja vaimon pitfifl sano- 
man: „amen, amen!** 

23. Sitten pitfifi papin kiijoittaman 
nflmfi kiroukset kiijaan, ia valaman 
ne sills katkeralla vedellfl, 

24. ja antaman vaimon juoda sen 
katkeran kirousveden, niin ett& ki- 
rousvesi menisi hfinen sisfiUensfi 
kalkeruudeksi. 

25. Ja papin .pitfifi ottaman epfii- 
lyksen uhrin vaimon kfidestfi, ja 
hfiSlyttfimlln sen Herran eteen ruo- 
kauhriksi,ja uhraaman sen alttarilla. 

26. Ja papin pitfifi ottaman pivon 
tSyden roiokauhrista , hfinen muis- 
tuttamus-uhriksensa , ja polttaman 
sen alttarilla ; sen jfilkeen antakoon 
hfin vaimon juoda sen veden. 

27. Ja kunhfin on juottanut hfineUe 
sen veden, niin tapahtuu, jos hfin 
on itsensfi saastuttanut ia ollut mie- 
hellensfi uskoton, ettfi kirousvesi tu- 
lee hfinen sisfillfinsfi katkeraksi , ja 
hfinen vatsansa ajettuu, ja hfinen 
larit^ensa lakastuvat; ja vaimo tulee 
kiroukseksi kansansa keskellfi. 

28. Vaan jos vaimo ei ole saastut- 
tanut itsefinsfi, vaan on pulidas, niin 
ei se tuota hfinelle mitfifin vanhin- 
koa, vaan hfin tulee hedelmfilliseksi. 

29. Tfimfi on laki epfiluulosta, kun 
joku vaimo poikkeaa pois miehensfi 
tykOfi ja saastuttaa itsensfi, 

30 tahi kun muutoin epfiluulon 
henki tulee mieheen ja hfin epfiilee 
vaimoansa; hfin asettakoon nfinet 
Herran eteen, ja papin pitfiJl tekemfin 
hfinelle kaiken tfimfin lain mukaan. 

31. Ja miehen pilfift oleman viatto- 
man siilfi pahasta teosta, vaan vaimo 
on kantava pahuutensa. 

6 Luku. 

Laki naslrein lupauksesta. Pappien julista- 
masta siunauksesta. 

J a Herra puhui Moosekselle, sanoen: 
2. Puhu Israelin lapsille, ja sano 
heille: jos joku , mies tahi nainen, 
on tehnyt erinoiqiaisen nasiri-lupauk- 
sen, eroittaaksensa itsensfi Herralle, 



141 



4 MOOS. 6. 7. 



3. niin hAiien tulee pidSttftA itseii- 
sft viinistfl^ Ja v2lkevftsta juomasta; 
vtinin etikkaa ja vilkevdn juoman 
etikkaa ei pidA hAnen juoman, eik5 
inyds mitdan, mikA on viinimar- 
joista puserrettu ; SIk6dn myOskAAn 
sydkO tuoreita eikA kuivia viinl- 
marjoja. 8 Moos. 10:9. Tuom. 13:7. 

4. Nilnkauan kuin nasiri-aika kcs- 
tns, nikOOn hdn sydkd mitdSn, mik& 
viinipuusta tulee, ei edes viinimar- 
jan sicmeniS ja kuoria. 

5. Niinkauan kuin nasiri-aikansa 
kestfifl, ftlk56n partavcitsi tuiko liA- 
nen p9&nsfi p9alle; siilien asti kuin 
hAnen Supauksensa pAivA tAytetaAn, 
pitAA hAnen pyhAn oleman, ja an- 
laman pAAnsA hiukset vapaasti kas- 
vaa. Tuom. 13:5. I Sam. 1:11. 

6. Koko sillA ajalla, jolloin hAn 
on Herrallc itsensA eroittanut, ei pi- 
dA hAnen meneniAnyhdenkAAnkuol- 
Icen ruumiin tykd, 

7. eikA saasluttaman ItseAnsA isAnsA 
laikka AitinsA, eikA veljensA taikka 
sisarensa kuolleeseen ruumiiseen ; 
sillA hAnen Jumalansa pyhitys on 
hAnen pAAnsA pAAllA ; 

8. niiuKauan kuin nasiri-aika kes- 
tAA, on hAn pyhitetty Herralle. 

9. Jos joku Akisti ja tapatui^massa 
kuolee hAnen lAheisyj'dcssAAn, niin 
tulee hAnen lupaulcsensa pAA saas- 
tutetuksi, ia hAnen pitAA ajeleman 
pAAnsA paljaaksi puhuistuspAi vAnAn- 
sA; seitsemAntenA pAivAnA pitAA liA- 
nen sen ajeleman. 4 Moos. I9:ii,i4,i6,i9. 

10. Ja kahdeksantena pl^iyAnA pitAA 
hAnen tuoman kaksi m^ltistA tahi 
kaksi nuorta kyylikystA papin tykO, 
seurakunnan majan oven eteen. 

11. Ja papin pitAA toisen niistA uh- 
raaman syntiuhriksi, ja toisen polt- 
touhriksi, ja sovittaman hAnen, lios- 
Jca hAn saastutti itsensA kuolleen run- 
miissa; ja niin pitAA hAnen pyhittA- 
mAn pAAnsA sinA pAivAnA. 

12. Ja liAnen pitAA itsensA uudel- 
leen pyhittAmAn Herralle, ja tuo- 
man vuosikuntaisen karilsan vikauli- 
riksi. Ja ne entiset lupauksen pAivAt 
tyhjAAn raukeevat, sillA IiAnen nasi- 
riutensa tuli saastutetuksi. 

IS.TAmAon nasirin laki: kun hAnen 
lupauksensa aika on tAytetty, niin 
tuotakoon hAn seurakunnan majan 
oven eteen. 

14. Ja hAnen pitAA tuoman uhrinsa 
Herralle: vuosikuntaisen virheettdr 
mAn karitsan polttouhriksi, vuosi-^ 
kuntaisen virheett5mAn uuhen syn- 
tiuhriksi ja vuosikuntaisen virheet- 
tOmAn oinaan kiitosuhriksi, 

15, sekA korillisen happamattomia, 



OljyllA sekpitettuja leipift hienoistn 
jauhoista. sAmpylAjauhoista , sekoi- 
tettuja Olwyn, ja ohukaisia happa- 
mattomiakakkuja, OIjyllA voideltuja. 
ynnA siihen kuuluvan ruoka- ja juo- 
mauhrin. 

16. Ja papin pitAA ne tuoman Her- 
ran eteen ja unraaman hAnen syn- 
tiuhriksensa ja polttouhrikscnsa. 

17. Mutta oinaan hAnen pitAA uh- 
raaman Herralle kiitosuhriksi, ynnA 
happamattomat leivAt korissa; ja 
papin pitAA myOs hAnen ruokauh- 
rinsa ja juomauhrinsa tekeniAn. 

18. Ja nasirin eli sen, jokaluvannut 
on, pitAA lupauksensa pAAn ajele- 
man paljaaksi, seurakunnan majan 
oven edessA, ja ottaman lupauksen- 
sa pAun hiukset ja heittAmAn tuleen, 
joka kiitosuhrin alia on. 

Ap.t 18:18. 21:2388. 

19. Ja papin pitAA ottaman oinaan 
keitetyn lavan, ja yhden happamat- 
toman leivAn korista, ja yhden ohu- 
kaisen happamaltoman kakun, ja 
paneman ne nasirin kAden pAAUe; 
sittekuin hAn on ajellut eroituksen- 
sa hiukset. 

. 20. Ja papin pitAA ne hAAlyttAmAn 
hAAlytys-uiirtksi Herran edessA; se 
on p>hA papille, ynnA hAAlytysrin- 
nan ja ylOnnj'slavan kanssa. Sen jAl> 
keen saakoon nasiri juoda viiniA. 

2 Moos. 29:27. 3 Moos. 7:31 89. 
21 TAmA on nasirin laki, joka uh- 
rinsa lupaa Herralle eroituksensa 
puolesta, paitsi milA hAn muutoin 
saattaa antaa. Niinkuin hAn on lu- 
vannut, niin pitAA myds hAnen te- 
kemAn nasiriutensa lain mukaaii. 

22. Ja Herra puhui Moosekselle, sa- 
no'en : 

23. Puhu Aaronille ja hAnen pojil- 
lensa, ja sano : nAin pitAA teidAnslu- 
naaman Israelin lapsia, ja sai^oman 
heille: 3 Moos. 9:22. Syr. 96:191 50:22. 

24. Herra siunatkoon sinua ja var- 
jelkoon sinua I . pb.67:2. 

25. Herra valistakoon kasvon^ si- 
nun pAAUesi, ja olkoon sinulle ar- 
mollinen 1 

26. Herra ylOntAkOOn kasvon^a si- 
nun puoleesi, ja antakoon sin^^e 
rauhan ! 

27. Niin tulee heidAn panna minun 
nimeni Israelin lasten pAAIle, ja mi- 
nA tahdon siunata heitfl. 

7 Luku. 

Pftftmiehei antavat lahjojft pyb&kkOOo. 

J a tapahtui sinA pAivAnA, kuin Moo- 
ses oli pystyttAnyt majan, voidel- 
lut ja pyhittAnyt sen ja kaikki sen 



142 



i MOOS. 7. 



tanrekalut, niin myOs asettanut alt- 
larin ja kaikki sen tarvekalut, voi- 
dellut ja pyhittftnyt ne, 2 Moos. 40:18. 

8 Moos. 8:1086. 

2. niin Israelin. pfiftmiehet , jotka 
ylimmdiset olivat isainsd huonekun- 
nassa, suviinp^fimfehet, jotka olivat 

ilimmftisia niitlen seassa, ioitten lu- 
u oli laskettu, toivat uhrilahiansa. 

3. He toivat uhrinsa Herran eteen : 
kuusi katettua vaunua ia kaksitois- 
ta tiSrkSS, aina vaunun kahden pftfi- 
mielien edestfi, mutta hdrjAn itse- 
kunkin edestS ; ja he toivat ne ma- 
jan eteen. 

4. Ja Herra puhui Moosekselle, sa- 
noen: 

5. „Ola ne heiltfi« kSytettfivfiksiseu- 
rakunnan maian * palveluksessa , ja 
anna ne Levilftisille , itsekuUenkin 
virkansa jfilkeen." 

6. Niin otti Mooses vaunut ja hftr- 
jSt, ia antoi ne Levildisille. 

7. Kaksi vaunua ja neija hftrkfifi an- 
toi hftn Gersonin lapsllle, heldfin 
virkansa jfilkeen. 

8. Netjfi vaunua ja kahdeksan hftr- 
kaa antoi hfin Merarin lapsille, hei- 
ddn virkansa j&lkeen, jonka he toi- 
mittivat Itamarin, papin Aaronin 
pojan. johdoUa. 

9. Mutta Kahatin lapsille ei hfin 
mitaSn antanut, $illa heidfln tuli 
pitSfi huolta pyhistS esineistft; be 
kantoivat ne olallaan^ 4 Moos. 4:4,15. 

10. Ja p9dmiehet uhrasivat alttarin 
Wtikimiseksi , sinfi pdivfinft, jolloin 
se oli voideltu* ja he toivat lahjan- 
sa alttarin eteen. 

11. Ja Herra sanoi Moosekselle: «,an- 
na jokaisen pftfimiehen tuoda uh- 
rinsa, itsekunkin pfiivfinflnsft, altta- 
rin vihkimiseksl.''^ 

12. EnsimmSisenft pfiivfinfi uhrasi 
lahiansa Nahesson, Amminadabin 
poika, Juudan sukukunnasta. 

13. Ja hdnen lahjansa oli yksi ho- 
Piavati , joka painoi sata ja kolme- 
kymmenta sikJifl, yksi hopiamalja, 
seitsemankymmentft sikliS, pyhlin 
sikiin jfilkeen, molemmat taynnfi 
hienoja jauhoja, Oljylld sekoitettuja, 
niokauhriksi ; 3 Moos. 2:1. 

14. edelleen kultainen malja, pai- 
nava kymmenen siklift kultaa, tayn- 
nd suitsutusta; 

15. yksi nnori hftrkfi, yksi oinas, 
yksi vuosikuntalnen karitsa, polt- 
toubriksl, 

16. yksi kauris syntiuhriksi ; 

,. . 8 Moos. 4:23. 

17. ja kiitosuhriksi kaksi hUrkfifi, 
viisi oinasta, viisi kaurista, ja viisi 
voosikuntaista karitsata. T&mft oli 



NahessQnin, Amminadabin pojan, 
lahja. 

18. Toisena pftivftnft uhrasi Neta- 
neel, Suarin poika, Isaskarln pftft- 
mies. 

19. Hftnen lahjansa oil hopiavati, 
joka painoi sata ja kolmekvmmen- 
tfi sikliS, ja hopiamalja, seitsemftn- 
kymmenen sikiin, pyhfin sikiin jftl- 
keen, molemmat tdynnfi hienoja jau- 
hoja, Oljyllfl sekoitettuja, ruokauh- 
riksi; 

20. edelleen kultainen malja, kym- 
menen siklift kultaa, tftynnftnsA suit- 
sutusta, 

21. nuori hfirkS kaijasta, oinas, 
vuosikuntalnen karitsa , polttouh- 
Hksi, 

2^. yksi kauris syntiuhriksi, 

23. ja kiitosuhriksi kaksi hftrkftft, 
viisi oinasta, viisi kaurista ja viisi 
vuosikuntaista^luiritsata. Tftmfi oli 
Netaneelin, Suarin pojan, lahja. 

24. Kolmantena pSivfinft tuli Sebu- 
lonin laslen pSSmies, Eliab, Helonin 
poika. 

25. Hftnen lahjansa oli hopiavati, 
joka painoi sata ja kolmekvmmen- 
tfi siklift, ja hopiama^a, seitsemftn- 
kymmentfi siklift , pyhftn sikiin jftl- 
keen, molemmat tfiynnft hienoja jau- 
hoja, O^jyllft sekoitettuja ruokauh- 
rik%i; 

26. edelleen kultainen malja, kym- 
menen siklift kultaa, tftynnfi suitsu- 
tusta, 

27. nuori hfirkft kaijasta, oinas, vuo- 
sikuntalnen karitsa, polttouhriksi, 

28. kauris syntiuhriksi, 

29. ja kiitosuhriksi kaksi hftrkftft. 
viisi oinasta, viisi kaurista, ja viisi 
vuosikuntaista karitsata. Tftmft oil 
Eliabin, Helonin pojan, labia. 

30. Neljftntenft pftivftnft tuli Rul>e- 
nin lasten pftftmies, Elisur, Sedeurin 
poika. 

31. Hftnen lahjansa oli hopiavati, 
joka painoi sata ja kolmekymmen- 
tft siklift, ja hopiamalja, seitsemftn- 
kymmentft siklift, pyhfin sikiin jfil- 
keen, molemmat tfiynnft hienoja jau- 
hoja, Oljyllft sekoitettuja, ruokauh- 
riksi; 

32. edelleen kultainen malja, kym- 
menen siklift kultaa, tftynnflnsft suit- 
sutusta, 

33. nuori hftrkft kaijasta, oinas, vuo- 
sikuntainen karitsa, polttouriksi, 

34. kauris syntiuhriksi, 

35. ia kiitosuhriksi kaksi hftrkftft, vii- 
si oinasta, viisi kaurista, ja viisi vuo- 
sikuntaista karitsata. Tftmft oli Eli* 
surin Sedeurin pojan, lahja. 

36. Viidentenfi pftivftnft tuli Simeo* 



148 



4 MOOS. 7, 



nin lasten pfifimics, Selumiet, Suri- 
saddain poika. 

37. Hfihen lahjansa oli hopiavati, 
joka painoi sata ja kolmekymmentS 
siktia, ja hopiamalja, seitsemfinkym- 
mentfi siklia, pyhfin siklin jatkeen, 
molemmat tayniift hienoja jauhoja, 
Oljyllfi sekoilelluja, ruokauhriksi ; 

38. sitten kultainen malja« kymme- 
nen siklifl kultaa, tdynndnsft suitsu- 
tusta, 

39. nuofihfirkS karjasta,oinas,vuo- 
sikuntainen karitsa, polttouhriksi, 

40. kauris syntiuhriksi, 

41. ja kiitosuhriksi kaksi hllrkas, 
viisi oitiastn, viisi kaurista, ja viisi 
vuosikunlaista karitsata. T^mS oli 
Selumielin,Surisaddainpojan,lahja. 

42. Kuudentena pfiivftna tuli Gadin 
lasten pSSmies, Eljasaf, Deguelin 
poika. 

43. HUnen lahjansa oli hopiavati, 
joka painoi sata ja kolmekymmentd 
siklifl Ja hopiamalja, seitsemfinkym- 
mentfi siklifl, pyhan siklin jfllkeen, 
molemmat tflynnfl hienoja lauhoja, 
dljyllfl sekQitettuja, ruokauhriksi, 

44. sitten kultainen malja, kj'mme- 
nen siklifl kultaa, tflynnflnsfl suilsu- 
tusta, 

45. nuori hflrkfl karja%ta,oinas,vuo- 
sikuntainen karitsa, polttouhriksi, 

46. kauris syntiuhriksi, # 

47. ja kiitosuhriksi kaksi hflrkflfl, 
viisi oinasta, viisi kaurista, ja viisi 
vuosikunlaista karitsata. Tflmfl oli 
EljasaOn, Deguelin pojan, lahia. 

48. Seitsemflntenfl pfiivflnfl tuli Ef- 
raimin lasten pflflmies, Elisama, 
Ammihudin pofka. 

49. Hflnen lahjansa oli hopiavati, 
joka painoi sata ja kolmekvmmen- 
tfl siklifl, ja hopiamalja, seitsemfln- 
kymmentfl siklifl, pyhSn siklin jfll- 
keen, molemmat tflynnfl hienoja jau- 
hoja, Oljyllfl sekoitettuja, ruokauh- 
riksi; 

50. edelleen kultainen malja, kym- 
menen siklifl kultaa, tflynnflnsfl suit- 
sutusla, 

51. nuori hflrkfl karjasla,oinas, vuo- 
sikuntainen karitsa, polttouhriksi, 

52. kauris syntiuhriksi, 

53. ja kiitosuhriksi kaksi hflrkflfl, 
viisi oinasta, viisi kaurista, ja viisi 
vuosikunlaista karitsata. Tflmfl oli 
Elisaman, Ammihudin pojan, lahja. 

54. Kahdeksantena pflivflnfl tuli Ma- 
nasscn lasten pflflmies, Gamliel, Pe- 
datsurin poika. 

55. Hflnen lahjansa oli hopiavati, 
joka painoi sata ja kolmekymmen- 
tfl siklifl, ja hopiamalja, 'seitsemfln- 
kymmentfi siklifl, pyhfln siklin jfll- 



keen, molemmat tflynnfl hienoja jau- 
hoja, dljyllfl sekoitettuja, ruokauh- 
riksi; 

56. edelleen kultainen malja, kym- 
menen siklifl kultaa, tflynnfl suitsu- 
tusta, 

57. nuori. hflrkfl karjasta,oinas,vuo- 
sikuntainei^ karitsa, polttouhriksi, 

58. kauris syntiuhriksi, 

59. ja kiitosuhriksi kaksi hflrkflfl, 
viisi oinasta, viisi kaurista > ja viisi 
vuosikunlaista karitsata. Tflmfl oli 
Gamlielin, Pedatsurin pojan, lahja. 

60. Yhdeksflntenfl pflivflnfl tu|i Ben- 
jamlnin lasten pflflmies, Abidan, Gi- 
deonin poika. 

61. Hflnen lahjansa oli hopiavati, 
joka painoi sata ja kolmekymmen- 
tfl siklifl, ja hopiamalja, seitsemfln- 
kymmentfl siklifl , pyhfln siklin jfll- 
kecn, molemmat tflynnfl hienoja jau- 
hoja, dljyllfl sekoitettuja, ruokauh- 
riksi, 

62. edelleen kultainen malja, kym- 
menen siklifl kultaa, tflynnfl suitsu- 
tusta, 

63. nuori hflrkfl karjasta,oinas,vuo- 
sikuntainen karitsa, polttouhriksi, 

64. kauris syntiuhriksi, 

65. ja kiitosuhriksi kaksi hflrkflfl, 
viisi oinasta, viisi kaurista, ja viisi 
vuosikunlaista karitsata. Tflmfl oli 
Abidanin, Gideonin pojan, lahja. 

66. Kymmenentenfl pflivflnfl tuli Da- 
nin lasten pflflmies, Ahieser, Ammi- 
saddain poika. 

67. Hflnen lahjansa oli hopiavati, 
joka painoi sata ja kolmekymmen- 
tfl siklifl, ja hopiamalja, seitsemfln- 
kymmenlfl siklifl, pyhfln siklin jfll- 
keen, molemmat tflynnfl hienoja jau- 
hoja, 61jyllfl sekoitettuja, ruokauh- 
riksi, 

68. edelleen kultainen malj», kym- 
menen siklifl kultaa, tflynnfl suitsu- 
tusta, 

69. nuori hflrkfl karjasta , oinas, 
vuosikuntainen karitsa, polttouh- 
riksi, 

70. kauris syntiuhriksi, 

71. ja kiitosuhriksi kaksi hflrkflfl, 
viisi oinasta, viisi kaurista, ja viisi 
vuosikunlaista karitsata. Tflmfl oli A- 
hleserln.Ammlsaddnln pojan,lahja. 

72. Enslmmfllscnfl toistakymm enen- 
tenfl pflivflnfl tullAsserin laslcn pflflr 
mies, Pagiel, Okranin poika. 

73. Hflnen lahjansa oil hojiaivati, 
joka painoi sata ja kolmekymmen- 
tfl siklifl, ja hopiamalja, seit»emfln- 
kymmenlfl siklifl, pyhfln siklin jfll- 
keen, molemmat tflynnfl hienr>?a3au- 
hoja, dljyllfl sekoitettuja, ruokau^)- 
riksi. 



144 



4 MOOS. 7. 8. 



74. edelieen kultaiaen malja, kym- 
menen siklift kultaa, tSynnS suilsu- 
ttista, 

75. nuori h§rk& kaijasta,oinas, vuo- 
sikuntainen karitsa, polttouhriksi, 

76. kauris syntiuhriksi, 

77. ja kiitosuhriksi kaksi hSrkSlil, 
viisi oinasta, viisi kaurista , ja viisi 
vuosikuntaista karitsata. Tlimd oli 
l^elin/Okranin pojan, lahja. 

78. Toiscna tolstakymmenentena 
paivfina tuli Naflalin lasten pdflmies, 
Ahira, Enanin poika. 

79. Hdnen lahjansa oli hopiavati, 
joka painoi sata ja kolmekvmmen- 
IS siklia, ja hopiamaija, seitsemlln- 
kymmenm siklm , pyh5n siklin j^- 
keeHjinolemmat tfiynnS hieaojajau- 
l^oja, O^yM sekoitettuja, ruokauh- 
riksi, 

SO. edelieen kultaineu malja, kym- 
meaen sikliS kultaa. tdynnft suitsu- 
tusta, 

81. nuori hftrkS karjasta,oinas, vuo- 
sikuntainen karitsa, polttouhriksi, 

82. kauris syntiuhriksi, 

83. ja kiilosuhnksi kaksi hUrkaft, 
viisi oinasta, viisi kaurista, ja viisi 
vuosikuntaista karitsata. T2Unft oli 
Ahiran, Enanin pojan, lahja. 

84. TSmd on Israelin lasten ruhti- 
luiitten lahja alttarin vihkimykseen 
sinS p^ivdnS, jona se voiaeltiin: 
kaksitoista hopiavatia, kaksitoista 
hopiamaljaa , Kaksitoista kultaista 
maljaa. 

85. Jokainen vati painoi sata ja kol- 
mekymmentH -siklili hopiata, ja jo- 
kainen malja seitsemfinkymmentd 
sikli^ niin eltii kaikkein astiain ho- 
pian luku oli kaksituhatta ja neljli- 
sataa sikliS, pyh5n siklin jaikeen. 
,86. Ja ne kaksitoista kultaista mal- 
aa. jotka olivat suitsutusta tllynn3, 
>ainoivat jokainen kymmenen sik- 
i^. pyhdn siklin jSlkeen, nlin ett0 
uukki kulta yhteensd maljoissa oli 
sata ja kaksikymmenta siklia. 

87. Eliiinten luku polttouhriksi oli : 
kaksitoista hflrkaa , edelieen kaksi- 
toista oinasta, kaksitoista vuosikun- 
taista karitsata, ynnS siihen kuulu- 
varuokauhri, ja kaksitoistakymmen- 
tt kaurista syntiuhriksi. 

88. Ja kaijan luku kiitosuhriksi oli : 
Delia hSrkaa kolmattakymmenta, 
kuusikymmentS oinasta, kuusikym- 
mentS kaurista , kuusikymmenta 
vuosikuntaista karitsata. Tama oli 
utlarin vihkimys- lahja, sitten kun 
« oU voideltu. 

®* Ja kun Mooses men! seurakun- 
nsn nu^aan, puhutellakseen Hfinta, 
Ana kuuU hftn fifinenpuhuvankans- 



sansa armoistuimelta, joka oli todis- 
tuksen arkin pSaUa, kahden Keru- 
bimin vMissA, ja sieltfi puhuteltiin 
hSnta. 2M00S. 25:22. 

8 Luku. 

Kynttllftjalan lamput Levilftistto pub- 
dislamisesta majan palvelukseen. 

J a Herra puhui Moosekselle, sa- 
. noen: 

2. .,Puhu Aaronille, ja sanp hftnel- 
le: kun asetat lamput sijaSlensa, niin 
pitaa ne seitsemSn lamppua valai- 
seman juuri paikkaa kynttil^alan 
edessa.*' 2 Moos. 25:37. 27:20. 40:25. 

3. Ja Aaron teki niin, ja asetti lam- 
put kynttiiajalkaan silia tavalla, niin- 
kuin Herra Moosekselle oli kSskeny t. 

4. Mutta kynttiiajalka oil tehty sor- 
vaamalla kullasta,varresta niinkuk- 
kasiin asti oli se sorvattu ; sen muo- 
don jaikeen kuin Herra oli Moosek- 
selle nayttanyt, niin teki h|ln kynt-* 
tilSijalan. 2 Moos. 25:31. 37:17. 

5. Ja Herra puhui Moosekselle, sa- 
noen: 

6. Ota Leviiaiset Israelin lasten kes- 
kelta ja puhdista heidat. 

7. Ja nain pitaa sinun tekeman 
heille, puhdistaaksesi heidat : priis- 
koita puhdistusvetta heidan paallen- 
sa, ja heidan pitaa ajeleman koko 
ruumiinsa ihon, ja vaatteensa pese- 
man, ja niin he ovat puhtaat. 

8. Ja sitten pitaa heidan otta'man 
nuoren harjan ynna siihen kuulu- 
van ruokauhrin hienoista, Oljylia 
sekoitetuistajauhoistaja toisen nuo- 
ren harjan pitaa sinun ottaman syn- 
tiuhriksi. 

9. Ja sinun pitaa tuoman Leviiaiset 
seurakunnan majan eteen, ja kokoo- 
man kaiken Israelin lasten kansan. 

10. Ja kun olet tuonut Leviiaiset Her- 
ran eteen, niin Israelin lasten pitaa 
paneman katensa Leviiaisten paaUe. 

11; Ja Aaronin pitaa Leviiaiset haa- 
lyttaman Herran eteen Israelin las- 
ten haaiytys-uhriksi, \sl heidan pitaa 
Herran palvelusta toimittaman. 

12. Ja Leviiaisten pitaa laskeman 
katensa harkien paan paaile, ja toi- 
nen harka tulee sinun uhrata Her- 
ralle syntiuhriksi, ja toinen polttouh- 
riksi Leviiaisia sovittamaan. 

13. Ja sinun pitaa Leviiaiset aset- 
taman Aaronin ja hanen poikains^ 
eteen, ja haaiyttaman heidat haaiy- 
lys-uhriksi Herralle. 

14. Silia lailla pitaa sinun Leviiaiset 
eroittaman Israelin lapsista, niinettu 
Leviiaiset ovatminun. 4 Moos. 3:13,45. 

15. Ja sitten Leviiaiset kaykddt si- 
saile palvelemaan seurakunnan ma« 



145 



4 MOOS. 8. 9. 



jassa, kun sin5 olet heidSt puhdis- 
tanut, ja hft&lytmnyt heidfit hdfily- 
tysuhriksi. 

16. Sillfi he ovat minulle annetut 
Israelii! lasten seasta, ja mina olen 
heiddtottanutilsellenikaikkeincdes- 
tfi, jotka ensisti avaavat flitinsfi koh- 
dun, nimittilin kaikkein esikoisten 
edestfl Israelii! lapsista. 

17. Siim kaikki esikoiset Israelin 
lapsista ovat minun, sekd ihmisistft 
ettS eldimi^tft; sinfi pftivfinft, jona 
minlk lOin kaikki esikoiset Ef[yptin 
maalla, pyhitin mind ne itselieni, 

2 AIoos 1.3 *2. 

18. Ja otin itselleni Levilftiset, kaik- 
kein esikoisten edestft Israelin lap- 
sista. 

19. ja annoin Levilfiiset Aaronille 
la hanen pojillensa lahjaksl Israelin 
lapsista, ettfi heidfin pit5& seurakun- 
nan majassa Israelin lasten virassa 

{lalveieman, ja sovittaman Israelin 
apset, ettei rangaistus tulisi Israe- 
lin lasten pfiftlle, jos he Ifihestyisivfit 
pyhfikk6§. 

20. Ja Mooses ynnft Aaronin kans- 
sa, ja koko Israelin seurakunta te- 
kivfil Levilftisille nSin ; niinkuin Her- 
ra oli Moosekselle kfiskenyt, niin te- 
kivdt Israelin lapset heille. 

21. Ja Levildiset puhdistivat itsensH 

i*a pesivdt vaatteensa, ja niin Aaron 
laaiytti heidat hddl^tysuhriksi Her- 
ran edessS, la sovitti heidSt, niin 
etta he puhdistettiln. 

22. Ja sitten Levil5iset menivfit sen- 
rakunnan majaan virkaansa teke- 
mddn Aaronin ja hSnen poikainsa 
edcss9 ; niinkuin Herra oil Moosek- 
selle kdskenyt LevilMsistft, niin te- 
kivat he heille. 

23. Ja Herra puhui Moosekselle, sa- 
noen: 

24. Tama on Leviiaisten laki: vii- 
denkoImattakyn(!menen vuotiset ja 
siia vanhemmat ovat velkapaat pal- 
veiemaan seurakunnan majassa. 

25. Mutta viidennestdkymmenesta 
vuodesta pitaa heidan vapaat ole- 
man palvcluksensavirasta; eikfihei- 
dan tarvitse enaa palvella. 

26. Heidan pitaa vaan auttamanvel- 
jidnsa seurakunnan majan palvelus- 
tydssa; mutta viran tOita el heidan 
tarvitse tehda. Nain sinun pitaa te- 
kemdn Leviiaisille heidan virkatoi- 
missansa. 

9 Luku. 

Fft&siUsjubla korvessa. PUvi maJan 
pUUlft. 

J a Herra puhui Moosekselle Sinain 
kcrvessa, toisena vuonoa sittekuin 



. he olivat lahteneet Egyptin maalta, 
ensimmaisenft kuukautena, sanoen : 

2. Israelin lasten pitaa paasiatstft 
pitaman maaratylia ajallansa. 

3. Neljantena toistakymmenentenft 
paivana t^lia kuulla, illan suussa, 
pitaa heidan sen pitaman, maarft- 
tylia ajalla; kaikkein saantOjensS 
ja asetustensa mukaan pitaa teidan 
sen tekemftn. 2 Moos. 12:18. 3 Moos. 23:5. 

4 Moos. 28^6. 6 Moos. 16:1. 

4. Ja Mooses puhui Israelin lapsil* 
le, etta heidan pit! paasiftistft pita- 
man. 

5. Ja he pitivftt pSasiaista neljftn- 
tend paivana toistakymmentaensim- 
maiselia kuulla, illan suussa, Sinain 
korvessa; kaiken sen jaikeen kuln 
Herra oli Moosekselle kaskeny t, niin 
tekivat Israelin lapset. 

6. Ja sielia oli muutamia miehlft, 
jotka olivat saasluttaneetitsensft kuol- 
leessa ihmisessa, niin etteivftt he 
saaneet pitaa paasifilsta sind pdivft- 
na ; ja he menfvat sind paivana Moo* 
seksen ja Aaronin eteen. 4 Moos. I9:ii. 

7. Ja ne miehet sanoivat hanelle: 
„me olemme saastuneet kuolleessa 
ihmisessa : miksi meita niin halvek- 
sitaan, ettemme saa uhrata meidfin 
lahjojamme aikanansa Israelin las- 
ten seassa?" 

8. Mooses sanoi heille: „seisokaat 
tassa, mina tahdon kuulla, mitft 
Herra kaskee teista." 

9. Ja Herra puhui Moosekselle, sa« 
noen: 

10. Puhu Israelin lapsille, sanoen: 
jos joku teista tahi jaikeentulevaisis* 
tanne saastuttaa itsensa kuolleessa, 
taikka on kaukaisella matkalla, hft* 
nen pitaa kuitenkin pitaman pftft- 
siaista Herralle. 

11. Toisella kuulla, neljantena pfii- 
vana toistakymmenta, illan suussa, 
pitaa lieidan sen tekeman, ja hei- 
dan pitaa sen syOman happamatto- 
man leivan ja karvasten ruohoin 
kanssa. 2 Moos. 12:8. i Aik. 30:2, 15. 

12. Ei pida heidan siita mitakfiftn 
tahteeksi jattaman huomeneksi, ei- 
ka luuta siita rikkoman; kaikkein 
paasiais-saantOjen mukaan pitaa hei- 
dan sen tekeman. 2Moo8.i2:io. 12:46. 

Job. 19:36. 

18. Mutta joka puhdas on, eikft ole 
matkalla, ja laiminlyO pitaa pfifi- 
siaista, han havitettakOdn kansois- 
tansa, sentahden, ettei han ole kan- 
tanut uhriansa Herralle maaratyllfi 
ajalla; hanen pitaa itse syntinsft 
kantaman. 

14. Ja jos joku muukalainen asuu 
teidan seassanne, ja myOs tahtoo pi- 



146 



4 MOOS. 9. 10, 



tflfiHerralle pftftsiftistft^niinpitAkOOn 
sen pft3siSisen sftftntOjen ja asetuk- 
sien mukaan. Yksi ja sama sSuntO 
olkoon telllft, niin muukalaisella 
liuin omaisellakin maassa. 

2 Moos. 12:49. 4 Moos. 16:15. 

15. Ja sinA pfiivanS, jona msga pys- 
tytettiin, vaijodi pilvi todistuksen 
m^an, ja oli illasta aina aamuun 
tsti mi^an pftftllft niinkuin tuli. 

2 Moos. 40:34,88. 1 Kiln. 8:1088. 

16. Niin tapahtui alati; pilvi var- 
Josi sen ja oli yOllfl niinkuin tuli. 

17. Ja kun pilvi kohosi majan pfi5l- 
Ul, niin vaelsivat Israelin lapset; ia 
missft pilvi seisahtui, siihen paik- 
kaan Israelin lapset sijoittivat itsen- 
^' 2 Moos. 40:36 ss. 1 Kor. 10:1. 

18. Herran sanan jfilkeen vaelsivat 
Israelin lapset, ja Herran sanan jfil- 
keen he mvAs itsensfi sijoittivat; 
niin kauan kuin pilvi pysyi majan 
pSHllft, pysyi vfit he my6s paikoil- 
lansa. 

19. Ja jos pilvi usiammat pHivfi) 
pysyi msyan pSfillA, niin ottivat Is- 
raelin lapset vaarin Herran mftd- 
r9yksist5, eivHtkft vaeltaneet. 

20. Ja jos niin tapahtui, ettft pilvi 
ainoastaan muUtamia pSivifi oh ma- 
jan nniUlfi, niin he sijoittivat itsen- 
sil Herran sanan jAlkeen, ja Herran 
sanan jAlkeen he my6s vaelsivat. 

21. Ja jos niin tapahtui , ettfi pilvi 
oli majan pftftllfi iilasla aamuun as- 
U. ja sitten aamuUa nousi , niin he 
lSk.sivnt matkalle; ja milloin pilvi 
paivSllA taikka yOUd nousi, niin he 
Uiksivat matkalle. 

22. Tahi jos pilvi kaksi pdivda tahi 
Kuukauden taikka muutoin kauan 
aiicaa pysyi majan pAdlia, niin Is- 
raelin .lapset olivat leirissAdn, eivSt- 
U matkustaneet; ja kun se nousi, 
niin he Ifiksiviit matkalle. 

23. Herran kfiskyn jAlkeen sijoitti- 
vat he itsensfi, ja Herran kdskyn jSl- 
Keen he 13ksivAt matkalle; he otti- 
vat vaarin Herran mSflrayksistii, 
Herran sanan jUlkeen Mooseksen 
kautta. 

ID Liiku. 

Hopeatorvpt Lftbtn Sinailta Parnnin kor- 
peen. Hobab. Mooseksen rukous. 

fa Herra puhui Moosekselle^ sa- 
" noen: 

1 „Tee ilsellesi hopiasta kaksi tor- 
vea. sorvaamalla sinun nc tekemftn 
Piliia; ne kdytettakOOn , kun seura- 
Kunta on kutsuttava kokoon, ja kun 
naalkalle on hlhdeltavfi. 
*' Kun niillft molemmilla hiljak- 
*ensa soitetaan, silloin pitan koko 



seurakunnan kokoontuman seura- 
kunilan majan oven eteen. 

4. Vaan kun ainoastaan yhdellft 
soitetaan, silloin pitfiA pAfimiehetja 
tuhanten esimiehet Israelissa tule* 
man kokoon. 

5. Mutta kun te hSlyllft soitatte, sil- 
loin pitfid ne leirit Ifthtemdn roat- 
kaan, jotka itftfin pflin ovat. 

6. Ja Kun te toisen kerran hfilyllft 
soitatte, silloiii pitaS ne leirit Ifthte- 
mftn matkaan, jotka etelUftn pflin 
ovat; leirien 19htiessft matkalle pi- 
tftfi teidfin hfllyllA suittamari. 

7. Mutta kun seurakunnan pitftft ko- 
koontuman, silloin fllksa haiyft soit- 
tako, vaan pulialtakaa hiljaLsensa. 

8. Ja papit, Aaronin pojat, ndillfi 
torvilla soiltakoot; ja tdmfl olkoon 
teilleja teidfln sukukunnillenneijan- 
kaikkinen saHntO. 

9. Ja kun te lahdette sotaan teidfin 
maassanne vihollisianne vastaan, 
jotka teita vainoovat, silloin puhal- 
takaat hfilylld torviinne, ettfi teilfi 
muistettaisiin Herran, teidfin Ju^ 
malanne, edessfi, ja te pelastettaisiin 
vihollisistanne. 

10. Ja ilopfiivfinfinne, ja juhlapfii- 
vinfinne, ja uuden kuun juhlina pi- 
tfifi teidfin torvilla soittaman, teidfin 
polttouhrianne ja kiitosuhrianne 
uhratessanne, ettfi nc olisivat teille 
mulstoksi teidfin Jumalanne edessfi. 
Minfi olen Herra, teidfin Jumalanne.** 

2Aik. 7:6. Ps. 81:488. 

11. Ja tapahtui kahtenakymmenen- 
tenfi pfiivfinfi, toisessa kuukaudessa, 
toisena vuonna, ettfi pilvi nousi to- 
distuksen majan pfifillfi, 

12. ja Israelin lapset Ifiksivfit mat- 
kaan jfiijestyksessfi Sinain korvesia; 
ja pilvi seisahtui Paranin. korvessa. 

13. Ja ensimmfiiset Ifiksivfit mat- 
kalle Herran sanan jfilkeen Moosek- 
sen kautta. 

14. Ja Juudan lasten leirin lippu 
Ifiksi ensin malkaan joukkoinensa, 
ja heidfin joukkonsa pfifimies oli 
Nahesson, Amminadabin poika. 

4 Moos. 2:3. 

15. Ja Isaskarin lasten suvun jou- 
kon pfifimies oli Netaneel, Suarin 
poika. 

16. Ja Sebulonin lasten suvun jou- 
kon pfifimies oli Eliab.Helonin poika. 

17. Sitten maja purettiin ; ja Gerso- 
nin ja Merarih lapset Ifiksivfit mat- 
kaan ja kantoivat majaa. 

4 Moos. 4:24,2988. 

18. Sen jfilkeen Ifiksi Rubenin lei- 
rin lippu joukkoinensa, ja sen jou- 
kon pfifimies oli Elisur, Sedeurin 
poika. 



147 



4 MOOS. 10. 11. 



19 Ja Simeonin last^n suvun jou- 
kon pdfimies oli Selumiel, Surisad- 
dain poika. 

20. Ja Gadin lasten suvun Joukon 
p99mies oli Eljasaf, Deguelin poika. 

21. Niin matkustivat myOs ne Ka- 
hatilaiset, jotka kantoivat pyhiS esi- 
neitd; ja toiset panivat majan ylOs, 
siihen asti ettfi ndmfi tulivat. 

22. Senjaikeen Ifiksi Efraimin las- 
ten leirin iippu joukkoinensa, ja 
sen joukon pflSmies oli Elisama, 
Ammihudin poika. 

23. JaManassen lasten sukukunnan 
joukon p55mies oli Gamliel, Pedat- 
surin poika. 

24. Ja Benjaminin lasten sukukun- 
nan joukon pSSmies oli Abidan, Gi- 
deonin poika. 

25. Senjfilkeen l&ksi Danin lasten 
leirin Iippu joukkoinensa , ja muo- 
dosti leirlen jaikijoukon. Ja heidfin 
joukkonsa pfiSmies oli Ahieser, Am- 
misaddain poika. 

26. Ja Asserin lasten sukukunnan 
joukon p&ilmies oli Pagiel, Okranin 
poika. 

27. Ja Naftalin lasten sukukunnan 
joukon pddmies oli Ahira, Enanin 
poika. 

28. TSss9 j3rjestyksess5 vaelsivat 
Israelin lasten joukot ; ja he Ifiksivfit 
niin matkalle. 

29. Ja Mooses puhui Hobabillc, mi- 
dianilaisen Reguelin , Mooseksen 
apen pojalle: „me menemme siihen 
paikkaan, josta Herra on sanonut: 
minS annan sen teille. T.ule meidSn 
kanssamme, me teemmc sinulle hy- 
vfia, silld Herra on hyvSft luvannut 
Israelille.** 

30. Mutta h&n vastasl: ,)en minft 
tule teidSn kanssanne, vaan minft 
menen omalle maalleni sukuni 
tykO." 

31. Ja hSn sanoi: ,,ftlft meistd luo- 
vu, sillft sinft tiedftt, missft meidftn 
tulee itsemme sijoittaa korvessa, ja 
sinft olet meidftn silmftmme. 

32. Jos sinft tulet meidftn kans- 
samme, niin se hyvft, minkft Herra 
meille tekee, sen me teemme si- 
nulle." 

33. Niin he matkustivat kolme pfti- 
vftkuntaa Herran vuoreki luota, ja 
Herran liiton arkki vaelsi heidftn 
edellSnsft kolme pftivftkuntaa, kat- 
somaari heille, missft voisivat le- 
vfttft. 

34. Ja Herran pilvi oli heidftn pftftl- 
Iftnsft pftivftllft, kun he leiristfi mat- 
kustivat. 2 Moos. 13:21. 5 Moos. 1:83. 

35. Ja kun arkki Iftksi matkaan, 
sanoi Mooses: ,iHerra, nouse, ettft 



sinun vihollisesi hajoitettaisiin, ja 
ne, jotka sinua vainoovat. pakenisi- 
vat sinun edestftsi!" 

2 Alk. 6:41. Ps. 682. FiB. 132:8. 

36. Ja kun arkki lepfisi, sanoi hftn : 

„palaja, Herra, niiden monen kym- 

menen tuhannen tykO IsraelissaP' 

II Luku. 
Kansan oaplna. 70 vaohinta. Peltokanat 

Ta tapahtui, kun knnsa kSrsimftt- 
•^ tOmyydestft napisi, oli se paha 
Herran korvissa; ja kun Herra sen 
kuuli, syttyi hftnen vihansa, ja Her- 
ran tuli alkoi palaa heidftn seas- 
sansa, joka ftftrimmftiset heidftn lei- 
rissftnsft poltti. 6 Moos. 9:22. Ps. 78:21. 

2. Silloin huusi kansa Mooseksen 
apua ; ja Mooses rukoili Herraa, niin 
tuli asettui. 

3. Ja se paikka nimltettiin Tabeera, 
koska Herran tuli oil syttyhyt hei- 
dftn keskellftnsft. 5 Moos. 9:22. 

4. Mutta se seka kansa, joka heitft 
seurasi, oli syttynyt himoon, ja Is- 
raelin lapset myOs rupesivat itke- 
mftftn, ja sanoivat: „kuka antaa 
meille lihaa syOdftksemme? 

1 Kor. 10:6. 

5. Me muistamme ne kalat, joita 
s6imme maksutta Egyptissft, ja ne 
kurkut ja melonit, ja puurlaukat« 
ja sipulit, ja kynsilaukat, 

6. Mutta nyt meidftn sielumme 
nftftntyvftt, eikft ole ikftnft mitftftn; 
em me saa muuta nfthdfi kuin tfttft 
mannaa.** 

7. Mutta manna oli koriandeiin 
siemencn muotoinen, ja nftOltSftn 
niinkuin bedellion. 2 Moos. 16:14,81. 

Ps. 78:24 SB. Viis. 16:20. Joh.6:31. 

8. Ja kansa juoksi sinne ja tftnne 
kokoamaan sltft, ja jauhoi myllyllft 
tahi survoi rikki huhmaressa ja keitti 
padassa, ja teki itsellensft siitft pais- 
tinkakkuja Ja ne maistoivat niinkuin 
Oljyleivftt. 

9. Ja kun kaste yOllft lankesi lel- 
riin, niin lankesi myOs manna sen 
I^ftftlle. 

10. Ja Mooses kuuli kansan itkevftn 
heidftn sukukunnissansa, iitsekunkin: 
majansa ovella ; ja Herran viha syt- 
tyi suuresti, ja Mooses myOs pani 
sen pahaksi. 

11. Ja Mooses sanoi Herralle : „mik- 
si iliin ahdistat sinun palvelijaasi? 

i'a miksen saa armoa sinun edessftsi, 
[oska panet kaiken tftmftn kansan 
kuorman minun pftftlleni? 

12. Qlenko minft kaiken tftmftn kan- 
san siittftnyt? olenko minft sen syn- 
nyttftnyt? koska sanot minuUe: kan- 



148 



4 MOOS. 11. 



na heitft helmassasi « niinkuin ela- 
lus*isd kantaa imevfin lapsen. siihen 
maahan, jonka valan kautta heidSn 
isillensfi fupasit? 

13. Mists minft olan lihaa kaiketle 
tille kansalle antaakseni? sillft he 
iikevfit minun edessSnI. ja sanovat : 
anna meille lihaa syddaksemnne. 

H. En mina yksinfini vol kaikkea 
tStS kansaa kantaa; siUfi se on mi- 
nuHe yldn raskas. 

15. Ja jos sind niin teet minuile, 
niin lyO minut kohta kuoliaaksi. jos 
minS muuloin olen armon saanut 
sinun edesslisi r ettfi pSfisisin nfik^ 
mflsta tStfl onnettomuuttani.'* 

16. Ja Herra sanoi Moosekselle : 
..kokoa minulle seitsemSnkymmen- . 
Ui miestft Israelin vanhimmista, jot-' 
ka tiedfil vanhimmiksi ja pSftmie- 
hiksi kansan seassa , ja tuo heidftt 
seurakunnan majan oven eteen, ja 
seisokoot siinft sinun kanssasi. 

2 Moos. 18:25 8S. 

17. Ja minft tulen alas, ja puhun 
siellS sinun kanssasi , ja otan siitft 
hengestfi, joka sinun pfiftllftsi on, ja 
annan heille, ettft he ynnfi sinun 
kanssasi kantaisival kansan kuor- 
man.ettel sinft yksinftsi sitAkantaisi. 

2 Moos. 18:25,26. 

18. Ja sano kansalle: ,pyhittftkfiftt 
leitilnne huomeneksi, ja te saatte 
lihaa sy0d5 ; sillft leidUn itkunne on 
tullut Hcrran korviin, ja te sanoi tte : 
kuka antaa meille lihaa syOdftk- 
semme? sillfi hyvin me elimme 
Egypiissft,' ja Herra antaa teille li- 
haa syddfiksenne. 2 Moos. 19:10. 

19. Ja le saatte si til syOdflksenne, 
ei pmvnksi, eikS kahdeksi. eikft vii- 
deksi, eikft kymmeneksi , eikfi kah- 
deksikymmeneksi pfiivdksi, 

20. vaan koko kuukaudeksi , siksi 
konnes se kfiy teidAn sieramislanne 
ulos, ja tulee teille fiilelftksi; sillft 
le olette Herran hyljfinneet, joka on 
leidSn keskellHnne, ja itkitte hftnen 
cd«ssftnsft ja sanoitte:' ,miksi me 
olemmetftnne IShteneet Egyptistfl?'*' 

21. JaMooses sanoi: „tftmi\kansa on 
kuusisataa tuhalta jalkamiestfl , joi- 
denka seassa mini! olen, ja sinft sanot : 
.minSannan heille lihaasyOdftksensfi 
koko kuukaudeksi.* 2Moos: 12:37. 

22. Tapetaaliko lampaat ja karja, 
ettft heille riittnisi? taikka kootaan- 
ko kaikki kalat merestft heille, ettn 
he ravittaisiin ?'' Job. 6:7. 

23. Herra sanoi Moosekselle: „on- 
ko Herran kftsi lilka lyhyt? Nyt olet 
KQ nSkevft, tanahtuuko slixulle mi- 
nun sanani jftlkeen vai eikft.'' 

Je9.60:2. 50:1. 



24. Ja Mooses men! ulos ja puhui 
kansalle Herran sanat,ja kokosiseil- 
semSnkymmentS miestA kansan van- 
himmista, ja asetii heidftt ympftri 
majaa. 

25. Niin tuli Herra alas pllvessfl, 
ja puhui hftnen kanssansa, ja otti 
si its hengestS, joka oli hSnen pSSl- 
IflnsS, ja antoi sen lulla niiden 
seitsemSnkymmenen vanhimpien 
pSSlIe. Ja tapahtui, kun henki las- 
keusi heidSn p&SllensS» nlln he en- 
iiustivat ; vaan sitS eivSt edelleen teh« 
neet. 

26. Mutia kaksl miestS jSi vielS lei- 
rlln, yhden nlmi oli Cldad ja loLsen 
nimi Medad ; niiden pSAUe oli mvds 
henki laskeunut — siUS he kuului- 
vat kirjoitettujen joukkoon, vaik- 
keivSt vielS olleet menneet todistuk- 
sen majalle — , ja he ennustivat lei- 
rissS. 

27. Niin juoksi yksi nuorukaineu 
ja ilmoitti Moosekselle, ja sanoi: 
„EIdad ja Medad ennustavat lei- 
rlssS." 

28. Niin sanoi Josua, Nunin polka, 
Moosek.scn palvelija , jonka hSn oli 
valinnut, ja sanoi^* „minun herran! 
Mooses, kiellS heitS.'' 

29 Mutta Mooses sanoi hSnelle: ,,o- 
letko sinS minun puolestani kilvas? 
Jospa kuikki Herran kansa ennus- 
taisi ja Herra antaisi henkensS tul- 
la heihin!'' 

30. Ja Mooses ja Israelin vanhim- 
mat palasivat leiriin. 

31. Ja tuli tuuli Herralta, ja ajoi 
peltokanat merestS, ja heitti ne lei- 
rin yli, tSSltSpfiin pSivSkunnan mat- 
kan, ja siellSpSin pSivAkunnan niat- 
kan leirin ympSriilS, liki kahta kyy- 
nSrSlA korKialle maan pSSUS. 

2 Moos. 16:13. Ps. 78:2688. 

32. Niin nousi kansa ja kokosi 
peltokanoja koko sen pdivSn, ja 
koko yOn, ja koko toisen pAivSn, 
ja se, joka vSliimmSn kokosi, ko- 
kosi kymmenen homeria; ja he 
levittivSt ne kohta ympSn lei- 
riA. 

33. Liha oli vielS heidSn hammas- 
tcnsa vSlissS, ennenkuin se oli syO- 
ty, syttyi Herran viha kansaan, ja 
Herra lOi heitS sangen suurella sur- 
malla. 4 Moos. 20:3. 5 Moos. 9:22. 

P8.78.-29 88. 

34. Ja se paikka sai nimen : himo- 
haudat; siilS siihen haudattiin hi^ 
moitseva kansa. 4 Moos. 35:16. 

6 Moos. 9*22. 

35. Ja kansa matkusti himohau- 
doilta Hatserotiin; ja he pysShtyi- 
vSt Halserolissa. 4Moos. 83:17. 



149 



4 MOOS. 12. 13. 



12 Luku. 



Mirjam pubuu MoosestA vastaan ja tulee 
spitaliseksi. 

J a Mirjam ja Aaron puhuivat Moo- 
sesta vastaan hfinen etiopialaisen 
vaimonsa. tShden, jonka hftn nainut 
oli: siU3L hdn oli ottanut eliopialai- 
sen naisen vaimokseen. 

2. Ja he sanoivat: Mpuhuuko Ju- 
mala ainoastaan Mooseksen kautta? 
eikd h9n myOs puhu meiddn kaut- 
famme?*' Ja Herra kuuli sen. 

3. Mutta Mooses oli sangen nOyrd 
raies, enemmdn kuin kaikki muut 
ihmiset maan pfiSlld. 

4. Ja Herra sanoi fikisti Moosek- 
selle, Aaronille jaMirjamille: „inen- 
kddt. te kolme, seurakunnan ma- 
jaan." Ja he menivfit sinne, kaikki 
kolme. 

5. Niin Herra tuli alas pilven pat- 
saassa, ja seisoi majan oven e- 
dessd : ja hSn kutsui Aaronin ja Mir- 
jamin, ja he molemmat menivftt 
ulos. 

6. Ja Hftn sanoi: ,,kuulkaat nyt mi- 
nun sanojani! Jos joku on teiddn 
seassanne profetta, niin mind, Her- 
ra. ilmoitan itseni hSnelle n&yssfi, 
ja puhuttelen hdnta unessa. 

7. Vaan niin en tee minun palveli- 
jalleni Moosekselle. H§n on uskol- 
linen koko minun huoneessani. 

Hebr. 3:2,5. 

8. Hdnen kanssansa minfi puhun 
suusta suuhun ja selvSsti, eikd ver- 
tauskuvissa, ja hSn ndkee Herran 
muodon. Miksette siis peljdnneel 
puhua minun palvelijatani Mooses- 
ta VAstaan ?' * .2 Moos. 33:11. 

9. Ja Herran viha syttyi heihin; ja 
hfin meni pois. 

10. Niin pilvi meni pois majan pddl- 
Ifl. Ja katso, Miijamissa oli spitali 
niinkuin lumi: niin Aaron kdflnsi 
itsensdMirjamiln pfiinja katso, hdn 
oli spitalinen. 

11. Silloin sanoi Aaron Moosekselle : 
^,ah herrani! Hlfl pane tStfl syntifi 
meiddn pddllemme; silld me olem- 
me tyhmflsti tehneet, ja syntift teh- 
neet. 

12. Alft anna hfinen tulla kuolleek- 
si, niinkuin siki6, jonka liha on puo- 
leksi mfidSntynyt.'' 

13. Niin Mooses huusi Herran puo- 
leen ja sanoi: „ah Jumala, paran- 
na hSntfl!'* 

14. Ja Herra sanoi Moosekselle: ,Jos 
hfinen isSnsfi olisi hfinen kasvoihin- 
sa sylkenyt , eik6 hfinen olisi pitfi- 
nyt hfipeemfin seitsemfin pAivfifi? 
Aima sulkea hfipel seitsemfiKsi pfii- 



vfiksi leiristfi ulos, ja sitten hfin jftl- 
leen otettakoon sisfiUe.'* 

3 Moos. 13:46. 14:8. 4 Moos. 6:2 88. 

15. ' Niin Mirjam suljettiin seitse- 

mfiksi pfiivfiksi ulos leiristfi, eikfi 

kansa Ifihtenyt matkaan, ennenkoin 

Mirjam otettlin takaisin. 

13 Luka. 

, Kaksitoista vakoojaa.-* 

Cenjfilkeen kansa Ifiksi Hatserotis- 
^ ta ja sijoilti itsensft Paranin kor- 
peen. 

2. Ja Herra puhui Moosekselle, sa- 
noen : 

3. „Lfihetfi miehet edellfisi vakoo- 
maan Kanaanmaata, jonka minfi Is- 
raelin lapsille annan; yksi mies it- 
sekustakin isfinsfi suvusta pitfifi Id- 
hetettfimfin, mutta ,oikoon se joku 
pfifimies heidfin seassansa.*^ 

5 Moos. 1:2288. 

4. Ja Mooses Ifihetti heidfit Paranin 
korvesta Herran sanan jfilkeen ; kaik- 
ki he olivat Israelin lasten pfifimie- 
hifi. 

5. Ja nfimfi ovat heidfin nimensfi: 
Rubenin sukukunnasta , Sammua, 
Sakkurin poika, 

6. Simeonin sukukunnasta, Safat, 
Horin poika, 

7. Juudan sukukunnasta, Kaleb,Je- 
funnen polka, 

8. Isaskarin sukukunnasta,Igeal, Jo- 
sefin poika, 

9. Efraimin sukukunnasta, Hosea, 
Nunin poika, 

10. Benjaminin sukukunnasta, Palti, 
Rafun poika, 

11. Sebulonin sukukunnasta, Gad- 
diel, Sodin poika, 

12. Joseftn sukukunnasta) Manas- 
sesta, Gaddi, Susin poika, 

13. Danin sukukunnasta, Ammiel, 
Gemallin poika, 

14. Asserin sukukunnasta, Setur, 
Mikaelin poika, 

15. Naflaiin sukukunnasta, Nakebi, 
Vofsin poika, 

16t Gaain sukukunnasta, Geuel, l^a- 
kin poika. 

17. Nfimfi ovat niiden miesten ni- 
met, jotka Mooses ifihetti yakoomaan 
maata; ja Hosean, Nuniii pojan, ni- 
mitti Mooses Josuaksi* 

18. Ja Mooses Ifihetti heidfit vakoo- 
maan Kanaanmaata; ja hfin sanoi 
heiile: .,menkfifit etelfi-osaan maata 
ja nouskaat sitteii vuorille, 

19. ja katselkaat maata, millinen se 
on, ja kansaa, jokin siinfi asuu. on- 
ko se vHkevA vai heikko, piei4 ^^ 
suuri, 



)(Q 



4 MOOS. 13. 14 



20. ja millinen maa se on, jossa he 
asuvat, onko se hyvft> vai paha, ja 
minkSkaltaiset kaupungit ovat. jois- 
sa he asuvat, asuvatko he nugoissa 
▼ai linnoissa, 

21. ja millinen maa' on, lihava vai 
laiha, ja onko puita siI19 maalla, vai 
ei. Olkaat hyvassfl turvassa. ja tuo- 
kaatmukananne maan hedelm&std.** 
OH nimiltAin se aika, jolloin ensini- 
mSiset viiniinarjat kypsyivftl. 

22. Ja hemenivHtjavakosivatmaan 
Sinin korvcsta aina Rehobiin asti» 
jonka kaulla Hamatiin mennASn. 

23. He menivilt elelS-osaan maata, 
ja tulivat Hebroniin ; siellfi oil Ahi- 
man, Sesai ja Talmai« Enakin lap- 
set. Ja Hebron oli rakcllu seitseinSn 
ajastaikaa ennenkuin. Soan Egyp- 
tissft. 6 Moos. 9:3. Jos. 14:15. 

24. Ja he tulivat Eskolin laaksoon, 
ja leikkasivat sieltS viinipuun ok- 
san viinimarja-rypdleen kanssa, ja 
kaksi kantoi sitfi korennolla. MyOs- 
kin ottivat he granati-omenia ja fii- 
kunoita. 5 Moos. 1:2488. 

25. Ja se paikka kutsuttiin Eskolin 
laaksoksi, sen vlinimaija-rypftieen 
t3hden, jonka Israelin lapset siitft 
leikkasivat. 

26. Ja he palasivat maata vakoomas- 
ta nelj9nkymmenen pdivftn per&std. 

27. Ja he kftvivat ja^ tulivat Moo- 
seksen ja Aarenin tykd, ja kaiken 
Israelin lasten seurakunnan tykO, 
Paranin korpeen Kadeksessa, ja 11- 
moittivat heille asian ja koko jou- 
koUe, millinen se maa oli, ja osoit- 
tivat heille maan hedelmfit. 

28. Ja he kertoivat hUnelle, ja sa- 
noivat : „me tulimmesiihen maahan, 
johonka meidftt lAhetit, jossa myOs 
rieskaa ja hunajala vuotaa; ja tHm^ 
on sen hedelmfid. 2 Moos. 83*3. 

29. Hutta kansa, joka siinft maassa 
asuu, on vdkcvfi, ja sielld ovat vah- 
vai ja suuret kaupungit ; ja me ndim- 
me sielld myOs Enakin poikia. 

SO.Amalekilaiset asuvat etelA-osassa 
maala, HetilHiset ja Jebusilaiset ja 
Amorllaiset asuvat vuorilla, Kana- 
nealaiset asuvat meren tyk0n5 ja 
Jordanin varsilla." 

31. Mutta Kaleb tyynnytti kansaa 
Mooseksen edess5 , ja sanoi : „kfty- 
k^nune rohkiasti ja omistakaamme 
maa; silia kyllS me sen voitamme.** 

32. Mutta ne miehet, jotka olivat 
sielia hSnen kanssnnsa olleet, sa- 
noival* „emme voi mennsi siia kan- 
saa vastaan: sillA he ovat meit& vA- 
kevammat.*^ 

33. Ja he saattoivat sen maan, jon- 
ka he katselleet olivat, pahaan huu- 



toon Israelin lasten seassa, sanoen: 
„maa, jonka Iftpitse me kSvimme 
vakoomassa sitfi, sy6 asujansa, ja 
kansa, jonka me siellfi nfiimme, o- 
vat varsin pitkifi ihmisifi. 
34. Me nfiimme siellfi myOs hirmui- 
set Enakin pojat, jfittilfiisten sukua; 
ja me olimme omissa silmissftmme 
niinkuin heinfisirkat, ja niin olim- 
me myOs heidfinkin silmissfifin/^ 

14 Luku. 

Eansan napina. Jumalan nhkaus. 
Yakoojain rangaistus. 

Silloin rupesi kokoseurakuntahuu- 
tamaan ja parkumaan, ja kansa 
ilki sen yOsen. 

2. Ja kaikki Israelin lapset napisi- 
vat Mooscsta ja Aaronia vastaan. ja 
koko joukko sanoi heille: ,JosKa 
olisimme kuolleet Egyptin maalla! 
taikka joska tftssfikorvessa olisimme 
kuol leet ! 2 Moos. 16:3. 5 Moos. 1 :26 hs. 

Ps. 106.*^ 88. 

3. Miksi Herra vie meidat tflhfin 
maahan miekalta surmattaviksi, ja 
jossa meidfin vaimomme ja lapsem- 
me joutuvat saaliiksi ! Eikd parempi 
ole, ettfi me palajamme Egyptiin?'* 

4. Ja he sanoivat toinentoisellensa: 
„asettakaamme pfifimies ja palat- 
kaamme Egvptiin!" 

5. Silloin Mooses ia Aaron lankesi- 
vat kasvoillensa koko Israelin lasten 
seurakunnan edessfi. 

6. Ja Josua, Nunin poika, ja Kaleb, 
Jefunnen poika, jotka myds olivat 
oUeet maata vakoomassa, repfisivfit 
vaatteensa, Syr. 46:9. lMakk.2:56. 

7. ja puhuivat Israelin lasten koko 
seurakunnalle, sanoen: „maa, jon- 
ka Ifipitse me olemme vaeltaneet, si- 
tfi vakoaksemme, on hy vin hyvfi maa. 

8. Jos Herralla on hjrvfi suosio mei- 
hin, niin hfin vie meidfit sillc maal- 
le, ja anlaa sen meille; se on maa, 
jossa rieskaa ja hunajala vuotaa. 

9. Ainoastansa filkfifit olko Herraa 
vastaan niskurit; ja filkfifit te peljfit- 
kO tfimfin maan kansaa, sillfi me 
syOmmc hcidfit niinkuin Icipfifi. Hei- 
cffin turvansa on luopunut hcistfi, 
ja Herra on meidfin kanssamme; 
filkfifit peljfitk5 hcitfi.'' 

10. Mutta koko kansun joukko huu- 
si, ettfi hepitikivitettfimfinkuoliaak- 
si. Silloin Herran kunnia nfikyi seu- 
rakunnan majassa kaikille Israelin 

lapsille. 

11. Ja Herra sanoi Moosckselle; 
,,kuinka kauan tfimfi kansa piikkaa 
minua? ja kuinka kauan ne ovat 
minuun uskomatta, kaikista mer- 



151 



4 MOOS. 14. 



keista huolimatta, jolka min9 hei- 
d&n seassansa tehnyl olen? 

12. Mind Ivdn heilS ruttotaudilla, 
ja h&vitdn heiddl; ja mind teen si- 
nun suuremmaksi ja vfikevSmm&k- 
si kansaksi, kuin tfimS on.*' 

2 Moor. 32:1088. 

13. Ja Mooses sanoi Herralle: „toN 
ta EgyptilSiset saavat sen kuulla, 
joiden keskeltS sind olet johdatla- 
nut IdmSn kansan sfnun voimatlasi, 

14. ja ne ovatsanoneet tfimfin maan 
asuvaisille, niin ettft he oval kuul- 
leet, ettd $in5, Herra, olet t5m9n 
kansan seassa , ja etta sinfl , Herra, 
n&hd{l§n kasvoista niin kasvoihin, 
ja etta sinun pilvesi seisoo heiddn 
pddll3nsfi, ja sind kAyt lieidfin edel- 
mnsa pSivSlia pilven patsaassa ja 
yOiia tulen patsaassa. 

2 Moos. 13:2188. 40:38. iKor. 10:1. 

15. Jos sind nyt tapattSmfin kansan, 
niinkuin yhden miehen, niin paka- 
nat, jotka sanoman sinusta ovat 
kuulleet, puhuvat ja sanovat : 

16. ei Herra voinut johdattaa tata 
kansaa siihen maahan, jonka hfin 
heille valalla oli luvannut; sentSh- 
den on h3n heidfit surmannut kor- 
vessa. 5 Moos. 9:28. 

17. Nyt siis enentfikOOn Herra voi> 
mansa, niinkuin sinS puhunut olet, 
sanoen : 

18. Herra on pitkSmielinen ja san- 
gen laupias, Ja antaa anteeksi vfifi- 
ryydet ja rikokset, mutta ei pidft yh- 
tfiSn viallista viatonna, vaan koslaa 
is&in vftfiryydet lapsille kolmanteen 
Ja neljSnteen polveen. 2 Moos. 34:688. 

Pb. 86:15. 103:8. 145:8. 2 Moos. 20:6. 34:7. 

5 Moos. 5:9. 

19. Niin anna anteeksi tSmfin kan- 
san rikos suuren laupcutesi tfihden, 
niinkuin sinfi tSlle kansalle annoit 
anteeksi hamasta EgyptistS Ifihfin 
asli." 

20. Ja Herra sanoi: ^ihfnfi annoin 
sen heille anteeksi, sinun sanasi jdl- 
keen. 

21. Mutta niin totta kuin minft eldn, 
niin koko maailma tfiytelSfln Her- 
ran kunnialla. 

22. Sillft kaikista niistfi miehistfl, 
jotka nftkiv&t minun kunniani ja 
ihmeeni, jotka minfi tein Egyptiss9 
Ja korvessa, ja nyt kymmenen ker- 
taa ov9t minua kiusanneet, eivStkfi 
totelleet minun sanaani : 

23. ei yhdenk99n pid9 n9keni9n si- 
tft maata, jonka min9 heid9n isil- 
lensfi olen valan kautia luvannut, 
eikS yksik99n , joka minua pilkan- 
nut on, saa Sit9 n9hd9. 4 Moos. 26:65. 

5111008,1:8588. Pi. 95:11. 



24. Vaan palvelijani Kalebin, kos- 
ka h9ness9 on toinen henki ja hdn 
uskolfisesti seurasi minua, vien mi- 
Ji9 siihen maahan, jossa h9n nyt 
on k9ynyt; ja h9nen siemenensft 
pit99 sen perim9n. 5 Moos. 135,36. 

Jos. 14:688. 

25. Mutta kun nyt Amalekilaiset ja 
Kananealaiset asuvat laaksoissa, niin 
nalatkaat huomenna ja matkusta- 
kaat korpeen Punaisen meren lietft 
myOten.** 4 Moos. 14:43,45. 

26. Ja Herra puhui Moosekselle J a 
Aaronille, sanoen: 

27. ,,Kuinkakauant9m9pahajouk- 
ko napisee minua vastaan? SillA 
min9 olen kuullut Israelin lasten 
napinan, kun he minua vastaan na- 
pisivat. 

28. Sent9hden sano heille: ,niin 
totta kuin min9 e]9n, sanoo Herra, 
min9 teen teille, niinkuin te minun 
korvaini kuullen puhuitte.* 

29. Teid9n ruumimne kaatuvat tSs- 
s9 korvessa; niin k9y kaikille, joit- 
ten luku laskettiin, kaikille, jotka 
kahdenkymmenen vuotiset ja sitfi 
vanhemmat ovat, Jotka napisitte mi- 
nua vastaan. 4Moo8.32:ll8S. Hebr. 8:17. 

30. Te ette suinkaan lule siihen 
maahan, jonka ylitse min9 k9teiii 
nostin, asettaakseni teid9t siell9 asu- 
maan, paitsi Kalebia, Jefunnen poi- 
kaa, Ja Josuaa, Nunin poikaa. 

4 Moos. 82:12. 

81. Vaan teid9q lapsenne, Jotka te 

sanoitte joutuvan saaliiksi, minft sin- 

ne johdatan, Ja he saavat tuntea sen 

maan, jonka te hylj9sitte. 

32. Mutta te — teidftn kuoUeet ruu- 
miinne j99v9t makaamaan tfihftn 
korpeen, 

33. ja teidftn lapsenne pitfift oleman 
paimenena tftssS korvessa neljftkym- 
ment9 ajastaikaa, kantaen teidfin 
huoruuttanne, siihen asti ettft teidftn 
ruumiinne kuluvat korvessa. 

34. Niiden nelj9nkymmenen pftivft- 
luvun jfilkeen, joina olitte maata 
vakoomassa, pitftft teid9n kantaman 
teid9n pahat tekonne nelJ9kymmen- 
tS ajastaikaa, aina ajastaika luettu 
p9iv9st9, -^ ja te tuiette ymmftrtfi- 
m99n, mitfif se on, kun minft luovun 
teistft. Ps. 95:10. Hes. 4:6. 

35. Minft, Herra, olen sen puhunut, 
sen minft myOs teen kaikelle tftlle 
pahalle Joukolle, Joka on itsensS asett 
tanut minua vastaan; tftssft korves- 
sa he kuluvat; siihen he kuolevat.*' 

36. Ja ne miehet, jotka Mooses oli 
19hett9nyt maata vakoomaan Ja pa- 
latessaan olivat saattaneet kaiken 
kansan napisemaan hftntft vastaan. 



162 



4 MOOS. 14. 15. 



Ja olivat tuottaneet pahan sanoman 
maasta, Juud. v. 5. 

37. ne miehet, jotka toivat pahan 
sanoman maasta, kuolivat Herran 
rangaistuksesta. 

38. Mutta Josua, Nunin poika, ja 
Kaleb, Jefunnen poika, jftivSt eld- 
mSdn kaikista niistfi miehistiS, jotka 
olivat kfiyncet maata vakoomassa. 

39. Ja Mooses puhui kaikki nfimd 
sanat Israelin lapsille. Silloin kansa 
murhehti suuresti. 

40. Ja he nousivat varhalta seuraa- 
vana aamuna ja menivftt vuoren 
kukkulalle, ja sanoivat: ,,katso, tds- 
sS me olemme; ja tahdomme nyt 
IShtea siihen paikkaan, josta Herpa 
on puhunut ; sillft me olemme syn- 
ti§ tehncet." 6Moo8.l:41. 

41. Mntta Mooses sanoi: ,,miksl te 
niin rikotte Hen^tm sanan? el se teU- 
le menesty. 

42. Alk35t menk6, sillft el ole Hei^ 
re teidan kanssanne, etteivftt vl- 
hoUisenne teltfi surmalsl. 

43. Silia Amalekilaiset ja Kananea- 
laiset ovat siellft teltfi vastassa, ia te 
iniekalla surmataan; sillft kunolette 
iise kSftntyneet pois Heirasta , nlln 
ei cAe Herra teldftn kanssanne.** 

44. Mutta he olivat ylimieliset ja 
laksivat vuoristoon; vaan Herran 
Uiton arkki ja Mooses el menneet 
leirista ulos. 

45. Niin tullvat Amalekilaiset ja 
Kananealaiset Jotka vuoristossa asui- 
vat, ja lOivftt heidftt ja hajolttivat 
heidftt hamaan Hormaan astl. 

6 Moos. 1:44. 
15 Luku. 

UbrltfiatOja. Sabbatin rikkoja kivitetftilD. 
Muistotupsut 

Ta Herra puhui Moosekselle» sa- 
" noen: 

2. Puhtt Israelin lapsille ja sano 
neille: kun te tulette siihen maahan, 
jossa teidAn asuman pitflft, jonka 
mind teille annan, 

3. Ja te uhraatte Herralle tuliuhria, 
polttouhria, tahi erikoisen lupauk- 
sen uhria, tahi omasta hyvfista tah- 
Qoita, tahi teidftn iuhlanne uhria, 
tehdSksenne Herralle otollista ha- 
joa kaijasta tahi lampaista : . 

2 Moos. 29:18. 3 Moos. 22:21. 

i niin jokainen, joka Herralle tah- 
too mieluisesti uhrata lahiansa, hfi- 
pen pitftfi tekemSn niokauhriksi 
lymmeneksen hienoja jauhoja , se- 
koitettuja neljftnneksellfi hinnift 61- 
JyS; 8 Moos. 2:1. 1&. 6:14. 

^> ja jnomauhriksi tulee sinun uh- 
f^ neljftnnes hinnift vUnift kuti^" 



kin karitsaa kohden, oil se sitten 
polttouhri tahi teurasuhri. 

6. Mutta kun oinas uhrataan, niin 
pitftfi sinun tekemftn niokauhriksi 
kaksi kymmenestft hienoja jauhoja, 
sekoitettuja kolmanneksella hinnift 
Oljyft; 

7. ja juomauhriksi tulee sinun uh- 
rata viinifi kolmas osa hinnistft ; sen 
sinun pitftft uhraaman Herralle le- 
pytyshajuksi. 

8. Mutta jos sinftuhraathfiijftnpolt- 
touhriksi, tahi erlnomaisen lupauk- 
sen uhril&si, tahi kiitosuhriksf Her- 
ralle, 

9. niin sinun pitfift hfirjftn kanssa 
tekemftn ruokauhriksi kolme kym- 
menestft hienoja jauhoja, sekoitettu- 
na puoleen hinniin Oljyft; 

10. ja juomauhriksi tulee sinun tuo- 
da puoli hinnift viinift ; tftmft on tu- 
liuhri otollisel&si hajuksi Herralle. 

11. Nftin sinun pitftft tekemftn kun- 
kin hftijfin suhteeh, oinaan, lam- 
paan, karitsan ja vohlan suhteen. 

12. Sen luvunjftlkeen,minkft te uh- 
raatte, pitftft teidftn tekemSn kullen« 
kin teuraalle, heidftn lukunsa jftl- 
keen. 

13. Jokainen oma kansalainen nftin 
tehkOOn , uhratessaan tuliuhrinsa 
otoUiseksi hajuksi Herralle. 

14. Ja jos joku muukalainen oleske- 
lee teidftn tyk6nftnne, tahi asuu tei- 
dftn sukujenne kesken,ja tahtooteh- 
dft Herralle tuliuhria otoUiseksi ha- 
juksi, hftn tehk06n niinkuin teteette. 

15. Kokoseurakunnallaolkoonyksi 
sama sftftnt6, sekft Jteillft ettft Aiuu- 
kalaisilla. Ijankaikkinen sfiftnt6 se 
olkoon tulevaisille sukukunnillenne, 
niin ettft Herran edessft muukalai- 
nen on niinkuin tekin. 2 Moos. 12.-49. 

4 Moos. 9:14. 

16. Sama laki ja oikeus olkoon teil- 
1ft ja muukalaisilla, jotka asuvat tei- 
dftn tykOnftnne. 

17. Ja Herra puhui Moosekselle, 
sanoen : 

18. Puhu Israelin lapsille, ja sano 
heille: tultuanne siihen maahan, jo- 
hon minft teidftt johdatan, 

19. ja syOtySnne sen maan leipftft, 
antakaat ylOnnysuhri Herralle. 

6 Moos. 8:10. 

20. Taikinanne alkeista pitftfi teidftn 
antamanyhden kakun unrilahjaksi; 
niinkuin te annatte Herralle lahjan 
riihestftnne, niin pitfift teidftn myds 
tftmfin lahjan tekemftn. 2Moos.23:i9. 

8 Moos. 23:10 ss. 

21. Niin pitfift teidfin siis antaman 
Herralle taikinanne alkeista uhrilah- 
jaksi» suvusta sukuun. 



153 



4 MOOS. 15. 16. 



22 Ja jos (e lietdmlUtS eksytte , ja 
laiminlyOtte tSyttSft nmtfi kSskyja, 
joita Herra Moosekselle on k&skcnyt, 

23. mitd Herra Mooseksen kautta 
saAtanyt on teille. siitH pdivfistfi, jo- 
na hiXn rupesi kftskemd3n,ainaedel- 
leen suvusta sukuun; 

24. jos se tapahtuu seurakunnan 
tietdmdttd, niin pitfi^ koko seura- 
kunnan tekemSn polttouhriksi yh- 
den nuoren hSrj5n kaijasta, otolli* 
seksi hajuksi Herralle, ynnft siihen 
kuXiluvan ruokauhrin jajuomauhrin 
kanssa, lain sddnnOn mukaan, ja yh- 
den kauriin syntiuhriksi. 

8 Moos. 4:1388. 

25. Ja papin pitSS nfiin sovittaman 
koko Israelin lasten seurakunnan, 
ja se heille annelaan anteeksi ; sillS 
se oli erehdystfi. JaheidfinpUfiftkan- 
taman lahjansa luliuhriksi Herralle, 
ja syntiuhHnsa Herran eteen tietft- 
ni8tt6myylens9 tdhden, 

26. niin se annetaan anteeksi koko 
Israelin lasten ioukolle, niin my6s 
muukalaisille, jotka asuvat heial&n 
seassansa; sillft kaikki kansaonsii- 
nfi tieldmfitlOmyydessS. 

27. Mutta kun yksi sielu tietfimSt- 
tansS syntid tekee, tifinen pitfiS tuo- 
man vuosikuntaisen vuohen synti- 
uhri ksi. 3 Moos. 4:27 ss. 

28. Ja |>apin pitdS sen eksyneen sie- 
lun sovittaman, koska hfin tietilmdt- 
t6myydest5 syntiS teki Herran edes- 
s9, ja se annetaan hdnelle anteeksi. 

29. SekS omaisille Israelin lasten 
seassa ettd muukalaisille, jotka hei- 
dfln l{eskelinns§' asuvat, olkoon sa- 
ma laki niille. jotka tietdmftttOmyy- 
desta erehtyvfll. 

30. Mutta JOS joku sielu elkivaltai- 
suudesta jotakin tekee, olkoon se 
omainen tahi muukalainen.hfin pilk- 
kaa Herraa; ja se sielu hflvitettil- 
k06n kansastansa. 

31. Sillfi han on Herran sanan kat- 
sonut ylOn, ja hSnen kdskynsft tyh- 
jfiksi tehnyt: se sielu on perftii hS- 
vitettSvfi ja nSnen syntinsa jfi&k66n 
bfinen pfiftllensS. 

32. Kun Israelin lapset vaelsivat 
korvessa, tapasivat he yhden mie* 
hen, joka puita kokosi sabbatlina. 

93. Ja ne, jotka h&net olivat lOvtfi- 
neet puita hakemasia, johdattivat 
h&net Mooseksen ja Aarnnin eteen, 
ja koko seurakunnan eteen. ' 

34. Ja he panivat hftnet talteesen; 
silU el ollut vielfi pfifitetty, miti hft- 
nelle pit! tehtftmftn. 8 Moos. 24:12. 

35. Mutta Herra sanoi Moosekselle: 
„sen miehen pitfiS totisesti kuole- 
man; kalken Icansan pitftfl hAnet 



kivittSmSn kuoliaaksl ulkona lei- 
ristft.** 

36. Niin koko seurakunta vei hftnet 
ulos leiristft, ja kivitti hftnet kuo- 
liaaksl, niinkuin Herra Moosekselle 
oli kfiskenyt. 

37. Ja Herra puhui Moosekselle, sa- 
noen: 

38. Puhu Israelin lapsille , ja sano 
heille, ettft he ja heidftn jfilkeisensn 
tekisivftt itsellensft tupsuja vaatet- 
tensa liepeisiin, ja panisivat sinlseii 
langan niiden tupsujen pftfiUe hei- 
dftn vaatettensa liepeissiLsMoos. 22:i2. 

Matt 23:6. 

39. Ja ne tupsut olkoot teille mer- 
kiksi, ja nfthaessftnne niitft pitftft tei- 
dftn kaikki Herran kftskyt muista- 
man ja tekemftn niitten mukaan, niin 
ettette tekisi teidftn sydftmmennfe 
ajatuksen jftlkeen, eikft huoHn teki- 
si teidftn silmftlnne himon jftlkeen. 

40. Sentfthden pitftft teidftn muista- 
man ja tekemftn kaikki minun kfts- 
icyni, ja oleman pyhftt teidftn Ju- 
malallenne. 

41. Minft olen Herra, teidftn Juma- 
lanne, joka teidftn Egyptin maalta 
ulos johdatin, ollakseni teidftn Ju- 
malanne; minft olen Herra, teidftn 
Jumalanne. 

16 Luku. 

Eorakin kapina. 

Ta Korak, Jetseharin polka, Joka 
^ oli Kahatin, Levin pojan, polka, 
otti kanssansa Datanin ja Abiramin, 
Eliabin pojat, ja Onin, Peletin po- 
jan, Rubenin suvusta, 4Moo8.26:9. 27:3. 

Syyr. 46:22. Juud. ▼. li. 

2. ja he nouslvat Moosesta vastaan : 
niin myOs Israelin lapsista kakslsa- 
taa ja viisikymmenta miestft ylim- 
mftisistft, seurakunnan kokouksen 
valitsemaa, kuuluisata miestft, 

3. ja he kokoontuivat Moosesta ja 
Aaronia vastaan, ja sanoivat heille : 
„olkoon jo kyllftksi ! sillft koko seu- 
rakunta on pyhft, ja Herra on hei- 
dftn kanssansa, la miksi te kbrotatte 
itsenne Herran kansan yli?** 

4. Kun Mooses sen kuuli, Iftnkesi 
hftn kasvoiUensiu 4 Moos. 14:6. 

5. Ja hfin puhui KoTakille ja koko 
hftnen seurallensa, sanoen: „huo- 
menna Herra ilmolttaa, kuka hftnen 
omansa on, ja kuka pyhft on fa saa 
hftntfl IfthestyS; Jonka nftn yalitsee, 
se saa hftntfl Ifthestyft. 

6. Tehkftftt nftin: ottakaatitsellenitie 
savuastiat, Korak ja koko hftnenseu- 
ransa, 

7. ja pankaat nlihin tulta, Ja heit- 
tftkftftt niihin sUitsutustaKerranede*- 



154 



4 MOOS. 16. 



sil huomenna ; ja se miesjonka Her- 

ra valitsee, olko 

koon se kyllftksi, te Levin poj 



ra valitsee, olkoon pyha. Nyt ol- 

U te Levin pojal.** 
8. Ja Mooses sanoi vielft Korakille : 



„kuulkaat nyt, te Levin pojat! 

9. VflhftkO se teille on, ettfi Israelin 
Jumala on teidftt eroittanut Israelin 
kansasta ja antanut tuUa tyk6nsA, 
ettS viranpalvelusta tekisitten' Her- 
ran tabernaklissa, ja ettft seisoisitte 
seurakunnan edessft,. heitft palvel- 
laksenne? • 

10. H&n on ottannt sinutja kaikki 
sinun veljesi. Levin lapset, tykOnsd; 
ja te pyydStte nytmyOs pappeuttal 

11. Smft ja koko sinun Joukkosi 
nostatte kapinan Herraa vastaan. 
Mika Aaron on, ettd te napise^e 
hania vastaan?" 

12. Ja Mooses U&hetti kufsumaan 
Datania ja Abiramia, Eliabin poikia ; 
mutta he sanoi vat; „emme sinne tule. 

13. Vahak6 se on, ettft sinft olet 
meidat tuoniit maalta, jossa rieskaa 
ja huiuyata vuotaa, tappaaksesi mei- 
dat korvessa, vaan sinft teet itsesi 
▼ieia pftftmieheksi meidftn ylitsem- 
me, ia talidgt hallita meitfi? 

U. Kaaniisti olet sinft meidSt Joh- 
dattanut siihen maahan, jossa ries- 
kaa ja hunajata vuotaa, ja antanut 
ineille pellot ja viinimftet perinnOk- 
si! Tahdotko vielft nftiltS miehiltft 
silmat puhkaista ? Emme tule sinne." 

15. SiUoin vihastui Mooses suuresti, 
ja sanoi Herralle: „ftlft kftftnnft it- 
Kasi lieidftn ruokauhrinsa puoleen ! 
En minft heiltft ottanut aasiakaan, 
enka ole yhdellekftfin heistft patiaa 
tehnyt." l Moos. 4:6. lSam.l2:a 

16. Ja Mooses sanoi Korakille: „si- 
nS ja koko sinun joukkosi olkaat 
hutnnenna Herran edessft, sinft ja 
he, sekft Aaron. 

17. Ja jokainen ottakoon suitsutus- 
astiansa, ja pankoon suitsutusta sii- 
hen, ja tuokoon Herran eteen , ku- 
kin suitsutusastiansa , kaksisataa ia 
viisikyiAmentft suitsutusastiata, niin 
myOs sinft ja Aaron kukin suitsu- 
tnsastianne." 

18. Ja kukin oUi suitsutusastiansa, 
ja pan! siihen tulen, ja heiftivftt sii- 
hen suitsutusta , ja seisoivat seura- 
kunnan majan oven edessft, Mooses 
ja Aaron my5s. 

W.^a-Itorak kokosi heitft vastadn 
koko kansan seurakunnan majan 
oven eteeh. Silloin Herran kunnia 
nakyi kaikelle kansalle. 

20. Ja Herra puhui Moosekselle ja 
Aaronille, sanoen: 

21. „Erotkaat tftstft j6ukosta,'niin 
.minft ftkUti taeidftt hukutan." 



22. Mutta he lankesivatkasvoillensa 
ja sanoivat : „Jumala, kaiken lihan . 
tienkein Jumala! jos yksi mies on 
syntift tehnyt, tahdotko antaa vihasi 
tuUa koko xansan pftftlle?" 

23. Ja Herra puhuf Moosekselle, sa- 
noen: 

24. „Puhu kansalle jasano : paetkaat 
Korakin, Datanin ja Abiramin ma- 
jan ympftrillft." 

25. Ja Mooses nous! ja men! Da- 
tanin ja Abiramin tyk6, ja vanhim- 
mat Israelista seurasivat hftntft, 

26. ja hftn puhui kansalle, sanoen: 
„l>aetkaat naiden jumalattomien ih- 
misten majain ympftriltft, ja ftlkflftt 
koskeko mihinkftftn heidftn omaan- 
sa, ettette my6s hukkuisi kaikissa 
heidftn synneissftnsft !" 

27« Ja he pakenivat Korakin, Data-; 
nih ja Abiramin majan ympftriltft; 
mutta Datan ja Abiram tulivat ulos 
ja seisoivat majaiusa ovella vaimoi- 
nensa, poikinensa ja lapsinensa. 

28. Ja Mooses sanoi : „siitft teidftn 
pitftft tietftmftn Herran minua Ifthet- 
tftneeksi, kaikkia nftitft tOitft teke- 
mftftn,jaettenomasta sydftmmestftni 
sitft tehnyt: 

29. Jos nftmft kuolevat niinkuin 
kaikki ihmiset kuolevat, tahi jos 
heitft rangaistaan, niinkuin kaikkia 
muita ihmisift rangaistaan, niin ei 
Herra ole minua Ifthettftnyt; 

30. mutta jos Herra tftssft jotakin 
uutta tekee, niin ettft maa avaa 
suunsa ja nielee beidftt kaiken kans- 
sa,jnitft heillft on, niin ettft he elft- 
vftnft menevftt helvettiin, niii) tei- 
dftn pitftft siitft tietftmftn, ettft nftmft 
miehet pilkkasivat Herraa." 

"31. Ja tapahtui, kun hftn kaUcki 
nftmft ^anat puhunut dli, halkesi 
maa heidftn altansa, 6Moo8.li:e. 

Ps. 106:17. 

32. ja maa avast suunsa ja nieli 
heidftt,ja heidftn huoneensa,ja kaik- 
ki ne ihmisetvjotka Korakin tykOnft 
olivat, ja kaiken heidftn tavaransa. 

4 Moos. 20:3. 4 Moos. 26:10. Juud.v. 11. 

33. Ja he menivftt elftvftnft helvet- 
tiin, kaikkinensa kuin heillft oli, ja 
maa peitti heidftt, ja he hftvitettiin 
pois seurakunnan keskeltft. 

34. Ja koko Israel, joka heidftn ym- 
pftrillftnsft oli, pakeni heidftn par- 
kunsa tfthden. Sillft he sanoivat: 
„ett'ei maa vaan meitftkin niell- 
si!" 

35. Ja tuli Iftksi Herralta, ja polttl 
ne kaksisataa ja viisikymmentft mies- 
tft, jolka suitsutusta uhrasivat. 

36. Ja Herra puhui Moosekselle,* sa- 
noen: 



155 



4 MOOS. 16. 17. 18. 



37. „Sano Eleasarille, papin Aaronin 
pojaile, eltfi hfin ottaa suitsutasas- 
iiat tulipalostaja heitldft tulen niis- 
td pois; silljl ne ovat pyhSt. 

38. Ja n9m3 savuastiat, — niitten 
miesten, jotka kuolivat syntiensd 
t3hden — ne taottakoon levyiksi ja 
peilettakOdn niillfl alttari; sillfi ne 
ovat olleet Herran eleen tuodut ja 
pyhitetyt. Ja ne pitdfi oleman mer- 
kiksi Israelin lapsille.** 

39. Ja Eleasar, pappi, otti ne vas- 
kiastial, joissa palaneet miehet oli- 
vat uhranneety ja antoi takoa ne 
ohukaisiksi levyiksi alttarin peit- 
teeksi, 

40. Israelin lapsille muistoksi« ettei 
vksikfiSn muukalainen Iflhestyisi, 
joka ei ole Aaronin siemenestS, uh- 
raamaan suitsutusta Herran eteen, 
ettei hdnelle tapahtuisi niinkuin Ko- 
rakille ja hfinen joukollensa « niin- 
kuin Herra oli hftnelle sanonut 
Mooseksen kautta. 

41. Toisena pdivSnfi napisi koko Is- 
raelin lasten joukko Moosesta ja Aa- 
ronia vastaan, ja sanoivat: .,te olette 
fappaneet Herran kansaa." 

42. Ja kun kansa kokoontui Moo- 
sesta ja Aaronia vastaan, ja kan 
he kaSntyivSt seurakunnan mi^aan 
pfiin, katso, pilvi peitti sen ; ja Her- 
ran kunnia nfikyi. 

43. Silloin Mooses ja Aaron astui- 
vat seurakunnan majan eteen. 

44. Ja Herra puliui Moosekselle, sa- 
noen : 

45. ,,Paetkaat tdstS kansasta: sillfi 
minfi surmaan Skisti heidfit.** Sil- 
loin he lankesivat kasvoillensa. 

46. Ja Mooses sanoi Aaronille: .,ota 
suitsutusastia , ja pane tulta siihen 
alttarilta, ja heita suitsutusta sen 
pfiaile, ja mene nopiasti kansan ty- 
ka ja sovita heidfit ; sillft vihan jul- 
muus on Herralta kSynyt ulos, ja 
rangaistus on jo alkanut.** 

47. Ja Aaron otti suitsutusastian, 
niinkuin Mooses hSnelle sanoi, ja 
juoksi kansan keskelle, ja kalso, 
rangaistus oli jo alkanut kansan 
keskellfi ; ja hfin pani suitsutusta ja 
sovitti kansan. 

48. Ja hfin seisoi kuolleitten ja elfl- 
vitten keskellfi; niin rangaistus aset- 
tui. 

49. Mulla niitS, jotka rangaistuksessa 
kuolivat, oli neljfitoista tuhatta ja 
seitsemfin sataa, paitsl niitfi, jotka 
Korakin kapinassa hukkuivat. 

50. J a Aaron palasi Mooseksen ty- 
k6, seurakunnan miOA^ ovelle; ja 
rangaistus asettui. 



17 Luku. 

Aaronin sauva yiberlOitiee. 

J a Herra puhui Moosekselle,sanoen: 
2. „Puhu Israelin lapsille, ja ota« 
heiltfi kaksitoista sauvaa, sauva kul- 
takin isfinsft huoneen ifilkeen, kai- 
kilta, heidfin pfifimiehiltfinsfi heidfin 
isfiinsfi huonekuntain ifilkeen; ja 
kiijoita kunkin nimi nSnen sau- 
vaansa. 

3. ^utta Aaronin nimi kiijoita Le- 
vin sauvaan; sillfi kullakin Isfinsft 
huoneen pSfimiehellfi olkoon yksl 
sauva. 

4. Ja pane ne seurakunnan majaan, 
todistuksen eteen, /jossa minfi olen 
teille saapuvilla. 

5. Ja jonka minfi heistfi valitsen, 
sen sauva pitfifi viheriOitsemfin ; ja 
minfi asetan Israelin lasten moni- 
naisen napinan. joUa he teitfi vas- 
taan napisevat.*^ 

6. Niin Mooses puhui Israelin lap- 
sille, ja kaikki heidfin pfifimiehen- 
sfi antoivat hfinelle kaksitoista sau- 
vaa, itsekukin pfifimies isfinsfi hue- 
neest^ yhden sauvan; ia Aaronin 
sauva oli heidfin sauvainsa seassa. 

7. Ja Mooses pani 'Sauvat Herran 
eteen todistuksen maiaan. 

8. Ja kun Mooses toisena pftivftnft 
meni todistuksen majaan, niin kat- 
so, Aaronin sauva. Levin huoneen 
puolesta, viheriOitsi; se kantoi sil- 
mikoita, puhjenneita kukkasia ja 
kvpsifi manteleita. Hel>r.9:4. 

9. Ja Mooses kantoi kaikki sauvat 
ulos Herran edestfi kaikkein Israe- 
lin lasten eteen; ja he nfikivfit ne, 
ja kukin otti sauvansa. 

10. Ja Herra sanoi Moosekselle: 
«„kanna Aaronin sauva Jfilleen todis- 
tuksen eteen tallella pidettfivfiksi, 
merkiksi niskureille lapsille, ettft 
heidfin napinansa minua vastaanlak- 
kaisi, etteivfit he kuolisi." 

11. Ja Mooses teki sen: niinkuin 
Herra hfinelle kfiskenyt oil, niin hfin 
teki. 

12. Ja Israelin lapset puhuivat Moo- 
sekselle, sanoen : „katso, me olemme 
kuoleman omati me hukumme, 
kaikki me hukumme 1 . 

13. Kukaikfinfilfihestyy Herran ma- 
jaa, se kuolee. Pitfifiko meidfin pe- 
rfiti hukkuman?'* 

18 Luku. 

Pappien Ja Levilftisten tehtftvfttja 
oikeudet. 

J a Herra sanoi Aaronille: slnfl Ja 
sinunpoikasi, jasinun isfisi huone 



156 



4 MOOS. 18. 



sinun kanssasi, kantakaat pyhdkOn 
viat; ja sinfl ja sinun poikasi sinun 
kanssasi, kantakaat teiddn pappeu- 
tenne viat. 

2. Mutta sinun veliesi isdsi Levin 
suvus^ta Ota kanssasi ; heidftn pitftd 
pysym&n sinun tykOnfisi ja palvele- 
maa sinua ; mutta sinS ja poikasi 
sinun kanssasi, palvelkaat todistuli- 
sen majassa. 

3. Ja he pit^OOt huolta sinun var- 
tiostasi, ja koko majan vartiosta; 
81k50t kuitenkaan ISiiestykO pyhifl 
astioita ja altlaria, ettetie sekS he 
elta le kuolisi. 

4. Mutta heidftn pitSfi pysymSn si- 
nun tykOnSsi otlamassa vaarin seu- 
kunnan majan vartiosta kaikessa ma- 
jan palvelulcsessa , eikft yhdenkSdn 
muukalaisen pidft teita latiestymSn. 

5. Niin ottakaat siis vaarin pyhdkOn 
vartiosta ja alttarin vartiosta , ettei 
enfta villa lulisi Israelin lasten pd&Ile. 

6. Ja katso, minft otin teidSn vel- 
jenne, LevilSiset, Israelin lasten seas- 
ta, ja annoin teille lahjaksi, Herran 
omiksi, palvelemaan seurakunnan 
majan palveluksessa. 4 Moos. 3;9, 12, is. 

8:13ss. 

7. Mutta sinft ja sinun poikasi si- 
nun kanssasi, ottakaat teidfin pap- 
peudestanne vaarin, ja palvelkaat 
Kaikissa mita koskee alttaria ja sita 
mitS esiripun sisApuolella on; sillfi 
teidAn pai>peutenhe annan minS teil- 
le lalijaksi. Jos joku muukalainen 
UUiestyy siihen, hftnen pitSS kuole- 
man. 

8. Ja Herra sanoi Aaronille : katso, 
minft annoin sinun haltuusi minun 
ylOnn^uhrini vartion; kaikki mitfi 
Uraelia lapset pyhittSvfit, annoin 
minfl sinulle ja sinun pojillesi osak- 
si, ^ankaikkiseksi oikeudeksi. 

9. Nftmft sinft saat siitft kaikkein 
pyhimmfistft, jota ei polteta : kaikki 
beidSn uhrllahjansa, ynnft niihin 
Ktialuvat ruokauhrinsa, ja kaikki 
keidto syntiuhrinsa, ja kaikki hei- 
oln vikauhnnsa, jotka he minulle 
luitavat, se olkoon sinulle ja sinun 
pojillesi kaikkein pyhin, 

10. ja kaikkein pyhimmfillft sijalla 
pttftft sinun sen syOmftn. Kaikki 
nUehenpuolisyOkOOnsitft; se olkoon 
sinulle pyhft. SMoos. 6:16,18,26. 

11. Minfi annoin vay6s sinulle ja 
sinun pojillesi ja tvttflrillesi sinun 
kanssasi heidftn lahiansa ylOnnys- 
uhrin, kaikissa Israelin lasten haS- 
qrWsuhreissa, ijankaikklseksi oikeu- 
odtti. Jokainen puhdas sinun huo- 
oeessasi syOkOOn sitfl. 8 Moos. 10:15. 

8 Moos. 22:11. 



12. Parhaimman 01J3p ja parhaim- 
man viininesteen, ja jyvftt ia niiden 
uutisen , kuin he antavat Herralle. 
annan minft sinulle. 

13. Ensimmftinen hedelm'ft kaikes- 
ta mitft heidftn maallansa kasvaa, 
jonka he antavat Herralle, pitftft ole* 
man sinun. Jokainen puhdas sinun 
huoneessasi sy5k05n sitft. 

14. Kaikki valallisella lupauksella 
eroitetut Israelissa olkoot sinun. 

3 Moos. 27:28. 

15. Kaikki mikft Sitinsft kohdun 
avaa, kaiken lihan seassa, minkfi 
he kantavat Herralle, olisi se ihmi- 
sistft tahi elftimistft, pitftft oleman 
sinun. Kuitenkin niin, ettft ihmis- 
ten esikoisista otat lunastuksen, ja 
myOs saastaisten elftinten esikoisista 
otat lunastuksen. 2 Moos. 13.2,12. 22:29. 

84:19. 4 Moos. 3:13,46 ss. 

16. Ja kuukautisena pitftft heidftn 
sen lunastaman, ja annettakoon lu- 
nastaa sinun arviosi jftlkeen rahalla, 
viidellftsiklillft,pyhftnsiklinjftlkeen, 
joka on kaksikymmentft geraa. 

2 Moos. 80:13. 3 Moos. 27:6^2^ ^i Moos. 3:47. 

Hes. 45:12. 

17. Mutta esikoisia kaijasta. taikka 
lampaista, taikka vuohista, ei sinun 
pidft antaman lunastaa, sillft ne ovat 
pyhftt; heidftn verensft pitftft sinun 
priiskoittaman alttarille,ja rasvansa 
pitftft sinun polttaman hyvftn hajun 
luleksi Herralle. 8Moos.i:9. 

18. Mutta heidftn lihansa pitftft ole- 
tnan sinun, niinkuin hftftlytysrinta 
ja oikia lapa sinun ovat. 

2 Moos. 29:26. 8 Moos. 7:84. 

19. Kaikki pyhitetyt yl6nnysuhrit, 
jotka Israelin lapset antavat lahjaksi 
Herralle, annan minft sinulle {a si- 
nun pojillesi, ja sinun tvttftrillesi 
sinun kanssasi ijankaikklseksi oi- 
keudeksi. Se on katoomaton ijan* 
kaikkinen liitto Herran edessft si* 
nulle ja sinun siemenellesl sinun 
kanssasi. 

20. Ja Herra sanoi Aaronille : eisi- 
nulla ole perint6ft heidftn maassansa, 
eikft osaa heidftn keskellftnsft; sillft 
minft olen sinun osasi ja sinun pe- 
rintOsi Israelin lasten keskellft. 

6 Moos. 10:9. 18:2. Jos. 13:14. Hes. 44:28. 

21. Mutta katso, Levin lapsille mi- 
nft olen antanut kaikki kymmenek- 
set perinndksi Israelissa, heidftn virr 
kansa tfthden, kun he palvelusta 
seurakunnan majassa tekevftt. . 

22. Sentfthden ftlk6dt tftstftlfthin Is- 
raelin lapset IfthestykO seurakunnan 
niajaa, etteivftt saattaisi syntift pftftl- 
lensft ja kuolisi: 

23. vaan Levilftiset pitftkOOt vaarin 



U7 



4 MOOS 18. 19. 



Seurakunnanmi^an palveluksesta Ja 
he saavat kantaasyntinsd ; se olkoon 
ijankaikkitieQ sSSntd teidSn suku- 
kunnissanne, - ja el heidfln pidS peri- 
mistS saaman Israelin lasten seassa. 

24. Sill5 Israelin lasten kymmenek- 
set Jotka heantavatlahjaksi Herralle, 
olen mind antanut Levildisille perin- 
nOksi ; senlAhdensanoin miiia neille, 
eltei heilhl Israelin lasten seassa pi- 
dfi perintoa oleman. 8 Moos. 27:30. 

6 Moos. 12:12. 

25. Ja Herra puhui Moosekselle, sa- 
noen: 

26. Puhu LeviiAisille ja sano keil- 
le. kun te otatte Israelin lapsilta 
kymmenekset, jotka minft teilfe an- 
na n heiltfi perinnOkseksenne, niin 
tehkaat siita Herralle ylOnnysuhri, 
kymmenes kymmeneksest5. 

27 Ja t^mft teidftn ylOnnysuhrinne 
luetaan teille, niinkuin te antaisitte 
jyvia riihesta ja nestettd kuumasta. 

28. Niin antakaat Herralle ylOnnys* 
uhriksi kaikista teidSn kymmenek- 
sistanne, jotka te Israelin lapsilta 
otatte ; ja tSm&n Herran ylOnnysuh- 
rin niista pitSfl teiddn antaman pa- 
pille Aaronille. 

29. Kaikista saaduista laUoistanne 
antakaat Herralle kaikkinaiset ylOn- 
nysuhrit, kaikista parhaista pyhi- 
tettftvaksi sopivat. 

80. Ja sano neille: kun te parhaan 
silts ylOnnfttte, niin luettakoon se 
Levilaisille niinkuin tulo riihestfi 
ja viinikuumasta. 

31. Ja syOk&St siitS kaikissa pai- 
koissa, te ja teiddn huonekuntanne, 
sillfi se on teidSn palkkanne palve- 
luksestanne seurakunnan majassa. 

82. Kun te parhaimmat ylOnnfttte, 
niin ei teid&n tarvitse synnillft ras- 
kauttaa itse&nne niitten tfihden, 
ettekfi saastuta niitS, jotka Israelin 
lapsetpyhittSneet ovat,ettek& kuole. 

1 9 Luku. 

Ruskian lebm&n verL Puhdistus-vesi. 

J a Herra puhui Moosekselle ja Aa- 
ronille, sanoen. 

2 Tfimfl olkoon teille laki ja sfiSn- 
tO, jonka Herra kflski, sanoen sano 
Israelin lapsille, ettS he tuovat si- 
nun tykOsi nuoren ruskian lehmSn, 
jossa ei yhtftfin virhettft ole, ia joka 
ei vielft ole ikeen alainen ollut. 

8. Ja antakaat se papille Eleasaril- 
le , hftnen pitfifl sen viemftn leiristfi 
ulos sielia teurastettavaksi hfinen 
edessftns&. Rebr. I3:ii. 

4. Ja papin Eleasarin pit&ft otta- 
man sen verestft sormellansa ja 



priiskoittaman sen verta Juuri seura- 
kunnan majaa kohden seitsemftn 
kertaa, 

5. ja antaman poIttaalehmSn edes- 
sfinsfi; sen vuota, lihat, veri ynnS 
sen sonta poltettakoon. 2Moo8.29:i4. 

3 Moo8. 4.11,12. Hebr.9:13. 

6. Ja papin pitfifi ottaman sedri- 

{>uuta ja'isoppia, ja tulipunaista vil- 
aa ja heittfimfin tuleen palaneen 
lehmfin p5fille. 8 Moos. 14:4. 

7 Ja papin pi tsa pesemfin vaatteen- 
sa, ja Kylpemfin vedessfl, ja sitte 
tuleman leiriin; ja pappi olkoon 
saastainen iltaan asti. 

8. Ja se, joka sen poltti, peskOAn 
myOs vaatteensa ja kylpekOOn ve- 
dessS Ja olkoon saastainen iltaan asti. 

9. Japuhdasmieskootkoon lehmfin 
tuhan , ja pankoon sen puhtaaseen 
paikkaanulkopuolellalelrift, tallella 
pidettfivfiksi koko Israelin lasten seu- 
rakunnalle vedeksi. Se onsyntiuhri. 

10. Ja se, joka lehmfln tuhan ko- 
kosi, pitaa pesemftn vaatteensa ja 
oleman saastainen iltaan asti. Tfimft 
olkoon ijankaikkinen ^fiftntO Israe- 
lin lapsille. ja muukalaisille, jotka 
heidfin keskellfinsA asuvat. 

11. Joka koskee johonkuhun kuol- 
leeseen ihmiseen, olkoon saast^iinen 
seitsemfin pAivfifl. 

12. Hanen pitaa sillfi vedellA puh- 
distamanitsensa kolmantena ja seit- 
semantena paivana, ja niin han tu- 
lee puhtaaksi. Ja jollei han puh- 
dista itseansa kolmantena ja seitse- 
mantena paivand , niin ei han tule 
puhtaaksi. 

13. Mutta jos joku koskee kuolleen 
ihmisen ruumiiseen, eika puhdista 
itseansa, han saastuttaa Herran ma- 
jan, ja han on havitettava pois Is- 
raelista. Koska puhdistusvesl ei ole 
priiskoitettu hanen paaUensA, niin 
on han saastainen; hanen saastai- 
suutensa on vieia hanen paailftnsa. 

14. Tama on laki , kun joku ihmi- 
nen telttamajassa kuolee : loka siihen 
majaan menee, ja kaikki mitft ma- 
jassa on, ovat saastaiset seitsemfln 

paivaa. 

15. Ja kaikki avoimet astiat , jotka 
kannettomina ja peittamattfl ovat, 
olkoot saastaiset. 

16. Ja jos joku koskee kedoUa jo- 
honkuhun miekalla lyOtyyn, tahi 
muutoin kuollecseen, tahi ihmisen 
luuhun, taikka hautaan, han olkpon 
saastainen seitseman paivfta. 

17. Ja saastaisen pundistamiseksi 
otettakoon poltetun syntiuhrin tuh- 
kaa ja kaadettakoon sen paaUe juok* 
sevata vetta astiaan. 



158 



4 MOOS. 19. 20. 



IS. Ja puhdas mies ottak6on isop- 

Eia, ja Kaslakoon veteen ja prii&> 
oittakoon sild majan ja senkaiujen 
pSalle ja niitten henkilOjen pdmie, 
Jotka sielld ovat, niin myds hfinen 

{)3iUlensS, joka on koskenut kuol- 
een luuhun tahi (apettuun, tahi 
muutoin kuolleeseen taikka hau- 
taan. 

19. Ja mies, joka on puhdas, priis- 
koittakoon sen saastaisen kolman- 
tena ja seitsemSntenH pSivfinfi, ja 
mhdistakoon hfinet seitsemantenfi 
>aivand ; ja h§n pesk5dn vaatteensa 

, a kylpekCOn vedessd , niin h&n 11- 
aUa tulee puhtaaksi. 

20. Mutta joka saastaiseksi tulee, 
eikll puhdista itsednsfi, hUn on 
h3vitettSvd seurakunnasta, siUfi hfin 
OD saastuttanut Herran pyhfikOn ei- 
ka ole priiskoitettu puhdistusvedel- 
12f sentahden on hlin saastaineh. 

21. Ja tdmd olkoon heille ijankaik- 
kinen sftSntO. Ja joka puhdistus- 
vettS priiskoitU, hSn pesk60n vaat- 
teensa. Ja joka koskee puhdistusve- 
teen, pitsa oleman saastainen lltaan 
asti. 

22. Ja kaikki, johonka saastainen 
koskee, pilfid oleman saastainen, ja 
joka hSneen sattuu, pitaa oleman 
saastainen lltaan astl. 

20 Luku. 

lOrJamin ^olema. Eansa oapisee. Yesi 
kalUosta. Aaronin kuolema. 

Ta Israelin lasten koko seurakunta 
^ tuli Sinin korpeen, ensimmfiisel- 
Ul kuulla; ja kansa viipyi Kadek- 
sessa. Ja Mlijam kuoli sielI9, ja 
sinne myfis haudattiin. 4 Moos. 83:36. 

2. Ja kansalla el oilut vettfi ; ja he 
kokoontuivat Moosesta ja Aaronia 
vastaan. 2 Moos. 17.-288. 

3. Ja kansa riitell Mooseksen kans- 
sajasanoi: ,joska mekin olisimme 
hukkuneet siellH, missfi meiddn vel- 
jemme hukkuivat Herran edessA! 
2M006. 16:288. 4M008.11:188. 16:1 ss. 21:5. 

4. Miksi olette vieneet Herran kan- 
san tShfin korpeen, ettft t3fl!!d kuoli- 
simme, sekfl me ettd meidUn kar- 
jamme. 

5. Ja mlksi te olette johdattaneet 
meidat Egyptistft, 4uodaksenne mei- 
ta tatifin panaan paikkaan,jossaem- 
me taida kylvSn , jossa ei ole fiiku- 
iH)ila, ci viinipuita, ei granatti-ome- 
lua, eikfl vettfiki^an juodaksemme?** 

6. Niin Mooses ja Aaron menivAt 
■Ansan tykOS seurakunnan majan 
oveUe, ja lankesivat kasvoillensa, ja 
Herran kunnla nfikyl heille. 



7. Ja Herra pnhiil Mooseksella, sft- 
noen: 

8. „Ota sauva, ja kokoa kansa, si- 
na ja sinun veljesi Aaron, ja puhu- 
kaatkallioUe heldan silmainsa edes- 
sa, ja se antaa vetensa - ja nain sina 
annat heille vetta kalliosta, ja iuo- 
tat kansan ja heidan kaijansa.*"^ 

Pb. 78:16. 105:41. Vii8.11:4. lKor.lO:4. 

9. Niin otti Mooses sauvan Herran 
edesta, niinkuin han oil kaskenyt. 

10. Ja Mooses ja Aaron kokosivat 
kansan kallion eteen ja sanoivat 
heille: „kuu!kaat nyt, te niskurit; 
pitaakO meidan tasta kalliosta (eille 
vetta saaman?** 5 Moos. 32:5088. 

11. Ja Mooses nosti katensd, ja lOi 
kahdesti sauvallansa kallioon, niin 
juoksi siita paljon vetta, ja kansa 
ja hetdan karjansa saivat juoda. 

2 Moos. 17:6. 5 Moos. 8:15. Jes. 48:21. 

12. Ja Herra sanoi Moosekselle ja 
Aaronille: „koska elte uskoneet mi- 
nuun, pyhittaaksenne minua Israe- 
lin lasten edessa, sentShden ei tei- 
dan pida johdattaman tata joukkoa 
siihen maahan , jonka mina heille 

annan.'* 4M008.27:14. 5M008.1:37. 31:2. 

13. Tama on Riitavesi, jossa Israe- 
lin lapset riitelivat Herran kanssa; 
ja han osoitti itsensa pyhaksi hei- 
dan seassansa. 2 Moos. 17:7. 3iMoo8. 10:3. 

5 Moos. 33:8. Ps. 106:32. Hes. 47:19. 

14. Ja Mooses lahetti r nansaattajat 
Kadeksesta Edomin kuninkaan ty- 
k6, sanoen : „nain sanoo sinun vel- 
jesi Israel: sina tiedat kaiken vai- 
van, mika meiia on kohdannut, 

Tuom. 11:17. 

15. etta meidan isamme menivat 
alas Egyptiin, ja me asuimmeEgyp- 
tissa pitkan ajan, ja Egyptiiaiset 
vaivaslvat meita ja meidan isiam- 
me, 

16. ja me huusimme Herran puo- 
leen, ja han kuul^ meidan aanem- 
me, ja lahetti enkelin, ja vai mei- 
d|lt Egyptista ulos. Ja katso, me 
olemme Kadeksessa, siina kaupun- 
gissa , joka on sinun aarimmaisilia 
rajoiilasi. 2 Moos. 14: 19. 

17. Anna meidan vaeltaa sinun 
maasi lapitse; me emme poikkea 
peltoihin eika viinimakiin, emme 
myOs juo vetta kaivoista; me vael- 
lamme oikiata maantieta, emmeka 
poikkea oikialle eika vasemmalle, 
siksi kuin tulemme sinun rajasi ylit- 
se.** 

18. Mutta Edom vastasl hanelle: 
„et sina saa mfnun kauttani vaeltaa, 
taikka mina kohtaan sinua miekal- 
la.*' 

19. Ja Israelin lapset sanoivat ha- 



159 



4 MOOS. 20. 21. 



neUe : ,,inevaellamtney1ifeist8 maan- 
tietfi, ja jos me ja meidlln kaijam- 
me juovat sinun vedesiasi, niin me 
sen maksamme; emmemuutalahdo 
kuin vaan jalkaisin vaeltaa tUstfi Ifi- 
pitse." 

20. Mutta hfin sanoi: ,,sinA ec saa 
vaeltaa t&stfi Idpitse.** Ja Edomilai- 
set 13ksiv3t heitfi vastaan paljolla 
vfieim ja vdkevSim k&dellfi. 

21. Ja nSin estivSt Edomilaiset Is- 
raelia vaeltamasta maansa fifiren Ifi- 
pilse. Ja Israel kfiSntyi heistft pois. 

22. Ja he Ifiksivfit Hadeksesta; ja 
Israelin lasten koko seurakunta tuli 
Horin vuoren tyk6. 4 Moos. 83:3788. 

23. Ja Herra puhui Moosekselle ja 
Aaronille Horin vuorella, Edomm 
maan rajalla, ja sanoi : 

24. „KokoontUKOon Aaron kansansa 
tykO; sillft ei h&n tule siihen maa- 
han, jonka mind Israelin lapsille 
antanut olen, sillfi te olitte minun 
kSskylleni kovakorvaisetRlitaveden 
tykOnS. 

25. Niin ota siis Aaron ja hftnen 
poikansa Eleasar, ja vie heidfit Ho- 
rin vuorelle. 4 Moos. 27:13. 83:38. 

6 Moos. 32:50. 

26. Ja riisu Aaronin yUfi vaatteet, 

f>ueta ne h&nen poikansaEleasarinyl- 
e ; ja Aaron siellft kootaan ja kuolee." 

27. Ja Mooses teki niin kuin Herra 
hSnen kfisk: ja he astuivat Horin 
vuorelle koko kansan nShden. 

28. Ja Mooses riisui Aaronilta h&- 
nen vaatteensa, ja puki ne hfinen 
poikansa Eleasarin ylle. Ja Aaron 
KuoIisleiI& vuoren kukkulalla; mut- 
ta Mooses ja Eleasar astuivat vuo- 
relta alas. 6 Moos. 10:6. 

29. Ja kun koko seurakunta nllki, 
ettfl Aaron oli kuoUut, itkivfit he 
h&nta kolmekymmentfl pftivftfl. 

21 Luku. 

Aradln kunlngas lyOdftftn. VaskikSrme. Si- 
boa Ja Og voitetaan. 

J a kun Kananealaisten kunlngas, 
loka asui Aradissa, etelfin puo- 
lella, kuuli Israelin tulleeksi, va- 
koojain tietfl myOlen, soti hfin Israe- 
lia vastaan, ja vei heists muutamia 
vangiksi. 4 Moos. 33:40. 

2. Niin I$rael lupasi Herralle lu- 
pauksen« ja sanoi: ,jos sinfi annat 
tfimfin kansan minun kfisiini, niin 
minft kiroon heidSn kaupunkinsa.** 

3. Ja Herra kuuli Israelin rukouk- 
sen, ja antoi heille Kananealaiset, ja 
he kirosivat heidftt ja heiddn kau- 

Sunkinsa. Ja se palkka nimitettiin 
iorma. 



4. Sitte Ifiksivfit he pois Horin vuo- 
ren tykOS, Punaisen meren tieCft, 
vaeltamaan Edomilaisten maan ym- 
pfiri. Ja kansa tuli kfirsimfittOmaksi 
matkalla. 

5. Ja kansa puhui Jumalata jaMoo- 
sesta vastaan: „miksi toit meidSt 
Egyptistfi korpeen kuolemaan? Sillft 
ei tfissfi ole leipfid eikft vettfi, ja mei- 
dfin sieluamme iljettfift tflmfl huono 
ruoka." 4 Moos. 11:1. 

6. Niin Herra Ifihetti kansan sekaan 
tulisia kfirmeita, jotka kansaa pu- 
rivat, niin ettft pa{jo kansaa Israe- 
lista kuoli. lEor.lO:9. 

7. Niin tuli kansa Mooseksen tykO, 
jasanoivat: „me teimme syntifi,Kun 
puhuimme Herraa ja sinua vastaan. 
KukoileHerraa ottamaan pois nftmft 
kflrmeet meidftn seastamme." Ja 
Mooses rukoili kansan edestft. 

8. Niin sanoi Herra Moosekselle: 
,,tee itsellesi kflrme, ja nosta se mer- 
kiksi ylOs; ja tapahtuu, ettfl Joka 
purtu on, kun hftn katsoo siihen, 
niin hfin elflfi." 

9. Ja Mooses tekivaskestakfirmeen, 
ja nosti sen merkiksi yl6s ; ja tapah- 
tui, etta jos joku joutul kfirmeen 
puremaksi, ja katsahti siihen vaski- 
kHrmeesen, niin hftn jfti elftmfiftn. 

2Kun. 18:4. Job. 8:14. 

10. Ja Israelin lapset Ifiksivfit mat- 
kaan, ja sljoittivat itsensfi Obotiin. 

4 Moos. 83:43. 

11. Ja he Ifiksivfit matkaanObotista, 
ja sijoittivat itsensfi Abarimin mfien 
tyk6, siihen korpeen, joka Moabin 
kohdalla on, auringon nousuun pfiin. 

1 Moos. 83:44,47. 

12. Sielta he sitten Ifiksivfit, ja si- 
joittivat itsensfi Saredin ojan tykO. 

13. Sitten he sieltfi Ifiksivfit ulos, ja 
sijoittivat itsensfi tuolle puolen Ar- 
nonia, joka korvessa on, ja tulee 
Amorilaisten maan fiSristfi; stllfi Ar- 
non on Moabin maan n^a, Moabin 
ja Amorilaisten vfilillfi. Tuom.ii:i8. 

14. Siitfi sanotaan „Herran sotain 
kiijassa**: „Vaheb Sufkssa ja Amo- 
nin ojat; 

15. ja sen ojan juoksu, joka. poik- 
keaa Arin asuntoon pfiin ja ulottuu 
Moabin rajaan.'* 

16. Ja sieltfivaelsivatheBeeriin.se 
on se kaivo, iosta Herra sanoi Moo- 
sekselle : „koKoa kansa, ja minft an- 
nan heille vettfi." 

17. Silloin veisasi Israel tftmfin vir- 
ren: „nouse, kaivo, veisatkaat hA- 
nestfi toinen toisellennel 

18. Tfimfi on se kaivo, jonka pfifi- 
miehet kaivoivat, ylimmfiiset ko- 
versivat valtikalla, sauvoiUansa.**-* 



lea 



4 MOOS. 21. 22. 



Tlst§ korvesta malkusHvat he Mat- 
ttniuin, 

19. Ja Mattanasta Nahalieliin, ja 
Nahalielisia Bamotiin, 

20. ja Bamotista siihen laaksoon, 
[oka on Moabin kedolla, Pisgan kuk- 
kalata kohden, Joka katsahtaa kor- 
peen p9fir. 

21. Ja Israel lAhetti sanansaatt^Jat 
Sihonin.Amoiilaisten kuninkaanty- 
kO. ja kfiski sanoa hfinelle : 

5 Moos. 2:26 88. Tuom. 11: 19 88. 

22. ^Salli minunvaeltaasinunmaa- 
kontasi ISpUse; emme poikkea pel- 
toihin, emmekfl viinimfikiin^einme- 
kS myOs juo vettfi kaivoista ; maan- 
tieta myOten me vaellamme, siksi 
kuin me tulemme slnunmaasififtris- 
tt ulos." 

23. Mutta Sihon ei sallinut Isitelin 
vaeltaa maakuntansa Iftpitse; vaan 
Sihon kokosi kaiken vflkensd Ja me* 
Di Isreelia vastaan korpeen. Ja hfin 
taliJaksaan, ja soti Israelia vastaan. 

24. Mutta Israel 101 hSnet miekan 
lerUlfi, ja valloitti hfinen maansa 
Araonista Jabbokiin asti, ja Ammo- 
nia lapsiin saakka; siUfi Ammonia 
naan aftret olivat vahvat. 
^11006.2:33. 20:7. Fa. 135:1088. Pb. 136:1888. 

Am. 2:9. 

25. Ja nftin Israel sal kaikki nfimd 
kaupunsit, ja Israel- asui kaiklssa 
Amorilaisten kaupungeissa, Hesbo- 
nissa ia kaiklssa sen tytthrlssfi. 

26. Sills Hesbonin kaupunki oil Si- 
honin.Amorilaisten kuninkaan,oma, 
jt hfin oli ennen sotinut Moabllais- 
[en kuninkaan kanssa, ja ottanut 
hfineltfi kaiken hfinen maansa Ar- 
noniin asti. 

27. Siitasanovafrunoflijat: ,,tulkaat 
Hesbonlin , rakentamann ja valmls- 
umaan Sihonin kaupunki! 

^ Sillfi tuli on kfiynyt Hesbonista 
Qlos« ja liekki Sihonin kaupungista ; 
^ on kuluttanut Moabin Arin , ja 
Amonin kukkuloitten asuvaiset. 

Jer. 48:45,46. 

29. Voi sinua Moab! sinfi Kamosin 
kansa olet hukkunut! Hfinen poi- 
kansa saatettiin pakolaiseksi ja tyt- 
nrensfi vangiksi Sihonille, Amori- 
l|ulen kuninkaalle. i Kud. 11:7,33. 

30. Me olemme heilfi ampuneet, 
Hesbon on kukistettu Diboniin asti : 
J^ h&vitimme heilfi hamaan No- 
w« ioka Medebaan ulottuu.** 

31* Niin Israel asul Amorilaisten 

S-Ja Mooses Ifihetti vakoomaan 
J«eicria; ja he volttivat sen tyltfiri- 
5Jttft. ja ajoivat pois nc Amorilaf- 
*^ Jotka siinft asuivat 



33. Sitten he kfifintyivfit toisaanne 

ia menivfit ylOs Basaniin. Niin Og, 
)as;anin kuningas, Ifiksi heilfi vas- 
taan, hfin Ja kaikki hfinen vfikensfi, 
sotimaan Edreissfi. 6Mooe.i'.4. 8:188. 

29:7. 

34. Mutta Herra sanoi Moosekselle: 
„filfi pelkfifi hfintfi, sillfi minfi olen 
antanut hfinet sinun kfisiisi, sekfi 
kaiken hfinen vfikensfi, ettfi hfinen 
maansa: ja sinun pitfifi tekemfin hfi- 
nelle niinkuin sinfi Sihonille, Amo- 
rilaisten kuninkaalle, teit, joka Hes- 
bonissa asui.'' P8. 135:10,11. 

35. Ja he lOivfit hfinet ja hfinen 
poikansa ja hfinen vfikensfi, siksi 
ettei yksikfifin elfimfifin jfifinyt, ja 
he omistlvat hfinen maansa. 

6 Moos. 8:8. 81:4. 

22 Luku. 

Balak ja Blleam. 

Sitten Ifiksivfit IsraeHn lapse! siel- 
tfi, ja siioittivat itsensfi Moabin 
kedoille, toiselle puolelle Jordania, 
Jerikon kohdalle. 
2. Ja Balak, Sipporin poika, nfiki 
kaikki, mi tfi Israel teki Amorilaisille. 
* 3. Ja Moabilaiset suuresti pelkfisi- 
vfit sitfi kansaa heidfin paljoutensa 
tfihden ; ia Moabilaiset kauhlstuivat 
Israelin lapsia. 

4. Niin he sanoivat Midianilaisten 
vanhimmille:„tfimfi kansa syO puh- 
taaksi kail^^ii. mttfi meidfin ympfi- 
ristOlIfimmeon, niinkuin hfirkasyOs- 
kelee vihannon laitumelta.'* Ja Ba- 
lak, Sipporin poika, oli siihen ai- 
kaan Moabilaisten kuningas. 

5. Ja hfin Ifihetti sanan Bileamille, 
Beorin pojalle, Peloriin, virran ty- 
kOnS, hfinen kansansa lasten maa- 
han, kutsumaan hflntfi, sanoen : „kat- 
so, kansa on Ifihtenyt JBgyptistfi, kat- 
so, se peittfifi maan piinn, ja aset- 
taa leirinsfi minua vastaan. 

6 Moos. 23:4. Jo8. 13:22. 24:9. Mik.6:5. 

6. Tule siis nvt ja kiroo minulle 
tfimfi kansa, sillfi se on minua vfike- 
vfimpi : ehkfi minfi voin lyOdfi hfinet 
ja karkoittaa pois maaftani; sillfi 
minfi tiedfin, ketfi sinfi siunaat, se 
on siunattu, ja jota sinfi kiroot, se 
on kirotlu.** 

7. Ja Moabilaisten vanhimmat yn- 
nfi Midianilaisten vanhimpien kans- 
sa menWfit sinne , ja heillfi oli noi- 
tumisen palkka kfldessfinsfi. Ja kun 
he tulivQt Bileamin tykO, sanoivat 
he hfinelle Balakin sanat. 2Piet.2:i5. 

Juud.v. 11. 

8. Ja hfin sanoi heille: „jfifikfifit 
tfinne yOksi, niin minfi sanon leille 
vastauksen, mitfi Herra minulle on 



IffaaiA] f 



161 



4 MOOS. 22. 



sanovM.*' J a Moabilaisten pfidmiehet 
jfiivftt Bileamin luo. 

9. Ja Jumala tuli Bileamin tyk6, 
ja sanoi : ,,initkfl miehet ne sinun 
tyk6nfisi oval?** 

10. Ja Bileam vastasi Jumalalle: 
^,Balak, Sipporin poika, Moabilaisten 
Kuningas, Ifihettf minulie sanan: 

11. *Katso, kansa ISksi EgyptistA ja 
peittfifi maan piirin ; tule siis ja ki- 
roa heid&t minulle, ettfl minfl voisin 
sotia heita vastaan ja karkoittaisin 
heidfit pois.** 

12. Mutta Jumala sanoi Bileamille: 
„A1& mene heidSn kanssansa, filil 
m^Os kiroa kansaa^ sillft se on siu- 
nallu.*' 

13. Silloin Bileam nousi varhain 
aamulla, ja sanoi Balakin p3dmie- 
hille: '.,menkdfit teidfin maallenne; 
sillS ei Herra salli minun Idhtefi 
teidSn kanssanne.** 

14. Ja Moabilaisten pfifimiehet hou- 
sivat ja tulivat Balakin lykO, ja .sa- 
noivat : ^ei Bileam tahdo luUa mei- 
dUn kanssamme.** 

15. Mutta Balak I&hetti vfeia paS- 
miehiS, useampia ja arvokkaampia 
kuin entiset. 

16. Ja he tulivat Bileamin tykO ja 
sanoivat hfinelle: „nSinsanoo Balak, 
Sipporin poika, sinulle: ,aia estele 
tulemasta minun tyk5ni; 

17. silia mina teen sinulle suuren 
kunnian, ja mita sanot minullc, sen 
mina myOs teen ; tule siis ja kiroa 
minulle tama kansa.** 

18. Niin vastasi Bileam\ Jd sanoi 
Balakin palvelijoille: ,^os Balak an- 
taisi minulle hiioneensa tayden ho- 
piata ja kultaa, niin en mina sitten- 
kaan taida Herran, minun Jumala- 
ni, sanasta luopua, niin etta tekisin 
si ta vastaan, oli se vaiidn tahi pal- 
jon. 4 Moos. 24:13. 

19. Vaan olkaat kuitehkin taaiia 
yOta tekin, niin mina tahdon tiediis- 
taa, mita Herra vieia minim kans- 
sani puhuva on,** 

20. silloin Jumala tuli yOlia Bilea- 
min lyk6 ja sanoi hanelje: ,jos ne 
miehet ovat tulleet kutsumaan sinua, 
niin nouse ja mene heidan kanssan- 
sa, vaan ainoastaan sita pitaa sinun 
tekeman, mita mina sinulle sanon.** 

21. Niiii Bileam' nousi varhain aa- 
mulla, satuloitsi aasinsa» ja seurasi 
Moabilaisten paamiehia. 

22. Mutta Jumalan viha syttyi, sen- 
tahden etta hdn sinnd meni. ja Her- 
ran enkeli seisoi tielia hanta vas- 
tnssa. kun hdn i^oi tiasillansa, ja 
kakst hanen palvelijatansa oil ha- 
heii kanssunsa. ' 



23. Ja aasi naki Herran enkelin sel- 
sovan tielia, paljastettu miekka k2\- 
dessd, ja aasi poikkesi tielta ja meni 
kedolle; vaan Bileam lOi aasia oh- 
jataksensa hanta tielle. 

24. Niin Herran enkeli asettui ah- 
taaseen kuiaan, viinimakien vaiil- 
la, jossaaidatolivatmolemminpuo- 
lin. 

25. Ja kun aasi naki Herran enke- 
lin, painui han aitaa vasten, ja- 11- 
kisti Bileamin jalan aitaa vastaan; 
ja han lOi sita kovemmln. 

26. Silloin Herran enkeli meni vie- 
ia eteenpain, ja asettui ahtaasen 
paikkaan , jossa ei ollut varaa poi- 
tceta oikialle eika vasemmalle puo- 
lelle. 

27. Ja kun aasi hakl Herran enke- 
lin, laski han Bileamin alle polvil- 
lensa; ja Bileam suuresti vihastui, 
ja lOi aasia sauvallansa. 

2S. Silloin Herra avasi aasin suun, 
ja se sanoi Bileamille: „mita minS 
olen rikkonut sinua vastaan, kun 
minua kolmasti olet IvOnyt?** 

29. Bileam sanoi aasille : „siHa pilk- 
kasit minua. Joska kadessani olisi 
miekka, niin tappaisin sinun.** 

30. Silloin sanoi aasi Bileamille: 
„enk6 mina ole sinun aasisi, jolla 
sina tahan asti olet ajanut? olenko 
mina koskaan ennen niin tehnyt si- 
nua vastaan?'.* Han vastasi: „et.** 

31. Silloin avasi Herra Bileamin sil- 
mat, niin etta han naki Herran en^- 
kelin seisovan tielia, ja paljastetun 
miekan hanen kadessansa; ja han 
kumarsl Itsensa, ja lankesi kasvoil- 
leiisa. 

32. Ja Herran enkeli sanoi hanelle : 
.,miksi sina jo kolmasti olet aasiasi 
ly6nyt? katso, mina laksin sinua es- 
tamaan ; silia tama tie on nuija mi- 
nun edessani. 

33. Ja aasi naki minut, ja on jo kol- 
me kertaa vaistynyt minun edestani; 
vaan jollei han olisi minun edestani 
vSistynvt, niin mina nyt sinut tap- 
paisin Ja jattaisin aasin eiamaan.'* 

34. Nim Bileam sanoi Herran en- 
kelille: „mina olen syntia tehnyt; 
silia en mina tiennyt, etta sina sei- 
soit vastassani tielia. Nyt siis, jollei 
se sinulle kelpaa; niin paligan mi- 
na takalsin.** 

35. Ja Herran enkeli sanoi Bilea- 
mille : ,,mene niiden miesten kans- 
sa, vaan aia puhu mitaan muuta 

kuin mina $inullesanon.**Ja Bileam 
seurasi Balakin paamiehia. 

36. Kun Balak kuuli Bileamin tu-' 
Icvan, laksi han hanta vastaan Moa- 
bilaisten kaupupkiin Amonin ra- 



162 



4 MOOS. 22. 23. 



joilla, JQika ftdrimmfiisellft rajalla 
virtaa. 

37. JaBalak sanoi Bileamille : „en- 
kO minfi sanaa IShetlUnyt sinun pe- 
riSsi kutsumaan sinua? miksi siis 
el tullut minun lykfini? vai luulil- 
Kos, etten mind voisi kunniata si- 
nulle osoiltaa?'* 

38. Bileam vastasi hllnelle: ,,katso, 
mini tulin nyl sinun tykOsi; vaan 
onko minulla voimaa mitSAn pu- 
hua? MinkA Jumala minun suuhu- 
ni antaa, sen minfl puhun.*' 

39. Ja Bileam meni Balakin kans- 
sa, ja he tulivat kuja-kaupunkiin. 

^. Ja Balak uhrasi karjaa ja 1am- 
paita, ja Ifihetti siim Bileamille ja 
pd3miehille, jotka hAnen kanssansa 
olivat. * 

41. Mutta huomeneltain tapahtui, 
elia Balak otti Bileamin, ja vei hfl- 
net Baalin kukkulalle, ja hfin nflki 
sieltS ftSrimmAiset kansasta. 

23 Luku. 

Balak ahraa. Bileam siunaa. 

(a Bileam sanoi Balakille: ,,raken- 
^ na minulle tiihAn seitsemfin alt- 
(aria, ja valmista mintille tassa 
seitsemSn hArkda, ja seitsemSn oi- 
nasla.** 

2. Balak teki niinkuin Bileam sa- 
noi. ja Balak ja Bileam uhrasivat 
KUllakin alttarilla hdrjan ja oinaan. 

3. Ja Bileam sanoi Balakille: , .sei- 
se polttouhrisi tykdnA. ja minS me- 
nentuonne; kenties Herra tulee mi- 
nnakohtaaniaan. ja miia hfln mi- 
noUe tietaar antaa, sen minfi tahdon 
«nuUc ilmoillaa." Ja hfin meni pois 
auhoUe kukkulalle. 

i Ja Jumala kohtasi Bileamin; 
mutla hSn sanoi Hfinelle: ,«seitse- 
nan alttaria minft valmistin. ja olen 
uhrannut hArjan ja oinaan joka all- 
willa." 

S- Ja Herra pani Bileamin suuKun 
»nal, ja sanoi : ..palaja Balakin ly- 
W. ja puhu nain.** 

6. Ja kun han lull jaileen hanen 
(ykdiisa, katso, niin han seisoi poU- 
touhrinsa tykOnd, kaikkein Moabin 
IwUesten kanssa. 

7. Niin alkoi hdn puheensa, ja sa- 
oo>: ^Syyriasta on Balak« Moabilais- 
<m kimingas, minut tuottanut, idan 
puolisilta vuorilta: ,tule ja kiroo 
■nmuUe Jaakob, tule, sadattele Is- 

yuf.* SMoo«.23:4ss. 

.«• Kuinka saatan mind kirota sita. 
jolt ei Jumalakaan kiroo? kuinka 
ouoa siia sadattelen. jota ei Herra- 
■Mui sadattele? 



9. Silia vuorten kukkuloilta minft 
hanet naen, ja korkeuksista min& 
hanta katselen. Katso, se kansa on 
asuva yksinansa, eika sita pakanaln 
sekaan lueta. 

10. Kuka lukee Jaakobin tomun, ja 
neljadnen osan Israelin lapsistd? 
Minun sieluni kuolkoon vanhurs- 
kasten kuolemalla, ja minun lop- 
puni olkoon niinkuin heidan lop- 
punsa.** 1 Moos. 13:16. 28:14. 

11. Silloin sanoi Balak Bileamille: 
„mita minun teet? Mina tuotin si- 
nut kiroamaari vihollisiani. ja katso, 
sina taydellisesti siunaat heita.'^ 

12. Han vastasi, ja sanoi: ,.eikO mi- 
nun pitaisi vaarin ottaa ja sita pi- 
taman ja puhuman. mita Herra mi- 
nun suuhuni antaa?'* 

13. Ja Balak sanoi hdnelle: „tule 
minun kanssani toiseen paikkaan» 
josta hanet saat nahda. Ainoastaan 
hanen aarimmaisensa sina taidat 
nahda, vaan et nae kaikkia; kiroa 
han minulle sielta.'* 

14. Ja han vei hanet vartijain-la- 
keudelle, Fisgan kukkulalle, ja ra- 
kensi settseman alttaria, ja uhrasi 
joka alttarilla harjdn ja oinaan. 

15. Ja han sanoi Balakille: „seiso 
tassa polttouhrisi tykdna. ja mina 
tahdon kohdata Hdnta tuolla.** 

16. Ja Herra tuli Bileamia vastaan, 
ja pani hanelle sanat suuhun, ja sa- 
noi: „mene jaileen Balakin tykO, ja 
sano nain.'* 4Moos. 22:3&. 

17. Ja kun han tuli hanen tykOnsa 
jaileen, katso, han seisoi polttouh- 
rinsa tykOna Moabin paamiesten 
kanssa. JaBalak sanoi hanelle: t^mU 
ta Herra sanoi?** 

18. Ja han alkoi puheensa, ja sa- 
noi : „nouse, Balak, ja kuule, kuun- 
tele minua, Sipporin poika! 

19. Ei ole Jumala inminen, etta 
han valhettelisi, taikka ihmisen lap- 
si, ettd iian jotakin katuisi. Sanoisi' 
ko han jotakin eika tekisi? Puhuisi- 
ko han jotakin, eika tayttaisi? 

1 Sam. 15:29. 

20. Katso, siunaamaan olen mina 
kasketty; Hdn myds siunasi, enka 
mina taida sita muuttaa. 

21. Ei nahda vaaryytta Jaakobissa, 
eika havaita pahuutta Israelissa. Her- 
ra, hanen Jumalansa, on hanen ty- 
kdndnsa, ja kuninkaan pasuna kuu- 
luu hanen keskeliansa. 

22. Jumala on hanen johdattanut 
ulos Egyptista; hanen vakevyyten- 
sa on niinkuin villiharjan. 

4 Moos. 24:8. 5M0O8. 33:17. 

23. Silia ei ole yhtaan velhoutta 
Jnnkobia vastaan, eika auta noituus 



163 



4 MOOS. 23. 24. 



Israelia vastaau; nyt pitdd sanotta- 
man Jaakobisia ja Israelista, mitd 
.lumala tehnyt on. 

24. Katso,se kansa on nouseva niin- 
kuin s}[5m!)ri jalopeUra, ja karkaava 
niinkuin tarkka jalopcura; eikd hdn 
Inskeudu levolle, ennenkuin li5n on 
saaliin syOnyt, ja juonut lapellujen 
vcren." 

23. Silloin sanoi Balak Bilenmillc: 
,.ellet tahdo kirota hcU5« niin 015 
siunnaknnn heitil.*' 

2G. Mutta Bileam vastasi ja sanoi 
Halakille: „enkd minA puhunut si- 
nulle, ianoen: kaikki« niit5 Herra 
sanoo, ISylyy minun lelidS?** 

27. Ja Balalc sanoi Bileaniille: ,,tu- 
le, mina vien sinut (oiseen paikkaan ; 
elika Jumalalle kelpaa, etta liunet 
sieltil kiroaisit minulle.'* 

28. Ja Balak vei Bileamin Peorin 
vuoren kukkulalle, joka korpeen 
pHin on. 

29. Ja Bileam sanoi Balakille: „ra- 
kenna tdh5n minulle seilseman alt- 
taria, ja valmista minulle lilssS seil- 
semSn hArkdd, ja seilsemSn oinas- 
la.'* 

30. Balak teki niinkuin Bileam sa- 
noi, ja uhrasi kullakin alUarilla hilr- 
Jan ja oinaan. 

24 Luku. 

Biieani vielft siunaa Isruelia ja paiajaa 
kotiansa. 

Kun Bileam ndki kelpaavan Her- 
ralle, eiitk ht^n siunasi Israelia, 
ei hSn mennyl pois, niinkuinennen, 
elsimaAn iinioitusta, vaan kUHnsi 
kasvonsa korpeen pi\in. 

4 Moos. 23:3,15. 

2. Ja Bileam nosti silm5ns5 ja nd- 
ki Israelin sijoittuneena sukukunnit- 
tain; ja Jumalan henki tuii hdnen 

^pdailensA. 

3. Ja hAn alkoi puheensa, ja sanoi: 
..ni^ila sanoo Bileam, Beorin poika, 
nAitii sanoo mies, jonka silmAt ava- 
lul oval. 4 Moos. 23:7, 18. 

4. Nditii sanoo hHn, joka kuulee 
Jumalan puheet, joka kaikkivaltiaan 
nHyt ndkee, joka lankeaa maahan, 
ja hiinen silmdnsfi avataan: 

5. Kuinka kauniit ovat sinun ma- 
jasi, Jaakob, ja sinun asumasi, Is- 
rael! 

6. Niinkuin joel he leviavSt, niin- 
kuin yrttitarha virran vieressS. niin- 
kuin aloepuut, jotka Herra istuttaa, 
niinkuin sedripuut veden (ykOnd. 

7. Vesi vuotaa h5nen ampftrisinn- 
sS, ja hanen siemenensa on paijois- 
sa vesissA. Hfinen kuninkaansa on 



oleva korkiam )i Agagia , ja hfiuen 
valtakuntansa korotetaan. 

8. Jumala johdatti hanet Egyptistfi, 
hanen vakevyytensa on niinkuin yk- 
sisarvisen vakevyys ; han nielee pa- 
kanat,vihollisensa,ja murentaa hei- 
dan luunsa, ja nuolillansa ampuu 
la vi tse. 4 Moos. 23:22. 

9. Han panee maata niinkuin tark- 
ka jalopeura ja niinkuin syOmari 
jalopeura; kuka tohtii herattaa hfin- 
ta? Siunattu olkoon se, joka sinua 
siunaa, kiroUu olkoon se, joka si- 
nua kiroo.'* 1 Moos, 49:9. 12:3. 

4 Moos. 23-24. 

10. Silloin Balak suuresti vihastui 
Bileamiin, ja han Idi kasiansd yh- 
teen, ja sanoi hanelle: ,,mina kut- 
suin sinut kiroamaan vihollisiani, 
ja katso, sina jo kolmasti taydelli- 
sesti siunasit heita. 

11. Fakene nytkotihisi! Mind ajal- 
teiin kunnioittaa sinua suuresti, ja 
katso, Herra on sen kunniaii esta- 
nyt sinulta.'* 

12. Ja Bileam sanoi Balakille: ,,en- 
k5 mina puhunut sanansaattajillesi, 
jotka sina lahetit minun tykOni, sa- 
noen: 

13. ,Jos Balak antaisi minulle huo- 
neensa tayden hopiata ja kultaa, en 

j mina sittenkaan voi Herran sanasta 
! luopua, tekemaan hyvaa tahi pahaa 
ininun mieleni jaikeen' ; vaan mita 
Herra sanoo, sen minakin sanon. 

4 Moos. 22:18. 

14. Ja katso, nyt mina lahden kan- 
sani tykd. Tule, mina ilmoitan si- 
nulle, mita tama kansa sinun kan- 
sallesi viimeiselia ajalla*tekeva on.** 

15. Ja han korotti aanensa, Ja sa- 
noi: „nain sanoo Bileam, Beorin 
poika, nain sanoo se mies, jonka 
silmat avatut ovat. 

16. Sen sanoo han, joka kuulee Ju- 
malan puheet, jolla ylimmflisen tie- 
to on, joka nakee kaikkivaltiaan 
niVyt, joka lankeaa maahan, Ja ha- 
nen silmansa avataan: 

17. Mina nain hanen, mutta en nyt. 
mina kalselen hanta, vaan en lAhel- 
la. Tahti nousee Jaakobista, ja val- 
tikka tulec Israelista, ja niusertaa 
Moabin aaret, ja havittaa kaikki so- 
tametelin lapset. Malt.2:2. 2SaiD.8:2. 

18. Han valloittaa Edomin, Ja Seir 
tulee vihollistensa vallan alle; ja Is- 
rael tekee voimallisia tCitft. 

2 Sam. 8:14. 

19. Jaakobista tulee hallilsija, ja 
havittaa jaannOksel kaupungeista.*' 

20. Ja kun hdn naki Amalekilaiset. 
korotti han aanensa, ja sanoi: „Ama- 
lek on ensimmainen pakanain seas- 



164 



4 MOOS. 24. 25. 26. 



sa, vaan viimeiseltft Jouluu hSn pe- 
rikatoon.** 2 Mom. 17:a ISam. 15:7. 

21. Ja kun hSn nfiki Kenildiset, ko- 
rotti hiln 2ISnens9, ja sanoi : «,sinun 
asuntosi on vahva, ja sin5 teit pe- 
sSsi kallioon. 

21Mutla havitys odottaa Kainia; 
ja Assur vie sinut vankina pois.*' 

23. Ja h9n korotti flSnensS , ja sa- 
noi: „voi! kuka jfiA eloon silloin, 
kiinvSkev5 Jumala nAita on tekevd? 

24. Ja haahdet tulevatKittiminran- 
noilta ja kukistavat Assurin, ja ku- 
kislavat Eberin; ja my6skin hAn 
hukkuu." 

£. Ja Bileam nousi ja meni mat- 
kaansa, ja tuli jdlleen kotiinsa, ja 
Balak myOs meni omaa Uetfins5. 

25 Luku. 

Kansan huoruus. Pinebaan kiivaus. 

la Israel viipyi Sitlimissfi ; ja kan- 
^ sa rupesi tekemilSn huorin Moa- 
bilaisten tyiarten kanssa. 4 Moos. 33:49. 

2. NSmS kutsuival kansan epdju- 
maliensa uhrille; ja, kansa sOi ja 
kumarsi heidftn epmumaliansa. 

3. Ja Israel supstui Baal-Feoriin ; 
niin Herran viha syttyi Israelia vas- 
taan. 5Moo8.4:3. Jos. 22:17. Hos.9:10. 

4. Ja Herra sanoi Moosekselle: ,,ota 
kaikki kansan pfifimiehet , ja hirtd 
ne Henralle aunngon puolella, ettfl 
Herran vihan tuli k5finnett§isiin Is- 
raelista pois." 

5. Ja Mooses sanoi Israelin luoma- 
reille: .,kukin tappakoon vftestdnsS 
ne, jotka Baal-Peoriin ovat suostu- 
neet.** 

6. Ja katso» yksi mies Israelin lap- 
^ista tuli, ja toi veljeinsd sekaan mi- 
dianilaisen naisen, Mooseksen ja 
kaikkein Israelin lasten seurakun- 
nan ndhden, jotka ilkiv5t seurakun- 
nan majan oven edessd. 

7. Kun Pinehas, Eleasarin poika, 
papin Aaronin pojan poika, sen nA- 
u, nousi hftn kansan keskeltfi, ja 
otti keihftSn kfiteensft, Ps. 106:30. 

Svyr. 45:23. lMakk.2:54. 
1 ja meni sen Israelin miehen j21- 
keen leltan niakuupaikkaan, ja pis- 
U heidiit molemmat, sekfi Israelin 
niehen eltd naisen vatsasta ISpilse. 
^en rangaistus lakkasi Israelin 
kttten keskellfl. 

9. Ja siinll rangaistuksessa surmat- 
ttinneljOkolmatlakymmentiltuhalla. 

1 Kor. 10:8. 

10. Ja Herra puhui Moosekselle, sa- 
■oen: 

11. i.Pinehas, Eleasarin poika, pa- 
pin Aaronin pojan poika, on kftftn- 



tSnyt minun vihani pois I&raelin 
lasten pd51ta, sen kautta, ettS hfin 
oil kiivas minun kiivauteni tfihden 
heiddn keskellflnsfl, niin etten minft 
minun kiivaudessani hukuttanut Is- 
raelin lapsin. 

12. SentAhdeii sano: katso, minft 
annan hdnelle minun rauhaniliiton. 

13. Ja hdnellfi ja hflnen siemenel- 
ISnsil hdnen j5Ikeensd on oleva ijan- 
kaikkisen pappeuden liitto, sent&h- 
den ettll hdn oli kiivas Jumalansa 
puolesta ja sovitti Israelin lapset.** 

14. Ja sen tapetun Israelin miehen 
nimi Joka midianilaisen naisen kans- 
$a tapetliin, oli Simri, Salun poika, 
ja oli ^hdenSimeoninhuonekunnan 
pASmies. 

15. Mutla midianilaisen naisen ni- 
mi, joka myOs lapettiin, oli Kasbi, 
Surin, midianin kansan huonekun- 
nan pAAmiehen, tylAr. 4 Moos. 31:8. 

16. Ja Herra puhui Moosekselle, sa- 
noen: 

17. „Ahdistakaat midianilaisia, ja 
lydkaat heiddt. 4 Moos. 31:2. 

18. Silin he ovat tehneet teille pa- 
haa kavaluuksillansa , joilla he tei- 
dat pettSneet ovat Feorin kautta, ja 
sisarensa Kasbin kautta, midiani- 
laisten panmiehen lyltaren, joka ta- 
petliin rangaistuksen pdivftnft, Peo- 
rin tahden. 

26 Luku. 

Israelin lasten luku lasketaan uudelleen 
Moabin kedoiila. 

J a rangaistuksen jSlkeen tapahtui, 
etta Herra puhui Moosekselle ja 
Eleasarille, papin Aaronin pojalle, 
sanoen : 

2. „Laskekaat koko Israelin lasten 
seurakunnan lukumaarf:, kahden- 
kymmenen vuotiset ja vanhemmat, 
heidan isainsa huonekuntien mu- 
kaan, kaikki sotaan kelpaavaiset 
miehet Israelissa.** 4 Moos. 1:2,8. 

3. Ja Mooses ia pappi Eleasar pu- 
huivat heidan kanssansa Moabin Ke- 
doiila, Jordanin tyk6na, Jerikon koh- 
dalla, sanoen: 

4. „Ne laskettakoon, jotka ovat kah- 
denkymmenen vuotiset ja vanhem- 
mat, niinkuin Herra oli kaskenyt 
Moosekselle ja Israelin lapsille, jotka 
Egyptista lahteneet olivat. 4 Moos. 1:1. 

5. Ruben, Israelin esikoinen. Ru- 
benin lapset: Hanok, josta on Ha- 
nokilaisten sukukunta, Pallu, josta 
Pallulaisten sukukunta, l Moos. 29:32. 

46:9. 2 Moos. 6:14. 4 Moot. 1:20. lAik.6:l. 

6. Hesron, josta Hesronilaisten su- 
kukunta, Karmi, josta Karmilaisten 
sukukunta. 



165 



4 MOOS. 26. 



7. Ndmil oval Rubcnihiisten suku- 
kiinnat. Ja heidAn lukunsa oli kol- 
meviidett^kymmentil tuhntta seitse- 
mflnsalaa ia kolmekvmmenia. 

8. Multa Fallun poilia oli Eliab. 

9. Ja Eliabin pojat: Nemuel, Da- 
laii ja Abiram. NAniA ovat ne Da- 
tan ja Abiram, niolcmmat seura- 
kunnau valitsemal, jolka ascttivat 
itsensS Moosesta ja Aaronia vaslaan 
Korakin eriseurassa, Ivun he kapi- 
noivat Herraa vastaan. 4 Moos. 16:2. 

Ps. 106:17 ss. 

10. Ja maa avasi suunsa ja iiieli 
heiddt ja Korakin, jolloin kapina- 
joukko kuoh', ja (uli soi viisikym- 
menta miestfi kolmatta sataa, ja he 
lulivat mcrkiksi. 

11. Vaan Korakin lapsct eivi\t kuol- 
leet. 

12. Simeonin lapsct heidAn suku- 
kunnissansa: Nemuel, hanesta Ne- 
muelilaisten sukukunta ; Jamin, hS- 
nestA Jaminilaistcn sukukunta; Ja- 
kin, hdnesta Jakinilaisten suku- 
kunta; 

13. Serak, hSnesIA Serakihiistcn su- 
kukunta; Saul, hdneslil Saulilaisten 
sukukunta. 

14. N£ima ovat Simconilaislen su- 
kukunnat, kaksikolmattakymmenta 
tuhatta ja kaksisataa. 

15. Gadin lapsct heidSn sukukun- 
nissansa: Sefon, hanestii Sefonikiis- 
ten sukukunla; Haj^gi, hanesta Hag- 

filaisten sukukunta; Suni, hanesta 
unilaisten sukukunta; 

16. Osni, hanesta Osnilalsten suku- 
kunta; Eri, hanesta Erilaisten su- 
kukunta: 

17. Arod, hanesta Arodilaislen su- 
kukunta; Ariel, hanesta Arielilais- 
ten sukukunla. 

18. Nania ovat Gadin lasten suku- 
kunnat, heidan lukunsa jaikeen: 
neljakymmenta tuhatta ja viisisataa. 

19. Juudan lapsct: Ger ja Onan; ja 
Ger ja Onan kuolivat Kanaan maal- 
la. 1 Moos. 38:7.10. 46:12. 

20. Ja Juudan lapsct heidan suku- 
kunnissa olivat: Sela, hanesta Scla- 
laisten sukukunta; Peres, hanesta 
Peresiiaisten sukukunta; Serak, ha- 
nesta ^erakilaisten sukukunta. 

21. MuttaPeresinlapsetolivat: Hes- 
ron, hanesta Hesronilaisten suku- 
kunta; Hamul, hanesta Hamulilais- 
ten sukukunta. 

22. Nfima ovat Juudan sukukunnat, 
heidan lukunsa jfilkeen: kuusikah- 
deksattakymmenta tuhatta ja viisi* 
sataa. 

23. Isaskarin lapsct heidan suku- 
kunuissansa: Tola, hanesta Tola- 



laisten sukukunta ;Pua,hanes(aPua- 
Inistcn sukukunta; 
21. Jasub, hanesta Jasubilalsten su- 
kukunta; Simron, hanesta Simroni- 
laistcn sukukunta. 

25. Xama ovat Isaskarin sukukun- 
nat, heidan lukunsa jaikcen: nelja- 
seitsemattakymmenta tuhatta ja kol- 
mesataa. 

26. Sebulonin lapset heidati suku- 
kunnissansa : Sered, hanesta Seredi- 
laisten sukukunta; Eton, hHnesta 
Elonilaistcn sukukunta; Jakleel, ha- 
nesta Jakleelilaisten sukukunta. 

27. Nama ovat Sebulonin sukukun- 
nat, heidan lukunsa jaikcen: kuu- 
sikymmenta tuhatta ja viisisataa. 

28. Josefin lapset heidan sukukun- 
nissansa: Manasse ja Efraini. 

29. Manassen lapset; Makir, hanes- 
ta Makirilaistcn sukukunta. Makir 
siitti Gileadin, hanesta Gilcadilais- 
ten sukukunta. Jos. 17:I. 

30. Nama ovat Gileadin lapset : Je- 
scr, hanesta Jeseriiaisten sukukun- 
ta; Helck, hanesta Helekiiaisten su- 
kukunta; 

31. Asrlel, hanesta Asrielilaisteu su- 
kukunta; Sikem, hanesta Sikemi- 
laisten sukukunta; 

32. Semida, hanesta Semidiiaisten 
sukukunta; Hefer, hanesta Heferi- 
laisten sukukunta. 

33. Mutla Selofkad oli Ileferin poi- 
ka, ja ei hanclia ollut poikia, vaan 
ainoastansa tyttada, ja Selofkadin 
tytarten nimet: Makia, Noa, Hogla, 
Milka ja Tirsa. 4 Moos. 27:1. 36:2. 

Jos. 17:3. 

34. Nama ovat Manassen sukukun- 
nat; heidan lukunsa oli kaksikuu- 
dettakymmenta tuhatta jaseitsemSn 
sataa. 

35. Nama ovat Efraimin lapset hei- 
dan sukukunnissansa: Sutelak, ha- 
nesta Sutelakilaisten sukukunta; Be- 
ker, hanesta Bekerilaisten sukukun- 
ta; Tahan, hanesta Tahanilaisten 
sukukunta. 

36.VaanSutelakin lapset olivat: E- 
ran, hanesta Eranilaisten sukukunta. 

37. Nama ovat Efraimin lasten su- 
kukunnat; heidan lukunsa oli kak- 
sineljattakymmenta tuhatta ja viisi- 
sataa. Nama ovat Josefin lapset hei- 
dan sukukunnissansa. 

38. Benjaminin lapset heidan suku- 
kunnissansa: Bela, hanesta Belalais- 
ten sukukunta; Asbel, hfinesta As- 
belilaisten sukukunta; Ahiram, ha- 
nesta Ahiramilaisten sukukunta; 

39. Sefufam, hanesta Sefufamilais- 
ten sukukunta; Hufam, hanesta Hu- 
familaisten suliukunta. 



166 



4 MOOS. 20. 27. 



40. Multa Belan lapset .olivat : Ard 
k Naeman, nftistft Ardilaistea ja 
Nflemilaisten sukukunta. 

41. Ndmft ovat Benjaminin lapsct 
heid5n sukukunnissansa ; heldAn lu- 
kunsa oli viisiviidettSkymmenta (u- 
haila ja kuusisataa. 

42. Nritn3 olivnt Danin lapset hci- 
dSn sukukiinnissiinsa : Suham, hSk' 
neslJlSuhamilaisfen sukukunta. Nfl- 
mS ovat Danin lapset heid5n suku- 
kunnissansa. 1 Moos. 46:23. 

43. Ja olivat kaikki yhteen Suha- 
milaisten sukukunta, nclj5seitsem5t- 
inkymmentA tuhatla ja neljfisataa. 

44. Asserin lapset heidAn sukukun- 
nissansa: Jimna, hSnestft Jimnalais- 
ten sukukunta ; Jesvi , hSnestfi Je.s- 
vil5isten sukukunta ; Brija, hflncstS 
Brijalaisten sukukunta. 

45. MuttaBrijan lapset olivat: Hc- 
ber, hfinestfi Hebrilllisten sukukun- 
ta; Melkiel, hfinestS MelkielilSisten 
sukukunta. 

46. Ja Asserin tytfir kutsuttiin Se- 
rak. 

47. NamS ovat Asserin lasten suku- 
kunnat, ja heidftn lukunsa kolme- 
kuudettakymmenta tuhatta ja neljA- 
sataa. 

48. Naflalin lapset heidSn sukukun- 
nissansa: Jakseel, hdnesta Jakseeli- 
laisten sukukunta; Guni, hSnestA 
Gunilaisten sukukunta; 

49. Jescr, hSnestS Jeserildisten su- 
kukunta; Sillem, hanesta Silleini- 
ISisten sukukunta. 

50. N9m3 ovat Naflalin sukukunnat, 
heidiin heimokuntainsa jAlkeen ; hei- 
dan lukunsa oli viisivildettdkym- 
nienta tuhatta ja neljSsataa. 

M. Tftm3 on fsraelin lasten luku: 
kuusikertaa satatuhatta ja yksi tu> 
hatla, seitsemSnsataa ja kolmckym- 
mentd. 2 Moos. 12:37. 4 Moos. 1:45 as. 2:32. 

52. Ja Herra puhui Moosekselle, sa- 
noen: 

53. NSille sinun pitfiA maan jaka- 
man perinn5ksi, nimien lukuin jai- 
keen. , 

54. Monilukuiselle anna suurem- 
pi perintO ja vShfllukuiselle piencni- 
pi perintd; jokaiselle pitfift annetta- 
nian perintGosa heidftn lukunsa jal- 

keen. 4M0O8. 33:54. 

55. Kuitenkin arvalla pitaa maa 
jae'ilaman, ja isftinsA suKukuntain 
nimien j&lkeen pitSS heidSn pen- 
non. 4M00S. 33:54. Jos.l4:2. 17:14. 

56. Arvalla on heidfin perimisensfi 
jaettava sen j&lkeen kuin heitft on 
|Mi\jon tahi vfihAn. . 

57. Ja tSmft on. Levil&isten luku 
hcidSnsukukunnissansa: Gerson.hA- 



nestii Gersonilaislen sukukunta; Ka- 
hat, hdnestS Kahatilaisten sukukun- 
ta ; Merari, hfinestS Merarilaisten su- 
kukunta. 2Moot.6:16. 4 Moos. 317. 

58. NAmfl ovat I^vin sukukunnat: 
Libnilflisten sukukunnat, Hcbroni- 
laisten sukukunnat, Mahelilaisten 
sukukunnat, Musilaisten sukukun- 
nat, Korakilaisten sukukunnat. Ka- 
hat siitti Amramin; 

59. ja Amramin vaimon nimi oli 
Jokebed, Levin tytSr, joka Levillr 
oil syntynyt EgyptissA: ja hAn syn- 
nytti Amramille Aaronin ju Moosek- 
sen, ja heidSn sisarensa Mirjaniin. 

2MoO8.6:20. 

60. Mutta Aaronille oli syntynyt 
Nadab ja Abihu, Eleasar ja Itamar. 

61. Ja Nadab ja Abihu kuolivat, 
koska he uhrasivat vierasta tulta 
Herran cdessS. 3 Moos. 10:2. 4 Moos. 3:4. 

lAlk.24:2. 

62. Ja h^iddn lukunsa oli kolme- 
kolmattakymmentA tuhatta, kaikki 
miehenpuoli, kuukauden vanhasta 
ja sen ylitse, jotka eivAt oUeet lue- 
tut Israelin lasten sekaan; sillA ei 
heille annettu perimistA Israelin las- 
ten keskellA. 

63. TAmA on Israelin lasten luku, 

i'onka Mooses ja pappi Eleasar las- 
[ivat Moabin kedoilla, Jordanin ty- 
kOnA, Jerikon kohdalla. 

64. NAiden laskussa ei yhtAAti ollut 
siitA luvusta, jonka Mooses ja pappi 
Aaron laskivat Israelin lapsista Si- 
nain korvessa; 

65. sillA Herra oli sanonut heille, 
ettA heidAn piti totisesti kuoleman 
korvessa ; eikA yksikAAn jAAnyt heistA 
elAmAAn paitsi Kalebia, Jefunnen 
poikaa, ja Josuaa, Nunin poikaa. 

4M008. 14:23,29. 32:10 ss. 
5 Moos. 1:35. lKor.lO:S.' 

27 Luku. 

Selofkadin tyttliret Josua m&ftrfttftfln kaii- 
san jobtajaksi. 

J a Selofkadin tyttAret, Heferin po- 
jnn, Gilcadin pojan, Makirin po- 
jan, Manassen pojan, Manassen, Joso- 
Iin pojan suvusta, joitten nimet oli- 
vat: Makla, Noa, Hogia, Milka jn 
Tirsa, tulivat esille. 4 Moos. 26:33. 36:2. 

Jos. 17:::. 

2. Ja he astuivat Moosckscn ja pn- 
pin Eleasarin, ja pnAmiesten, ju 
kaikcn kansan eteen, seurakunnan 
niajan oven edessA, la sanoivat: 

3. „MeidAn isAmme kuoli korvessa, 
eikA hAn ollut siinA joukossa, jotka 
melelin nostivat Herraa vastaan Ko- 
rakin kapinassa, vaan hAn on oman 



167 



4 MOOS. 27. 28. 



fiyntinsd tfihden kuollut: eikH ollul 
h^nelld poikia. 4 Moos. 16:1,288. 

4. Miksi meidSn isSmme nimi hS- 
vifiisi suvustansa pois, sentdhden 
ettei hSnellft oilut yhtSSn poikaa? 
antakaat meille osa isfiimme velJeJn 
seassa.'* 

5. Ja Mooses saattoi heidSn asian- 
sa Herran eteen. 

6. Ja Herra puhui Moosekselle, sa- 
noen : 

7. „Selofkadin tyltSret ovat oikein 
>uhuneet; sinun tulee antaa heille- 
cin perintOosa heidSn isSinsd vel- 

, ein seassa, ja saattaa heille is3nsS 
perintd. 

8. Ja puhu Israeiin lapsille, sa- 
noen: jos joku kuolee ilman poikaa, 
niin teid5n pituS h5nen perimisen- 
sd antaman hdnen tyttarellensd. 

9. Jollei h&nelia ole lytdrta, niin 
antakaat parinlO hflnen veljillensd. 

10. Ja jollei hdnelld ole veljiS, niin 
antakaat se h&nen sedillens5. 

11. Jollei hSnelld ole setid, niin an- 
takaat se hSnen Ilihimmiiiselle su- 
kulaisellensa, hfinen Idhimmaiselle 
heimolaisellensa hdnen omasta su- 
vustansa, ettfi hdn sen omistaa. T5- 
mSk olkoon Israeiin lapsille sdHntd 
ja oikeus, niinkuin Herra on Moo- 
sekselle kfiskenyt.'* 

12. Ja Herra sanoi Moosekselle: 
.,aslu yl6s laile Abarimin vuorelle, 
ja katso sitfl niaata, jonka minS Is- 
raeiin lapsille annan. 5 Moos. 32:48,49. 

13.* Ja kun sen nahnyl olel, niin 
sinfikin kootaan kansasi tykO, niin- 
kuin sinun veijesi Aaron koottu on. 
4 Moos. 20:12 S8. 24 8S. 5 Moos. 1 :37. 

14. SillS te olitte niinun sanalleni 
kovakorvaiset Sinin korvessa knn- 
san riidcUessS, kun teidi&n olisi tul- 
lut minua pyhitlAd vedeii kautta 
heidSn edcssansfl.** Se on se riila- 
vesi Kadeksessa, Sinin korvessa. 

15. Ja Mooses puhui Herralle, sa- 
noen : 

16. „Herra, kaiken lihnn henkein 
Jumala, asettakoon yhden miehen 
kansan pliHmieheksi, 

17. joka heidfin edessdnsS kSvisi 
ulos ja sis511e, veisi heitil ulos ja si- 
sSlIe, ettei Herran seurakunta olisi 
niinkuin lampaat ilman paimenta.** 

18. Ja Herra sanoi Moosekselle: 
..Ota Josua, Nunin poika, sinun ty- 
kOsi, joka on mies. jossa Henki on, 
ja pane kdtesi hSnen pSSllensd, 

19. ja as^ta hfln papin Eleasarin 

ia koko seurakunnan eteen, ja anna 
iSnelle kdskyja heidSn silmdinsd 
edessS. 6Moos. 3:2i. 

20. Ja pane sinun kunniastasi hfi- 



nen pa&llensfl, ettfi Israeiin lasten 
koko seurakunta olisivat hUndle 
kuuliaiset. 

21. Jahfln^astukoon papin Eleasarin 
eteen, joka kysykdOn nciivoa hilnrn 
puolestaan valkeuden kautta Herran 
edessd; ja Hdnen sanansa mukaan 
kfiykOCt ulos ja sis511e sekS hdn etltl 
Israeiin lapset h5nen kanssansa, ja 
koko seurakunta.*' 2Moo8.28:3i». 

22. Ja Mooses tekl niinkuin Herra 
hdnelle kdski, ja otti Josuan ja asetti 
hdnen papin Eleasarin ja koko seu- 
rakunnan eteen, 

23. ja laski kfitensfl hdnen pfidllen- 
sd, ja antoi hdnelle kdskyja, niin- 
kuin Herra oli Moosekselle puhunut. 

28 Luku. 

XJbrilakeja. 

J a Herra puhui^f oosekselIe,sano«n : 
2. Kdske Israeiin lapsia, ja sano 
heille: pitdkddt huolta minun uh» 
ristani, joka on minun leipdni, tuli- 
uhriksi ja lepytyshajuksi minulle, 
niin ettd te seivmdSrdtylld ajalla mi- 
nulle uhraatte. 8Moofi.3:il. 21:6. 

3. Ja sano heille: tfimS on se tuli- 
uhri, jonka teiddn pitdd uhraaman 
Herraile: kaksi virheet5ntft vuosi- 
kautista karitStia jokapdivfl, alino- 
maiseksi polttouhriksi. 

4. Uhraa yksi karitsa aamulla, Ja 
uhraa toinen karitsa illansuussa, 

5. ja siihen kymmenennes osa efas- 
ta hienoja jauhoja ruokauhriksi,se- 
koitettuna neljdnnes osaan hinniil 
puserrettua 61jyd. 2 Moos. 29:40. 

8 Moos. 2:1. 

6. Tdmd on alituinen polttouhri, 
joka Sinain vuorella uhrattiin otol- 
liseksi hajuksi; se on tuliuhri Her- 
raile. 

7. Ja uhraa my6s juomauhriksi 
neljdnnes osa hinnid ensimmdiselle 
karitsalle. Juomauhri vdkevdstd vii- 
nisld pitdd uhrattaman Herraile py- 
hdkOssd. 

8. Toisen karitsan pitdd sinun uh* 
raaman illan suussa: niinkuin aa- 
mulliscn ruokauhrin ja juomauhrin 
pitdd sinun senkin valmistaman, 
otollisen hajun tuleksi Herraile. 

9. Mutta sabbatin pdivdnd pitdft si- 
nun uhraaman kaKsi virheetOntil 
vuosikautista karitsata,ja kaksi kyni* 
menestd hienoja jauhoja, sekoitettu- 
na Oljylld, ruokauhriksi, ynnfi sen 
jtiomauhrin kanssa. 

10. Tdmd on ioka sabbatin poltto- 
uhri, paitsi jokapdivdista poUtouh- 
ria juomauhrinensa. 

11. Mutta ensimmdisenfi pftlvflnft 



168 



4 MOOS. 28. 29. 



oloi kuulcaudessa pil^a teidSn uh- 
raaman Herralle polttouhriksi : kak- 
si nuorta hfirkfiS, vhden oinaan, 
seitsemSn vuosikautfsta virheetOntfl 
karitsata, 

,11 ja kolme kymmenestS hienoja 
jauhoja ruokauhriksi , sekoitetluna 
dljyiis. jokaiselle hdnaile , ja kaksi 
kvmmenesia hienoja jauhoja ruoka- 
uhriksi, 51iyim sekoitettuna , jokai- 
selle oinaalle, 

13. ja kymmenes hienoja jauhoja 
ruokauhriksi, OljyllA sekoitetluna, 
jokaiselle karitsalie; se on lepytys- 
haiun tuli Herralle. 

14. Ja naihin kuuluvat juomauhrit 
oikoot puoli hinnifi viinifi hSrjaile, 
kolmannes hinni5 oinaalle, neljdn- 
nes hinnifl karitsalie. Se on kuu- 
bu*'.nen polttouhri, vuoden joka 
kuukaudelle. 

15. My5skintuleeleidSnuhra(ayksi 
kauris syntiuhriksi Herralle; paitsi 
jokapaivaistfl polttouhria juomauh- 
rinensa pitfiS se valmistettaman. 

' 16. Mutta neljanlenft toista pSivana 
ensimmaiselia kuulla on paasiainen 
Herralle. 2 Moos. 12:18. 23:15. 3Moos.23:5. 
\ • 4 Moos. 9:3. 6 Moos. 16:1 ss. 

17. Ja viidentenatoista paivana slta 
kuuta on juhla. Seitseman paivaa 
pitiia syOtaman happamatonta lei- 
pa§. 

18. Ensimmaisena paivana on py- 
H kokous; aikaat silloin tehkO mi- 
tUn tyOta. 

19. Ja teidan pitaa uhraaman tuli- 
nhria, Herralle polttouhriksi : kaksi 
nuorta harkaa, ja yhden oinaan, 
Biin myds seitseman vuosikautista 
karitsata; virheett6mat ne oikoot. 

20. Ja naitten ruokauhriksi tulee 
teidan uhrata aijyliasekoitettuja hie- 
noja jauhoja,kolmekymmenestahar- 
jiiue, ja kaksi kymmenesta oinaalle, 

21. ja ain'a yksi kymmenes jokai- 
selle niista seitsemasta karitsasta ; 

22. mydskin tulee teidan uhrata 
yksi kauris syntiuhriksi teita sovit- 
tamaian. 

23. Paitsi aamuista polttouhria, jo* 
ka jokapaivainen polttouhri on, tei- 
dSn pitaa ne tekemdn. 

.24. faiia tavalla pitaa teidan niina 
iokaisena seitsemana paivana uhraa- 
man tuliuhrin leipaa otolliseksi ha- 
JQksi Herralle; paitsi jokapaivaista 
polttouhria pitaa se valmistettaman 
juomauhrinensa. 

25. Ja seitsemantena paivana pitaa 
teiUa oleman pyha kokous; aikaat 
silkiin tehkO. mitaan tyOta. 

20L.Ja uutisten paivana, kun uh- 
nuuteuutta ruokauhria Herralle viik- 



kojuhlananne, pitaa teilia pyha ko- 
kous oleman; aikaat silloin tehkO 
mitaan tyfita. 3 Moos. 23:15, 16. 

27. Ja uhratkaat polttouhri otolli- 
seksi hajuksi llerralle: kaksi har- 
kaa, yhden oinaan ja seitseman vuo- 
sikautista karitsata, 

28. ja niitten ruokauhriksi: hieno- 
ja jauhoja sekoitetluna filjylia, kolme 
kymmenesta kummallenkin harjai- 
le, kaksi kymmenesta oinaalle, 

29. ja aina kymmenes kullenkin ka- 
ritsalie niista seitsemasta karitsasta; 

30. niin myds uhratkaat yksi kauris 
teita sovittamaan. 

31. Tama tehkaat paitsi jokapai- 
vaista polttouhria ruokauhrinensQ ; 
virheettOmat ne teilia olkool, niin 
myOs niiden juomauhrit. 

29 Luku. 

Ubrilakeja. 

Seilsemannen kuukauden ensim- 
maisena paivana pitaa teiiia py- 
ha kokous oleman; aikaat silloin 
tehka yhtaan tyOia. Se on soittami- 
sen juhlapaiva. 3 Moos. 23:2488. 

2. Ja uhratkaat polttouhri otolli- 
seksi hajuksi Herralle: yksi nuort 
harka, ylcsi oinas, seitseman vuosi- 
kautista virheetdnta karitsata. 

3. Ja niiden ruokauhriksi: aijylia 
sekoltettuja hienoja jauhoja, kolme 
kymmenesta harjaile, kaksi kymme- 
nesta oinaalle, 

4. ja yksi kymmenes jokaiselle ka- 
ritsalie, niista seitsemasta karitsasta ; 

5. ja uhratkaat myOs yksi kauris 
syntiuhriksi, teita sovittamaan, 

6. paitsi uuden kuun polttouhria 
ja ruokauhria, ja paitsi jokapaivais- 
ta polttouhria, saannOn mukaisine 
ruokauhrinensa ja juomauhrinensa, 
otollisen hajun tuleksi Herralle. 

7. Kymmenentena paivana tassa 
seitsemannessa kuukaudessa pitaa 
myds teilia pyha kokous oleman ; ja 
teidan pitaa vaivaaman teidan sielu- 
janne, ja aikaat silloin yhtaan tyCta 
tehka. 3M00S. 16:29. 23:27. 

8. Ja teidan pitaa uhraaman polt- 
touhria otolliseksi hajuksi Herralle: 
yhden nuoren harjan, ja yhden oi- 
naan. ja seitseman vuosikautista vir- 
heetdnta karitsata, 

9. ynna niiden ruokauhrin kans- 
sa: hienoja jauhoja, sekoitetluna ai- 
iylia, kolme kymmenesta haijaile, 
kaksi kymmenesta oinaalle, 

10. ja aina kymmeneksen jokai- 
selle karitsalie, niista seitsemasta 
karitsasta; 

11. ja uhratkaat myOs yksi kauris 



IFlnoisfa] 9* 



W? 



4 MOOS. 29. 30. 



synliuhriksi, — puitsi spvittomisen 
Kviitiuhriaja jokapiiivSistd polttouh- 
riu, ruokauhrincnsa ja juomauhri- 
nensa. 3Moo8.iG:i5. 

12. ViidenlcnStoisla pHivilna seitse- 
ini\iinessA kuukaudcssa pi tail tcilld 
pvhH kokous olenian ; alkaiit silloiii 
niiUliin tyOtn IcIikO, ja (cidaii pitafl 
juhlaa pitHmdn Herralle scitscman 
pHivAd. 3Moos.23:.34. Joh. 7:2. 

13. Ja Icidnn piUlA uhraamanpolt- 
touhria ja tuliuhria, otolliseksi ha- 
juksi Herralle: kolmetoisla nuorta 
hf\rk9ii, kaksi oinasta« neljAloisIa 
vuosikautista, virheetdntd karitsata; 

14. ynnA niiden ruokauhrinkanssa, 
sampylajauhoja, sckoitedit Oljyiln: 
kolmc kymnienesin jokaiselle niisia 
koInie.s(atoista liSrjdstA, kaksi kyin- 
inenesld kullenkin niist5 kahdesta 
oinaasta, 

15. ja kymnicnekscn itsckullenkin 
niistSl neljSstdtoisla karitsasta; 

16. myOskin lulce tcidSn uh'rata 
kauris synliuhriksi; — paitsi joka- 
pAiviiistA polttouhria ruokauhrincn- 
sa ja juomauhrinensa. 

17. Ja toiscna pAivdnd:'kaksitoista 
nuorta hdrkdd, kaksi oinasta, neljA- 
toista vuosikautista virheetOntA ka- 
ritsata, 

18. ja niiden ruokauhrit ja luoma- 
uhrit hJlHille, oinaille ja karitsoillc, 
mnarAtyllA tavalla niiden luvun mu- 
kaan, 

10. ja siihen myds kauris syntiuli- 
riksi; — paitsi jokapaivAistA poll lo- 
uhria, ruokauhrincnsa ja juomauh- 
rinensa. 

20. Kolmantcna {^aivanH: yksitois- 
ta h.lrkAA, kaksi .oinasta, neljAtoista 
vuosikautista, virhcct^ntA karitsata, 

21. vnnA niiden ruokauhrit ja juo- 
mauhrit hArjillc, oinaille la karit- 
hoille, mAArAtvllA tavalla niiden lu- 
vun mukaan, 

22. ja siihen my5s J<auris synliuh- 
riksi; — paitsi jokapAivAistA poltto- 
uhria ruokauhrincnsa jd juomauh- 
rinensa. 

23. NeljAntcnA pAivAnA : kymmenen 
liArkAA, kaksi oinasta, neljAtoista 
vuosikautista, virhcetdntA karitsata, 

24. ja niiden ruokauhrit ja juonia- 
uhrit, hArjillc, oinaille ja karitsoil- 
lc, niAarAtyllA tavalla niiden luvun 
mukaan, 

25. ja siihen kauris synliuhriksi; 
— paitsi JokapAivAistA polttouhria, 
ruokauhrincnsa ja juomauhrinensa. 

2G. Ja viidcntciiA pAivAnft. ^hdck- 
sAn liArkAA, kaksi oinasta, ncljatoista 
vuosikautista virheetOntA karitsata, 

27. Ju nifden ruokauhrit ja juoma* I 



uhrit , hArjille, oinaille ja karitsoil- 
lc, mAArAtyllA tavalla niideu luvun 
mukaan^ 

28. ja siihen myOs kauris syntiuh- 
riksi ; — paitsi jokapAivAistA poltl6- 
uhria, ruokauhrincnsa ja juomauh- 
rinensa. 

29. Ja kuudcntcna pAivAnA: kali- 
dck.san hArkAA, kaksi oinasta, neljA- 
toista vuosikautista virhcetdntA ka- 
ritsata, 

30. vnnA niiden ruokauhrit ja juo- 
mauhrit, hArjillc, oinaille ja karil- 
soille, mAArAtyllA tavalla niiden lu- 
vun mukaan, 

31. ja siihen my6s kauris synliuh- 
riksi; — paitsi JokapAivAistA poltto- 
uhria, ruokauhrincnsa ja juomauh- 
rinensa. 

'32. Ja scitscmAnlenA pAivAiiA: scit- 
seniAn hArkAA, kaksi oinasta, ncljU- 
toista vuosikautista, virhccl5ntA ka- 
ritsata, 

33. ja niiden ruokauhrit ja juo- 
mauhrit, hArjillc, oinaille ja karit- 
soillc, mAArAtyllA tavalla niiden lu- 
vun mukaan, 

34. ja siihen my6s kauris synliuh- 
riksi; — paitsi JokapAivAistA poltto- 
uhria, ruokauhrincnsa ja juomauh- 
rinensa. . 

35. Kahdeksas pAivA oikoon teille 
pAAtOsjuhla; alkAAt silloin mitAAn 
tyOlA tchkd. 3 Moos. 23:3r.. 

36. Ja teidAn pitAA silloin uhraa- 
man polttouhria, otollisenhajun tuli- 
uhria Herralle : yhden hArjAn, yhdon 
oinaan ja seitscmAn vuosikautista, 
virhcctdntA karitsata, 

37. ja niiden ruokauhrit ja juoma- 
uhrit, hArjillc, oinaille ja karitsoil- 
lc, mAArAtyllA tavalla niiden luvun 
mukaan, 

38. ja siihen myOs kauris .synliuh- 
riksi; — paitsi JokapAivAistA poltto- 
uhria, ruokauhrincnsa ja juomauh- 
rinensa. 

39. NAmA [litAA- teidAn uhraamau 
Herralle teidAn juhlapAlvinAnne* 
paitsi sitA mitA tc lupaatte ja hv-^ 
vAslA lahdosta annatte polttouhrik- 
scnne, ruokauhrikscnne, juomauh- 
riksenneja kiitosuhrikscnne. 

30 Luku. 
Laki lupfluksista. 

Ju Mooses sanoi Israclin lapsill« 
kaikki, mitA Herra hAnelle oli 
kAskenvt. 

2. Ja {^looses puhui Israclin suku- 
kuntain pAfimichillc, sanoen: tfi.nnil 
on, minkA Hcrra kAski: 
S. Jos mies lupaa lupauksen Hcr- 



170 



4 MOOS. 30. 31. 



talle (ahi vannoo valaA, ]6\\k& kaut- 
U hfln itsensS kleltSmisessS si too 
sieiunsa, niin filk06n hAn tehkO sa- 
naansa turhaksi, vaan tayttfikOOn 
kaikki, mitft hfin on suulfansa lu- 
vannut.' 3 Moos. 27:2. B Moos. 23:21.' 

Saani.5:38S. 

4. Ja josiiainen,olessaanvieIS isdn- 
sS huoneessa nuoruudes$ansa, lupaa 
lopauksen Herralle, sitoen itsensd, 

5. ja hSnen is^lnsS kuulee h5ncn 
Inpauksensa ja- valasiteensh, jolla 
hdn on sieiunsa sitonut, ja hdnen 
isSnsd on Sdneti siihen, niin olkoot 
kaikki hdnen lupauksensa vahvat, 
ja koko hfinen valasiteensft , jolla 
hSn on sieiunsa silonut, olkoon py« 
syvS. 

6. Mutta jos hflnen isKnsIl kieltSfi 
sen sinS pSivfinA, jona hSn sen kuu- 
lee, niin liSnen lupauksensa ja va- 
lasiteensS, jolla li9n on sieiunsa si- 
tonut, eivSI ole vahval; ja Herra on 
h^elle amlollinen, koska liAnen i- 
siinsS on sen h^neltA kieltiinyt. 

7. Ja jos hsInellS on mies , ja hSn 
on jotain luvannut, taikka jotain on 
sirailansa puhunul, jolla li5n on sie- 
lunsa sitonut, 

.8. ja hSnen miehensfi kuulee sen, 
ja on 99neti siihen sinA p9ivflnd, jo- 
na hSn sen kuulee, niin pitftfl hA- 
nen lupauksensa vahvana oleman ; 
ja hAnen valasiteensfi, jolla hiln on 
Melunsa sitonut, on my6s vahva. 

9. Mutta jos hAnen miehcnsA sen 
weltaa sina pSivAnS , jona hfln sen 
kuulee, niin hAn pAAsee lupaukses- 
tansa, ja siitA mitA hAn suullaiisa 
varomatlomasti on puliunut, jolla 
hSn sieiunsa sitoi ; ja Herra on hA- 
nelle armollinen. 

10. JLesken ja hyljAtyn vaimon lu- 
paus ja kaikki, johon hAn on sie- 
iunsa sitonut, pysykOOn hAnelle voi- 
massa. 

11. Ja josvaimo miehcnsA huonees- 
sa tekee lupauksen, tahi sieiunsa 
siloo valallansa, 

12. ja mies kuulee sen, ja on AAne- 
K siihen, eikA kiellA sitA, niin pitAA 
Kaiken sen lupauksen ja valasiteen, 
jolla hAn on sieiunsa sitonut, ole- 
man vahvana. 

13. Mutta jos hAnen miehensA tekee 
sen lyhjaksi sinA pAivAnA, jona hAn 
Sen kuulee, niin kaikki mitA hAn 
on puhunut, lupaukset ja valasiteet, 
j3Sv9tmitAttOmiksi;sillAhAncnmie- 
nensH on sen tehnyl tyhjAksi, ja 
Herra antaa hAnelle anteeksi. 

14. Ja kaikki vaimon lupaukset j& 
valat, jolla hAn sitoutuu itsensAkiel- 
Uniiseen,pitflAhftnen miehensA joko | 



vahvistaman, taikka tyhjAksi tekc- 
mAn. 3 Moos. 16:29. 

15. Mutta jos hAnen miehensA on 
AAneti siihen, slit A pAivAstA toiseen, 
niin hAn vahvistaa Icaikki hAnen lu- 
pauksensa ja kaikki hAnen valasi- 
teensA; koska hAn on AAneti ollut 
sinA pAivAnA, jona hAn sen kuuli, 
niin nAn vahvistaa ne. 

16. Mutta jos hAn peruuttaa ne sen 
julkeen kuin hAn sen kuuli, niin 
pitAA hAnen kantaman vaimonsa 
vAAryyden. ' 

17. NAmA ovat ne sAAnnOt, jotka 
Herra on kAskenyt Moosekselle mie- 
hen ja vaimon vAlisestA suhteesta, 
sekA isAn ja tyttAren vAIisestA suh- 
teesta, kun tytAr nuorena vielA on 
isAnsS huoneessa. 

31 Luku. 

Israel kostaa Midianilalsille. Bileam 
hukkuu. Saalis joetaan. 

J a Herra puhui Moosekselle*. sa- 
noen; 

2. „Kosta Midianilalsille Israelin 
lasten puolcsta ; sitten kootaan sinA 
kansasi tykd." 4 Moos. 25:17. 27:13. 

3. Niin Mooses puhui kansalle, sa- 
noen: „varustakaat miehiA sotaan 
Midianilaisia vastann,ettA he kostai- 
sivat Midianilalsille Herran puolesta. 

4. Jokaisesta sukukunnasta tuhan- 
nen miestA lAhetlAkAAt sotaan, kai- 
kista Israelin sukukunnisla.*^ 

5. Niin otettiin Israelin sukukun- 
nista tuhat joka sukukunnasta; niin 
he varustivat sotaan kaksitoista tu- 
hntta miestA. 

6. Ja Mooses lAhelti heidAt sotaan, 
tuhannen .jokaisesta sukukunnasta, 
ynnA Pinehaan, papin Eleasarin po- 
jan kanssa, ja pyhat aseet, ja nlyOs 
ilotorvet olivat hAnen kAde^sAnsA. 

7. Ja he sotivat Midianilaisia vas- 
taan, niinkuin Herra oli Moosekselle 
kAskenyt, ja lOivAt kuol'iaaksi kaiken 
miehenpuolen. 

8. Niin tappoivat he myOs Midiani- 
laisten kuninkaat heidAn lydtyjensA 
joukossa: Evin,* Rekemin, Surin, 
Hurin ja Rcban, viisi Midianilaisten 
kuningasla ; Bileamin, Beorin pojan, 
lOivAt he myOs niiekalla kuoliaaksi. 

Jos. 13:21 8. 

9. Mutta Israelin lapset ottivat van- 

§iksi Midianilaisten vaimot ja hei- 
An lapsensa ; ja kaikki heidAn elAi- 
mensA ja kaikki heidAn karjansa ja 
kaiken heidAn tavaransa hery6stiyfit. 

10. Ja kaikki kaupungit heidAn- a- 
suntopaikoissaan ja kaikki heidAn 
linnansa he polttivat. 



171 



4 MOOS. 31. 



11. Ja he ottivat mukanansa saaliin 
ja kaikki mitd oteUavaa oli, sekft ih- 
miset ettd elSimet, 

12. ja veivfit ne Mooseksen ja papin 
Eleasarin eteen, ja kokolsraelin fas- 
ten seurakunnan eteen — vangit ja 
ryOstetyt elSirfiet, ja saaliin, — lei- 
liin Moabin kedolfe, joka on Jorda- 
nin tvkOnfl JerikoQ kohdalla. 

13. Ja Mooses ja pappi Eleasar ja 
kaikki 'seurakunnan paamietiel me- 
nivfil heitS vastaan ulos leiristfi. 

14. Ja Mooses vihastui sedan pfifi- 
mietiiin, jotka clival tuhanten ja 
satain pfifimietiet, kun he tulivat so- 
taretkeltfi. 

15. Ja Mooses sanoiheille: ,,oletteko 
jSttfineet kaikki naisei elSmfifin? 

. 16. Katso,nehfihsaattoivatBileaniin 
neuvosta -Israelih lapsia syiiUft teke- 
mSfin Herraa vastaan Peorin asias- 
sa, ja rangaistiis tuli Hetran kansan 
pnane.4M00B.22:5. 24:U. 252. 2PIet2:158s, 

17. Niin lyOkSfit nytkuoliaaksi kaik- 
ki ' miehenpuoli fasten seassa, ja 
kaikki naiset, jotka miehen tunte- 
nect ja miehen kanssa maanneetovat, 
lyfikast myOs kuoliaaksi. Tuom. 2i:ii. 

18. Mutta kaikki naispuoliset lap- 
sista, jotka eivflt ole miestd tunte- 
neet eikS maanneet miehen tyk0n3, 
sallikaat elSfi. 

19. Ja' pysykaat Itse ulkona leiristfi 
seitsemfin pfiivftfi. Kaikki Jotlca olet- 
te ihmisen tappaneet tahi tapettuun 
koskeneet, puhdistalcaat itsenne kol- 
mantena ja seitsem&ntenft pllivdnft, 
sekd te itse, ettS vangit. 4 Moos. 19:16. 

20. Ja kaikki vaatteet,ja kaikki nah- 
kakalut Ja kaikki, jotka vuohen kar- 
voista fendyt ovat, ja kaikki puua- 
seet pit&ft teidfin puhdistaman.*'. 

21. Ja pappi Eleasar sanol sot^Jou- 
kolle, joka sodassa bli ollut: tfimfi 
on Iain sfi9nt0, jonka Herra on kfis- 
kenyt Moosekselle: 

72, Ainoastansa kulta, hopia,. vas- 
ki, rauta, lina ja lyijy, 

23. ja kaikki, mikS tulen kestftft, 
kdyttakAUt tulen Ifipitse, ja se on 
pundas; kuitenkin ovat ne puhdis- 
tusvedelift kirkkaaksi tehtfivat. Mut- 
ta kaikki se, joka ei tuila kestfi, pi- 
tSd teidfin kfiyttfimfin veden ISpitse. 

24. Ja teidfln pitflfl pesemAn vaat- 
teenne seitsemantenfi pfiivfinA, niin 
te tuktte puhtaaksi; sitten tulkaat 
leiriin. 

25. Ja Herra puhui Moosekselle, sa- 
noen: 

26. „Lue vangittujen saalis,sekfl ih« 
miset ettft elfilmet, sinfi ja pappi E- 
leaser, Ja ylimmflisel kansan van- 
himmat 



27. Ja anna puoll saallista nilUe, 
iotka sotaan menivfitiasotineetovat, 
ja toinen puoli muulle kansalle. 

1 Sam. 80:24. 

28. Ja ylennfl veroksi Herralle so- 
tbmiehistfi, Iotka sodassa olivat, alna 
viidestfi sadasta yksi sielu, ihmisis- 
tS, elfiimistd, aaseistaja lampaista. 

29. Heille tulevasta puolesta osasta 
pitfia sinuii ne ottaman ja antaman 
papille Eleasarille , ylOnnykseksi 
Herralle. 

30. Vaan lapsille tulevasta puolesta 
osasta Ota aina viidestfikymmenestS 

JrksU ihmlsistfi, kaijasta, aaseista ja 
ampaista, ja kaikista el§imistfi, ja 
anna ne Levil§isille , jotka vartioit- 
sevat Herran majaa^'* 

31. Ja Mooses ja pappi Eleasar te- 
kivfit niinkuin Herra oli k&skenyt 
Moosekselle. 

32. Ja saalis, joka oli jdlellA sota- 
vSen ry6s^tamdstli saaliista, oli kuu- 
sisataa viisi kahdeksattakymmentfi 
tuhatta lammasta, 

33. kaksi kahdeksattakymmentfi tu- 
hatta nautaa, 

34. yksi seitsemfitlfikymmentA tu- 
hatta aasia. 

35.. Ja naisvAkefi, jotka eivftt olleet 
miehen kanssa maanneet, oli kak- 
sineljfittfikymmentfi tuhatta sielua. 

36. Ja puolet tfistfi, joka sotaan 12lh- 
teneiden osaksi tuli, oli luvultaan 
kolmesataa seitsemSnneljfittfikym- 
mentft tuhatta ja viisisataa lammasta. 

37. josta tuli Herralle kuu^isataa ja 
viisikahdeksattakymmentfi lammas- 
ta* 

38. ja kuusi neljdttakymmentfi tu- 
hatta nautaa, josta Herralle kaksi- 
kahdeksattakymmenta ; 

39. ja kolmekymmentfi tuhatta ja 
viisisataa aasia, josta Herralle yksi 
seitsemattakymmenta ; 

40. niin myOs ihmisten sieluja kuu- 
sitoistakymmenta tuhatta, ja niista 
tuli Herralle kaksi neliattakymmen- 
ta sielua. 

41. Ja Mooses antoi Herran ylOn- 
nysuhrin osan papille Eleasarille, 
niinkuin Herra oli hanelle kdskeny t. 

42. Mutta toinen puoli siita. jonka 
Mooses oli sotamiesten saaliista ja- 
kanut Israelin lapsille, 

43. joka kansalle tuli, oli kolmesa- 
taa seitseman neljattakymmentft tu- 
hatta ja viisisataa lammasta, 

44. kuusi neljattakymmenta tuhatta 
nautaa, 

45. kolmekymmenta tuhatta ja vii- 
sisataa aasia, 

46. ja kuusitoistakymmentft tuhat- 
ta ihmisten sielua. 



172 



I 



4 MOOS. 31 . 32. 



47. Ja Mooses btfi siilH puolesta 
osasia, joka Israelin lasten oli. aina 
yhdenviidestSkymmenesIS, sekS ib- 
misisld ellfi elSimisia, ja anfoi sen 
Leviiaisllle, jolka varlioilsival Her- 
mn majaa, niinkuin Herra oli Moo- 
sekselle kftskenyt. 

48. Ja solavden pd511ysiiiiehet, jolka 
olival asetetut tuhanten ja satain pAA- 
michiksi, menival Mooseksen lykO, 

49. ja sanoivat hdnelle: „sinun pal- 
velijasi ovat laskeneet sotamiesten 
luvun, jotka meidHn allamme oli- 
vat, ja ei siitS yhtdkHAn puutu, 

50. ja me tuomme Hcrralle lahjoja, 
senj51keen kuin kukin saanut on, 
kullaisia esineilA, kflsirenkaita, ran- 
nerenkaila, sormuksia, korvarenkai- 
la, scppeleilii, ettA meidSn sielum- 
me soviletlaisiin Herran edessfi." 

51. Niin Mooses ja pappi Eleasar 
oltivat heilta kul]an,kaikellaisiaesi- 
neim. 

52. Ja kaikki yKJnnysuhrin kulta, 
jonka tuhanten ja satain p55miehet 
Herralle uhrasivat, oli kuusitoista- 
k^mmentAtuhatta seitsemfinsalaa ja 
viisikymmentH sikliS. ~ 

53. SotaVdki oli r>'6vannyt itseku- 
kin edestdnsd. 

54. Ja Mooses ja pappi Eleasar ol- 
tivat kullan tuhanten ja satain p5!l- 
miehiltd, ja he vcivdt sen seurakun- 
nan majaan Israelin lapsille muis- 
toksi Herran eteen. 

32 Luku. 

Rabenin ja Gadfn lapset, ja puoli Manas- 
sen sukuknntaa saavat osakseen inaan Jor- 
danin itfipuolella. 

Dubenin lapsilla oli sangen pal jo 
*^ karjaa, ja Gadin lapsilla oli myds 
aivan suuri joukko karjaa, ja he 
nakivSt Jaeserin ja Gileadin maan, 
ellS se oli sovelias karjan laidun. 
.2. Sentahden tulivat Gadin lapset 
ja Rubenin lapset ja puhuivat Moo- 
sekselle ja papillc Eleasarille ja kan- 
san pSflmiehille, sanoen : 

3. „Atarot, Dibon, Jaeser, Nimra, 
Hesbon, Eleale, Seban, Nebo ja Boon, 

4. se maa , jonka Herra on lySny t 
Israelin kansan edess3, on sovelias 
tnaa karjalle, ja nicill5, sinun pal- 
velijoillasi, on karjaa.'* 

5. Ja he vieia sanoivat: ,Jos me 
olemmearmonlOyl^neet sinun edes- 
(iisi, niin anna sinun palvelijoillesi 
turns maa omaksi ; 2il5 anna meidUn 
menna Jordanin ylitse.** 

6. Mooses sanoi Gadin ja Rubenin 
lapsille: „pitaiskO teidSn veljenne 
menemSn sotaan, ja te j^fitte tfihan? 



7. Miksi te kfifinnfllle Israelin las- 
ten sydSmmet menemflstfi ylitse sii- 
hen maahan. ionka Herra heiUe on 
antanul? 

8. Niin lekivftt my<Js leidftn isfinne, 
kun minS IShetin heidltt Kades Bar- 
neasla kalsomaan tdtfi maata; 

9. kun he tulivat Eskolin malle ja 
nfikiv9t maan, kdHnsivftt he Israelin 
lasten sydAmmen, niin etiei he sii- 
hen maahan tahtoneet mennS, jon- 
ka Herra oli heille antanut. 

4 Moor. 13:388. 24 ss. 

10. Ja Herran viha syttyi sina pfti- 
v9n!l, ja h9n vannoi, sanoen: 

11. Tama kansa, joka Egyptisia lah- 
tenyt on, kahdenkymmenen vuoti- 
set ja vanhemmat, ei suinkaan pidft 
nakeman siia maata, jonka mina 
Abrahamille, Isaakille ja Jaakobille 
olen valan kaulta luvannut, — kos- 
ka eivat ole minua uskollisesti seu- 
ranneet, — 4 Moos. 14:28 ss. 26:65. 

5 Moos. 1:35. 

12. paitsi Kalebia, Jefunnen, Keni- 
siiaiscn poikaa, ja Josuaa, Nunin 
poikaa; siUa he uskollisesti seura- 
sivat Herraa. 

13. Ja Herran viha syttyi Israeliin, 
ja Han laski heidat menemaan kor- 
peen sinne ja tanne neljakymmen- 
ta vuottarSiksi kuin koko se suku- 
kunta hukkui, joka oli Herran edes- 
sa pahaa tehnyt. 

14. Ja katso, te olette nousneet lei- 
dan isanne sijaan, te synlisten si- 
kidt, ja lisaatle vieia Herran vihan 
tulta Israelia vaslaan; 

15. silia jos te kaannytte hanesia 
pois, niin han antaa teidan enem- 
man aikaa viipya korvessa, ja niin te 
saatatte turmion taman kansan yli.*' 

16. Silloin he astuivat hanen eleen- 
sa, ja sanoivat: „me rakennamme 
ainoaslansa tahan pihaloita meidan 
karjallemme, ja kaupungeita mei- 
dan lapsillemmc. 

17.Mutta me ilsetahdommevaruslai- 
da jakiirehtienricntaaisraclinlasten 
edelia, siihen asti elta me saalamme 
heidat paikoilleen ; vaan meidan lap- 
scmme ovat naissa vahvoissa kau- 
pungeissa maan asuvaisten tahden. 

18. Me cmme palaja meidan huo- 
neisimme, enncnkuin Israelin lap- 
set ilsekukin ovat saanect perintOnsa. 

19. Silia emme tahdo heidan kans- 
sansa peria silia puolen Jordanin 
tahi etempaa; vaan meidan perin- 
tdmme oikoon laiia puolella Jorda- 
nia iiaan pain.*' 

20. Ja Mooses sanoi heille: „jos to 
taman teettc, ja varuslalte ilscanhc 
sotaan Herran edcssa, Jos. irisss. 



173 



4 MOOS. 32. 33. 



21. ja menette Herran cdess5 Jor- 
dnnin ylilse. jokainen kuin teistti 
on varustetlu, siksi etta hiXn ajaa 
kaikki vihollisensa pois kasvoinsa 
edestS, 

22. ja maa tulee Herran edcs.sn ala- 
maiseksi; ja (e sittcn palajaltc ta- 
kaisin, niin te olette viattomat Her- 
ran ja Israelin edessS, ja niin (limn 
maa on teiddn omanne Herran edes- 
sS. 

23. Multa jos ette niin (ee, kafso, 
niin te rikoUe Herraa vaslaan,'ja 
saatte tuntea, eU5 rangaistus k5sil- 
taa teiddt. 

24. Niin rakenlakaat siis kaupun- 
geita teidSn lapsillcnne, ja pihatoita 
leiddn karjallenne, ja lehkiiftl niin- 
kuin te sanoille.*' 

25. Ja Gadin ja I\ubenfn lapsct sa^ 
noival Moosckselle: „sinun palveli- 
jasi IckevSt niinkuin minuri herrani 
on kSskenyf. 

26. Mcid5n lapscmmc, vaimomme, 
tavaramme ja kaikki karjamme jaA- 
vSt GiJeadin kaupunkeihin. 

27. Multa me, sinun palvclijasijaii- 
demme kaikki ylidcssa joukos.sa va- 
rusletluna solaan Herran edessd« 
niinkuin herrani on sanonut.'' - 

Jos. 4:12. 

28. Niin Mooses kflski heidan puo- 
leslansa pappia Eleasaria, ja Josua- 
la, Nunin poikaa, ja Israelin lastcn 
sukukunlain vlimmriisiil isin, 

29. ja sanoi hcillc: ,oos Gadin ja 
Bubenin lapset mencvSt tcid5n kans- 
sanne Jordanin ylilse, kaikki varus- 
telluna sotaan Herran edessS, ja Ic 
saatte kaikki maan haltuunne, niin 
antakaat heille Gileadin maa omaksi. 

30. Vaan jps eival he mcne varus- 
tetluna teidiln kanssanne, niin peri- 
kO<Jt teidan kanssanne Kanaanmaal- 
la." 

31. Ja Gadin ja Rubenin lapset vas- 
tasivatja sanoivat: ^niinkuinHcrra 
on puhunut sinun palvelijoillcsi, 
niin me Iccmme. 

32. Me mcncmme varustctluna Her- 
ran edess5 Kanaanmualle, ja niin 
omistamme mcid5n perintOosammc 
tdlia puolella Jordanin.'* 

33. Niin Mooses antoi Gadin ja Ru- 
benin lapsill*^ ja puolelle Manasscn, 
Josefin pojan, sukukunnalle Siho- 
nin, Amorealaistcn kuninkaan val- 
takunnan, ia Ogin, Basanin kunin- 
kaan valtakunnan, maan kaupun- 
keinensa, jotka niissil maan Ailrissa 
ympSrillh olivat. 4Mpos.34:i4. 

5 Moos. 3:12,13. 29:8. Jos. 13:8. 22:4. 

34. Ja Gadin lapsct rakensivat Di- 
bonin, Alarolin, Aroerin, 



35. Alarot-Sofanin , Jaeserin, Jog- 
behanin, 

30. Bclnimran ja Belaranin, vah- 
vat kaupungit ja pihatot. 

37. Rubenin lapset rakensivat Hes- 
bonin, Elealen, Kirjalaimin, 

38. ja Nebon, Baalmconin, Musa- 
botsemih ja Sibman, pa antoivat ni- 
met niille kaupungeille, jotka. he 
rakensivat. 

39. Ja Makirin, Matiassen pojan 
lapset, meniviit Gilcadiin ja voilli- 
vat senja ajoivat ulos Amorealaiset, 
jotka sielia asuivat. i Moos. 60:23. 

5 Moos. 8:15. 

40. Niin Mooses antoi Makirille, 
Manasscn pojalle, Gileadin, ja hHu 
asui siclla. 

41. MuUa Jair, Manasscn poika, me- 
ni ja voitti heidan maan kyl5ns5, 
jotka \ii\n kutsui Jairin kyliksi. \ 

5 Moos. 3:14. 

42. Mcni myos Noba, ja voitti Ke- 
natin tvttArinensil, ja hUn kutsui 
sen Nobaksi ninicn.sa mpkaan. 

33 Luku. 

Israelii! Inston Iciripaikat korpivnclluksen 
aiknna. 

NamH ovat Israelin lastcn matkat, 
kun he Ulksivat Egyplin maalta, 
jarjestctyt joukkoihinsa, Mooseksen 
ja Aaronin johdolla. 

2. Ja Mooses kirjoitti hcidSn mat- 
kansa, niinkuin he matkustivat Her- 
ran kilskyn jalkeen. Ja namit ovat 
heidan malkusfuksen.sa IShtdpaik- 
kain mukaan: 

3. Ja he inksivilt matkalle Ramsck- 
scsta viidcntcndtoista pSivilnfl cn- 
simmnisessil kuukaudessa; toisena 
pftiviUiii p5nsi5isestn lAksivat Israe- 
lin lapsct ulos korkian kadenkaut- 
ta, kaikkcin Egyplilaistcn .silmfiin 
cde.ssa. 2M00S. 12:37. 14:S. 

4. Ja Egyplilaiset hautasivat esi- 
koisensa, jolka Herra heidan seas- 
.sansa lyGnyt oli, ja Herra oli myOs 
antanut tuomion kaydi\ heidan ju- 
malicnsa ylitse. 2Moos. 12:12. 

5. Kun Israelin lapset olivat vacl- 
taneet Ramsckscsta, niin he sijoitti- 
vat itsensH Sukkotiin. 

6. Ja matkustivat Sukkotista, ja si- 

i'oittivat itscnsil Etamiin, joka on 
Lorven jlarcUa. 2 Moos. 13:20. 

7. Ja he matkustivat Etamista' ja 
palasivat Pi-hakirotiin,joka onBaal- 
scfoniin pilin, ja sijoittivat itsensfi 
Migdolin kohdalle. 2Moos. 14 2. 

8. Ja he matkustivat Hakirotin 
cditse ja kavivHt keskcltA mcrta kor- 
pccn, ja matkustivat kolmc pilivA- 



174 



4 MOOS. 3B. 



kuniaa Etamin korvessa, ja sijoitti- 
vat ilsensfi ^laraan. 2 Moos. 1422. 15:23. 

9. Ja he matkustivat Marasla Ja tu- 
livat Elimiin; jn Elimissil oli kak- 
siloisla iahdettfl, ja seitsemflnkym- 
inenlfi palmupuuta, jn he sljoitlivat 
ilsensa sielia. 2Moos. 15:27. 

10. Ja he mnlkuslivat Elimista, ja 
sijoitiivat ilsensS Punnisen ineren 
ramialle. 

11. Ja he matkustivat Punaiseii me- 
ren luola, ja sijoittivat ilsensH Sinin 
liorpeen. 2Moos. 1G:1. 

12. Ja he matkustivat Sinin kor- 
vesta, ja sijoittivat itscnsfi Dofkaan. 

13. Ja he matkustivat Dofkasta, ja 
sijoittivat itsensd Alusiin. 

14. Ja he matkustivat Alusista, ja 
sijoittivat itsensn Hafldimiin, jasiinfl 
ei ollul kansalle vettA juoda. 

2 Moos. 17:1. 

15. Ja he matkustivat RafidimistH, 
ja sijoittivat itsensi\ Sinain korpcen. ] 

2 Moos. 19:1 SS. 

16. Ja he matkustivat Sinnin kor- 
vesta, ja sijoittivat itsensH Himohau- 
tloille. 4M0O8. 1134.- 

17. Ja he matkustivat Himohaudoil- 
lA. ja sijoittivat itsensA Ilascrotiin. 

4 Moos. 11:35. 

IS. Ja he matkustivat Hascrotistu, 
ja sijoittivat itsensfi Kitniaun. 

19. Ja he matkustivat Kitmnstn, 
j:i sijoittivat itscnsA nimonParesiiii. 

20. Ja he matkustivat ItimonPuro 
sesta, ja sijoittivat itscnsH Libnaun. 

21. Ja he matkustivat Lil)nasta, ja 
sijoittivat itsensA Rissaan. 

22. Ja he matkustivat liissasta, Ja 
sijoittivat itsensA Kchelalaan. 

23. Ja he matkustivat Keliclatasta, 
ja sijoittivat itsensA Saferin vuorellc. 

24. Ja he matkustivat .S^irerin vuo- 
relta.ja sijoittivat itsensA Haradaan. 

^- Ja he matkustivat Harada^ta, i 
ja sijoittivat itseusA Mukhelotiin. 

26. Ju he matkustivat Maklielotistu, 
jn sijoitiivat itsensA Tahatiin. 

27. Ja he matkusti\at Tahatista, Ja 
sijoitiivat itsensA Taraan. 

25. Ja he matkustivat Tarasta, Jm 
sijoittivat itsensA Mitkaan. 

29. Ja he matkustivat Mitkasta, Ja 
sijoittivat itsensA Masmonaa'n. 

30. Ja he matkustivat Hasmonasta 
ja sijoittivat itsensA Moserotiin. * 

5 Moos. 10:0. J 

31. Ja he matkustivat Moserolista. 
ja sijoittivat itsensA Bcne-Jaokaniin. 

32. Ja he matkustixat Bcnc-Jaoka- 
nisia, ja sijoittivat itsensA Horgid- 
nadiin. 

33. Ja he matkustivat Horgidji^ndis- 
^f ja sijoittivat itsensA Jotbataan. 



34. Je matkustivat Jotbatastaf ja si- 
joittivat itsensA Abronaan. 

35. Ja he matkustivat Abronasta, Ja 
sijoittivat itsensA Etsionseberiin. 

3C. Ja he matkustivat Etsfongebe- 
rista. ja sijoittivat itsensA Sinin kor- 
peen, se on Kades. 4Moos. 2u:i. 

37. Ja he matkustivat Kadeksesta, 
ia sijoittivat itsensA Horin vuorelle, 
joka on Edomin maan rajoilla. 

4 Moos. 20:22. 

38. SifnA meni pappi Aaron Horin 
vuorelle* Herran kAskyn jfdkeen, ja 
kuoli siellA neljAnteiiAkymmenen- 
tenA vuotcnn, sittekuin Isrnelin lap- 
set olivnt lAhtcneet Egyptin maal- 
ta, ensimmAisenA pAivAnA viiden- 
nessA kuussa. 4 Moos. 20:25 ss. 

5Moos. lO.C. 32:50. 

39. Ja Aaron oil sadan ja kolmen- 
kolmattakymmentA vuolinen kuol- 
lessansa Horin vuorella. 

40. Silloin kuuli Kananealaisten ku- 
ningas. joka asui Aradissa, etelAAn 
pAin Kanaanmaalla , ettA Israelin 
lapsct olivat tulossa. 4Moos.21:l. 

41. Ja he matkustivat Horin vuo- 
reltaja sijoittivat itsensA Salmonaan. 

4 Moos. 21 :4. 

42. Jo he matkustivat Salmonasta. 
Ja sijoittivat itsensA Punoniin. 

43. Ja he matkustivat Punonista. Ja 
sijoittivat itsensA Obotiin. 

4 Moos. 21:10. 

44. Ja he matkustivat 01>otista. Ja 
siioittivat itsensA Ije-Abarimiin,Moa- 
bin rajoille. 4Moo8.2i;ii. 

45. Ja he matkustivat IjestA« ja si- 
joittivat itsensA Dibon-Gadiin. 

4G. Ja he matkustivat Dil>on-Gadis- 
ta, Ja sijoittivat ItsensA Aimon-Dib- 
lataimiin. 

47. Ja he matkustivat Almon-Dib- 
lataimista, Ja sijoittivat itsensA Aba- 
rimin vuorelle Nebon kohdallc. 

4 Moos. 21.11 

48. Ja he matkustivat Abarimin 
vuorelta. Ja sijoittivat itsensA Moa- 
bin kedoille, Jordanin rannalle Je- 
rikon kohdalle. 1MOO0. 2-J:i. 

49. Ja he sijoittivat ItsensA Jorda- 
nin rannalle hamasta llet-Jesiniotis- 
ta ainu Abel-Sittimiin Moabin ke- 

doilla. 4Moop. 2.M. 

30. Ja Herra puhul Mooseksclle, 
Moabin kedoilla. Jordanin rannaila, 
Jerikon kohdalla. sanoen: 

51. Puhu Israelin Inpsille, Ja snno 
heille: kun olottc lullect Jordanin 
vlitse Kanaaimiaalle. 
*5*i. niin tcidAn niiAA kaikki sen 
mannasukkaal teiuAnedcslAnne aja- 
man pois, ja kaikki lieid;in maala- 
tut kuvapat-saansa ja valetut kuvan- 



175 



i MOOS. 33. 34. 35. 



sa hflvittfim&n, ja kaikki heidfin uh- 
rikukkulansa kukistaman. 

2 moos. 23:32. 84:1288. 5 Moos. 7:288. 

Jos. 11:12. 

53. Ja nlin omistakaat tnaa ja asu- 
kaat siin&; sillS teille olen minfi 
maan antanut omistaaksenne sen. 

54. Ja teidfin pitfifi maan jakaman 
arvallateiddn sukukunnillenne. Joi- 
ta usiampi on, niille pitfifi teidfin 
enempi antaman perinnOkseksensfi; 
ja joita vfihempi on, niille vfthem- 
inSn perinn<JkseksensS : mihin arpa 
lankee kullenkin, siella olkoon hfl- 
nen osansa; isfiinne sukiikuntain 
jftlkeen pitdfi teidSn perinrftn. 

4 Moos. 26:56. Jos. 14:2. 

55. Mutta jollette maan asuvaisia 
^a ulos teiadn edestftnne, niin ovat 
ne, jotka heistft jfitfttte, teille niin- 
kuin orjantappurat silmiss^nne ja 
keihSs kyljessanne; sillft he ahdis-. 
tavat teitfi siin& maassa, jossa te 
asulle. Jos. 23.13. Tuom. 2:3. 

56. Ja silloin tapahtuu, ettS minfi 
teen niin teille ^ kuin minft aivoin 
heille tehdfi. 

34 Luku. 
Luvatun maan rajat; jakajain nimet 

JaHeiTapuhuiMoosekselIe,sanoen: 
2. Kdske Israelin lapsia, ja sano 
heille: kun te tulette Kanaanmaalle, 
niin se maa se on, joka tc^ille peri- 
miseksi lankeaa,Kanaanmaangain- 
sa jfilkeen. 

3. CtelSn puoli rupeaa Sinin kor- 
vesta Edomin tykdfi, ja eteia rajan- 
ne kfiy Suolaisen meren fifirestfi, jo- 
ka itfifin pain on. i Moos. 14:3. 

2 Moos. 28:31. Jos. 15:1 ss. 

4. Ja se rajanne kfifintyy etel5puo- 
lella Akrabimin kukkulaa ja menee 
Siniin. niin ettft sen uloskfiyminen 
on etelfin puolelta KadesBarneaa ja 
ulottuu Hasar-Adariin, ja menee As- 
moniin. 

5. Sitten kfiftntyy raja Asmonista 
Egyptin virtaan pain ja loppuu me- 
ressa. 

6. Mutta rajanaianteen pain olkoon 
teilia suuri meri; se on maanne 
aari lanteen pain. 

7. Ja tama on rajanne pohjaan 

£ain : kaykaat raja suuresta meresta 
amaan Horin vuoreen asti, 

8. ja Horin vuoresta maaratkaat ra- 
ja siihen astl'etta Hamatiin tullaan, 
niin etta raian loppu on Sedadassa. 

9. Ja se raja menk^JOn Sifoniin, ja 
sen loppu olkoon Hasar-Enanissa. 
Se olkoon teidan rajanne pohjoisessa. 

10. Ja my<Js maaratkaat rajanne 
itaan pain, Enanista Sefamiin. 



i 



11. Ja raja .iienk06n Sefamista alas 
Riblaan asti, Ainin itapuolella; sitte 
juoskoon se alaspain, ja menkOOn 
tCfnneretin meren sivutseitapuolella, 

12. ja tulkoon Tt^a alas Jordanille, 
a'sen loppu olkoon Suolainenmeri. 
e on oleva teidan maanne, n^oi- 

nensa joka taholta. 

13. Ja Mooses kaskl Israelin lapsia, 
ja sanoi: tama on maa, jonka tei- 
dan pitaa jakaman keskenanne ar- 
valla, jonka Herra kaski antaa niille 
yhdeksaile sukukunnalle , ja sille 
puolelle sukukunnalle; 

Xi. silia Rubenin lasten sukukun- 
ta, heidan isainsa huonekuntain jftl- 
keen, jaGadIn lasten sukukunta hei- 
dan isainsa huonekuntain jaikeen; 
ja puoli Manassen sukukuntaa ovat 
JO saaneel osansa. 4 Moos. 32:33. 

15. Nama kaksi sukukuntaa jasepiro- 
11 sukukunta ovat saaneet penntO- 
osansa taiia puolen Jordania, Jerikon 
kohdalla itaan pain. 

16. Ja Herra puhui Moosekselle, 
.sanoen: 

17. Naiha ovat miesten nimet, iot- 
ka maan teille jakavat: pappiElea- 
sar ja Josua,Nunih poika. Joe. 14:1. 21:1. 

18. Siihen my<Js ottakaat yksi paa- 
mies jokaisesta sukukunnasta^maa- 
ta jakamaan, 

19. la nama ovat miesten nimet: 
Juudan sukukunnasta Kaleb, Jefun- 
nen poika ; 

20. simeonin lasten sukukunnasta 
Semuel, Ammihudin poika; 

21. Benjaminin sukukunnasta Eli- 
dad, Kislonin poika; 

22. Danin lasten sukukunnan paa- 
mies, Bukki, Joglin poika; 

23. Josefin lapsista, Manassen su- 
kukunnan paamies, Hanniel, Efodin 
poika; 

24. Efhiimin lasten sukukunnan 
paamies, Kemuel, Siflanin poika; 

25. Sebulonin lasten sukukunnan 
paamies, Elisafan, Pamakin poika; 

26. Isaskarin lasten sukukunnan 
paamies, Paltiel, Assanin poika; 

27. Asserin lasten sukukunnan paa- 
mies, Akihud, Selomin poika; 

28. Naflalin lasten sukukunnan paa- 
mies, Pedahel, Ammihudin poika. 

29. Kama ovat ne, jotka Hen-a on 
kaskenyt Israelin lasten perinloosaa 
jakamaan Kanaanmaalla. 

35 Luku. 

LeviUisten kanpungit Vapaakavpungit 
Laki murhaajista. 

J a Herra puhui Moosekselle, Moa- 
bin kedoilla, lasna Jordania Jeri- 
kon kohdalla, sanoen: 



176 



4 MOOS. 85. 



X Kfiske Israelii! lasten antaa peri^ 
misestftnsfi LevilHisille kaupungeita 
asuakscnsa niissfi; aniakaat iny6s 
U\il3isille esikaupunkeja niiaen 
ympfirilia, Jos. 21:2. 

3.ett9heasuisivat kaupungeissa. fa 
PitSisivfltkaijansa.tavaransajakaik- 
kinaiset cl2liniens2\ esikaupungeissa. 

i Esikaupungit, jotka teidfln tulee 
antaa Levililisille, pitaa oleman tu- 
hannen kyyn3rStIl Kaupungin muu- 
rista ulos pSin yltympdri. 

5. Kiin teidfin pitHJI mittaaman 
kaupungin ulkopuolclla : idfln puo- 
lelle kaksi tubatta kyynfirHlfi, ja ete- 
liln puolelle kaksi tuhatta kyynSrfi- 
tS, ja lannen puolelle kaksi tuhatta 
kyynSHllS, ja pohjan puolelle kaksi 
luhaCla kyynSHlta, etlfi kaupunki 
olUi keskellfi. NOma olkoot heidfin 
esikaupunkinsa. 

6.'Ja niiden kaupunkien seassa, 
jotka te annatte Levilftisille, olkoon 
kuusi vapaakauj)unkia, etUt sc. joka 
' jonkun kuoliaaksi lyO, pakenisi nil- 
bin; paitsi nfiita pitfifi telddn an- 
taman heille kaksi viidettakymmen- 
a kaupunkia, 2 Moos. 21:I3. 

5MooB.4:4l88. Jos. 20:2 8S. 21:3. 

7. niin ettft kaikkiansa kaupungei- 
ta, jotka te annatte LevilfifsiUe, tu- 
lee kahdeksan viidetiakynimentfi esi- 
kaupunkeinensa. 

8. Ja ne kaupungit Jotka te annatte 
Israclin lasten omaisuudesta , ovat 
niin annettavat, ettft se, jolla paljon 
on, antaa enemmfin, ja se, jolla vfi- 
nftnon,antaa vShemman; antakoon 
ilsekukin Levilfiisille kaupunkeja 
jaossa saadun perimisensfl mukaan. 

9. Ja Herra puhui Moosekselle, sa- 
noen: 

JO. Puhu Israelin lapsille ja sano 
heille: tultuanneJordanin yfitse Ka- 
naanmaahan, 

.11. valitkaat itsellenne kaupunflit, 
jotka olkoot vapaakaupungeita, joi- 
ninka tappaja voipi paeta, kun hfin 
japalarmasta on jonkun kuoliaaksi 
tyjnyt. 6M008. 19:288,' 

12. Ja senkaltaiset vapaakaupungit 
olkoot teidankeskelianneturvapaik- 
kana vereii kosti^an tflhden, eltei 
tappaja kuolisi ekinenkuin hSn ko- 
ko seurakunnan oikeuden edessft 
on seisonut. 

13. Ja ne kaupungit jotka te an- 
natte, olkoot teille Kuusi vapaakau- 
punkia. 

14. Kolm^ kaupunkia pitilfi teidfin 
anlaman tfillft puolen Jordaniav ja 
kolme itse KanaanniaaUa;,nfii)afi ol- 
koot vapaakaupungit.' 

15. Seka Israeuii laj^e, ettA muu 



kalaisille ja huonekuntalalsitic hei* 
dSn seassansa« olkoot ne kuusi kau- 
punkia pakopaikkana, johon jokai- 
nen vol paeta, joka tapaturmassa 
jonkun sielun kuoliaaksi Iy6. 

16. Mutta jos joku lyO toista rautai- 
sella aseella, niin ettfi hfin kuolce, 
hfin on murhaaja ; murhaajan pitfiil 
totisesti kuoleman. 1 Moos. 9:6. 

2 M008. 21:1288. 3M008. 24:17 88. 

17. Ja joS hfin paiskaa jonkun ki- 
vellfi, joka hfinen kfidessfinsfi on« 

i'osta voi kuolema seurala, Ja se 
molee, niin hfin on murhaaja, ja 
hfinen pitfifi totisesti kuoleman. 

18. Jos hfin ]y6 hfintfi jbllakulla 
puuaseella, josta kuolema voi seu- 
rata, ja se kuolee, hfin on marhaa- 
ja,ja hfinen pitfifi .totisesti kuoleman. 

19. Verenkostaja saa tappaa mur- 
haajan; missfi kohdanneekin. saa 
hfin hfinet tappaa. 

20. Jos joku svOksee toisen vihasta 
taikka paiskaa nfintfivfiijytessfi, niin 
ettfi hfin kuolee* &Moos.i9:ii. 

21. taikka viliasta ly6 toista kfidel- 
Ifinsfi, niin ettft hfin kuoled, niin to- 
tisesti kuoletettakoon se, joka Idi, 
sillfi hfin on murhaaja. Verenkosta- 
ja saa kohdalessaan hfinet tappaa. 

22. Mutta jos hfin s^dksee hfinet ta- 
paturmasta ilman vihaa, taikka heit- 
tfifi jotakin hfinen pfifillensfi ilman 
pahaa tarkoitusta, 2MoeR.2i:i3. 

23. taikka nfikemfittfi hfintfi h'eittfifi 
hfintfi kivellfi, josta kuolema saattaa 
seurata, niin ettfi hfin kuolee, eikfi 
ole hfinen vihamiehensfi , eikfi hfi- 
nelle mitfifin pahaa aikonut, 

24. niin seurakunta tuomitkoon Iv^ 
jfin ja verenkostajan vfililifi nfiiden 
sfifintOjen mukaan. 

25. Ja kansan pitfifi vapahtaman 
murhaajan verenkostajan kfisistfi» 
antaen hfinen palata vapaakaupun- 
kiin jfiUeen, johonka hfin pakeni; 
ja siellfi pitfifi hfinen oleman ylim- 
mfiisen papin kuolemaan asti, joka 
pvhfillA Oljyllft on voideltu. 

26. Mutta jos murhaaja rohkiasti 
menee vapaakaupunkinsa rajain 
ylitse, johonka hfin paennut on, 

27. ja verenkostaja tapaa hfinet ul- 
kona vapaakaupunkinsa rajoista, ja' 
lyO hfinet' kuoliaaksi, niin.ci hfinel- 
le mitfifin verenvikaa siit^ tule; 

28. sillfi hfinen piti vapaakaupun- 
gissansa oleman ylimmaisen papin 
kuolemaan asti,jaylimmfiisen papin 
kuoleman ifilkeen tuleman perintO- 
maallensa jfiUeen. 

29. Nfimft olkoot teille |a lapsillen- 
ne oikeuden sfifiiit^Jnfi suvusta su- 
kuuD, missfi asunettekin.. 



177 



4 MOOS. 35. 3G. 5 MOOS. 1. 



30. Jos joku lyO foiscn kuollnnksi, 
niin murhnajn on kuoletcUavn to- 
distajaiii todisluksen mukann; mut- 
ta vhden todislajan todislus cl olc 
kylUksi kuoleman tuomioon. 

OMoos. 17:C. 19:15. Matt 18:16. Joh.8:17. 
2Kor. 13:1. Hcbr. 10:28. 

31. Alkaat otlako yhtiian lunastus- 
hintaa murhaajan hcngcn cdestil, 
joka on kuolcmaan vikap32; silld 
IiAnen pildd (otlscsli kuoleman. 

32. Jd aikagl oltako yhtnan hinlaa 
silts, ioka vapaakaupunkiinsa paen- 
nut oli.ja tahtoisi palata jAllcon asu- 
niaan maassa cnnen papin kuole- 
mata. 

33. AlkAilt saastutlako inaala, jossa 
le asutto; silia sc, joka vcrccn vika- 
pft& on, han saastuttaa maan, ja 
maata ei voida. puhdistaa vcrestH, 
joka siihcn vuodalctlu on, muuloin 
kuin sen vcren kautta, joka sen vuo- 
dattanut on. lMoos.9:G. 

34. Alkttat saastuttako maala, jossa 
te asutte, jossa myOs minS asun; 
sillft mInS olen Herra, joka asun 
Israclin laslen keskellS. 

36 Luku. 
Selofkadin tyt&rtcn naimisista* 

J a ylimmHiset isilt Gileadin lasten 
suvusia, joka oli Manasscn pojan 
Makiiin poika, Josctin lasten suvus- 
ia, kSvivat edes, ja puhuivat Moo- 
seksen ja pi\amiesten , Israclin las- 
ten ylimmfiislen isfiin edcss5, 

4 Moos. 2C:29 ss. 

2. ja sanoivat: ,,Horra kdski minun 
hcrrani jakad maan arvalla Israclin 
lapsille perittataksi. Ja sin5, minun 
herrani, oletHcrralta saanut kSskvn 
antaa mcidAn veljemme Seloflcaclin 
perimyksen hdnen lytt5rillensS. 

4 Moos. 26:55 S3. 27:1,8. Jos. 17:3 ss. 

3. Mutia jos he joutuvat valmoiksi 
jollekulle Israelin lasten toisista su- 
vuista, niin otetaan heldfin pcrin- 
tOnsft nieidSn isfiimme perikinOstd, 



ia lisataun sen suvun pcrimykscen, 
johon he tulevat, ja niin tulee mel- 
dHn perimykscmme orpa vfihenne- 
lyksl. 

4. Kun Israclin lasten riemuvuosi 
tulee, niin lisAtiinn heidAn perintOo- 
sansa sen siivun pcrimykscen, jo- 
honka he tulevat; ja nain heidSn 
perintonsS otetaan pois mcidtln i- 
silimmc perimykscsta.** SMoos. 25:13. 

5. Silloin saasi Mooses Israclin lap- 
sille Herran kaskyn mukaan, ja sa- 
noi: „Joscnn lasten suku on oikcin 
puhunut. 

G. TAnul on sc, mfnkA Herra kHski 
Sclol'kadin tyltHrista, ja sanoi : inon- 
k6dt naimisun kcIlenkH he tahto- 
vat.kuitcnkin niin, cttA he mcnevrit 
naimisiin jollekin isdinsa sukukun- 
nasia, 

7. cttei Israelin lasten perimys nie- 
nisi yhdcsta suvusta toi.secn; silla 
jokainen Israelin lasten seassa riip- 
pukoon kiinni isilinsil sukukunnan 
perimyksessn. 

8. Ja kaikki tyttSret, joilla on pe- 
rimys jossakin Israelin lasten suvus- 
sa, mcnk56t naimisiin jollekulle i- 
sansH sukukunnasta, ettti jokainen 
Israelin lasten seassa pitSisi isHnsa 
perimyksen, 

9. ja cttei perintOosa mcnisi yhdes- 
lt\ sukukunnasta toiseen, mutla jo- 
kainen py.syisi omas.sa perimykscs- 
sansalsniehn lasten sukuin .seassa.^* 

10. Niinkuin Herra kaski Moosck- 
selle, niin tekivat Selofkadin ty ttHret : 

11. Mahela, Tii-sa, Hogla, Milka, 
Noa, Selofkadin tyttSrcl, menivut 
naimisiin sctfiinsS pojillc, 

12. ja tulivat vaimoiksi niillc, jotka 
olivat Manasscn, Josefin pojan su- 
vusta; niin pysyi licidSn perimyk- 
sensS heidSn is^nsA huonekunnan 
suvussa. 

13.Namn ovatnekaskyt ja oikcudet. 
joita Herra Mooscksen kautta sCxiXsi 
Israelin lapsille, Moabin kedoilla, 
Jordanin raiinalla, Jerikon kohdalla. 



VIIDES MOOSEKSEN KIRJA. 

DEUTERONOMION. 



I Luku. 

Mooses. pubuu kansalle-siitli, mit& oli kor- 
pivaelluksen aikana tapahtuDuL 

Nflm3 oyat ne sanat, iotka Mooses 
puhui koko Israelille tdllA puo- 
len Jordanin, korvessa, Araban ke- 



dolla Punaisen mcren kohdalla, Pn- 
ranin. Tofclin, Labanin, Haserotiu 
ja Disahabin vaiheella. 5Moos. 33:2. 

2. Yksitoisla paiv{\matkaa on Ho- 
rcbista, Scirin vuoren kautta Kades 
Barneaan asti. 

3. Ja tapahtui neljAntenftkymnic- 



178 



5 MOOS. 1. 



nen(en5 vuonna, cnsilnmUiscn^ pSi- 
vflnS, ensimmuiscssil kuussa loisla- 
kymmentfi^ etia Mooses puhui Israe- 
llnlapsllle kaikki, milrt Herra ha- 
nen kAski heillc puliua. 

4. Sillckuin hSn oli lyftnyl Sihonin, 
Amorilaislcn kuninkaan, joka Hes- 
bonissa asui, niin myOs Ogin, Ba- 
sanin kuninkaan, joka Astarolissa 
Edrcissa asui, • 4 Moos.' 21:24. 21:33. 

5. tSIia puolcn Jordanin, Moabin 
maalla, rupcsi Mooses selittamaan 
tfila lakia, ja sanoi : 

6. Herra, meidHn Jumalamme, pu- 
hui meillc Horcbissa, sanocn: le 
olcltc jo kylia kauan olleet Ullla 
vuorella ; 

7. kfiantykaat ja menkaat malkaan 
Amori.laislen vuorelle, ja kaikkcin 
heita lahelia asuvaislen lyk5, kcdol- 
la, vuorella, alankomaassa, eleia- 
maassa ja meren salamissa,Kanaan- 
raaalle ja Libanoniin, hamaan suu- 
recn Fralin virlaan asli. 2 Moos. 23:31. 

8. Katso, niina olcn teille antanut 
niaan, jolta on Icidan edcssSnne; 
menkaat ja omislakaaf se maa, jos- 
la Herra Icidan isillenne Abraham 
■nillc, Isaakille ja JaakobiHc vannoi 
anlavansa sen Iicillc ja hcidan sie- 
incncllensa lieidSn jalkcensa. 

1 Moos. 15:18. 17:8. 

9. Niin mina puhuin leilie silloin, 
sanocn : „en mma voi yksinani kan- 
laa leiia. 2Moos^i8:i8. 

10. Silia Herra, IcidHn Jumalanne, 
on lisannyt teitu, ja katso, tc olclle 
tilmlpana niin monta, kuin taivaan 
tntidet. 

11. Herra, teidan isainne Juniala, 
lisalkodn tciUl vicla monia luliatia 
kcrlaa encmmaa, ja siunalkoon Ici- 
la, niinkuin ban leillc sanonut on. 

12. Kuinka mina yksinani voin kan- 
laa teidan laakkannc, kuormanne 
ja riilanne? 

13. Valitkaat teille loimelliset, ym- 
niarlavaisct ja tunnetut miebet tei- 
dan suvuislanne, ja mina asetan 
bcidai teidan paamiehiksenne." 

14. Niin le vastasitte minua, sa- 
nocn: „hyva on asia, josta puliut 
tehdaksesi.** 

15. Niin olin mina bc ylimmaiset 
leidun suvuistannc, toimelliset ja 
(unnetut miehet, ja asetin teille paa- 
michiksi, tuhannen, sadan, viiden- 
kymmcnen ja kymmenen paamie- 
hiksi, ja csimiehiksi teidan suku- 
kunnillenne. 

IC. Ja mina myOs kaskin teidan 
tuomareianne silloin, sanoen : kuul- 
knat teidan veljianne, ja tuomilkaat 
oikcin jokaisen mieben ja banen 



veljensa vaiilia, ja hanen rauuka- 
laisensu vaiilia. Joh. 7:24. 

17. Alkaat katsoko kenenkfian muo- 
toa tuomiossa, vaan kuulkoQt nlln 
)ienta kuin suurtakin; aikaat pel- 

, atkO kctaan, silia tuomio on Juma- 

an. Mutta jos joku asia tulee teille 

ilka raskaaksi, niin antakaat sen 

tulla minun eteeni, kuullakseni sita. 

2 Moos. 18:2G. 23:3. 3 Moos. 10:15. 

5Moos.lC:19. 2Aik. 19:6. San.lS:S. 24:23. 

28:21. Jaak.2:9. 

18. Ja mina kaskin teita siiben ai- 
kaan kaikista, mita teidan tekeman 
piti. 

19. Niin me laksimmo Horebista, 
ja vaelsimme koko sen suuren ja 
birmuisen korveii ISpitSe, jonka tc 
nabnect olettc, Ambrilaisten vuori- 
seuduille, niinkuin Herra, meidan 
Jumalamme, mcille kaski. Ja metu- 
limme Kadcs-Barneaan, 

20. Niin sanoin mina teille: „to 
olette tulleet Amorilaislcn vuorelle 
asli, jonka Herra, meidan Juma- 
lamme, anlaa mcille. 

21. Knlso, Herra, sinun Jumalasi, 
on sinulle antanultaman maan; me- 
ne ja omisla se, niinkuin Herra, si- 
nun isaisi Jumala, sinulle sanonut 
on ; aia pelkaa, aiaka bammasty.*' 

22. Ja te lulitle kaikki minun ty- 
k5ni, ja sanoitte: „1ubettakaamme 
miebet meidan edellamme vakoo- 
maan maala, ja ilmoiltamaan mcil- 
le tieta, jola meidan sinne mene- 
man pitaa, ja kaupungeita, joibin- 
ka meidan tuleman pitaa.** 

23. Ja asia kelpasi minulle; ja mi- 
na otin kaksiloista miesta .teidan 
seastanne, jokaisesta sukukunnasta 
yhden. 

24. Ne menivat matkaansa, ja as- 
tuivat vuorelle, ja tulivat Eskolin 
laaksoon asti, ja vakosivat sen. 

4 Moos. 13:3,24. 

25. Ja he ollivat maan bedelmasta 
myQlansa ja toivat mcille, ja ilmoit- 
tivat mcille asian,ja sanoivat: „maa 
on by va , jonka Herra , meidan J u- 
malamme, mcille anlaa.'*" 

2G. Mutta cite tabtoneet menna sin- 
ne, vaan olitte vastabakoiset Herran, 
teidan Jumalanne sanalle, 

27. ja napisillc majoissanne, ja sa- 
noille: „Hcrra on mcille vibainen, 
ja on tub'nut mcldat ulos Egyptin 
maalla, anlaaksensa meidat Amori- 
laislcn kasiin bukutettaviksi. 

4 Moos. 14:2. 

28. Kubunka menemme? Meidan 
veljcmme ovat peljattancet sydam- 
memmo, sanocn: se kansa on suu- 
rcmpi ja yarlevampi meita, ja ne 



179 



5 MOOS. 1. 2. 



kaupungit ovat suuret ja varusletul 
taivaasecn asli; me olemme my6s 
nfthneet sielia Enakin poikia." 

4 Moos. td:29. 

29. Ja minfi sanoin teille: „filkfiflt 
hammaslykO, aikftSt my6s peljasty- 
kO hciia: 

30. silia Herra, tekian Jumalanne, 
kay teidan edelianne, ja solii leidan 
puoleslanne.niinkuin ban myasleh- 
nyt on Egyplissa teidan silmainne 
edessa, 2 Moos. 14:14,24 ss. Jos. 10:14,42. 

31. ja korvessa, jossa sina olet nah- 
nyl, kuinka Herra, sinun Jumalasi, 
on sinun kanlanut. niinkuin mies 

cantaa poikansa, koko silia tielia, 
Ota te vaojtaneet olette, slihcn asti 
'cuin te tahan paikkaan lulitte/' 

5Moos.32:10ss. 

32. Mutta etle siltenkaan uskoneet 
Herraan, teidan Jumalaanne, 

33. joka kavi lielia teidan edelian- 
ne, osoittamaan leirin paikkaa, vdl- 
la tulessa, valaisten teille tieta,jota 
kaviltei ja paivaiia pilves^. 

2 Moos. 13:21. 40:38. 4 Moos. 10:34. 

34. Kun Herra kuuli teidan liuu- 
tonne,vihasluihanjavannoi,sanoen: 

35. „Ei yksikaan tasta pahasta su- 
kukunnasta pida nakeman siia hv- 
vaa maata, jonka mina olen valalla 
Iiivannut antaa teidan isillenne, 

4 Moos. 14:23. 26:^ 5 Moos. 2:14. Ps. 95:11. 

36. paitsi Kalebia,Jefunnenpoikaa; 
han on sen nakeva, hanelle mina 
annan sen maan, jonka paaile han 
astunut on, ja rtyOs hanen lapsil- 
lensa, koska han uskoUisesti seura- 
si Herraa.** 

37. Ja Herra vihastjui myds minuun 
leidan tahteiine, ja sanoi: ,,et sina- 
kdan sinnc tule; 4 Moos. 20:12. 27:l3ss. 

5 Moos. 3:26.27. 4:21. 34:4ss. 

38. vaan Josua, Nunin poika, si- 
nun palvelijasi, on sinne tuleva; 
vahvista hania, silia han onjakava 
Israelille perinndn. 

39. Ja teidap lapsenne, jotka le sa- 
noitte saaliiksi joutuvan, ja teidan 
poikanne, jotka eivat tanapana tie- 
da hyvaa eika pahaa, he tulevat 
sinne, ja mina annan sen heille, ja 
heidan pitaa sen omistaman. 

4 Moos. 14:3. 

40. Vaan palaitkaat te ja menkaat 
korpeen, Punaisen mcren tieia.'' 

41. Niin te vastasitte, ia sanoitte 
minulle: „meolemmc rikkoneet Her- 
raa vastaan ; me lahdemme nyt ja 
sodimme, niinkuin Herra, meidan 
Jumalamme meille kaskenyt on.'* 
Ja te valmistauduitte, iokainen sota- 
aseinensa, ja ynseyctessa menitte 
vuorelle. iMoos.l4:4088. 



42. Mutta Herra sanoi mfnulle: „sa- 
no heille: aikaat sinne menkd, aikaat 
mvaskaan sotiko, silia en mina ole 
teidan kanssanne, eftette tulisi lytS- 
dyksi teidan vihollistenne edessa.'* 

43. Kun mina naita teille sanoin, 
niin elte kuulleet minua, vaan olit- 
te Hermn sanalle vastahakoiset , ja 
lAksittc rdyhkeydessa menemaan 
vuorisloon. 

44. Niin tulivat Amorilaiset, jotka 
vuorella asuivat, teita vastaan, ja 
ajoivat teita takaa niinkuin kiitia- 
laiset tekevat, ja lOivat teidat maix- 
han Seirissa Hormaan asti. 

4 Moos. 14:45. 

45. Ja 16 palasitte sielta ja itkitte 
Hernkn edessa ; mutta el Herra tah- 
tonul kuulla teidan aantdnne, eika 
sita korviinsa ottanut. 

46. Niin te jaittc Kadekseen olemaan 
kauan aikaa; kauan sielia viivyitte. 

2 Luku. 

Edoiu, Moab, Ammon sMsletSan. 
Sihon lyMaiin. 

Sitten me palasimme ja matkus- 
timme korpeen Punaisen meren 
ticta, niinkuin Herra oli minullesa- 
nonut, ja vaelsimme Seirin vuoris- 
ton ympari kauan aikaa. 

2. Ja Herra puhui minulle, sa- 
noen: 

3. Te olclte jo kyliaksi kauan vael- 
taneet tamanvuoristonympari;kaftn- 
tykaat pohjoiSeen pain. • 

4. Ja kaske kansaa, sanocn : teidan 
pitaa vaellaman teidan veljenne E- 
saun lasten rajain ylitse, jotka Sei- 
rissa asuvat, ja 'he pelkaavat teita ; 
mutta varokaat sangen visusti, 

4 Moos. 20:14 ss. 

5. ettette ala sotaa heita vastaan; 
silia en mina anna teille jalankaan 
leveytta heidan maastansa; sllia R- 
saun lapsille olcn mina antanut Sei- 
rin vuoren perinnOksi. l Moos. 36:8. 

6. Rahalla pitaa teidan heiltaruuan 
ostaman, jonka te syCtlc; niin myfis 
pitaa teidan heilta rahalla ostaman 
veden, jota le juotle. 

7. Silia Herra, sinun Jumalasi, on 
siunannut siniin kaikissa kattesi 
taissa, ja on pitanyt huolta matkus- 
tuksestasi tassa suuressa korvessa; 
jo neljakymmenta ajastaikaaon Her- 
ra, sinun Jumalasi, ollut sinun kans- 
sasi, niin ettei sinulta mitaan ole 
puuttunut. 

8. Kun me veljemme Esauii lasten 
tykoa vaellaneet olimme, jotka Sei- 
rin vuorella asuivat, sita kedon tie- 
ta Elatista ja Etseongeberista , niin 



180 



5 MOOS. 2. 



kUnnyimme Ja menimme Moabin 

korven tietS. 

9. Ja Herra sanol minulle: „filft va- 
hingoita Moabilalsia, fiI2Ucft rupea 
sotaan heidfth kanssansa: sillft en 
minS anna sinulle miUlan hfinen 
maastansa perimisekai; sillft LoUn 
lapsille olen minft Ann antanut pe- 
riimOksi. IHoos. 19.87. 4 Moos. 21:28. 

10. EmiUUsetovalmuinoinsillftpai- 
blla asuneet, jotka oUvat suuri, vft- 
kevS Ja varteva kaosa, niinkuin E- 
nakilaiset. 1 Moot. 14:6. 

4M008. 13.*23l 29:84. 

11. He luulUin myOs Refalaisiksi, 
niinkuin Enakilaiset: Moabilaiset 
kutsnival heitft Eniilfiisiksi. 

11 Moinoin asuivat Horilalset Sel- 
rissft; mutia Esaiin lapset ajoivat 
ne pols ia hukutUvat edestfinsft. Ja 
asuivat Beidftn maassansa , — niin- 
kuiD Israel leki perintOmaassansa, 
ionka Herra heilie antoi. 
■ ^, 1 Moos. 14:6. 861:208a. 

13. Niln nouskaal nyt. Ja matkusta- 
kaatSaredin ojan ylitse." Ja me 
vaelsimme Saredin oJan ylitse. 

: 4 Moos. 21:12. 

14. 4a aika, Joka kului matkuslaes- 
nmme Kades-Bameasta, siihen astl 
kuin me Uilimme Saredin oJan ylit- 
>«« oli kahdeksan vuotta neUattft? 
kymmentft; ja tftllft ajalla kuoli ko- 
ko sukukunta, leirin sotamiehet, 
niinkuin Herra heilie vannoniit oli. 

.^. . 4 Moos. 14:29 88. 

15. Sillft Herran kftsi oli heitft vas- 
nan, hukuttamaan heitft leidssft, 
siihen asU kuin hfln perftU lopetti 
heidftt. 

' 16. Run sitten kaikki sotamiehet oli- 
vat loppumi kuoUeet kansan seasta, 
17. punui Herra minulle, ja sanoi : 
,18. „Tftnfipftnft matkustat sinft Moa- 
bin n^ain ylitse, Arin Iftpi, . 

19. ja Iflhestyt Ammonin lapsia; 
mutta aift heitft vahingoita ftlftkfi ru- 
pea sotaan heidftn kanssansa : sillft 
en. minft anna sinulle Ammonin las- 
ten maata perimisieksi; vaan Lotin 
lapsille olen minft sen antanut pe- 
rinnftksi. l Moos. 19:88. Tuom. 11:16 ss. 

20. Se on my6s luettu Refalaisteii 
maaksi: sillft Refolaiset ovat mui- 
noin siinft asuneet. Ammonilaiset 
kulsavat heitft Samsumilaisiksi. 

21. He oUvat suuri, vflkevft ja var- 
teva kansa, niinkuin Enakilaiset. 
Ja Her^ hftvitti ne heidftn edestftn- 
iit niin ettft he ajoivat heidflt ulos, 
ja asuivat heidftn maassansa. 

22. Niin oli hftn tehnyt Esaun lap- 
siUe, Seirin vuorella asuvaisiUe, hfi- 
viMftisiftnsA Horilaiset heidftn edes- 



tftnsft, niin ettft he ajoivat heidftt 
ulos, Ja asuivat heidftn sijassansa 
tfthftn pftivftfin asti. 

23. Avilaiset asuivat maankylissfl 
Gatsaan asti : mutta Kaflorilaiset Iftk- 
sivftt Kaftorista ja hSviltivAt ne, ja 
asetluivat heidftn maahansa. 

24. Nouskaat nyt ja Ifthtekfifit, ja 
matkustakaat Amonin ojan ylitse; 
katso, minft olen antanut sinun kft- 
siisi Sihonin. Amorilaisten kunin- 
kaan Hesbonissa, mainensa. Rupea 
siis nyt omlstamaan sen, ja soti- 
maanhftntft vastaan. 

25.Tftnftpftnfi minft alan tuottaa kaik- 
ken kansan pftfille koko taivaan al- 
ia pelvon Ja va\istuksen sinun edes- 
sftsi, niin ettft he, sanoman sinusta 
kuultuansa, vftrisevftt, ja vapisevat 
sinun edessftsi.** 2!Moo8. 23:27. 

6 Moos. 11:25. 

26. Ja minft Ifthetin sanansaattajat 
Kedemotin korvesta Sihonille, Hes- 
bonin kuninkaalle, rauhallisilla sa- 
noilla, sanoen : ^ 4 Moos. 2i:2i ss. 

6 Moos. 20:10. 

27. „Anna minuh ' vaeltaa sinun 
maasi Ifipilse, ja niinkuin tie antaa, 
niin minft vaellan; en minft poikkea 
oikialle enkft vasemmnlle.4 Moos. 2i.'22. 

28. Ruokaa pitftfi sinun rahan edes- 
tft antaman minulle syOdft, ja vettft 
rahan edestft juOda; minft kftynvain 
joudukkaasli maan Iftpi, — 

29. niinkuin Esaun lapset, Seirissft 
asuvaiset, minulle lehneet oyat, jn 
Moabilaiset Arissa asuvaiset, -^ sii- 
hen asti elift minft tulen Jordanin 
ylitse, siihen maahan, jonka Herra, 
meidfln Jumalamme, aniaa meille.** 

30. Mutta Sihon, Hesbonin kunin- 
gas, ei. tahtonut antaa meidftn vael- 
taa maansu; Iftpi: sillft Herra, sinun 
Jumalasi, k'ovetti hftnen mielensSJa 

gaadutti hfinen sydftmmensft, koskn 
lerra tahtoi iantaa hftnet sinun kfi- 
siisi, niinkuin tftnftpfiivftnft on. 

6 Moos. 29:7. Am. 2:9. 

31. Ja Herra sanoi minulle: „katso, 
minft olen ruvennut antamaan ku- 
ningas Silionin ja hftnen maansu 
sinun valtaasi; rupea omistamaan 
ja perint6nfts pitftmftftn hftnen niaa- 
tansa.'* 

32. Ja Sihoii Iftksi sotimaan meitft 
vastaan, hftn ja kaikki hftnen vS- 
kensft, Jaksassa. .. 

33. Mutta Herra, meidftn Jumalam- 
me, fintbi hftnet meidftn valtaamme, 
ja me Idimme hftnet ja hftnen lap- 
sensa, Ja kaikki hftnen vftkensft. 

34. Ja me valloitimme silloin kaik- 
ki hftnen kaupunkinsa, ja iiukuUm- 
me kaikki kaupungit, miehet Ja va|* 



m 



5 MOOS. 2. 3. 



mot ja lapsel, niin ellemme yhta- 
knnn jdimneet; 

35. ainoastaan eiaimet ine ryflslim- 
me ja saaliin kaupungeista, jotka 
valloilimme; 

36. hamaslaAroerisla,Arnonirtojan 
rannalla, ja kaupungista joerf laak- 
sossa, niin Gileadiin asti, el ollut 
yhlAk^iln kaupunkia, joka olisi ollut 
meiia vHkevflmpi ; Herra, meidSn Ju- 
malamme, antoi kalkki meiddn val- 
taamme. 

37. Mutta Ammonin lasten maahan 
ei sinil luUul, etka Jabbok-joen ran- 
tamaihin, elkfl kaupunkeihin vuo- 
rella, etka mlhinkaan, josla Herra, 
meidan Jumalamnle, oil meita kiel- 
lanyl. 

3 Luku. 

Ogin valtakunta. Rubenin, Gadin-jaMa- 
nassen perintO-osa. Mooseksen rukous. 

Sillen me kfiannyimme ja laksim- 
me vaellamaan Basanin lieia; ja 
Og. Basanin kuningas, laksi kaiken 
vakensa kanssa meila vastaan soli- 
maan Edreissa. 4Moos.2i:33ss. 

.•> Moos. 29:7 ss. 
2. Mutta Herra sanoi minulle: „aia 
pelkaa hanta; siiia mina olenantn- 
nut hanen sinun kasiisi'ja kaiken 
hanen vakensa ja hanen maansa ; ja 
sinun pitaa lekeman banejle, niln- 
kuin teil Sihonille, Amorilaisien ku- 
ninkaalle, joka Hesbonissa asui.*^ 

4 Moos. 21:24. 
' 3. Ja niin Herra. mefdan Jumalam- 
mc, antoi kuningas Ogin Basanista 
meidan kasiimme ynna kaiken ha- 
nen vakensa kanssa; ja me 15inlme 
hanen siksi, ettei hanelle yhtakaan 
jaanyt; 4Moos. 21:35. 5 Moos. 4:47. 

4. Jasllloln me valloitimme kaikkl 
hanen kaupunkinsa, ja ei ollut ha- 
nelia yhtaan kaupunkia, jota cmme 
hanelta oltaneet pois: kuuslkymmen- 
ta kaupunkia, ja koko Argobin maa- 
kunnan, joka oli Ogin valtakunta 
Basailissa. 

5. Kaikkl nama knupungit oHvat 
vahvistetut korkeilla muureilla, por- 
teilla ja teljillS; paltsinuitaolimuita 
kaubunkeja, jotka olivat maankylia. 

G. Kaikkl n^md me maahan kukis- 
timme, nilnkuin me Sihonille, Hes- 
bonin kuninkaalle,olimme tehneet; 
me havilimmc kaikkl kaupungit, 
mlehet, vaimot ja my<Js lapset; 

7. vaan kaikki eiaimet ja koko saa- 
liin kaupungcista otin[ime Itsellem- 
me! 5 Moos. 20:14, 

8. Niin me stls otimitie siihen al 
kaan kahdelta Amorilaisten kunln- 
kaalta, jotka hallllsivat silld puolen 



Jordanin, maan Amonin joesta Her- 
monin vuorcn astl. 

9. — jonka Sldonuaiset nimittivfit 
Siriohiksi, mutta Amorilaiset kut- 
suivat sen Senirlksi, — . 

10. ja kaikki kaupungit lakeudella, 
ja koko Gileadin, jo koko Basanin« 
Salkaan ja Edreihin astl, Ogin val- 
takunnan kaupungit Basanissa. 

11. Silia ainoastaan Basanin kunin« 
gas Og oli vieia jaielia Refalaisista ; 
katso,nanen vuoteensa,se rautainen 
vuode, - eikO se ole Ammonin las- 
ten Rabbatissa? — joka on yhdeksSn 
kyynaraa pitka, ja nelja kyynarSa 
levia^ miehen kyynarpaan mitan 
mukaan. 

12. Ja niin me slihen aikaan s^n 
maan valloitimme; Aroeristaasti Ar- 
nonin joen varrella, ja puolen Gilea- 
din vuorimaata ja sen kaupungit 
annoin mIna Bubenilaisille ja Gadi- 
laisille. 4 Moos. 32:33. 5 Moos. 29:8. 

Jos. 12:1. 13:8 ss. 

13. Mutta mita Gileadista jai, ja ko- 
ko Basanin, Ogin valtakunnan, an- 
noin mina puolelle Manassen suku- 
kunnalle, koko Argobin maakunnan, 
koko Basanin kanssa, joka kutsu- 
taan Refalalsten maaksi. 

14. Jair, Manassen poika, sal koko 
Argobin maakunnan Gessurin ja 
Makatin maan aariin, ja kutsui Ba- 
sanin Oman himensa mukaan Jairin 
kyUksi, tahan paivaan astl. 

4 Moos. 82:41. 

15. Mutta Makirill.e mina annoin 
Gileadin. 4 Moos. 32:39. 

16. Ja Rubetiilaisille ja Gadilaisille 
annoin mina osan Gileadlsta, Amo- 
nin jokeen astl, keskelle jokea, joka 
rajpna on, niin Jabbokin jokeen as- 
tl, jossa Ammonin lasten raja on, 

17. niin mydsAraba nimisen kedon 
ja Jordanin rqjamalnensa, Kinnere* 
tista niin kedon mereen, se on Suo- 
laiseen mereen astl, Pisgan vuoren 
alapuolella, itaa kohden. 

4 Moos. 34:11 8. 5Mo08. 4:49. 

18. Ja mina kaskin teita silia ajalla, 
ja sanoin: „Herra-, leidan Jumalan- 
ne, on antanut teille tamSn maan o- 
maksenne; menkaat sota-aseinenne 
vcljeinne Israelin lasten edellfi, kaik- 
ki te, jotka vakevat olette sotaan 
menemaan ; 4 Moos. 82:17. 

19. ainoastaan teidan vaimonne, lap- 
senne ja karjanne (silia mina tiedAn 
tcilia olevan paljon kaijaa) antakaaf 
olla kaupungeissanne, jotka minft 
teille olen antanut, 

20. siksikuin Herra myOs teidAnvel- 
jenne saattaa lepoon, -nilnkuin tei- 
dankin, etta hekin oroistaisivat sen 



182 



5 MOOS. 3. 4. 



maan, jonka Herra, teid5n Jutnalan- 
ne, heille antava on tuolla puolen 
Jordanin; sitten te palajatt^ kukin 
omaisuuteeiine , jonka minfl teille 
antanul olen.** Jos. 22:4. 

21. Ja minS sanoin Josualle silld 
:ijalla: „sinun silmftsi ovat n&hneet 
kaikki,mitA Hcrra, teidAn Jumalan- 
ne, naillc kahdelle kuninkaalle on 
tehnyt; niin hftn myOs on (ckevfl 
kaikille vallakunnille, joihin sina 
menel. 4 Moos. 27:18,22. 

22. Alkant heita pcljntkd; sillfl Her- 
r.i, teidAn Jumalanne, itse solii lei- 
(liln puolestanne." Jos. 10:14,42. 

23. Ja mind rukoilin Herraa siilien 
uikaan, sanoen: 

24. „Herra, Herra, sina olel ruven- 
nul iimoiltamaan palvelijallesi sinun 
kunniasi ja vilkevSn kfitesi ; silhl ku- 
ka on Juinala taivaassa lulii maas- 
sa, joka voi sinun tekosi ja vilkesi 
verlalsla Ichdft? Ps.86:8. 89:7. 

25. Anna nyt ininun meniiA kalso- 
niaan silii Iiyvfi5 maata tuolla puo- 
Icn Jordanin, niitft hyvifl vuorimai- 
la ja Libanonia." 

26. Mutia Herra viliaslui minuun 
tcidfln iniitenne, eikd kuiillut ru- 
koustani , vaan sanoi minullc: „${• 
nulla on kylla, MH minulle siitik a- 
siasla enaa puhu. 4 Moos. 20:12. 

DM(K)S. 1:37. 4:21. 31:2. 34:4. 

27. Aslu Pisgaii kukkulalle, ja nosta 
silmasr IHnleen pHin, pohjaan pain, 
lounaasen pain ja itahnpain, ja katso 
silmillasi; silia et sinS saa menna UV 
mUn Jordanin ylilse. DMoos. 1:37. 34:ii. 

28. Muttu kaske Josuaa ja vahvista 
hilntu, ja rolikaise h5nta; siUa lia- 
ncn pitaa mcncman ylitse taman kan- 
!>nn edelia, ja jakanian heille perin- 
ndksi sen maan, jonka sinfl nhet.'* 

4Moo8.27:188S. 5Moo8. 31:23. Jos. 14:1. 

29. Ja me olimnie siina laaksossa, 
joka on Bct-Peorin kohdalla. 

4 Luku. 

Kehoitua lain kuuliaisuuteen* Kolnie 
vapuakaupunkia. 

Ta kuule nyt« Israel, nc sdAnnOt ja 
^ oikcudct,*jolka niinft opelan Icille 
lehdaksenne, ella le elAisitte ja luli- 
Mlle siihen niaalian ja omistaisiKe 
niaan, jonka Herra, leidSn isAinne 
Juniala, teille on antava. 
2. Alkaai mitaan lisatkd siihen sa- 
naan, minka mina teille kTisken, fil- 
kaatka mitaan siiia ottako pois, kat- 
keSksennc Herran, teidan Jumalan- 
ne, kfiskyja, jotka mina teille kas- 
KO. b Moo». 12-32. Jos. 1:7. San. 30*. 

Iltti. 23:18 ts. 



3. Teidan silmSnne ovat naimeet, 
miia Herra on tehnyl Baal- Peori lie; 
silia kaikki, jotka seurasivat Baal- 
Peoria, on Herra, sinun Jumalasi, 
hukuttanut teidan seastanne. 

4Moo8.&:38s. Jofi. 22:17. 

4. Vaan te, jotka riiputtekiinniHer- 
rassa, teidan Jumalassanne, eiatte 
kaikki tanapana. 

5. Katso, mina opeltn teille kaskyt 
ja oikeudet.'niinkuin Herra, minun 
Jiimalani, minullc kasken^t on, ctta 
tetekisitteniittchmukaansiinamaas- 
sa, johonka tc tulette omistamaan 
sita. 

C. Niin pitakaat siis ja tehkaat ne; 
silia tamaon teidan ymmarr>'ksenne 
ja viisautenne kaikkein kansain e- 
dessa*, kun he kuulevat kaikki na- 
ma kaskyt, niin he sanoval: „tama 
suuri kansa on todella vifsas ja ym- 
mArtavainen .kansa.** 

7. Silia mika kansa oh niin suuri, 
jota Jumala niin lahestyy, niinkuin 
Herra, Jumalanne meita, niin usein 
kuin me hanta rukoilemme? . 

2Sain.'7:23. Fit. 146:18. 147:19a. 

8. Ja milia kansalla, Joskin olisi kuin- 
ka ylistettava, on niin hurskaat saan- 
nOt ia kaskyt, kuin kaikki Ifinia laki 
on, jonka mina teille tanai)ana an- 
nan? 

9. Karta siis ja varjele sielusi sap- 
'gen visusti, cttet unhottaisi niiia a- 

sioita, jotka sinun silmasi ovat nah- 
licet, ja ettci ne lahtisi sydammes- 
lasi kaikkena elinaikanasi ; Ja sinun 
pitaa niita julistaman lapsillesija las- 
tesi lapsille: 2 Moob. 19:1788. 

5 Moor. 6.7. 11:19. 

10. sita paivaa. jolloln scisoit Her- 
ran, sinun Jumalasi, edessa Horc- 
bissa, kun Herra sanoi minulle; „ko- 
koa minullc kansa, antaakseni hei- 
dan kuulla minun sanojani , jotka 
heidan pitaa oppiman, ctta he pel- 
kaisivat minua kaikkena elinaika' 
nansa maan paaila, ja opcttaisivat 
niita lapsilleen." 

11. Ja te astuitte esille. ja seisoille 
alhaalla vuoren Juurella, ja vuori 
paloi taivaaseen asti, ja siclia oli i)i- 
nieys. pilvi ja synkcys. 2Moo8.i9:ic. 

12. Ja Herra puhui teille keskelta 
tulta; puheen flanen te kuulitte, 
mutta ette yhtakaan kuvaa nahneet, 
vaan aanen kuulitte. 

13. Ja han ilmoitti teille liittonsa, 
jonka han kaski teidan pitamaan: 
nekymmenen sanaa, ja han kirjoitti 
ne kahteen kiviseen tauluun. 

2 Moos. 31:18. 34:28. 5 Moos. 9:10. 

14. Ja Herra kaski minun silloin o- 
pettaa teille saSnn^^t ja oikeudet, et- 



18a 



5 MOOS. 4. 



til le tckisitte niitten mukaan siinA 
liiaassa, johoii te mcnelte omista- 
inaan sit5. 

15. Varjelkaatsiissieli]^anncsangen 
visusli ; silltl et (e ole yhtAkdiln ku- 
vaa nilhneet sind pfiivilna, ionn Hcr- 
ra puhui (eille keskcllA tulta, Hore- 
hissa, 

16. et telle turmelisi itseSnne, etteka 
tckisi itsellenne kuvaa, ei minkniln 
muotoista, ei miehcu eikd naiseii 
kaltaistn, 2Moos.20:4. 

17. ei minkA5n elAimcn kaltaista, 
joka on niaunprinilii,ei minkdAnliu- 
nun kuIlaista,jokaIent5u laivaanalla; 

IS.cikiljonkunmadonmuotoamaan 
pdilildt eikn jonkun kalan muotoa, 
joka on vedessil maan alia, 

19. ja ettet sinA nostaisi silmidsi tai- 
vaascen pAin ja katselisi aurinkoa, 
kuuta ja tfihtid, ja kaikkeu taivaau 
sotajoukkoa, ettct aniaisi ilsciisi vie- 
lellil kumartamaan ja palvelemaan 
nil til, jotka Herra, sinuu Jumalasi« 
jakanut on kaikille kansoille koko 
taivaan alia. 6 Moos. 173. 2Kuu.2i:5. 

Jer. 8:2. 

20. Multa tcidilt on Herra ottanut ja 
johdattanut ulos rautapdtsisinEgyp- 
llstil, etlA olisilte hilnelleperintOkan- 
sa, niinkuin se myOs on tAnSpOnA. 

a'Moos. 19:5. lKun.S:51. Pft. 136:4. 

21. Ja Herra vihastui minuun tei- 
dfin puheenne tdhden , niin cttA hiin 
vannoi, etten miml saa mennu Joi^- 
danin ylitse,eikft tuleman siihcnhy- 
vAdn maalian, jonka Herra, sinun 
Jumalasi, antaa sinulle perinndksi. 

4M009. 20:12. 5 Moos. 1.37. 3:26. 31:2. 'MA. 

22. Siim minun tUytyy kuoUa tnssA 
maassa, enka saa ktlydil Jordanin 
ylitse; mutta te menette sen ylilse 
ja omistatte sen hyviln maan. 

23. Niin kavahtakaat, ettette Her- 
ran, teidUn Jumalanne, liittoa un- 
hottaisi, jonka liiln teidtln kanssan- 
ne on tehiiyt; nikA5tk& tehkO kuvaa 
niink^iin muotoista, niinkuin Her- 
ra, sinun Jumalasi, sinulta kieltli- 
nyt on. 

24. Silia Herra, sinun JumalasI, on 
kuluttavainen tuli ja kiivas Jumala. 

& Moos. 9:3. Hebr. 12.29. 
^ 23. Kun siitfit lapsia,ja lastcn lap- 
sia. ja te vanhenettc maassa, Ja tur- 
melette itsenne, ja teette itsellenne 
kuvia jonkun muotoisia, niin ettA 
teclte pahaa Herran, teidftn Junia- 
lunne, edessA ja vihoitatte hAnen, 
26. niin niinA tAiiApAiiAotantaivaat 
ja maan todistajaksi teitA vastaan, 
etlA leidAn pitAA Akisti perAti huk- 
kuman siitA maasta, jolionka menet- 
\e Jordanin ylilse^ omistamaan sitA. 



Elte saa kauan elAA siinft, vaan te 
perAti hukutetaan. 3Moot.26:i46s. 

6Moo8.«:19. ll.lGss. 28:1588. a0a9. 31:28. 

27. Ja Herra on hajoittava teidAt 
kansain sekaan, ja tetulettepieneksi 
kansaksi, jAtetyksi pakanoitten kes- 
kcUe, kuhunka Herra teidAt vie. 

5 Moos. 28:62 88. 

2S. SiellA te palvelette epAjumalia, 

jotka ihmisten kAsialat ovat: puita 

ja kiviA, jotka eivAt nAe, eikA kuule, 

cikAsyd eikAhaisfa.Ps.li5:4 ss. 135:15 as. 

29. Jos sinA silloin siellA etsit Her- 
raa, sinun J umalatasi, niin sinA Idy- 
dAt hAnet , jos etsit hAntA koko sy- 
dAmmestAsi, ja koko sielustasi. 

Jes. 55:6. Hos. 3:5. Vils. 1:2. 

30. Kun jondut hAtAAn ja nAmA 
kaikki pAAlIesi tulevat, niin sinA vii- 
mcisina pAivinA palajat Herran, si- 
nun Junialasi lykd, ja kuulel hAneu 
AuntAnsA. 

31. SillA Herra, sinun JumalasI, ou 
armoUinen Jumala; ei hAn sinua 
hyljAA,eikA kadota sinua, ei liAn un- 
hota isAisi liittoa, jonka hAn tieillc 
on valalla vahvistanut. 

32. Kysele entisiA aikoja, jotka oval 
ennen sinua olleet siilA pAivAstA, jo- 
na Jumala loi ihmisen maan pAAlle. 
kysy yhdestA taivaan AArestA niin 
toiseen AAreen : onkoikinAniinsuuri 
asia tapahlunut tahisenkaltaistaiki- 
nA kuultu? 

33. Onko joku kansa kuuUutJuma- 
lan AAiicn puhuvan tulen keskeltA, 
niinkuin sinA kuuUut olet, ja sitten- 
kin iAAnyt elAmAAn? 2Moos.i9:i8ss. 

34. TaUi onko joku jumala koctel- 
lut mennA ottamaan itscllensA kan- 
saa toisen kansan keskeltA, vitsauk- 
silla, ia tunnustAhdeillAJa ilimclllA, 
ja sodalla , ja vAkevAUA kAdellA , ja 
ojetulla kAsivarrella ja peljAttAvillA 
tcoilla, niinkuin Herm, teidAn Ju- 
malanne, kaikki nAmA tehnyt on 
teillc EgyptissA silmAisi edessA? 

35. NAmA olet sinA itse nAtinyt, tie- 
tAAksesi, ettA Herra yksin on Juma- 
la, ja paitsi hAntA ei yksikAftn muu. 

5 Moos. 32:39. Jes. 45:5. 

36. Taivaasta on hAn anlanut sinun 
kuuUa AAnensA, opeltaaksensa sinua, 
ja maalla on hAn antanut sinun nAh- 
dA suuren tuLensa, ja tulen keskeltA 
olet sinA kuullut hAnen sanansa. 

37. Koska hAn isiAsi rakasti ja va- 
il tsi heidAn siemenensA heidAn JAI- 
keensA, on hAn vienyt sinut ulos £• 
gyplin maasta kasvoillansa ja suu- 
rclla voimallansa, 2Moo8.l9:i6. 

38. ajamaan ulos sinun edestAsisuu- 
ret kansat, vAkevAmmAt sinua, joh- 
dattaaksensa sinua heidAn maahan- 



184 



5 MOOS. 4. 5. 



sa, ja antaaksensa siimlle sen pe- 
rinnoksi, niinkuin se limlpilnil on. 

39. Niin tieda siis t5n5pana jo pane 
mieleesi, clia Herra on Jumala, yl- 
hUallii taivaassa ja alhaalla maassa, 
ja ei ^'ksikSftn muu ; 

40. pidn siis hSnen sdflntOnsSJakfls- 
kynstl, jolka mina tannpSn«n sinulle 
kiisken, niin ettfi sinun ja sinun lap- 
sillesi sinun jSlkeesi hyvin k5visi, 
ja et(u olisit pitkdikdinen maassa, 
jonka Herra. sinun Jumalasi, sinulle 
lahloo antaa iknp3iviksi. 5 Moos. 6:2. 

41. Silloin eroitd Mooses kolme kau- 
punk!a« silla puolen Jordanin, au- 
ringon nouseniisen puolella, 

OIoos. 35:6, 14. 5 Moos. 19:2 ss. Jos. 20.2,8. 

42. ella sinne voisi paela se, joka 
Uetam3(t3 Idhimm^isensS lyO kuo- 
liaaksi, eika ole ennen ollut hdnen 
vihamiehensa ; ettd hdn pakenisiyh- 
teen niistA kaupungeista ja elSisl. 

43. NSm5t olivat: Belser korvessa, 
tasangolla, Rubenilaisia varten, ja 
Ramot Gileadissa Gadilaisia varten, 
ja Goan Basanissa Manasselaisla 
varten. 

44. Tdm3 on se laki, jonka Mooses 
pan! Israelin lasten eteen. 

45. Ja nSm^t ovat todistukset, sfiSn- 
ndt ja oikeudet, jotka Mooses sanoi 
kraelin lapsille, heidan lahdettyan- 
sa Egyptisia, 

46. silia puolen Jordanin, laaksossa 
Bet-Peorin kohdalla, Sihonin, Amo- 
rilaisten kuninkaan maalla, joka 
Hesbonissa asui, jonka Mooses ja 
Israelin lapset lOlvat Idhdettyansa 
Egyplisia ; 4 Moos. 21 :24. 5 Moos. 1 :4. 

47. ja he omistivat hSnen maansa, 
niin mySsOgin, Basanin kuninkaan, 
niaan, kahden Amorilaisten kunin- 
kaan, jolka silia puolen Jordanin a- 
suival, auringon nousuun pain, 

5 Moos. 3-3. 

48. AroerislaAmoninjoenreunalla, 
Sionin vuoreen asli, se on Hermon, 

49. ja kaiken lakian maansilia puo- 
len Jordanin itaan pain , lakeuden 
nereen asti, Pisgan vuoren alia. 

5 Moos. 3:17. 

5 Luku. 

HoRblssa tehty liitto. Kymmenen kftskyli. 
Keuvo kuuliaisuuteen. 

Ta Mooses kutsul koko Israelin, ja 
" sanoi heille: kuule, Israel, naita 
sdSntaia ja oikeuksia, jolka mina ta- 
napana puhun (eidan korvainne 
kuullen, Ja oppikaat ne, ja pitAkaat 
ne, t^hdaksenne niiden jaikeen. 
2. Herra. meidan Jumalamme, leki 
mlon meidan kanssamme Horebis- 

*•• 2 Moos. 19.'588. 



3. Ei lehnyt Herra tata litttoa mei- 
dan Isaimme kanssa, vaan meidan 
kanssamme, jotka nyt tassa olemme 
lanapana, ja kaikki*eianime. 

4. Herra puhui kasvoista kasvoihin 
Icidankalissanneyuorella, tulen kes- 

kelta. 2 Moos. 19:19. 20:1. 

5. Silloin mina seisoin Herran ja 
(eidan vaiilianne,ilmoittamassa teil- 
le Herran sanaa; silia le pelkasitte 
(ulta, ja elte nousneet vuorelle; jn 
han sanoi: 2Moo8. l9:iGss. 20:18. 

6. Mina olen Herra, sinun Jumala- 
si, joka sinun Eg}'p(in maalla, or* 
juuden huoneesla ulos vienyt olen. 

2 Moos. 20:2. 

7. Alkddn sinulla olko muita junia- 
lia minun edessani. rs.8i:io. 97:7. 

8. Ala tee itsellesi kuvaa minkaan 
muotoisia niista, jotka ylhaaiia tai- 
vaassa on, tahi alhaalla maassa, taik- 
ka vesissa ma^in alia. 

9. Aia-niita kumarra, aiakfi palvele 
niita; silia mina, Herra, sinun Ju- 
malasi, olen kiivasJuma1a,jokakos- 
tan lapsille isain rikokset kolman- 
leen ja neljanteen polveen, niille. 
jotka minua vihaavat, 2 Moos. 34:7. 

4 Moos. 14:18. 5 Moos. 24:16. Jer.32:lS. 

10. mutta teen laupiudcn monelle 
tuhannelle, jotka minua rakastavat 
ja kaskyni pitavat. 

11. Aia turliaan lausu Herran, si- 
nun Jumalasi, nfmea; silia ei Her- 
ra jata sita rankaiscmatta, joka ha- 
nen nimensa turhaan lausuu. 

12. Pida lepopaiva, ctla sen pyhit- 
taisit, niinkuin Herra, sinun Juma- 
lasi, sinun kaski.2 Moos.20:8. 3 Moos.23:3. 

13. Kuusi paivaa tulec sinun tydta 
tehda ja kaikki askaresi tolmittaa; 

14. mutta scitsemas paiva on Her- 
ran, sinun Jumala.si, lepopaiva: sil- 
loin ole tyOta tckemaiia, sina ja si- 
nun poikasi, ja tyttarcsi,japalvelija- 
si, ja piikasi, ja narkasi, ja aasisi, ja 
koko sinun karjasi.ja muukalaisesi, 
joka on luonasi porteissasi, etta si- 
nun palvelijasija piikasi levossa oli- 
sivat niinkuin sinakin. l Moos. 2:2. 

Hfs. 20:12. Hebr.4:4. 

15. Ja muista, etta sinakin olit orja 
Egyptin maalla,ja Herra, sinun Ju- 
malasi, jdhdatti sinut sielia vakevai- 
la kadelia ja ojennclulla kasivarrel- 
la Seniahden Herra, sinun Juma- 
lasi, kaski sinun piiaa lepopaivan. 

16. Kunnioita isaasija ailiasi, niin- 
kuin Herra, sinun Jumalasi, on si- 
nun kaskenyt, etta kauan elaisil, jp 
menestyisit siina maassa, jonka Her- 
ra, sinun Jumalasi, sinulle antaa. 

9 Moos. 20:12. Syyr.3:9. Matt 15:4. 
" Mark. 7:10. Et 9i2. 



18S 



5 MOOS. 5. 6. 



17. Alfi tapa. aMooe.20:18. Matt. 6:21. 

Room. 13:9. 

18. Alfi le« huorin. 2Moos.ao:U. 

Matt. 5:27. Luuk. 18:20. 

19. Alfi varasfa. 2Moos.20:i5. 

20. Alfl sano vfifirSft todislusta Ifl- 
himmfiistSsi vasfaan. 2 Moos. 20:16. 

Room. 13:9. 

21. Alfi himoitsc inhimmAisesi vai- 
inoa. AlShimoilselAhimmdisesihuo- 
netta, hAnen peltoansa.palvelijalan- 
sa, piikaansa, hdrklfAnsa. nusiansn, 
eika mitfiSn, mikA lAhimmnisesI omn 
on. 2Moos.^:17. Room. 7:7. Jaak. 1:14 s. 

22. NAmat ovat ne sanat, jotka Her- 
rii puhui kaikelle teid5n seurnkun- 
nallenne vuorella, tulesta, pilvcslfi 
ja synkeydeslfi. suurella SSnelld. ei- 
kfi siihen enfifi lisfinnyt; ja hftn kir- 
joitti ne kahteen kiviseen tauluun, 
ja antoi ne miniille. 

23. Ja tapahtui, kun te 59nen kuu- 
lifte pimeyden keskeKQ, ja viiori pa- 
loi tulesta, niin te tulitte minuii ty- 
kOni, kaikki pfifimiehet jasukujenne 
vanhimmat, 

24. ja sanoiUe: „katso, Herra, mei- 
dfinJumalamme«on osoittanut meille 
kunniansa ja suuruutensa, ja mc 
kuulimme hAnen fiAnensfi tulesta. 
Tfinfipfinfi olemme nShneet, e\lh Ju- 
mala voi puhua ihmisille, ja he jAJ\- 
vfit elSmnSn. 2Moos. 19:19. 5 Moos. 4:33. 

25. Ja miksi meidAn nytpilAisikuo- 
leman? tAmA suuri tuH on meidat 
kuluttava. Jos me useammin kuu- 
Icmme Herran, meid An J umalamme, 
AAnen, niin me kuolemme. 

26. SillA mikA on kaikki liha, ettA 
se kuulisi elAvAn Jumalan AAnen tu- 
lesta puhuvan, niinkuin me, ja jAi- 
si elAmAAn? Tuom. 13:22. 

27. LAhesty sinA ja kuulc kaikki, 
mitA Herra.meidAnJumalammcsa- 
noo, ja sano sinA meille kaikki, mita 
Herra, meidAn Jumalamme, sinun 
kanssasi puhuu, niin me tahdomme 
kuulla ja tehdA niitA.*' 2Moos. 24:3,7. 

28. Ja Herra kuuli tcidAn sanainnc 
AAnen, jotka puhuitte minun kans- 
sani, ja Herra sanoi minulle: „minA 
kuulln tAmAn kansan sanat, jotka he 
puhuivat sinun kanssa.si; se on kaik- 
ki hyvA, mitA he puhuivat. 

29. Joska hcillA olisl senkaltainen 
sydAn, pelkAAmAAn minua ja aina 
kAtkemAAn kaikki minun kAskyni, 
ettA heille menestyisi ja heidAn lap- 
sillensa iankaikkiscsti I rs.8i:i4. 

30. Mene siis ja sano heillc : ,palat- 
kaat kotianne teidAn majoihinne.' 

31. Mutta sinun pitAA seisoman tas- 
sfi minun edessAni, niin minA pu- 
hun sinulle kaikki kAskyt, sAfinnOt 



ja oikeude! jotka sinun pitfifi heille 
opcttaman. ettA he tekisfvfil niiden 
iAlkeen silnA maassa, jonka minfi 
heille annan heidAn omistettavak- 
sensa.** 

32. Niin pitAkfiAt nAmfi ja tehkAAl 
niinkuin Herra, teidAn Jumalanne, 
teidan kAski, ja AlkAAt poiketko oi< 
kialle eikA vasemmalle puolelle; 

3j. vaan vaeltakaat niita teitA. jolta 
Herra, tcidAn Jumalanne, kAski tei- 
dAn vaellaa, ettA te elAisille ja me- 
nestyisilte, ja olisitte pitkAikAiset sii- 
nA maassa, jonka te omistatte. 



N' 



6 Luku. 

NeuTOja noudattamaan Jumalan kHskyJS. 

• 

fimA ovat ne kAskyt , sfiAnndt ja 
oikeudet, jotka Herra, leidfin Ju- 
malanne, kAski opettaa teille, ettfi 
tekisitle niitten muk^an siinA maas- 
sa, johon te menette omistamaan 
sitA, — 

2. ettA pelk$isit Herrad , sinun Ju- 
malatasi, ia pitAisit kaikki lifinen 
sAAntOnsA ja kfiskynsA , jotka minft 
kAsken sinulle, sinA ja lapses!, ja 
lastesi lapset, kaikkena sinun ellnai- 
kanasi, ettA kauan elAisit. 

3. Israel, sinun pi tAA siis kuuleman 
ja pitAmAnne, tcfidAksesi niitten mu- 
kaan, ettA sinulle hyvin kAvisl, ja te 
paljon lisAAntyisitte, niinkuin Her- 
ra, sinun isAisi Jumala, on sinulle 
luvannut, maassa, jossa rieskaa ja 
hunajata vuotaa. 

4. Kuule, Israel, Herra, meidAn Ju 
malammc, on yksi -ainoa Herra. 

5 Moos. 4:35. Mark. 12:29. lKor.8:4s8. 

Gal. 3:20. 

5. Ja sinun pitAA rakastaman Hoo. 
raa, sinun Jumalatasi, koko sydAm- 
mestAsi, ja koko sielustasi, ja koko 
voimastasi. 5 Moos. 10:12. Matt. 22:37. 

Mark. 12:30. Luuk. 1027. 

G. NAmA sanat, jotka minA kftsken 

sinulle tAnApAnA, pitAA sinun sydAm- 

mecsi paneman, 5Moos. 32:16. 

7. ja teroittaman ne lapsillesi, ja 
niisIA puhuman huoneessaistuissasi 
ja tiellA kAydcssAsi, ja maata pan- 
nessasi ja noustcssasi. i Moos. 18:19. 

5 Moos. 4:9. 11:19. 

8. Ja sinun pitAA sitoman ne mer- 
kiksi kAteesi, ja olkoot sinulle muis- 
tutukseksi silmAisi vAlissA. 

2 Moos. 13:9.16. 5 Moos. 6:8. 11:181 
San. 3:3. 6:21. 7:3. . 

9. Ja sinun pitAA klrjoittaman ne 
huoneesi pihtipicliin ja portteihlsi. 

10. Kun nyt Herra, sinun Jumalasi, 

iohdattaa sinut siihen maahan,jon- 
La hAn valan kautta on luvannut 



18G 



5 MOOS. 6. 7. 



isiilesi. Abruhamille, Isaakille ja 
JaakobiUe, sinulle anlaaksensa,suu- 
retjnknuiiiit kuupungit.joita et sinfl 
rakentanut, Jos. 24:13. 

11. ja huoncct liiynnft kaikkcn hy- 
vxTUa. joila ct sina itse Ijlyllslnyt, 
ja viiojonkiviscl kaivot, joila el siiiA 
ole kaivanut.ja viinimnet ja filjy- 
macl, joila el sina ilse islullanul, ~ 
ja sina syot ja ravilaan. OMoos. 8:10. 

12. niin varo cllel unltola Herraa, 
jokasinut Ej^ypliii maalta, orjuu- 
den huoneesta* on johdattanul ulos. 

13. Sinun pilaa pelkilamnn Herraa, 
sinimJumalaasi, ja palvelcnianhnn- 
in, ja Ii5neii niniensA kautia tulec 
sinun vannoa. O Moos. 10:12,20. 13.M. 

Jer. 4:2. Matt. 4:10. Luuk. 4:8. 

14. Alkani seiii*alko niuukalaisia ju- 
malia, niideii kansain juinalia, jot- 
ka leidau ympArilianne asuval. 

15. SillA licri-ii, sinun .lumalasi, on 
kiivas Juinalu leid;*ln keskellAnne, 
javaro, ellei lierran. sinun Juma- 
lasi, viha syllyisi siuuun, ja hukut- 
laisi sinul maan pftfillA. 

16. Alkaat kiusatko Herraa, leidAn 
Jumalalanne,niinkuin le hSnia kiu- 
sasille Massassa ; 2 Moos. 17:7. 

Matt. 4:7. Luuk. 4:12. 

17. vaan pilAkaAt uskollisesli Her- 
nia, teiddn Jumalanno, kdskyt, ja 
haiien aseluksensa ja snUnliinsfi, jol- 
ka han sinulle kAsk^nyt on, 

18. elia leet, mikft on oikia ja hy- 
ya Hcn*an edessa, elta sinulle hyvin 
kavisi, ja paSsisil siihen maahan ja 
oinisiaisit sen hyvan maan, josia 
Herra vannoi sinun isiilesi, 

19. clia ban karkoillaa kaikki vi- 
nolliset sinun edestasi. niinkuin Her- 
ra ^nonut on. 

20. Kun poikasi tastaiahin kysvy 
smulla, sanoen : „miia nama lod'is- 
[uksel, saanndl ja oikeudet oval, jol- 
Ka Herra, meidan Jumalamme, Icil- 
•e kaskenyl on?*' 

.21. niin sinun piiaa sanoman po- 
jallesi: me olimnie Faraon orjia 
Kgyplissa; mulla Herra johdatli 
meidal ulos Egyptisia vakevaihl ka- 
aciia. • 

22. Ja Herra leki suuria ja kauheila 
mcrkkeja ja Ihnieiia Egyplissn Fa- 
raolle ja koko hanen huoneellensa 
njeidan silmaimme edcssa. 

23.Jahanjohdalliineidatsieliaulos, 
cua ban veisi meidai siihen maa- 
Jan, jaanlaisi meille sen maan.jon- 
KJ ban valalla lupasi isillemme. 

-M.Ja Herra kaski meila tekemaan 
•aikkein naiden saamojen mukaan, 
)a pelkaamaan Herraa, meidan Ju- 
malalamme. elia meille hvvln ka- 



vist kaikkena elinaikanamme , niin- 
kuin myds lanapana kay. 
25. Ja se on oleva meille vanhurs- 
kaudeksi, jos me pidamme ja leem- 
mc kaikki nama kaskyt Hcrran, 
meidan Jumalamme, edessa. niin- 
kuin ban meille on kaskenyl.*' 

7 Luku. 

Kasky bftvittUmafin Kananealalset Israel 
on Herran kansa. 

KUB Hcrrn, sinun Jumalasi, vie si- 
nut siihen maahan, Jobon sina 
mcnel omislan^aan siia, ja kun hau 
ajaa paljon karisaa ulos sinun edes- 
lasi: Heliiaiset, Girgasilaiset, Amo- 
rilaiset, Kananealaiset, Fcresllaisot, 
Hcviiaiset ja Jebusilaiset, seitsenian 
kansaa,jolka sinua suurcmmat ja 
vakevammat oval; 2 Moos. 23:23 ss. 

34:11 ss. 5 Moos. 31:3. 
' 2. Ja kun Herra, sinun Jumalasi, 
antaa heidai sinun vallaasi. ja sina 
lydl heidat. niin sinun piiaa peniti 
heidat kirolluna bukutlaman; aUl 
tee miiaan liilloa heidan kanssansu, 
aiaka armabda beiia. 2Moos. 23.32. 
34:12. 5 Moos. 20:16 s. 31:5. 

3. Ala rupea heiinolaisuuleen hei- 
dan kanssansa; aia anna tyltariasi 
heidan pojillensa,aiakn ola pojillesi 
vaimoja heidan lyliarisiaan, 

Jos. 23:12. Tuom..3:5ss. Esr. 9:1s. 

4. Silia he viellelevai sinun poikasi 
luopumaan minusia ja palvclemaan 
muukalaisia jumalia; ja niin Her- 
ran viha syllyy leihinjahannopiasli 
bukuttaa leidat. 

5. Mutta nain piiaa teidan lekeman 
heille: heidan alllarinsakukistakaat 
ja palsaansa rikkokaat, heidan mel- 
sistdnsa kaatakaal ja IicidAn epaju- 
malansa kuvat tulessa polllakaat. 

2 Moos. 23:24. 34:13. 4 .Moos. 33:52. 

5 Moos. 12:2 s. 

6. Silia sina olel Herralle, sinun Ju- 
malallesi, pybilelly kansa ; sinut on 
Herra, sinun Jumalasi, valinnul o- 
niaksi kansaksensa kaikistakansois- 
ta, kuin asuvat maan paaihl. 

2 Moos. 19:5. 5 Moos. 4:20. 14:2. 26:lR. 

lPict:2.-9. 

7. Ei ole Herra miclislynyl leihin 
ja valinnul leidat sentahdcn, etUl 
leidan lukunnc on suurempi kuin 
kaikkcin iniiiden kansain; silia sina 
olel vahin kaikista kansoista; 

8. multa koska Herra rakasti leila 
ja piiaa valansa. jonka luln vannoi 
teidan isillenncjohdalli ban leidal u- 
los vakevaila kadelia ja vapahli leidai 
orjuudenhuoneesia, Faraon, Egyplin 
kiininkaan, kadesia, &Moo8.i0:i5. 



187 



5 MOOS. 7. 8. 



9. Niin tiedft siis, ettU Herra, siniin 
Jumalasi, on Jumala, uskollincn Ju- 
mala , Joka pitflS liiton ja snilyttaA 
laupiuden tuhanteen polveen niiden 
kanssa. Jk>tka hflntS rakastavat ja pi- 
tfivflt hfinen kdskyns5, 2Moos.20Hi. 

34:7. 5 Moos. 5:9 s. 32:4. 

10. mutta varmasti kostan niille, jot- 
ka hSntfi vihaavat, niin ettA Ii5n liu- 
kuttaa lieidfit. Hfln el viivv kosta- 
inasta niille, jotka h5ntA viliaavat, 
vaan kostaa niille varmasti. 

11 Niin pidfl.siis ne knskyt,4flAn- 
nOt ja oikeudet, jotka mind sinulle 
kasken tAnfipAnd, ja lee niitten mu- 
kaan. 

12. Jos te nSmSt oikeudet kuuletle 
sekA pidAtte ja teette ne, niin myOs 
Herra, sinun Jumalasi, pilAA sinulle 
sen liiton ja laupiuden, jonka hAn 
valalla lupasi isillesi, 3Moos.26:38s. 

5Moos.28:lSB. 

13. ja rakastaa sinua , ja siunaa si- 
nut, ja enentAA sinut; hAn siunaa 
sinun ruumiisi hedelmAn.ja maasi 
hedelmAn, sinun jyvAsi, viinisi ja 
Oljvsi, sinun kanasi sikiOt ja 1am- 

Eaittesi karitsat, siinA maassa, jonka 
An isillesi valankauttalupasisinulle 
antaa. 

14. Siunatlu olet sinft oleva kaikis- 
ta kansoista. Ei sinussa ole miestA 
eikA vaimoa hedelmAtOntA, eikS yh- 
tASn hedelmAtOntA karjassasi. 

2 Moos. 23:26. 

15. Ja Herra poistaa sinulta kaikki 
sairaudet; e! hAnyhtAkAAn Egyptin 
pahaa tautia, jotka sinA tunnel, pa- 
ne sinun pAAllesi; mutta hAnheitlAA 
ne kaikkein niiden pAAUe, jotka si- 
nua vihaavat. 2Moo8.9:U. 15:26. 

16. SinA olet nielevA kaikki ne kan- 
•sat, jotka Herra, sinun Jumalasi, si- 
nulle antaa; AlA sAAli heitA, AlAkA 
palvele heldAn jumaliansa, sillA se 
tulisi sinulle paulaksi. 2 Moos. 23:33. 

5 Moos. 12:308. 

17. Jos sinA sanot sinun sydAmmes- 
sAsi: „nAmA kansat ovat suurem- 
mat kuin minA; kuinka taidnn mi- 
nA heidAt ajaa ulos?*' 

18. niin AlA pelkAA heilA; muista 
larkasti, milA Herra, sinun Juma- 
lasi, feki FaraoUe ja kaikille Egyp- 
tilAisille, 

19. ja muista i\iitA suuria vitsauk- 
sia, jotka silmAsT nAhneet ovat, ja 
merkkejA ja ihmeilA , ja sitA vAke- 
vAtA kAtlA ja ojennettua kAsivartta, 
jolla Herra, sinun Jumalasi, johdatti 
sinut Samalla tavalla tekee Herra, 
sinun Jumalasi, kaikille niille kan- 
soille, joita sinft pelkAAt. 

5 Moos. 4:34. 29:8. 



20. Niin myOs Herra, sinun Juma- 
lasi, lAhett^A heidAn sekaansa am- 
piaiset, siksi ettA kaikki hukutetaan, 
jotka ovat jAAueet ja itsensfi lymyi- 
lAneet sinulta. 2 Moos. 23:28. Jos. 24:12. 

21. AlA hAmmAsty heidAn edessftn- 
sA; sIllA Herra, sinun Jumalasi, on 
kcskellAsi, se suuri ja peljAttftvft Ju- 
mala. 

22. Ja Herra, sinun Jumalasi, kar- 
koittaa nAmA kansat sinun edestAsi, 
vAhitellen toisen toiscnsa jAlkeen. Ahl 
AkistA hukuta heitA, ettei metsAn pe- 
dot lisAAntyisi sinua vastaan maan 
pAAllA. 2 Moos. 2330. 

23. Herra, sinun Jumalasi, antaa 
heidAt sinun kAsiisi, ja lAheltAA hei- 
dAn keskellensA si^ureneripuraisuu- 
den, siksi ettA hAn hukuttaa heidAt, 

24. ja antaa heidAn kuninkaansa si- 
nun valtaasi, ja sinA hukutat heidAn 
nimensA taivaan alta; ei yksikAAn. 
vol seisoa sinua vastaan, siksi eiiSk 
heidAt hukutat. Jos. 10:22s. 11:12. 12:7s. 

25. HeidAn epAjumaliensa kuvat pi> 
lAA sinun tulella polttaman ; AlA hi- 
moitse silA hopiata ja kultaa, miksi. 
niiden pAAllA on, AlAkA ota mitAAn 
itsellesi slit A, et lei seolisi sinulle pau* 
laksi ; sillA se on Herralle, sinun Ju- 
malallesi, kauhistus. 5Moo8.i2:3. 

Jos. 7:1,21. 2Makk.l2:40. 

26. Ja AlA vie sitA kauhistusta huo- 
neesesi,ettet itse tulisi kirotuksi; vaan 
sinun tulee pitAft se ilelyksenA ja 
kauhistuksena, sillA se on kirottu. 

5 Moos. 13:17. 

8 Luku. 

Henran hyvftt tyOt Israelia kohtaan kor- 
pivaelluksen aikana. Yaroitiiksia. 

Kaikki kftskyt, jotka minft kftsken 
sinulle tftnApAnft, pitAkAftt ja teh- 
kAAt,ettA te elAisitte ja lisAAntyisitte, 

ia pAAsisitte omistamaan maan, jon- 
[a Herra on valalla luvannut tei- 
dAn isillenne. 

2. Ja muista kaikkea, mitA on ta- 
pahtunut sillA matkalla, jota Herra, 
sinun Jumalasi, johdatti sinut nAinft 
neljAnAkymmenend Vuonna kor>*es- 
sa, vaivataksensa sinua ja koeteUak- 
sensa sinua, etIA hAn tielAisi mitft 
sinun sydAmmessAsi oli,pidAtk(^hft- 
nen kAskynsA, vai et. 

3. Ja hAn kuritii sinua ja antoi si- 
nun isota; ja hAn ravitsi sinua nian- 
nalla. ruualla, jota et sinA eikfl si- 
nun isAsi tunteneet, ettA hAn antaisi 
sinun tietAA, ettei ihminenelAainoas- 
tansa leivftstft, vaan ettA hftn elftft 
slilft kaikesta, mitA Herran suusta 
lAhtee. 2Moo8. 16:15,35. 4 Moos. li:7 

Matt 4:4. Lotik.4:4. 



188 



5 MOOS. 8. 9. 



4. Sinun vaalleesi eivfit kuluneet 
yItSsi ntlind neljiinS kvmmenenS 
vuonna eikfi jalkasi kuulettuneel. 

5 Moos. 29-3. Neh.9:21. 

5. Niin k5siti\ se syddmmessfis, ettft 
Herra, sinun Jumulasi, on kuritta- 
nut sjnua, niinkuin mies kuriUaa 
poikaansa. 

6. Ja pidil Herran, sinun Jumalasi, 
kfiskyt. vaeltaaksesi hdnen tiellflnsS 
ja peljataksesi hunta. 

7. SillA Herra, sinun Jumalasi, vie 
sinut hyv55n maahan , siihen niaa- 
lian, jossa vesiojat, Idhteet ja jfir\el 
laaksoissa ja vuorten rinleill^ vuo- 
lavat, 

S. maahan, jossa nisua, ohraa, vii- 
nipuita, flikunapuita ja granatin 
omcnia, maahan, jossa on dijypuita 
ja hunajaa, 

9. maahan, jossa ci sinun larvitse 
puutteessa syddil leipslilsi, jossa ci 
mluian puutu, maahan, jonka kivet 
ovat rautaa, ja jossa sina vaskcn 
vuorista lohkaiset. 5Moos.6:U. 

10. Ja kun sind sydnyt ja ravitlu 
olet, kiitS silloin Herraa, sinun Ju- 
malatasi, sen hyvdn maan edestii, 
jonka lian nntoi sinulle. 

11. Niin varo siis, etlel unhota Her- 
raa, sinun Jumalatasi, niin ettet pi- 
dd hanen kaskyjSnsli, oikeuksiansa 
ja saiintdjnnsa, jotka min& t&nSp&nd 
sinulle annan. 

12. Kun syOnyt ja ravittu olel, ja 
rekennat kauniit huoneet ja asut 
niissS, 

13. ja sinun karjasi ja lampnasi, ho- 
Piasi ja kultasi, ja kaikki mim si- 
nulla on, lisnantyvSt, 

14. varo, ellei syd5mmesi silloin 
tuleylpiaksi, niin ettft unhotlaisit 
Herran, sinun Jumalasi, joka sinun 
johdatti ulos Egyptin maalta, orjuu- 
den huoneesta, 

15. ja on sinun johdattanut sen suu- 
ren ja hirmuisen korven lilpi, jossa 
oli myrkyllisia kflrmeit^i ja skor|)io- 
ii€Ja> ja lossa kuivuus vallitsi, eika 
oUut ensinkAan ven&,jaanloi sinulle 
veden vuotaa kovasta kalliosta, 
2 Moos. 17:6. 4 Moos. 20:11. 21:6. Ps. 78:16. 

16. ja joka ravitsi sinua korvessa 
mannalla, josla ci sinun isAsi lien- 
neel, ndyryyUAAkscnsa ja koetellak- 
scnsa sinua, ia viimeiselta hyviiii 
tehddksensa sinulle, 2Moos.i6:i5. 

17. Ala sentdhden suno syddmrnes- 
sas: „minun voimani ja kateni vil- 
kevyys on minuUe nnin voimallisel 
ly5l lehnyl,'* 

18. vaan muista Herraa, sinun Ju- 
malatasi; siliahftn antaa sinulle voi- 
inan, tekemaan senkaltaisia voimal- 



lisia tekoja, vahvislaaksensa liitlon- 
sa, jonka han vannoi isillesi; niin- 
kuin se tanakin paivana lanahtuu. 

19. Vaan jos sina unholal Herran. 
sinun Jumalasi , ja noudalat muita 
jumalia, palvelet ja kumarrat niitS, 
niin mina tanApana lodistan leille, 
ctta te pcrati hukutte. 

20. Juuri niinkuin pakanat, jotka 
Herra hukuttaa Icidan edestanne, 
niin tekin hukutte, koska ette olleet 
Herran, teidan Jumalaune, aanelle 
kuuliaisct. 

9 Luku. 

Kansan uppiniskaisuus korpivaelluksen ai- 

kona. 

I/uule, Israel! lanapana sina me- 
^ net Jordanin ylitse valloittamaan 
kansoja, jotka ovat sinua suurcm- 
mat ja vakevaminat,suuriu kaupun- 
geita, varusiettuja taiviuiseen asti, 

5 Moos. 1:28. 

2. suurta ja vartevaa kansaa, Ena- 
kin poikia, jotka sina tunnel ja joista 
olet kuullut sanottavan: kuku voi 
seisoa Enakin poikia vastaan! 

4M008. i3r29,338. 

3. Niin sinun pitaa tanapana tieta- 
man, etta Herra, sinun Jumalasi, 
kay sinun cdeliasi niinkuin kulutta- 
vainen tuli; han hukuttaa heldat, 
ja han uleutaa heidat sinun edessA- 
si, ja sina ajat heidat ulos ja huku- 
tat nopiasti, niinkuin Herra sanoi si- 
nulle. 5M008.4:24. HetMT. 12:29. 

4. Kun Herra, sinun Jumalasi, on 
heidat ajanut ulos sinun edestasi, 
niin aia sano sydammessas: Herm 
on minun tannc luonut omistamaan 
lata niaata minun vanhurskauteni 
tahden; silia Herra ujaa nama pa- 
kanat sinun edestasi ulos heidau ju- 
malattomuulensa tahden. 

1 Moos. 15:16. 3 Moos. 18.-24 s. 

5. Et sina tule omistamaan heidau 
maatansa sinun vanhurskautcsi ei- 
ka sydammesi vakuuden tahden; 
vaan Herra, sinun Jumalasi, ajaa 
pakanat ulos heidau jumalattomuu- 
tensa tahden, etta Herra vahvislai- 
si sanausa, jonka Herra sinun isil- 
lesi Abrahaniille, Isaakille ja Jaako- 
bille vannoi. iMoos. 12:7. 22a68. 26:3 s. 

28:13. 

6. Niin liedfi nyl, eltei Herra, sinun 
Jumalasi, anna sinulle tata hvvaa 
maata omistukseksesi vanhurskau- 
tesi tahden; silia siufl olct uiskuri 
kansa. 

7. Muista ja aia unhota, kuinka si- 
na Herran, sinun Jumalasi, vihoitit 
korvessa; siita paivasta kuin sinA 
laksit Egyptin maalta, stihen asti 



189 



C MOOS. 9. 10. 



kuintctullcetolettc tfthiin pnikknan, 
oletle te olleet Herrnllc vaslahakoi* 
Sel. 2 Moos. 14:11. 16:2. 

8. Horebissa le my6s vihoiUttc Her- 
ran, ja Herra vihastui tcihin, niin 
ettA h^n talitoi teiddt hukuttaa. 

2 Moos. 32:10. 

9. Kun mina olin astunut vuorcllc 
vastaan oltamaaii kivisi5 tauluja, 
sen liiton lauluja, joiika Hcrru teki 
teidiln kaiis.saiiiie, olin minfl vuo- 
rella neljAkymmcnin puivfiA ja nel- 
jrikyninienia yfiia, en syonyl leipSa, 
enkYi juonut vcllft, 2Moos.24:is. 34:28. 

10. ja Hcrra anloi tpinullc kaksi ki- 
vista laulua, klrjoitctlua Jumalan 
sormella; ja niissfi olivut kaikki sa- 
nat, jolka Herra teillc fulesla vuo- 
rella puhui kokoukscn paivAnft; 

2Moos. 19:18s. 31:18. 5Moos. 4:11s. 

11. ja tupahtui niiden neljHnkym- 
nienen pdivan ja neljankymmenen 
v5npcrasla,etta Herra antoi minulle 
kaksi kivista liiton taulua, 

12. ja Hcrra sanoi minulle: ,,nouse 
ja mene nopiasti tAillta alas; silla 
sinun kansasi, jonka Egyntista olct 
johdatlanut ulos, on turmelleet itson- 
sS; he oval nyt jo poikennut pois sil- 
(fi tieltd, jonka mina kaskin heillc, 

I'll oval tehneet itsellensa valetun 
:uvan.** 2Moo8. 32:78. 

13. Ja Herra puhui minulle, sa- 
noen: MminAolennAhnyt tAmflnkan- 
san, ja kalso, se on niskuri kansa. 

14. Juta minut rauhaan; mind hu- 
kutan heidnt, ja pyyhin pois hei- 
dSn nimcnsA taivaan alia; ja minii 
tahdon sinut tehdA vakevAmmaksi 
ja suuremmaksi kansaksi kuin td- 
mfi on." 

15. Ja kun minA k^annyin ja as- 
luin vborelta alas, joka (ulesta pa- 
loi, ja pidin kaksi liiton taulua mo- 
lemmissa kSsissSni, 

16. niin nilin minS, ja katso, te 
olitte tehneet syntiA Herraa, teiddn 
Jumalatanne vastaan. te olitte teh- 
neet itsellenne valetun vasikau; te 
olitte niin plan poikenneet poissiltA 
tieltn, jonka Herra kdski teille. 

17. Ja min$ otin ne molemmat tau- 
lut ja heitin molemmista kdsistSni, 
ja l(Sin nc rikki teid^n silmfl|nne 

Cdess5, 2 Moos. 32:19. 

IS.jalankesinmaahanHerraneteen, 
niinkuin ennenkin, niinA nelidnd- 
kymmenenS p&ivdn5ja neljAnfikym- 
menenA ydiiS, ja en syOn^t leipAS, 
enkfi juonut vctta , kaikkein teidftn 
synleinne t3hden, joita te tehneet 
Olitte, tehdessflnne pahaa Herran 
edessft ja vihoitlaessanne hflnet. 

19. Sillfl mina pelkAsin sitfl vihaa 



ja* hirmuisuuttn, joka Hcrrassa oli 
^yttynyl leilii kohlaan, niin ellil 
han tahtpi hukuttaa teiddt; ja Herra 
kuuli minun rukoukseni vielA .sil- 
hlkin kertaa. 

20. Herra oli m}rds suuresti vihai- 
nen Aaronille, niin ettA hAn tahtoi 
hanet hukuttaa; vaan minA rukoi- 
lin silloin Aaroninkin edesta. 

21. Mutta teidSn syntinne, sen vasi- 
kan, jonka Ic tehneet olitte, olin mi- 
nd ja pollin sen tulessa, ja Idin sen 
rikki ja survoin perdti, niin etta se 
murcni tomuksi, ja heitin sen to- 
mun siihen ojaan, joka siitA vuo- 
rcsla vuosi. 2 Moos. 32:20. 

22. Niin niyds Tabeerassa, ja Mas- 
sassa, ja hiniohaudoilla te vihoititte 
Herran. 2Moos. 17.-7. 4 Moos. 11:1,3,34. 

23. Ja kun Herra mhctti teidat Ka- 
des-Barneasta, ja sanoi: „nlenk5llt 
ja omistakaat maa, jonka minA an- 
noin teille,*' niin te olitte Herran, 
teidAn Junialanne, kAskylle vastuha- 
koiset, ja ctte uskoneet hSntA, ette- 
kA olleet kuuliaiset hancn aAnellen- 
sa. 4 Moos. 13:2 s. 14:1 s. 

21. Te olette olleet Herrallc tottele* 
muttomat, aina siitS pAivAstA asti 
kuin mind leiddt tuntenut olen. 

25. Ja mind lankesin maahan Her- 
ran eteen, neljdkymmentd pdivdd ja 
neljdkymmentdyfitd mind siind ma- 
kasin; silld Herra sanoi, etld hdn 
tahtoi hukuttaa teiddt. 2 Moos. 32:11,31 s. 

34:88. 4 Moos. 14:13,16. 5 Moos. 10:10. 

26. Ja mind rukoilin Hcrraa, sa- 
noen : „Herra. Herra, did hukuta si- 
nun kansaasi ja pcrikuntaasi, jon- 
ka suurella voimallasi olet pelasta- 
nut ja vdkevdlld kddelldsi Cgyptistfi 
olet johdattanut ulos. 

27. Muista palvelijoitasi Abrahamia, 
Isaakia ja Jaakobia ; did katso tdmdn 
kansaii u^piniskaisuutta, junialat- 
tomuutta ja syntia, 

28. ettei sen maan asukkaat, josta 
meiddt olet johdattanut, sanoisi : sen- 
tdhden, ettei Herra voinut heitd vie- 
dd siihen maahan, jonka hdn heille 
o1iluvannut,jaettd hdn vihasi heitd, 
johdatti hdn heidat ulos, tappaak- 
sensa heiddt korvessa. 4 Moos. 14:16. 

29. Silld he ovat sinun kansasi ja 

f>erimyksesi, jonka suurella voinial- 
asi ja ojennetulla kdsivarrellasi joh- 
dattanutolet. 

lO Luku. 

Uudet taulut Aaronin kuolema. Leviiftis- 
ten periut5. Kchoitus vilpittAmftilii Juma- 
lan pelkoon. 

Silloin sanoi Herra minulle: „vuo- 
leit.sellesi kaksi kivisfd taulua en- 



190 



5 MOOS. 10. ]1. 



(istcn kaltaista , ja astu minun tv- 
kt>ni vuorelle. ja leeitsellesi puuark- 
ki. 2 Moos. 25:10s. 34.18 

2. niin mina kir]oilan niihin tau- 
luihin ne saiiat, jolka qiissft ensim- 
mnisissH lauluissa olivnl, jolka sHr- 
kenyl old; ja pane ne arkkiln.'* 

2 Moos. 2516,21. .32 19. 5Moos.9J0. 

3. Niinniin5teinarkin sitfimipuus« 
io. jn vuoliiS kaksi kivisi:! laulua 
enlis4cn knllaisla, ja asluin vuorelle, 
pitficn knksi tairliia kAdessAni. 

4. Ja nan kirjoitti, sen ensimm5i- 
sen kirjoituk<%en muknan, niihin lau- 
liiihin ne kymmenet sanal, iotka 
llcrra Icille puhui vuorella tulesfa, 
kokouksen pdivAnd; ja Herra antoi 
ne minulle. 2 Moos. 32 16. 

5. Sitlen minA kdSnnyin ja astuin 
vuoreltn alas, ja panin taulut ark- 
kiin, jonka mini olin tehnyl, eliS 
sielli) olisivat. niinkuin Herra mi- 
nulle kdskenyt oli. 

6. Ja Israelm lapse! menivSI Berot- 
Bene-Jaaknnisla Moseraan; siellA 
kuoli Aaron ja liaudaltiin. ja hAnen 
poikansa Eleasar (oimilli^papin vir- 
kaa hdnen sijassansa. 4Moo& 20:23. 

33:30,388. 

7. SieltA mrnJvAt he Gudgodaan; 
Gudgodasla Jotbataan, siihen maa* 
han, jossa vesiojal oval. 

8. Silloin eroiili Herra Levin su- 
vun, kanlamaan Herran liiton ark- 
kia. seisoniaan Herran edess3, pal- 
%'elemaan hAniA ja siunaamaan hA- 
nen nimes.sA3n tAhAn pAivAAn asti. 

4 Moos. 3:5 s, 8:5 s. 

9. SenlAhden ei Levi saanut osaa 
eikA perintOA veljeinsA kanssa; silla 
Herra on heidAn perint&n.sA, niin- 
kuin Herra, sinun Jumalasi, sanoi 
heille. 4 Moos. 18:208. 5 Moos. 18:1 s. 

Jos. IP 7. 

10. Ja minA .seisoin vuorella niin- 
kuin ennenkin, neljAkymmenIA pAi- 
vAA ja neljAkymmenIA y6IA, ja vielA 
silloinkin kuuli Herra minun ru- 
koukseni; Herra eilahlonuthukuUaa 

sinua. 2Moos. 32:118. 34:28. 5 Moos. 9:23. 

11. Ja Herra sanoi minulle: ,,nouse, 
mene matkaas. ja lAhde vaellamaan 
kansan edellA, etIA he menisivAl 
omislamaan sen maan, jonka minA 
vannoin heidAn IsillensA, antaakse- 
ni sen heille." 

12. Nyl siis, Israel, milA Herra, si- 
nun Jumalasi, niuula sinulta vaatii- 
kaan, kuin ettA pelkSisit Herraa, si- 
nun Jumalalasi, ja vaeltaisit kaikis- 
sa h5nen teissAnsd, ja rakaslaisit 
hAnId, ja palvelisit Herraa, sinun 
Jumalatasi. kaikesia sinun svdAm- 
jneslds Ja kaikesta siouo slelustas, 



13. niin cttA pitAisit Herran kAskyI 

i'a liAnen sAAnl6nsA. jolka minA kAs- 
Len sinulle lAnApAnA, otlA sinulle 
hyvin kAvisi ! 

14. Kalso, laivaal ja laivastcn tal- 
vaal oval Herran, sinun Jumalasi, 
ja maa ja kaikki, milA siinA on. 

1 Kun. 8.27. pj» 24:1. 

15. Kullenkin Herralla on ollul hy- 
v3 suosio sinun isiisi ja rakasli hei- 
tfi: ja hAn vnliisi heidAn siemenen- 
sA heidAn jAlkeensA, hAn valitsi lei- 
dAi kaikisia kansoista, niinkuin lA- 
nApAivAnAkin on. 2 Moos. 19-5. 

5 Moos. la. 

16. Niin ympArileikatkaat sydAm- 
menne esihahka, ja AlkAAl enAA nls- 
kuril oiko. 5Moos .lO.G. Jer. 4 4. 

Ap. t. 7 51. Room. 2 29. Kol. 211. 

17. SillA Herra, IcidAn Jumalanne, 
on kaikkein jumalain Jumala, ja 
kaikkcin herrain Herra, suuri Ju- 
mala. voimallinen ja peljAIIAvA, jo- 
ka ei kalso muoloa eikA lahjoja ola, 

2Aik. 19-7. Job. 34:19. Viis. 6:8. Syr. 35:16. 

Ap.t 10:348. Room.211. Qui. 2:6. 

Kol. 3:25. iPiel. 1 17. 

18 joka orvoille ja leskille oikeu- 
den tekee, ja rakasiaa muukaluisiu, 
niin etIA hAn heille leivAn ja vaal* 
teen aniaa. 

19. SenlAhden pilAA myds leidAn 
rakastaman muukalalsla; sillA It kin 
olitte muukalaiset Egyptin maalla. 

2 Moos 22.21. 23:9. 

20. Sinun pilAA pelkAAmAn Herraa. 
.sinun Jumalalasi, hAnIA pilAA sinun 
palveleman, hAnessA pilAA sinun 
Kiinni riippuman, ja hAnen nimensA 
kautta vannoman. 5Moos.6i3. 13:4. 

Matt. 4:10. Luuk.4:8. 

21. HAn on sinun ylislyksesi ja si- 
nun Jumalasi, joka sinun suhleesi 
leki niilA suuria ja hirmuisia l^ilA, 
joita sinun silmAsi nAhneel oval. 

2 Moos. 15:2. 

22. SeitsemAnkymmenlA sielua oli- 
vat isAsi,kun menivAt alasEgypliin; 
multa nyl Herra, sinun Jumalasi, 
ontehnytsinut monilukuiseksi niin- 
kuin taivaan lAhdel. i Moos. 46:27. 

2 Moos. 1:5. 1 Moos. 15:5. 

II Lukii. 

Mooses mulstuttaa Herran IhmelUl )ft ke- 
lioiUaa kuufiaisuuteen. 

Niin rakasta nyl Herraa, sinun Ju- 
malalasi, ja pidA hAnen lakinsa, 
sAAnlOnsA, oikeutensa ja kAskynsA 
alinomaa. 

2. Ja tUnApAnA pankaa mieleenne 
— sillA en minA teidAn laslenne 
kanssa puhu, jotka eivAt silfl ticdA, 



191 



5 MOOS. 11. 



eivfilkfi ole nfihneet — Herran, tei- 
dftn Jumalanne kuria, hfinen jaloul- 
tansa , voimallista k&tUknsfl Ja ojen- 
netlua kftsivarttansa, 

3. ja h5nen ihmeitSnsfi ]a tekoian- 
sa, jotka hfin teki Egyptilflislen kes- 
kelia Faraolle, Egyplin kuninkaalle» 
Ja koko liAnen maakunnallensa, 

4. ja mita KSn teki Egyptilfiisten 
sotavSelle, hctdftn hevoisillensa ja 
vaunuillensa, kuinka hdn antoi Pu- 
naisen meren vedet juosta heiddn 
pfiaUensfl, kun he teitfi ajoivat ta- 
kaa, Ja kuinka Herra hukutU hei- 
dfit hamaan Ifihfin pfiivfifln asti, 

2 Moos. 14:238. 

5. ja mita hfin teille kor\'essa teh- 
nyt on, siihen asti kuin te tfllifin 
paikkaan tulitte, 

6. ja milfl h&n teki Datanille ja 
Abiramille, Eliabin. Rubenin pojan, 
pojilie, kuinka maa avasl suunsa ja 
nieii lieidSt, ja heidftn perheensfi ja 
majansa seka kaikki heidfin tava- 
ransa, mikft oli heidfln hallussansa 
koko Israelin keskell&;4Moo8. le.sis. 

26:10. 27:8. Ps. 106:17. 

7. sillfi teidSn silm&nne ovat nfth- 
neet kaikki ne suuret Herran teot, 
jotka hftn lehnyl on. 

8. Sentfitiden pitakflfit kaikki kSs- 
kyt, jotka min5 teille lAnfipAnfi kHs- 
kcn. etta te vahvistuisitte ja paasi- 
sitte omislamaan sita* maata, jota 
menette valloittamaan. 

9. etta te kauan siina maassa eiai- 
sitte, Jonka Herra, sinun JumalasI, 
valan kautta lupasi antaa t^idan 
isillenne ja heician si^menellensd, 
maan« jossa rieskaa'Ja hunaJata vuo- 
taa. 

10. Silia se maa, johonka nyt menet 
omistamaan sita, ei ole niinkuin 
Egyptin maa, josta te Idhteneet olet- 
te, Jossa sind siemenesi kylvit« ja 
polkemalla jalallasi kastelit niin- 
kuin ryytimaata. 

11. Vaan se maa, johonka te me- 
nette omistamaan sita, on vuorinen 
ja laaksoinen maa, jonka sade tai- 
vaasta kastelee; 5 Moos. 8:7. 

12. Jostu maasla Herra, sinun Ju- 
malasi, pitaa huolta; ja Herran, si- 
nun Jumalasi, silmat aina sita kat- 
selevat vuoden alusta vuoden lop- 
puun asti. 

13. Ja tapahtuu, Jos te hyvln kuu- 
liaisel olette minun kaskyilleni, Jot- 
ka minfttanapana teille kasken, nfln 
etta rakaslalte Herraa, teldan Juma- 
latanne. Ja palveiette hanta kaikesta 
sydammestBnne ja kaikesta sielus- 
tanne, 

14. etta mlnfi annan teidan maal- 



lenne sateen ajallansa, syyssaleen 
ja kevatsateen, ja sina korjaat jy- 
vasi, viinisi, Ja Oljysi. 5Moos.28:i2. 

Jer.5:24. Joel. 223. 

15. Ja mina annan karjallesi ruo- 
hoa kedoillasi; ja sina syOt ja ravi- 
taan. ' • 

16. Varokaat, ettei teldan sydantan- 
ne vieleltaisi, niin etta poikkeatte 
nalvelemaan vieraita jumalia, ja 
Kumartamaan niita, 

17. ja Herran viha syttyisi teihin, ja 
sulkisi taivaan, ettef sadetta tulisi, 
eika maa antaisi hedelmaansft, ja 
te kiireelia hukkuisitte siita hyvasta 
maasta, jonka Herra on teille anta- 

riut. •SMoos.26'.19. 6 Moos. 28:23. 

18. Niin pankaat nyt namd minun 
sanani teidan sydammeenne ja mie- 
leenne, ja ^itokaal ne merkiksi tei- 
dan kaslinne, ja olkoot ne muistu- 
tukseksi teidan silmainne vaiissa; 

6 Moos. 6:6 8. San. 6:218. 

19. ja opettakaat niita lapsillenne« 
niin etta sina puhut niista huoneessa 
istuissasi, tielia kdydessasi, levata 
pannessasi^ ja nouslessasi ; 

6M008. 4:9 s. 6:7. 

20. Ja kirjoita ne sinun huoneesi 
pihtipieliin ja portteihisi; 

21. etta sina Ja sinun lapses! kauan 
eiaisitie siina maassa, jonKa Herra 
teidan isillenne vannoi antaaksensa 
heille, niin kauan kuin paivat tai- 
vaasta maan paaiia ovat. 

22. Silia Jos te kaikki namft kas- 
kyt pidatte, jotka mina teille kas- 
ken , Ja teette niitten mukaan, niin 
etta rakastatte Herraa, teidan Juma- 
laanne, ja vaellatte kaikissa hanen 
teissansa, ja riiputte hanessd kilnnl, 

23. niin Herra ajaa kaikki namS 
kansat pois teidan edesianne; ja te 
valloitatte suuremmat Ja voimalll- 
semmat kansat, kuin te olette. 

24. Kaikki paikat, Johon teidan Jal- 
kanne astuu, ovat teldan: korvesta 
ja Libanonista Ja Fratln virrasta aa- 
rimmaiseen mereen asti on rajanne 
Oleva. 2M00S. 23:31. 4M008.34:28. 

^ J08.1*.38. 14«. 

25. Ei yksikaan vol olla teita vastaan; 
pelvon ia vavistuksen antaa Herra 
tulla kaikkein niiden maiden paaile. 
lossa te vaellatte, niinkuin ban teil- 
le on sanonul. 

26. Katso, ;nln9 asetan tandpftna 
teidan eteenne sekd' siunaukseQ ettft 
kirouksen ; 

27. siunauksen. jos te knuliatsel 
olette Herran,teiaan Jumalanne, kfis- 
kylle, jonka mind tanapdna teille 
kasken, 6 Moos. 28.38. 

28. ja kirouk$en,]os ette toltele Her- 



192 



5 MOOS. 11. 12. 



ran, teidftn Jumalniiiie fc&skyjtl, jn 
poikkeattc siim ticlta, joiikn minil 
leille lunapanu kasken, niiii cltil vael- 
fatte muicfen jumaluin jiilkeen. joita 
etic tunne. 5Moos.2S:i5. 

2D. Ja kun Hcrra. sinun Jumqlasi, 
johdattaa sinut siihen maahaii, jo- 
hon nyt menct si(aomistaniaan,niin 
julista siuiiaus Gcrisimin vuorella, 
ja kirous Ebalin vuorella. 

h Moos. 27:12 s. Jos. 8:34 s. 

30. Katso, civatko ne sijaitse silI5 
puolen Jordan in. Hen pcrAlId, au- 
ringon las kemi seen piiin Kananea- 
laisten maalla , jotka asuvat lakeu- 
dcUa, Gilgalin kohdalla, Moren tam- 
miston luhclla? iMoos. 12:G. 

31. Silhl teidAn pit3[& mencmt&nJor« 
danin ylitsc, valloitlaiDaan sitS maa- 
ta, jonka Herra, (eidan Jumalannc, 
teille antaa, omistaaksenne sen, ja 
asuaksenne siin5. 

32. Kiin plUlkaat ja tehkSnt kaikki 
ne s3(inndt ja oikeudet, jotka minS 
tSnSpSnS panen teidfin eteenne. 

5 Moos. 5:33. 

12 Luku. 

KSskj h&vlttlliniian ep5jainalat. Jumalr.n 
palveluksen paikka* 

Nimat ovat nc sUdnndt ja oikcu- 
det, Joita teidnn tulee pitdfi, ja 
tehdH mitten mukaan siind maas* 
sa, jonka Herra. sinun isiiisi Ju- 
mala, antoi sinulle omistcttavaksesi 
niin kauan kuin te maan paiUhl 
elatte. 

2. Teidan pitaa perSti havittaman 
kaikki ne paikat, joissa pakanat, jot- 
ka te ajatte pois, ovat jumaliansa 
palvelleet; oh sc korkeilla vuorilla, 
Kukkuloillatahi viheri5isten puitten 
alia. 5 Moos. 7:5. 

,3. Ja kukistakaat heiddn alttarinsa 
ja sTirkekMt hcidiin kuvapatsaansa, 
heidun metsistdnsH tulella poltta- 
l^at, ja heidan epSjumalansa kuvat 
rikki hakatkaat ; ja hukuttakaat hei- 
dan nimensa siitS paikasta. 

4. PalvcUessanneHerraa,teidAnJu- 
malaanne, ei tcidan pida niin teke- 
man; 

5. vaan siinH paikassa, jonka Her- 
ra, tcid&n Jumalanne, valiisec jo- 
kaisesta teiddn sukukunnistanne, 
siscttaaksensa siihen nimens5, silna 
etsikaat hilnen asuntonsa , ja sinnc 
pitSit sinun tuleman. 2 Moos. 20.24. 

lKun.8:29. 2 Aik. 7:12,10. 

6. Ja sicllu pitHa teidftn uhraaman 
teiddn polttouhrinnc ja muut uh- 
finne, ja teid3n kymmeiieksenne, 
ja kattenne yldnnysuhrin, ja teiddn 
lupausuhrinne, ja vapaaehtoiset uh- 



'rinne, sckA esikoisct karjastanne ja 
lainpaistanne. 

7. Ja sicllii teidan pi tan syOm;'Wi 
Hcrran, teidiin Jumalanne, edcssit, 

t'a iloitseman, te ja teidiin perheenne, 
Laikesta kdttenne tydstn, joilla Her- 
ra, sinun Jumalasi, on sinua siu- 
nannut. 

8. Alknnt tehkO niinkuin me tAssd 
ttlnfipaivSnil teemme, jokainen mitti 
h£(nen mielestSnsA on oikca. 

9. Siim ette vielH ole tShdn asti tul- 
Icet lepoon ja perimykseen, jonka 
Hcrra, sinun Jumalasi, sinulleantaa. 

10. Mutta kun olelte mcnneet Jor- 
danin ylitse. ja asuttc siinii maassa, 
jonka Herra, leidun Jumalanne, an- 
taa telddn peria, ja kun hSn antaa 
teille levon kaikilta IcidHn vihamie- 
hiltdnne ympArillfinne,niin ettil tur- 
vallisesti asutte, 

11. niin pitua tciddii viemSn sille 

f>aikalle, jonka Herra, sinun Juma- 
asi, valitsce, ettA h5ncn nimensd 
siinii asuisi, kaikki nAmu, jotka mi- 
na teille kaskcn: teidiin polttouh- 
rinnc, ja Icuras-uhrinne, kymmenek- 
senne, krutenne ylOnnysuhrin, ja 
kaikki parhaat lupaus-uhrinne, jot- 
ka te Hcrrallc lupaattc. 

12. Ja iloitkaat Hcrran, teidiln Ju- 
malannc, cdessu, sekn te etta teidan 
poikanne ja tyllarcnne, tcidan pal- 
vclijanneja piikanne, ja myos Levi- 
lliisct, jolka tcidan porlcissanne oval, 
silin ci hcillii oleo.saa aikiX perintoa 
teid5n kanssannc. 4Moos. 1S:24. 

5 Moos. 10:9. 18:1. 

13. Karia uhraamasla poltlouhriasi 
joka paikassa, jonka nAct; 

14. vaan siind paikassa, jonka Hcr- 
ra valitsee jossakussa sinun suku- 
kunnassasi, sielHi pltaii sinun polt- 
touhrisi uhraaman ja tckcman kaik- 
ki, mita minii sinulle kiisken. 

15. Kuitenkin saat teurastaa ja sy6- 
da llhaa niin paljon kuin haluttaa, 
Hcrran, sinun Jumalasi, siunaukscn 
jdlkeen, jonka h0n sinulle on anta- 
nut kaikissa sinun kaupunkiesi por- 
tcissa; sckd saastainen ctlii puhdas 
siita syokOOn, niinkuin melsavuo- 
hen ja pcuran lihaa. 

16. Mutta alkdat verta syoko; vaan 
kaatakaat se maahan niinkuin vcsi. 

1 Moos. 9:4. 3MOOS. 3:17. 7:26. 17:10. 19:26. 

5 Moos. 15.23. 

17. Et sina saa porteissasi sydda si- 
nun jyvasi, viinisi ja oljysi kvm- 
mencksia, eika myos csikoisia kar- 
jastasi ja lampaistasi, eika yhtakaan 
lupaus-uhria, jonka sina luvannut 
olet, eika vapaaehtoista uhria, cikd 
kattesi ylonnysuhria; 



VfkaUkkl 7 



193 



5 MOOS. 12. 13. 



18. vaan Herran, sinun Jumalasf, 
edessS pitna sinqn niita sydni5n sii- 
nft paikassa, jonka Herra, sinun Ju- 
malasi, valitsee, sin5 ja sinun poi- 
kasi, ja tytldresi, ja palvelijasi ja 
piikasl, ja LevilSinen, joka sinun 
portissasi on; ja iloitse Herran, si- 
nun Jumalasi^edessakaikista kflttesi 
saannoisla. 

19. Ja Ola vaari, etiet hyljaa Levi- 
Idista, niin kauan kuin sinS el5( 
maan pSniia. 6Moos. 14:27. Syr. 7:31. 

20. Kun Herra, sinun Jumalasi, le- 
vittaa sinun maas! rajat, niinkuin 
Iidn sanoi sinulle, ja sinA sanot: 
„min5 s5isin litiaa/' koska sinua 
haluttaa liliaasyOdA; niinsyOlihaa 
sielusi himon jillkeen. i Moos. 2S:H. 

6 Moos. 19-3. 

21. Jos se paikka, jonka Herra, si- 
nun Jumalasi, valitsi, antaaksensa 
nimensa sieII5 asua, on sinulle liian 
kaukana, niin teurasta karjastasi ja 
lampaistasi, jotka Herra sinulle an- 
tanut on, niinkuin minil sinulle kSs- 
kin, ja syO porteissasi sielusi himon 
jalkcen. 

22. Niinkuin metsavuohcn ja peuran 
lihaa syddflSn, niin pitdft sinun sen 
sy6m5n; sekA saastainen ettS puh- 
das silt A sy6k6dt. 

' 23. Varo vaan, etlet verla sy5 ; sillfl 
veri on sielu, sentHliden et sinft saa 
sy(Sd5 sielua lihan kanssa. 

3 Moos. 7:26. 17:11. 

24. Et sinft saa sit3 svdda, mutta 
kaada se maahan niinkuin vesi. 

25. Ala syO sita, etta menestyisit, 
sina ja lapsesi sinun jaikeesi, koska 
oikein tennyt olet Herran edessa. 

26. Mutta kun sina pyhitat jotaih 
mika sinun omasi on, taikka teet 
lupauksen, niin ota se ja tuo siihen 
paikkaan, jonka Herra valinnut oh. 

27. Ja uhraa/sielia polttouhrisi se- 
ka liha etta veri Herran, sinun Ju- 
malasi alttarilla; mutta sinun teu- 
ras-uhrisi veri kaada Herran, si- 
nun Jumalasi, alttarille, ja syO liha. 

28. Ota vaarin, ja kuule kaikki nfi- 
ma sanat, jotka mind kasken si- 
nulle. etta menestyisit, sina ja sinun 
lapsesi sinun jaikeesi ijankaikkises- 
ti, koska olet oikein ja kelvoUisesti 
Herran, sinun Jumalasi, edessft teh- 
iwl, 

&. Kun Herra, sinun Jumalasi, ha- 
vittaa pakanat sinun edestasijoitten 
lub sina tulel heitft valloittamaan, 
ja sina olet heidat ajanut ulos ja 
asul heidan maassansa, 

30. niin ota vaarin, ettet paulaan 
lankea heitft seuraamaan, sittekuin 
he ovat hukutctut sinun edestasi, ja 



ettet etsisi heidan jumaliansa,* sa* 
noen: „niinkuin tamakin kansaon 
palvcllut epajumaliansa, niin tali- 
don myOs mina tehda.'* 

5Moos. 18:9s. Jos. 23:7. Ps. 106:35s. 

31. Ei sinun pida niin tekeman 
H^rralle, sinun Jumalallesi; silia he 
ovat tehneet jumalillensa kaikkia 
sita, mika Herralle on kauhistus, 

1'ota han vihaa; silia he ovat poi- 
Lansakin ja tvttarensa tulessa polt- 
taneet jumalillensa. 

32. Kaikki, mita mina kdsken teille, 
se pitakaat, tchdaksennesen jaikeen ; 
aikaat siihen mitaan lisatkO eika 
siita mitaan vahentakO. 5 Moos. 42. 

Jos. 1:7. San. 30:6. lim. 22:188. 

• 13 Luku. 

VS&rist& profetoista. Viettelyksestft ep&ju- 
nialan palvelukseen. 

Jos profetta eli unennakija nousee 
teidan keskelianne, ja antaa teille 
mcrkin tahi ihmeen, 

2. ja se merkki taM ihme todella 
tapuhluu, josta han puhui sinulle, 
sanoen: „kaykaamme ia noudatta- 
kaamme vieraita jumalia, joita et 
sina tunnc, ja palvelkaamme niita ;'* 

3. niin Ala kuuntele sen profetan 
tahi unennakijan sanoja, silia Her- 
ra, teidan Jumalanne, koettelee tei- 
ta, saadaksensa tietaa rakastatteko 
Herraa, teidan Jumalaanne, koko 
sydammestanne ja koko sielustanne. 

4. Herraa, teidan Jumalaanne, pi- 
taa teidan noudattamnn ja hanta 
pelkaaman, ja hanen kHskynsa pitft- 
man ja hanen aantansa kuuleman, 
hanta palvcleman ja hAnessa kiinni 
riippuman. 5 Moos. 6:13. 10:00. 

5. Mutta sen profetan lahi unennA- 
kijanpitAakuolenlan; silia hanopet- 
ti teita luopumaan Herrasta, teidan 
Jumalastanne, joka teidai Eg>'ptin 
maasia johdatti ulos jd sinut orjuu- 
den huoneesta pelasli , ja han viet- 
teli sinut silta tieltA, jota Herra, si- 
nun Jumalasi, kaski sinun kaymaAn ; 
ja sinun pitaa eroittaman pois pa- 
nan scastasi. 5 Moos. 18:20. 

6. Jos sinun veliesi, aitisi polka, 
tahi sinun poikasi, tahi tyttdresi, ta- 
hi vaimosi, joka sylissasi on, tahi 
ystavasi, joka on kuin oma s^dam- 
mesi, viettelisi sinua salaa, ja sa- 
noisi : .,kaykaamme ja palvelkaam- 
me muita jumalia, joita et slnft 
tunne, eika isasikaan,'* — 

7. kansain himalia teidftn ympftris- 
tAUanne, joko he lahellA tahi kau- 
kana ovat, toisesta maan fifirestA 
toiseen ; 



194 



i 



5 MOOS. 13. 14. 



S. niin 515 si i hen suostu, fihlkA olc 
hanelle kuuliuineii, ja dlkdon sil- 
miisi saniikri liantA; 51:1 hanlu ar- 
niahda. alakn salaa liant5, 

9. vaan surmaamalla surnian h5- 
net; sinun katcsi olkoon ciisin h5n- 
fii vaslaun, ctUl li5ii surmattaisiin, 
ja sen perUstd koko kansaii k5si. 

5 Moos. 17:7. 

10. KivillA h^n surmattakoon, sillil 
han tahloi luovuttaa sinut Herrasta, 
sinun Junialaslasi, joka sinut Egyp- 
jin maasia, orjuuden huoneestu on 
johdaHanut ulos, 

11. elta koko Israel sen kuulisi ja 
pelkaisi, eikil scilaisla pahiiutta tei- 
(lah keskeimnne enn5 tcliUlisi. 

5 Moos. 17:13. 

12. Jos sinil saat kuulla jossakussa 
kaupungissasi , joiika Herra, sinun 
Jumalasi, sinulle antaa asuttavakse- 
si, sanottavan : 

n. „muutamat belialin lapsct ovat 
iShlenecl sinun joukostasi, ja kSHn- 
Uincet kaupunkinsa asujat pois, ja 
sanoneel: kaykaamnie. palvelkaani- 
mcmuita jumaliajoita ellc lunne," 

14. niin pitAS sinun ctsiman, tutki- 
raan ja kyseleniHn visusli; ja katso, 
jos sc on olkein toila, jos se kauhis- 
tus Ieid5n scassaune tapahtunut on, 
,15. niinsurmaa sen kaupungin asu- 
jat miekan teralla, ja hukuta hcidat, 
ja kaikki mita ikHna siina on, ja 
neidan karjansa niiekaii lernila. 

16. Ja kokoa kaikki saalis keskellc 
sen katua, ja polla tulcssa, sekii 
kaapunki e(t5 kaikki sen saalis, 
Hcrralle, sinun Jumalallesi, ellS se 
autiana pysyy ijankaikkisesti, eikiV 
ikilnS enfla lule rakennellavaksi. 

17. Al5 mitAfin kSsiisi j5ta siita ki- 
rotusta, elia Hcrra kdantyisi vihan- 
sa julmuudcsta , ja antaisi sinulle 
»aui>euden, ja armahlaisi sinua ja 
cneniaisi sinut, niinkuin h5n isillc- 
si vannoi, 

W. jos sin5 Hcrran, sinun Jumala* 
si, 35nellc kuuliaincn ollut olct, ja 

tilanyt kaikki hanen kHskynsa, jot- 
a mina sinulle tan5p5na kaskcn, 
oikein tehdaksesi Hcrran, sinun Ju- 
malasi, silniain edessa. 

14 Luku. 

PaluuuaiiAen murhe kuolleesta kiellctlUin. 
Pohtaat ja saustaiset elilimet. Kymmeiiek- 

ECt. 

Tc olcllc Herran. teidSn Jumalan- 
''' ne, lapset: alkaat piirustelko it- 
<Hinne,alkaatka itseannc keritko pal- 
jaaksi teidan otsaltanne jonkun kuol- 
Ken liUiden. 3 Moos. was. 21 :5. 



2. Silia sina olct pyhS kansa Hcr- 
ralle, sinun Jumalallesi, ja Hcrra 
onsinunvaiinnulcrinomaiseksikan- 
saksi kaikista kansoisia, jotka niaan 
paaua ovat. 2Muos.19*.5. 5Moos. 4:20. 

7 rO. 20.18. 

3. Ala syO mitaan kauhJslavaista. 

4. Mulla namat ovat ne elAiniel. 
joita le saatte sydda: harka, lamnias 
ja vuolii, 3M0O8. Ilr2s. 

.5. peura.metsavuohi, ruskia peura, 
vuorikauris, gaselli, puhveli, maki- 
kauris. 

G. Ja kaikellaisia eiainiia, joilla on 
kaksiliaarainen sorkka, kokonansii 
hajoitetiu kahtia, ja jolka marchti- 
val, niita tc saatle SN-OdA. 

7. Mutia niista. jotka marehtivai, 
ja halaislun sorkkansa jakavat, al- 
kaat kuilcnkaan syok5 naita : kame- 
lia, janista, kaninia; silld he niareli- 
tivai, vaan eivat ole kuitenkaan ko- 
konansa kaksisorkkaiset ; nc olkoot 
teille saastaiset. 

8. Sika, jolla tosin on kaksfliaarai- 
sct sorkat, mulla ei kuilenkaap mar- 
lichdi, olkoon teille saastainen; ha- 
nen lihaslansa ci teidan pidA syd- 
inan, eika .sen raatoon.koskeman. 

9. NamAt oval ne, joita te saatle 
syoda kaikista niisia, jolka vedessa 
ovat: kaikkia, jolla uimus ja suo- 
mus on, saatte syftdA. 3Moos. ii:9. 

10. Mulla sita, jolla ei olc uimuk- 
sia eika suomuksia, alkaat syfikd; 
se on teille saastainen. 

11. Kaikkia puhtaita lintuja syfi- 

kaat. 

12. Mulla namAt ovat ne, joita ette 
saa syoda : kotka, luukotka ja kala- ' 
kotka, 

13. van's, harakka ja kokkoHiitu 
lajinensa, 

14. ja kaikki kaarnchet lajinensa, 

15. kamclikurki, tarhapdlld, luovc 
ja liftukka lajinen.sa, 

16. huhkaja, hyypie, y0kk6, 

17. ruovonparisliya, storkki, mcri- 
melsas, 

18. haikara, pa|)ukaija lajinensa, 
harjallntuja nahkasiipi. SMoos. 11:19. 

10. Ja kaikki siivelliset matelijat ol- 
koot teille saastaiset; .aikd6n niilA 
SYiiiakf). 

20. Kaikkia puhtaita siivellisia saat- 
te syoda. 

21. Alkaat syakd yhtaan raatoa; 
muukalaiselle, joka porteissasi on, 
anna se syOlAvaksi, talii myd sc vie- 
raalle; silia sina olet pyha kansa ' 
llerralle, sinun Jumalallesi. Ala kei- 
lA vohlaa emansa rieskassa. 

2 Moos. 23:19. 34:20. 

22. Sinun piiaa vflpitldmasti kym- 



195 



» 



5 MOOS. 14. 15. 



meneksel antaman kaikesta sinun 
jyvfitulostasi, joka pellollasi kasvaa 
vuosi vuodelta. 3 Moos. 27:30. 

5 Moos. 12:6. 

23. Ja sinun pitna Herran, sinun 
Jumalasi, edessS, siinft paikassa, jon- 
ka hdn valitsee, eii^ hftnen nimensft 
siinS asuisi, syOnilin sinun jyvfisi, 
viinisi ja dljysl kymmenekset , esi- 
koiset sinun karjastasi ja lampais- 
tasi, ettfi oppisit pelkflflmoan Herraa, 
sinun Jumalatasifkokoelinaikanasi. 

5 Moos. 12:18. 

24. Mutta Jos tie on sinullc ylOn 
pitkS, niin ettet taida sita viedS sin- 
ne, koska se paikka, jonka Herra, 
sinun Jumalasi, on valinnut, ettA 
liftnen nimensti sielld asuisi.on kau- 
kana sinusta, — kun Herra, sinun 
Jumalasi, on siunannut sinun, — 

25. niin myO se raliaan , ja ota ra- 
ha kilteesi, ja mene siilien paikkaan, 
ionka Herra, sinun Jumalasi, on va- 
linnut, 

26. jaosta silia rahalla kaikkia, mi- 
tA sielusi halifaa. oli se naula-elfiin 
tahi lammas, viiniA talii vSkevftft 
iuomaa, taikka mitS ikanfi sielusi 
haluaa, ja syO se Herran, sinun Ju- 
malasi, edessH, ja ole iloinen, sinS 
ja sinun perlieesi. 

27. Ja am hyljaa Leviiaista, joka 
sinun porteissasi on, silia ei hanelia 
ole osaa eika perimysta s^nun kans- 
sasi. 5 Moos. 12:12, 19. 

28. Joka koImannenvuodcnlopuUa 
pitaa sinun tuoman kaikki kym- 
menekset silta vuodelta ja laskeman 
ne portteihisi. 5 Moos. 26:12. 

29. Ja sitten tulkoon Leviiainen, 
jolla ci yhtaan osaa eika perimysta 
ole sinun kanssasi, ja muukalainen, 
ja orpo, ja leski, jotka porteissasi 
ovat, ja he sydkOdt ja ravittakoot, 
etta Herra. sinun Jumalasi, sinua 
siunaisi kaikissa sinun kailesi tOis- 
sa, jota teet. 4 Moos. 18:24. SMoos. 26:12. 

28:2. 

15 Luku/ 

Vapaavuosi. KOyhftt Bsikoiset. 

Seitseman vuoden perastA pitaa si- 
nun pitaman vapaavuotta. 

2 Moos. 23:10 s. 4 Moos. 25:3 s. 

2. Ja nain pitaa se vapaavuosi pi- 
detiaman * jokainen velkoja, joka jo- 
takin kadestansa laiiimmaisellensa 
lainannut on, antakoon hanen olla 
levossa ja olkoon velkomatia lahim- 
mAistansa ja veljeAnsa, silia Herran 
vapaavuosi on kuulutettu 

3. Muukalaista saat sina velkoa; 
mutta veljellesi jAia hanen \^elkansa. 
. 4. Ja ei pida yksikaan kerjaaja tei- 



dan seassanne oleman; silia Herra 
on siunaava sinua siinA maassa, jon- 
ka Herra , sinun Jumalasi , sinulle 
perimiseksi antaa, omistaaksesi sita, 

5. jos vaan ahkerasti kuulet Her- 
ran, sinun Jumalasi, aftnen, ja pi- 
dat ja teet kaikki nAma kaskyt, jot- 
ka mina sinulle tanapana kdsken. 

6. Silia Herra, sinun Jumalasi, on 
siunaava sinua, niinkuin ban sinulle 
on sanonut, niin etta lainaat mo- 
nelle kansalle, mutta itse et lainaksi 
Ota ; ja sina olet hallitseva paljokan- 
saa, mutta sinua ei yksikaan hallitse. 

0M008. 28:12. 

7. Jos joku veljistasi on joutunut 
kdyhaksi jossakussa kaupungissa si- 
nun maassasi, jonka Herra, sinun 
Jumalasi, sinulle antaa, niin aia ko- 
venna sydantasi aiaka sulje kattasi 
kdyhaita veljeliasi, 3 Moos. 25*35. 

8. vaan avaa katesi hanelle, ja lui- 
naa mielui^esti senjalkeeu kuin hfin 
puulteessansa larvitsee. Matk5:^ 

Liiuk. ^:34. 

9. Varo, cttei sydammessasi nouse: 
bclialin ajatus, etta sanoisit: tinyi- 
tulee pian seitsemas vuosi, joka on 
vapaavuosi,'' ja etta pahallasilmaua 
katselet koyhaa veljeasi etka mitftAn 
anna handle ; ja han huutaa sinun 
ylitsesi Herran tykO, ja se tulee si- 
nulle synniksi. 

10. Sinun pitaa hyvaiia mielelia an- 
taman hanelle; aikOdn sydammesi 
paheksuko, kun hanelle annat; silia 
.sentaiiden on Herra, sinun Jumala- 
si, siunaava sinua kaikissa tAissllsi, 
ja kattesi askareissa. 

11. Silia ci kdyhia tule puuttumaan 
maalta; sentahden kasken mina si- 
nua ja sanon : avaa aina katesi vel- 
jellesi, joka tarvitse\*a ja kdyha on 
sinun maassasi. Matt26:ll. Job. 12s. 

12. Jos sinun veljesi, hebrealainen 
mies tahi vaimo, myO itsensa sinul- 
le, niin hAnen pitaa palveleman si- 
nua kuusi vuotta; mutta seitsemfin- 
tena vuonna pitaa sinun hanen va- 
paaksi paastaman. 2 Moos. 21:2. 

3 Moos. 25:39 s. Jer. 34:14. 

13. Ja kun sina hanen vapaaksi 
pAAsiat, niin aia anna hanen mennft 
tyhjin kasin tykoasi; 

14. mutta sinun pitaa hanelle mie- 
luisesti lahjoittamanlampaistasi, rii- 
hestasi ja viinikuumastasi, niin etta 
annat hanelle siitA, jolla Herra,. si- 
nun Jumalasi, sinut on siunannut. 

15. Ja muista, etta itse olit orja E- 
gyptin maalla, ja Herra, sinun Ju- 
malasi, pelasti sinut; sentAbden mi- 
iiA naita sinulle tanapanfi kasken. 

16. Jos ban sanoo sinulle: ien minft 



196 



5 MOOS. 15. 16. 



Ifthde sinun tykOfisi ; sillfi h9n rakas- 
laa linua ja huonettasi , koska hft- 
nen on hyvd olla sinun tykOnSsi ; 

2Moo8.21:&s. 

17. niin ota naskali ja pistft hftnen 
korvansa lilpi oveen, ja anria hftnen 
olla oijasi ainaiseksi; niin pihin si- 
nun myds tekemfln orja - piikasi 
kanssa. 

18. AIS tyOldsty siitfi, etlS hfinet ty- 
kA9si vapaaksi pSdslSt; sillfi hSn on 
palvellut sinua yhlfi paljon, kuin 
kaksinkertainen palkoliinen« kuusi 
vuoHa. Niin Herra, sinun Jumalasi, 
siunaa sinua kaikissa tOissSsi. 

19. Kaikki IiHrkyiset karjan esikoi- 
Msta, ja oinnat lammasten esikoisls- 
la. pilaii sinun pyhittfimfin Hernille, 
sinuQ Jumalallesi; fiia ty&15 tee kar- 
jasi esikolsella, filfikfl keritse lam- 
mastesi esikoista. 2 Moos. 13:2. 34:19. 

3M008. 27:26. 4 Moos. 3:13. 8:17. 

20. Herran, sinun Jumalasi, edcssfi 
Piiaa sinun ne sydmfin, sinS ja per- 
neesi,vuosi vuodelta,siinfi paikassa, 
jonka Herra on valinnut. 

21. Jos siinfi on joku virhe, niin et- 
i^ se ontuu taikka on sokia, laikka 
siina on joku muu virhe, niin HIS 
uhraa sits Herralle, sinun JumalaU 
'«i. 3 Moos. 22:20. 6 Moos. 17 :1. 

M.il. 1:8,13. Syr. 35:10. 

22. Porteissasi pilSil sinun sen syd- 
ni3n; saastainen ja puhdas siitSsyO- 
kddn niinkuin mctsSvuohen ja pcu- 
nin lihaa. 

23. Mutta sen veria 313 sy5, vaan 
vuodata se maahan niinkuin vesi. 

1 Moos. 9:4. 8 Moos. 3:17. 17:10. 
5 Moos. 12:16,23. 

1 6 Luku. 

LaU pSfisi&is-, helluntai- ja lehtimajan- 
luhlasta. Tuomorit. 

Ala vaarin Abib-eli tShka-kuusta, 
^ elta pidat Herralle, sinun Juma- 
lallesi, paasifilsm; silin Abib-kuussa 
on Herra, sinun Jumalasi, johdat- 
(anut sinut Egyptista, yOim. 

2 Moos. 122. 13:4. 23:15. 3 Moos. 23:5. 
4 Moos. 9:2 8. 28:168. 2Aik.35:l. 

2. Ja leurasta Herralle, sinun Ju- 
malallesi, pftfisifliS'lampaita ja kar- 
jaa siind paikassa, jonka Herra va- 
litsee nimensft asumasijaksi. 

2 Moos. 12:15. 

3. Aid syA hapanta leiptlil sind juh- 
kina. Seitsemfin pAivda pitflft sinun 
sydmSn happamntonta leipSa, mur- 
been leipSft. SillA sinU mksit kiirees- 
U Bgyptin maasia ulos. Koko elin- 
aikanasi piiaa sinun muislaa sita 
piiv&a, jona laicsit Egyptin maasta. 
21I00I. 12148. 3Moot.23«.4Moos.92. 28:16. 



4. Seitsemana paivana aikMn nah- 
tak6 hapannutla taikinaa missaan 
sinun maasi aarissa; ja lihasla, jola 
ensimmaisena pAivana ehtoolla teu- 
rastetaan, ei pida mitaan jaaman 
ylitse ydn huoniencksi. 

2 Moos. 12:10. 3425. 

5. Et sina saa teuraslaa paasiais« 
uhria missaan sinunporteissasi,jotka 
Herra, sinun Jumalasi, slnullc an- 
laa; 2Aik.35:1. 

6. mulla siina paikassa, jonka Her- 
ra, sinun Jumalasi, valilseva on ni- 
mensa asumasijaksi. siina leurasta 
paasiaiseksi illalla, kun aurinko on 
iuskenu(,siliaajalla,kuin sinaEgyp- 
lisia laksit. 2Aik.6.lO. 

7. Ja kypsenna ja syO siina paikas- 
sa, jonkn Herra, sinun Jumalasi, va- 
lilseva on, ja palaja sitten huomc- 
nellain ja mene majaasl. 

8. Kuutcna paivfina syO liappama- 
tonta; mutta seitsemantena pdivana 
on Hcrran, sinun Jumalasi, paaiOs- 
juhla; aia silloin mitaan ty6ta tee. 

3 Moos. 23:8. 

9. Lue itsellesi seitseman viikkoa; 
aloita lukcmaan nc seilsemSn viik- 
koa siita kuin sirppi eloon viedaan. 

10. Ja pida viikkojuhla Herralle', 
sinun Jumalallesi, ja anna hyvfin- 
tahtoiset lahjasi kadestasi, senjai- 
kecn kuin Herra, sinun Jumalasi, 
sinuUe siunannut on. SMoos. 23:16. 

4 Moos. 2826. 

11. Ja iloitse Herran, sinun Juma- 
lasi, edessA, Sina ja poikasi, tytta- 
resi, palvclijasi, piikasi, ja iJeviiai- 
nen,joka on sinun porteissasi, ja 
muukalainen, ja orpo ja leski, jotka 
ovat keskeliasi, iloitse siina paikassa, 
jonka Herra, sinun Jumalasi, on 
valitseva nimensa asumasijaksi. 

12. Ja muista, etta itse olet ollut 
orja EgyptissA, ja pida ja tee nama 
sAnnnat. 

13. Lchtimajan juhlaa pida seilse- 
niAn paivaa, kun olet koonnut rii- 
hcslAsi ja viinikuumastasi. 

3 Moos. 23:34. 

14. Ja iloitse juhlanasi, sina ja poi- 
kasi ja tyttaresi, palvelijasi, piikasi, 
LevilAinen, muuxalainen, orpo ja 
leski, jotka ovat porteissasi. 

15. SeitsemAn paivaa pida juhlaa 
Herralle, sinun Jumalallesi, siina 
paikassa, jonka Herra on valitseva; 
silia Herra, sinun Jumalasi, siunaa 
sinua kaikissa, mita sinA kokoat, ja 
kaikessa kattesi taissa; sentAhden 
iloitse. 

16. Kolmastivuodessa tulkoot kaik- 
ki miehenpuolesi nAkyviin Herran, 
sinun Jumalasi, cleen siina paikas- 



197 



5 MOOS. 16. 17. 



sa, jonka hfin on valitseva, happa- 
mattoman leivdn juhlana, viikko- 
iuhlana, ja lehtimajan juhlana; fil- 
k05n yksikdantyhjinkfisinesiintykO 
Herran eteen, 2Moos. 23:17. 3423. 

8 Moos. 23:4 s. Syr. 35:8 s. 

17. vaan jokainen lahjoinensa Her- 
ran, sinun Jumaiasi,siunauksenjdl- 
keen, jonka, hun sinulle on antanut. 

18. Tuomarit ja kilskyluiset aseta 
itsellesi kaikkiin sinun portteihisi, 
jotka Herra, sinun Jumalasi, sinulle 
antaasukukunnissasi,tuomitsemaan 
kansaa oikialla tuomioUa. 

19. AlS kdanna oikeutta, IMSl muo- 
don mukaan katso, ja dl5 lahjoja 
Ota; silin lahjat sokaisevat toimellis- 
ten silmfit ja ksrintav5t hurskasten 
asiat. 2 Moos. 23:68. 3 Moos. 19:15. 

5Moos.l:17. San. 15'.27. 

20. Oikeulta, oikeutta noudattele, 
cttd einisit ja omistaisit sen maan, 
jonka Herra, sinun Jumalasi, sinul- 
le aniaa. 

21. Aia istuta itsellesi metsistcajon- 
kun kallaista puuta Herran, sinun 
Jumalasi, 4ilttarin juureen, jonka 
itsellesi teet. 

22. Alu pystytS itsellesi kuva-patsas- 
ta, jota Herra, sinun Jumalasi, vi- 
haa. 3 Moos. 26:1. 

ly Luku. 

Ep&Jumalanpalveluksen rangaistus. 
Tuomarit ja kuninkaat. 

A" in uhraa Herralle, sinunJumalal- 
lesi, mitfilln nautaa tahilammas- 
ta, jossa on joku virhe taikka vam- 
ma; sillti se on Herralle, sinun Ju- 
malullesi, kauhistus. 3 Moos. 22:20s. 

5 Moos. 15:21. Mai. 1:8,13. 

2. Jos jossakussa sinun porleistasi, 
jotka Herra, sinun Jumalasi, antaa 
sinulle, tavalaan joku mies tahi nai- 
nen, joka pahaa tekee Herran, sinun 
Jumalasi, silmHin edessil, rikkoen 
hunen liittonsa, 

3. ja menec palvelemaan vieraita 
jumalia ja kumartaaniitd,aurinkoa, 
kuuta tahi jotakuta taivaan joukos- 
ta, jota en min^ ole kdskenyt, 

4. ja se sanolaan sinulle, ja sind 
kuulet sen, niin tiedustele visusli, 
ja jos varmasti todeksi havaitaan, 
etta senkallainen kauhistus Israelis- 
sa on lehty, 

5. niin vie se mies tahi nainen u- 
Ips, joka senkaltaisen pahuudenon 
tehny t, portteihlsi, ja^kivitfi han kuo- 
liaaksi. 

6. Kahden talii ko.lmen suun todis- 
tuksesta hfln kuoletettakoon , joka 
kuoleman on ansainnut; mutta yh- 



den suun todistuksesta filkMnhilntft 
kuoletetlako. iMoos. 36:30. 5Moo8.^9:i5. 
Matt 18:16. Joli.8:17. 2Kor.l3:l. Hebr.l0:28. 

7. Todistajain kSsi piiaa ensim- 
maisena oleman hanen pfiaUens^ 
tappamaan hanta, ja sittenkoko kan- 
san kasi; eroila pois paha keskelta- 
*>• _ , , 6Moo8.13:9. 19:19. 

8. Jos joku asia tuomitessasi nftkyy 
sinusta hamaraksi, veren ja veren 
yaiilia, rikoksen ja nkoksen vfilillfi, 
loukkauksen ja loukkauksen vfilillfi, 
ja mita rilta-asioita onkaan sinun 
porteissasi, niin nouse ja mene sii- 
hen paikkaan, jonka Herra, sinun 
Jumalasi, valitseva oh, 6Moo8.2i:&. 

« * . , . 2Aik.l9a08. 

9. ja tule pappien ja Leviiaisten luo»- 
ja sen luo, joka siihen aikaan on 
tuomari, ja kysy heiltS; hesanovat 
sinulle tuomion sanan. Mai. 2:7. 

10. Tee sen sanan jaikeen, jonka he 
sinulle julistavat,siinapaikassa, jon- 
ka Herra on valitseva, ja ota vaarln, 
etta teet kaikki mita he sinulle o- 
pettavat. 

11. Sen lainjaikeen. jonka he opet- 
tavat sinulle,ja sen tuomion jaikeen, 
jonka he sanovat sinulle, pitaa sinun 
tekeman,niin ettet sjita sanasta, jon- 
ka he sanovat sinulle, vilpistele, ei 
oikialle eika v^senlmalle. 

12. Ja jos joku ylpeydesta el ole 
kuuliainen papille, joka sielia sei- 
soo Herran, sinun Jumalasi, palve- 
lusta tekemassa, tahi tuomarille, sen 
niiehen pitaa kuoleman; ja ola si- 
na se paha Israelista pois, 

13. etta koko kansa sen kuulisi ja 
pelkaisi, eika enaa ylpiasti tekisi. 

14. Kun tulet siihen maahan, jonka 
Herra, sinun Jumalasi, sinulle an- 
taa, omistaaksesi sita ja asuaksesi 
siina, jasanot: „minaasetan kunin- 
kaan itselleni, niinkuin kaikki kan- 
sat jotka ympariliani ovat,**i Sam.8:io. 

15. niin aseta se kuninkaaksi itsel- 
lesi, jonka Herra, sinun Jumalasi, 
valitsee. Aseta veljistasi kuningas it- 
sellesi; et sina saa asettaa muuka- 
laista, joka ei ole sinun veljesi. 

16. Mutta aikOOn han pitakd mon- 
la hevosta, ja aikOOn viekO kansaa 
jalleen Egyptiin saadaksensa enem- 
man hevosia,silia Herra sanoi teille: 
„aikaat enaa tata tieta palatko.*' 

1 Kim. 10:26,288. Jes. 31:1 s. 

17. AlkOOn han mydskaan ottako it- 
sellensa monta vaimoa, ettei hanen 
sydammensa luopuisl pois; aik56n- 
ka kootko itsellensa aivan paljon 
hopeata ja kultaa. 

18. Ja kun han istuu valtakuhtansa 
istuimella,niin kirjoituttakoon itsel- 



198 



5 MOOS. 17. 18. 19. 



lensil tSmfin Iain pappien, Levihlis- 
ten, hallussa olevan Iciijan mukaan. 

19. Se oikoon hflnen tykOnftnsA, ja 
hAn lukekoon sittk koko elinaikansa, 
eltA hSn oppisi pelkAflmfifin Hernia, 
Jumalatansa , ja pitdm5fln koko tA- 
miin lain sanat ja nAmfl sii9nnOI, 
ja eflil hfin lekisi niiden jftlkcen, 

Jos. 178. 

20. niin etlei hnn koroltaisi sydAn- 
tilnsA veljiensd yUtse,eikfi myOs kAs- 
Ityisia vilpistelisi. ei oikialle eikA 
vasemmalle-puolelle, etlA hdn pfli- 
v3ns2 pidenUisi valtakunnasi^insa, 
hiio ja lidneii poikansa Israelissa. 

l8 Luku. 

Pappfen Ja LeviUUsten osa. Noituus Ja 
taikaus. VJlarat profetat. 

Dapeilla, Lcviiai.silin ja koko Levin 
*^ sukukunnalla fllkOOn olko osaa 
cikfi perintOA Israelissa. Herran uh- 
riajahSnen perinlOfinsft he.syOkdOt. 

4M008. 182a 5 Moos. 10:9. 12:12. 14:27,29. 

lKor.9:13. 

2. Ei pid9 hAnellfl perialOft r.Icman 
vdjiensA keskellsl ; sillA Herm on hA- 
nen pcrintOnsA, niinkuin HAn on 
hineJle sanonut. 

3. Ja tAmd oikoon pappien oikeus 
kiinsalla ja niillA, jolka uhraavat jo- 
ko hArjSn tahi lampaan: papille an- 
netlakoon lapa« leukaluut ja sisftl- 
lyksel; 

,4. ja uutisen jyvistAsi, vilnistAsi.dl- 
jystdsi, ja liemenet lampaistaslpitAA 
sinun antaman hAnelle. 

5. Silln Herm, sinun Jumnlasi, on 
h3net valinnut kaikista sukukunnis- 
tasi, eltS hAn ja hAnen poikansa jo- 
ka pAivA seisoisivat ja palvelisivat 
ilerran nimecn. 

6. Kun LevilAinen lulce josiakusta 
poriislasi, koko Israeli^ta, jossa hAn 
vieraana on, ja hAn tulce koko sie- 
lunsa halusta siihen paikkaan, jon- 
ka Hcrra on valinnut, 

7. niin palvelkoon hAn Herran, Ju- 
nalansa, nimeen, niinkuin kaikki 
muutkin LevilAiset, hAnen veljcnsA, 
Jotka siellA seisovat Herran edessA. 

S. Ja heidAn kaikkien pitAA saman 
vernin osaa saamHn syOdAkscnsA, 
sHtflhuolimatla, milA hAnellA on van- 
liempainsa my^yslA omaisuudesta. 

9. Kun lulet siihen maahan, jonka 
Hemi, sinun Jumalasi , sinulle an laa, 
niin AlA opi lekemAAn sen kansan 
kaubistusten jAlkeen. 3 Moon. 18:26. 

5Moos. 12298. 1 Kun. 1424. 2 Kun. 16.3. 

10. AlkOAn yhlAliAAn sinun seassasi 
lAytykO. joka poikansa tahi tytthren- 
slUytiAA tulen Iftpitse, tahi jokii on 



ennuslaja.pAivAn valitsija.tielfiJA ia» 
hi velho, 3M008.1821. 19:31. 20.-6,27. 

1 Siim. 28:7 s. 

11. tuhi lumooja, tahi noila, tahi 
roerkkien tulkitsija, tahi joka jota- 
kin kuolleilla kysvy. Je8.8:i9. 

12. SillA joka senkallaisia tekee, on 
Hcrralle kauhistus, ja senkaltaislcn 
kauhisluslen tAhden ajaa Herra, si- 
nun Jumalasi. heidAt uJos sinun e- 
deslAsi. 

13. Sinun pitAA oleman vilpitOn 
Herran, sinun Jumalasi, edessis. 

14. SillA nAmA kansal, joiden maan 
sinA omistut, kuuleval pAivAn valit- 
sijoila ja ennustajia; mutia ei ole 
Herra , sJnun Jumalasi, scllaista si- 
nulle sallinut. 

15. Profetun sinun keskeltAsi, vel- 
jistAsi. minun kaltaiseni, herAltAA 
sinullc Herra, sinun Jumalasi, hAn- 
lA kuulkaat. Joh.i:45. 6u'».46. 6:14. 

Ap.t322. 737. 

16. On oleva kaiken sen jAlkeen, 
kuin sinA anoil Herralta, sinun Ju- 
nialaltasi, Horebissa kokoukscn pAi- 
vAnA. sanocn: „en mihA voi enAA 
kuulla Herran, minun Jumalani, 
AAntA, enkA nAhda sitA suuria tulta, 
Cttcn kuolisi.'* 2iMoos.20:19. 5Moo8.523s. 

17. Ja Herra sanoi minulle: „hc 
oval oikein puhuneel; 

18. MinA herAtAn heille Profelan 
heidAn veljislAnsA, sinun kallaisesi, 
ja niina panen minun sanani hAnen 
suuhunsa; hAn puhuu heille kaikki, 
niitA minA hAnelle kAsken. 

19. Ja jos joku ei kuulc minun sa- 
nojani, joila hAn minun nimceni 
puhuu, niin minA sen hAnellA voa- 
din. 

20. Mulla jos joku profettarohkenec 
puhua minun nlmessAni sitA, jola 
minA en kaskenyt hAnen puhua, ja 
jos hAn puhuu muiden jumalicn 
nimeen, niin sen profelan pilAA kuo- 
Icmon. 5 Moos. 13:5. Jer. 14:13. 

21. Jos sanol sydAmmessAsi : ,kuin- 
ka me liedAmme, mitA sanoja ei 
Herra ole puhunui?* 

22. Kun proft'lla puhuu Herran ni- 
meen, cikA siilA milnAn lule, eikA 
niin tapahdu, niin ne ovat sanoja, 
joila ei Herra ole puhunut; se pro- 
fella on sen puhunut ylpeydesIA; AIA 
pelkAA hAntA.** Jer. 28:9. 

19 Luku. 

Laki vapaaknupungeista, rnjan siir^nii- 
sostH ja UMlistajistn. 

Kun Herra, sinun Jumnlasi, on hA- 
vittAnyt pakunal, joiden niaan 
•Herra, sinun Jumalasi, sinullc an- 



199 



5 MOOS. 19. 20. 



} 



iatk, Ja sina olet heidSt njanut ulos 

*a asettunut heidfin kaupunkeihinsa 

a huoneisinsa, 2Moo8. 21038. 

4Moo8.36:108. 5Mo08.4:4l8. 1229. Jo8.20:2>. 

2. niin eroita itsellesi kolme kau- 
punkia siind maassa, jonka H^rra, 
sinun Jumalasi, antaa sinulle omis- 
tettavaksi. 

3. Ja valihista tiet niihin, ja jaakol- 
meen osaan maasi fiflret, jonka Her- 
ra, sinun Jumalasi, sinulle antaa pe- 
riniifiksi, ettft vol' sinne paeta, joka 
miehentappajaksi tullut on. 

4. Ja nAin on miehentappajan lai- 
ta, joka saa sinne paeta ja eldH : jo- 
ka tappaa]Shimmftisensfitiet5ni5ttft, 
eika ennen vihannut hfintfi, 

5. vaan niinkuin joku menisi met- 
sMn IfihlmmSisensfi kanssa puita 
hakkaamaan, ja noslaisi kfisln kir- 
veensft hakkaamaan puuta maahan, 
ja kirves piitoaisi varrestajasattuisi 
mliimmfiiseensS, niin ettll tftmSi siitA 
kuolisi; sellainen paetkoon yhteen 
nSistd kaupungeista ja saakoon elSS, 

6. ettei verenkostaja ajaisi takaa 

miehentappi^ota * koska hdnen sy- 
ddmmens&on katkera, ja saavuttaisi 
hiinet, kun matka on pitkfi, ja 15isi 
hfinet kuoliaaksi, vaikka ei hftn kuo- 
leman syytft ole tehnyt, sillft ei hah 
ennen vihannut hSntS. 

7. Sentahden kSsken mfnft sinua, 
sanoen : „eroita itsellesi kolme kau- 
punkia." 

S. vJa jos Herra ,. sinun Jumalasi, 
maasi rajat levfttdft, niinkuin hdn 
vannof isiUesi, ja antaa sinulle koko 
sen maan, jonka hftn lupasi isillesi 
antaa, 5 Moos. 12:20. 

9. jos muutoin pidSt kaikki nfimH 
kSskyt, ja leet sen jaikeen kuin mi- 
nd sinulle tfinfipSna kfisken, cttK ra- 
kastat Herraa, sinun Jumalatasi, ja 
vaellat hfinen teissfinsA koko elinai- 
kasi, niin lisS9 vielA kolme kaupun- 
kia nnihin kolmeen, Jos. 20:7. 

10. ettei viatonta vertavuodatettaisi 
sinun maassasi, jonka Herra, sinun 
Jumalasi, sinulle antaa periniiOksi, 
ja veren vika tulisi sinun padllesi. 

11. Mutta jos jpkuvihnaiahimmais- 
tansA ja vaiJ3ry hilntS ja karkaa hft- 
nen paailensH' ja tappaa h5net, ja se 
pakenee yhteen niistd kaupungeista, 

4 Moos. 35:208. 

12. niin vanhimmat hHnen kaupun- 
gistansa IdhettSkddt sinne sanan, ja 
tuokoot hflnet sielta, ja antakoot hd- 
net verenkostajan k^siin, ettS hdn 
kuolisi. 1 Moos. 9:6. 2 Moos. 21:12, 14. 

13. AlkCdn silmusi sflfilikO hiintd, 
ja Ota pois viattoman veren syy Is- 
raelista, ettA menestyisit. | 



14.Aia siirrfiiahimmftisesiri^aa,joi\- 
ka edeltSjAt panneet ovat sinun pe- 
rint6<toi , jonka perit siinfi maassa, 
jonka Herra. sinun Jumalasi, sinulle 
antaa omistettavaksi. 5Mooe.27:i7. 

,^ ,.. , San. 22:2a 23:10. 

16. AlkdAn yksi todist^ja ylcsinflnsll 
astuko ketaSn vastaan jostakusta pa- 
hasta teosta ja synnistfl, mika ikfina 
pahatekoseolisi,jokatehdaan; mut- 
ta kahden tahi kolmen todistf^an 
suun kautta on joka asia vah\is- 
tettava. 4Mooe.35ax 5Moo8.i7«8. 

Mattl8:l«. Joh.8:17. 2Kor.l8:l. Hebr.l0:28. 

16. Jos vairft todistida nousee jota- 
kuta vastaan ja todlstaa synnistft 
hanta vastaan, 

17. niin molemmat miehet, jotka 
riitelevat, seisokoot Herrah eaessS, 
pappien ia tuomarein edessa, jotka 
siihen aikaan ovat, 5 Moos. 17:9. 

18. ja tuomarit visusti tutkisielkoot 
sita; ja katso, jos todistaja on vafirfi 
todistaja, ja todistaa vaarin v6]jean- 
sa vastaan, 

19. niin tehkddt hanelle, niinkuin 
han n koi tehda veljellensd; ja eroi- 
ta pahu pois luotasi, San. 19:5. 

20. etta muut sen kuulisivat ja pel- 
kaisivat, eivatka tekisi enaa senkal- 
taista pahaa teidan seassanne. 

21. AlkMn sUmasi saaiikA hanta : 
henki hengesta,silmasilmasta, ham- 
mas hampaasta, kdsi kadesta, jalka 

jalasta. 2M008. 21:23. SMoos. 24:20. 

Bfatt 5:38. 
20 Luku. 

Sotalakeja. 

Kun menet sotaan vihollisiasi vas- 
taan, ja iiaet hevoset ja vaunut, 
ja kansan, joka on suurempi sinua, 
niin m pelkaa heita; silia Herra, 
isinun 'Jumalasi, joka sinut johdalti 
ulosEgyptin maasta, on sinun kans- 
sasi. Jos. 8:1. 

2. Ja kun lahdette taisteluun, niin 
astukoon pappl edes ja puhukoon 
kansalle, 

3. ja sanokoon heille: „kuule, Is- 
rael ! te menette tanapana sotaan tei- 
dan vihollisianne vastaan; aikO()n 
sydammenne pehmetkd, aikaat pel- 

jdtko, aikaat vaviska, aikaat ham- 

mastykA hciddn edessAnsa, 

4. silia Herra, teidan Jumalaqne, 
kay teidan kanssanne, sotimaan tei- 
dan edestannc vihollisianne vas- 
taan, ja autlaa teita.** 

5. Ja paamiehet puhutelkoot kan- 
saa, ja sanokoot: ,Joka uuden huo- 
neen on rakentanut, eika siina vielfi 
ruvennut asumaan, han menlcAftn 
pois ja palatkoon kotiansa, ettei hMm 



200 



5 MOOS. 20 21. 



huolisi sodassa, ja joku toincn omis- 
laisi sen. N€h. 1227. P8.30:l. iWakk 3:JC. 

6. Ja jos joku on isluttanut viini- 
m5en, eikS siitil viclA mitaan hcdcl- 
maia olc saanut, hfln tncnk&dn pois 
japalatkoon kotiansa, ellci hSnkuo- 
lisi sodassa, ia toinen korjaisi en- 
simmaiset heaelmdt; SMoos. 19:23s. 

5 Moos. 28:30 

7. ja jos joku onvaimon kihlannut, 
eika vieia ole ottanut h5ntd (ykOn- 
sd, h9n menk55n pois ja palalkoon 
kotiansa, eltei hSn kuolisi sodsiissa, 
ja toinen naisi h5net ** 6 Moos. 24a. 

8. Ja pSamiehcl vicIA puhukoot kan- 
salle ja sanokoot* ,,joka on pelkuri 
ja arkasydHmminen . hfln nienk^On 
pois ja palatkoon kotiansa, citcl liAn 
saallaisi veljiensd syd5miniil pclku- 
riksi) niinkuin hfinen sydflmniensfi 
on." Tuoin-T-S. 

9. Ja silfekuin p5ftniiehet ovat lo- 
pettaneet puheensa kansa11c,niinhe 
asettakoot solajoukon ylimmitiset en- 
simmfiiseksi kansan elecn. 

10. Kun menet jonkiin kaupungin 
eleen, sotimaan sitfi vastaan, niin 
taritse heille rauhan 

11 Ja jos se sinua rauhallisesti vas- 
taajaavaasinu]le,niinolkoonkaikki 
kansa, joka siind on, sinullc veroU 
linen ju palvelkoon sinua. 

12. Mutta jos ei se tee rauhaa sinun 
kanssasi, vaan sotii sinua vastaan, 
niin piiritS se. 

13. Ja kun Herra, sinun Jumalasi, 
antaa heidnt sinun kdsiisi, niin \\6 
kuoliaa)(si kaikki miehcnpooli mic- 
kan ternilfl. 

14. Mutta vaimot, lapset ja elflimet, 
ja kaikki mitA kauiHingtesa oh , ja 
kaikki saalis ota itsellesi, ja syd vi- 
hollislesi saalista,jonka Herra,sinDn 
Jumalasi, antaa sinuUe. Jos. 82. 

15. Ja lee niin jokaiselle kaupun- 
gUle, joka sinusta on aivan kaukana, 
eiliaoIen3iden kansainkaupunkeja 

16. Mutta nHiden kansain kaupun- 
geista, jotka Herni, sinun Jumalasi, 
sinullc perimiseksi antaa. Alii jata 
eiamSSn yhtfikadn henkeS; 

17. vaan hukuta nc perSti : nimit- 
tain Hctilaiset, Amorilaiset, Kana- 
nealaisel, Feresildisct, Hcvilfiiset ja 
Jebusilaiset, niinkuin l-fcrra, sinun 
Jumalasi, sinulle on kilskcnyt; 

2M00S. 23:32. 34:12. 5Moos.|7.-2. 
Joe. 10:14, 11:11s. 23:12. 

18. etteivni he opcttaisf teitn tcke- 
maan kaikkia niitd kauhistuksia, joi- 
la he lekiv§t jumalillcnsa, ja ettctle 
lekisi synliil Herraa, teidftn Juma- 
laanne vastaan. 

19. Jot sinft olet kauan piiriltdnyt 



jonkun kaupungin, jota vastaan si- 
nA sodit valloittxiaksesi sltfi, niin aiti 
hdvitii sen puitu.diaklikirveeliarais* 
kaa niiia; sillA sinfl saat nitst2isy5- 
dfi,scntAhden iil3 hakkaa niitfl maa- 
linn , silia metsUn puut eiv5t ole ih- 
niisi5, joita sinun tulce piirittfiSk. 
20. Vaan ne puut, joista tiedi&t,etlei 
ne ole sydtHviii, hftvitil ja hukkaa 
maahan, ja rakenna vurustus kau- 
punkia vastaan, jonka kanssa sinQ 
sodit, siksikuin se kukisluu. Jer'6:<>. 

21 Luku. 

Salamurhasta. Sodassa vangitun valmon 

naimisista. Esikoisen perintJk)sastA. Hir- 

tetyn maahan paneniisesta. 

Jos siinA maassa, jonka Hcrra, si- 
nun Jumalasi, sinun omaksesi an- 
taa, l&ydetflSn murhaltu makaava- 
ita kedolla, eika tiedetii, kuka hi&net 
tappoi, 

2. niin kHjrkdOt ulos vanhimpasi ja 
tuomarisi, ja mitalkoot matka sen 
tapetun luota kuupunkeihin, jotka 
tapetun ympSrillil ovat. 

3 Joka kaupunki tnpettua lAhin 
on, sen vanhimmut otlakoot karjasta 
nuorcn IchmSn, jolla ei ole tydlii 
tchty, ja joka ci ole ikeen alia oilut, 

4. ja kaupungin vanhimmat talut- 
lakoot sen nuorcn lehmiln laaksoon, 
jossa juoksevaa vettd on, ja jonlp 

{>ohjaa £i kynneti eika kylvetti, ja 
eikatkoot lehniSn kaulan siinA ojan 
varrella 

5. Ju papit. Levin pojat, kSykddt 
edes, sillii Hcrra, sinun Jumalasi, 
on heidAt vaiinnut pal velemaan hfin- 
tn, ja siunaamaan Herran nimcen; 
ja heidSnsanansajaikeen pi t5d kaik- 
ki rlidat ja kaikki hengen vahingot 
paatettdmAn. SMoos. 10:8| 17:8s. 

6. Ja kaikki vanhimmat siitii kau- 
pungistn, joka tapettua iniiinnA on, 

)cskddt kntensti nuoren lehmdn pddl- 
fi , jonka kaula ojon varrella lei- 
kattiin, 

7. ja he vastatkoot,ja sanokoot: ,M 
metdSn kHtcmme liXiik verta vuodal- 
tancet,cik{i silmdmme sit A n5hneet; 

8. Ole armollinen kansullesi Israe- 
lille, jonka sina, Herra, pelustit, ja 
filn lAtn viatonta verta annn lulla si- 
nun kansasi Israclin paillle;" ja niin 
he. ovat sovitetut siita verestA. 

0. Ja niin sina croit;ft lykoAsi viat- 
toman vcren syyn, kun teet sen, mi- 
kn oikia on Herran silmissA. 

10 Kun mcnet sotaan vihollisiasi 
vastaan, ja Herra, sinun Jumalasi, 
antaa heidUl sinun kilsiisi, ja sinQ 
vict licila vankina pois, 



[Ffnaish] 7* 



201 



5 MOOS. 21. 22. 



If. )a nflet vankien seassa kauniin 
naisen, ja miellyt hfinecn Ja tahdol 
ottaa hdnet vaimoksesi, 

12. niin vie IiAn huoncesesi, ja an- 
na hfinen kerilfl hiukscnsa jaleika- 
la kyntensS, 

13. jA riisua vaalteensa, joissa hAn 
vangittiin, ja anna hftncn istua si- 
nun huoneessasi « ja itkefi kuukau- 
den isfiflnsd ja ditidnsfi; mene sitten 
hflncn tykOnsfi ja ole hSnen miehen- 
sH, ja h3n olkoon sinun vaimosi. 

14. Ja jos lapahtuu.etteihililsinulle 
kelpaa, niin anna hSncn mennft ku- 
hunka hfln tahloo; mutta lUfi suin- 
kaan myO hSntd rahaun, filfl myOs- 
kA5n pidft hSntfi oijanasi, silld sinft 
alensit hiincn. 

15. Jos jollakin michellft on kaksi 
vaimoa, yksi. jota hfin rakastaa, ja 
toincn, jota hfin vihaa, ja ne synnyt- 
tavat hanellc lapsia, sekK se, jota 
hHn rakastaa, elta se, jota hftn vi- 
haa, routta csikoinen on sen, jota 
hftn vitiaa; 

16. ja aika tulee, ettfl hfin lastensa 
vfililm jakaa tavaransa perinnOksi, 
niin ei hdn saa telidfi sen rakkaam- 
man poikaa esikoiseksensa s^n vi- 
hattavan esikoisen eteen; 

17. vaan hAnen pitfifi tunnustaman 
sen vihattavan pojan esikoiseksensa, 
niin cttfi tiAn antaa hfinelle kaksin- 
kertaisesti kaikisia niislfi, mitfi bfi- 
nelia IdydctfiAn ; sillfi se on hfinen 
ensimmAinen voimansa, ja hfinelle 
tulee esikoisen oikeus. i Moos. 4^:8. 

lAik.5:l. 

18. Jos jollakin on pahatapainen ia 
kovakorvaiiien poikat joka ei kuule 
isAnsfi ja fiitinsfi AAntfi, eikfi tottele 
heitfi, kun he hfintfi kurittavat, 

19. nijn ottakoot hAnen isAnsfi ja 
fiitinsfi hfinet kiinni, ja viekOOt kau- 
punkinsa vanhimpien luo, portin 
etccn 

20. ja sanokoot kaupunkinsa van- 
himmille: „tAmfimcidAnpoikamnie 
on pahatapainen ja kovakorvainen, 
eikfi tottele meidfin fiflntfimme, jaon 
syAmfiri ja juomari:** 

21. ja kaikki kaupungin kansa ki- 
vittAkOAn hfinet' kuoliaaksi ; ja niin 
tjnfi eroitat pahan tykOfisi, ettfi ko* 
ho Israel sen kuulisi ja pelkfiisi. 

V2. Jos joku on tehny t jonkun syn- 
nin , joka kuoleman on ansainnul, 
ja hfin kuoleletaan ja ripustetaan 
puuhun, 

23. niin ei saa hfinen ruumistansa 
yOtfi pilAfi puussa, vaan haudatkaat 
hfin kohla sinA pAivfinfi ; sillfi se, io- 
ka puussa riippuu, on Jumalan ki- 
rous, eltet saastuttaisi sinun maata- 



si, ionka Herra, sinun Jumalasi, si- 
nulie perimiseksi antaa. Oal. 3a3. 

22 Luku. 

S&ftliTftiiiyyde8t& eliiiini& kolitaan. 
Huoruuden rangaistulcsesta y. m. 

Jos nfiet veljesi hfirjAn tahi 1am- 
paaneksynecn,niin filfi kfifinnfiit- 
seasi pois, vaan vie ne jAUeen vel- 
jellesi. 2 Moos. 23:4. 

2. Jollei veljesi ole sinua lAsnA etkfi 
sinfi hfintfi tunne, niin ota se sinun 
huoneesesi, ia olkoon se luonasi 
siksi kuin veljesi etsil sitfi, ja niin 
anna se hfinelle jfilleensfi. 

3. Niin tee myOs hfinen aasinsa suh- 
teen, hfinen vaatteensa ja kaikkinai- 
sen kadonneen suhtcen, joka veUcl- 
tfisi kadonnul on, ja sinfi sen lOysil ; 
filfi vetfiydy siitfi pois. 

4. Jos nfiet veljesi aasin tahi hfir- 
jfin langennecna ticllfi, niin AlA kAAn- 
nfi itsesi pois hcLstfi; vaan aula ne 
joudukkaasti ylOs hfinen kanssansa. 

Matt. 12:11. Luuk.l3:l&. UiS, 

5. Nainen ei saa michen asetta kan- 
taa, eikfi mies saa pukea yllensfi vai- 
mon vaatteita: sillfi joka sen tekee, 
on Herralle, sinun Jumalallesi, kau- 
histus. 

6. Jos lOydfit linnun pesfin tiellfi 
puusta tahi muasta, ja .siinfi on po- 
jat tahi munat, ja emA istuu polkain- 
sa tahi munain pfifiUfi, niin filfi ota 
emfifi poikinensa; 

7. vaan pfifistfi emfi pais, ja ota po- 
jat itsellesi; ettfi menestyisitjakauan 
elfiisit 

8. Kun rakennat uutta huonetta, 
niin tee kfisipuut ympfiri kattosi pfifil- 
le, ettfet veren vikaa saattais4 tiuo- 
neesesi, jos joku sieltfi putoaisi. 

9. Alfi kylvfi vilnimfikeesi moninai- 
sia sicnienifi,ettet saastuttaisi sieme- 
ncsi kokousta, jonka kylvfinyt olet, 
sekfi viinimfien tuloa. 3Moo8.i9:i». 

10. Alfi kynnfi hfirjfiUfi ja aasiUa yh- 
dessfi. 

11. Alfi pue sitfi vaatetta vllesi^ joka 
villaisesta ja liinaisesta yndessfi ku- 
dottu on. 

12. Tee itsellesi tupsutvaatteesi nel- 
jfifin kulmaan, jolhi olet puetettu. 

4M00«.16d8. Matt. 23:5. 

13. Jos joku mies on nainutvaimon, 
Ja on mennyt hfinen tykOnsfi, ja ru- 
peaa vihaamaan hfintfi, 

14. jasoimaa hfintfi johonkuhunhfi- 
pififin vikapfiAksi, ja saattaa hAnestfi 
pahan sanoman,sanocn: „niinA otin 
tfimfin vaimokscni, ja nienin hfinen 
tykOnsfi, enkfi lOytfinyt hfintfi neit- 
seeksi ;** 



202 



5 MOOS. 22. 23. 



15. niin vaimon isfl ja fiiti ottakoot 
hdnel, ja tuokoot vaimon neitsyyden 
merkit edes, ja nfiyttfikOdt vanhim- 
mille kaupungin portissa. 

16. Ja vaimon isft sanokoon van- 
himmille: ,,min5 annoin ttllle mie- 
helle minun tyttflreni vaimoksi , ja 
nyl hftn vihaa hfintft; 

17. ja katso. h9n soimaa hftntft hS- 
piflllisiin asioihin vikapSAksi, ja sa- 
noo: ,en minS lOylftnyl sinun lylflr- 
tSsi neilseek^i.* Ja katso, t3md on 
minun tytOreni neitsyyden merkki." 
Ja levitfHkCat vaatteen kaupungin 
vanliimpien etcen. 

IS. Niin kaupungin vanhimmat ot- 
lakoot sen mielien , ja rangaiskoot 
Iianta, 

19. jn sakoittakoot h&nt0 sataan ho- 
pia-sikliin, ja antakoot ne sen nuo- 
ren vaimon isHllc, ettS hi&n h!Vpfiisi 
neitseen Israelissa; ja hAn pitAlcdGn 
iiSnl5 vaimonansa, eik5 saa h5ntA 
hyijSta kaiklcena clinaikanansa. 

20. Mutta jos se tosi on, ettei vaimo 
iSydelly ncitsecksi, 

21. niin vietiikdCn vaiiiidisfinsft liuo- 
neen oven eteen, ja kaupungin kan- 
sa kivittdk56n hanct kuoliaaksi^ettft 
hSn teki ilkcydcn Israelissa, kun hfin 
salavuoteudcssa makusi isflnsfl huo- 
necssa; ja niin sin5 palian pois ty- 
k69si eroifat. 

22. Jos joku iCydetAfin maanneen 
vaimon tykOna, jolla aviomies on, 
niinpitaa niolcmpain kuoleman,se- 
kS mies, etta vaimo, jonka tyliOnS 
hSn makasi ;^ja niin pahuus otetaan 
pois Israelista. 3 Moos. 20:10. 

23. Jos neitsyt on michelle kihlattu, 
ja toinen tapaa hflnet kaupungissa, 
ja makaa hSnen, 

24. niin pitdft ne molemmat vietfi- 
in9n kaupungin porttiin, ia molem- 
mat kivitettSmfin kuoliaaksi , tyltd, 
koska h9n ei huutanut, sillft hfin oli 
kaupungissa, mies, koska hfin Ifihim- 
m3isensfi vaimon hfipfiisi; ja niin 
sina eroitat pahan tykCfisi. 

25. Jos joku tapaa kihlatun tytOn 
kedoUa, ryGvSfl ja. makaa hfinen, 
niin mies pitfifi yksin tapettaman, 
joka makasi hfinen ; 

26. mutta tytOllc ei sinun pidfi mi- 
l9Sn tekemfin; sillfi ei tyttO yhtfifin 
kaoleman syntifi tehnyt, vaan niin- 
kuin joku karkaisi Ifihimmfiistfinsfi 
vastaan ja lOisi hfinet kuoliaaksi, 
niin on myOs tfimft asia. 

27. Sillfi hfin tapasl hfinet kedolla ; 
kihiattu tyttG huusi, vaan el pllut 
hSnellfi auttajata. 

28. Jos loku kobtaa neitseen , joka 
ei ole kihlattUy Ja ottaa hfinen kiin- 



ni ja makaa hfinen, ja he niin la* 
vataan, 

29. niin se, joka hfinen makasi, an- 
takoon tvtOn isfiUe vilsikymmentfi 
hopiasikfifi, ja ottakoon sen tylOn 
vaimokseen, koska hfin on alenta- 
nut hfinen; ei hfin saa hyljfllfi hfintfi 
kaikkena elinaikanansa. 2 Moos. 22:16. 

30. Ei yksikfifin saa ottaa isfinsSvai- 
moa, eikfi paljastaa isfinsfi vuodelta. 

.8 Moos. 18:8. 20:11. 6 Moos. 27:20. 

23 Luku. 

Piihtaacita el&mSstft Herran seumkunnossa. 

Porttojen palkka. Koron otlamlseo 

kielto, 7. m. 

Raajarikko ja kuohittu filkOOt tul- 
ko Hferran seurakuntaan. 

2. Ei saa mydskfifin fipfirfi tulla Her- 
ran seurakuntaan ; ei kymmcnenleen 
polveenkaan asti pidfi jonkun heis- 
tfi Herran seurakuntaan tuleman. 

3. Ammonilaiset ja Moabilaiset ei- 
vfit saa tulla Herran seurakuntaan, 
ei kymmenenteenkfifin polveen asti, 
eipfi ikfinfifin tulla Herran seurakun- 
taan, Neh. 13:1. 

4. senffihden etteivfithekohdanneet 
teitfi tiellfi leivfillfi ja vedellfi, kun 
te Ifiksilte Egyptislfi, ja ettfi he palk- 
kasivat sinua vastaan Bileamin, B^o- 
rin pojan, Mesopotamian Pctorlsta, 
kiroomaan sinua.4 Moos. 22:58. Jos. 24:9. 

5. Mutta Herra, sinun Jumalasi, ei 
kuullut Bileamia, vaan Herra, sinun 
Jumalasi, muutti sinulle kirouksed 
siunaukseksi ; sillfi Herra, sinun Ju- 
malasi, rakasti sinua. 4 Moos. 22.*9^r. 

6. Alfi koskaan elinaikanasi pyydfi 
heille rauhaa tahi jotakin hyvfifi. 

7. Edomilaista filfi kauhistu; slllH 
hfin on sinun veljesi. Alft myOs E- 
gyptilfiistfi kauhistu ; sillfi sinft olit 
muukalainen hfinen maassansa. 

1Moos.25'.2S. 

8. Ne lapset, jotka heistfi syntvvfit 
kolmannessa polvessa, tulkoot tier- 
ran seurakuntaan. 

9. Kun Ifihdet leiristfisi vihollisiasi 
vastaan, kavahda itsefisi kaikkinai- 
sesta pahasta. 

10. Jos joku on teidfin .seassanne, 
joka ei ole puhdas> koska hfinelle 
ydllfi jotakin tapahtunuton; hfinen 
pitfifi menemfin ulos leiristfi, eikfi 
saa tulla leiriin, SMdos. 16U6. 

11. ja hfinen pitfifl ehtoona itsensfi 
vedellfi pescmfin, ja sittekuin aurin- 
ko laskenut on, palatkoon leiriin. 

12. Ulkona leiristfi olkoon sinulla 
paikka. johonka menet tarpeillesi. 

13. Olkoon sinulla pieni kalikka 
vyOUfisi, ja kun menet ulos tarpeil- 



203 



5 MOOS. 23. 24. 



lesi, kaiva sillfi, ja istuttuasi peit5 
saaslaisuutcsi. 

14. Sillft Herra, sinun Jumalasi, 
vaeltaa leirisi Idpitse pelastamaan 
sinua, ja antamaan vihoUisesi sinun 
etccsi, sentahden pilfiS sinun ieirisi 
pyliS oleman, ettei hAn mitftSn h5- 
peflUistS nakisi sinussa, ja kli&ntyi- 
si pois sinusla. 

15. Alii isfinnSn haltuun anna sitH 
orjaa, joka hftneltd sinun tyk5si ka- 
rannut on. 

16. H^n olkoon luonasl, sinun kes* 
Iteilflsi siinS paikassa, joka hUnelle 
keipaa, jossakussa sinun poflissasi, 
niinkuin hdn hyvtiksi nak^e; &\Si 
sorra hftntn. 

17. Ei pida yhtfilcfifin portion ole- 
man Israelin lasten tytdrten seassa, 
eikfl yhtflfin huorintckijdt& Israciin 
poikain s^assa. 

18. Aia kanna porton palkkaa cik5 
koiran hintaa Herran, sinun Juma- 
lasi, liuoneeseen jostakusla lupauk- 
sesta; siilft ne molemmat ovat Her- 
rallc, sinun Jumalallesi, kauhislus. 

19. AlA korkoa ota veljellSsi rahas- 
ta, ruoka-aineisla tahi niuusta, josta 
korko otetaan. 2 Moos. 22:25. 
8Moo8.25:368. Neb. 6:7. Ps.l5:5. Luuk.6:35. 

20. Muukalaiselta ota korko, multa 
dia veIjellSsi« etti& Herra, sinun Ju- 
malasi, siunaisi sinua kaikissa yri- 
tyksissdsi siind maassa, johonka me- 
net omistamaan silS. 

21. Jos Herralle, sinun Jumalallesi, 
lupauksen lupaat, niin fild viivytli 
maksaa sitS; sillfl Herra, sinun Ju- 
malasi. on sen totisesti vaativa si- 
nulta, ja se on sinulle synti. 

3 Moos. 27:2. 4 Moos. 30:8. Saarn.5:4. 

22. Vaan jollet sinfi lupaa, niin ei 
se tule sinulle synniksi. 

23. PidS se, mita huuliltasi on kfiy- 
nyt ulos, ja tee, niinkuin sinft Her- 
ralle, sinun Jumalallesi, vapaaehtoi- 
sesti olet luvannut, minkA suullasi 
puhunut olet. 

24. Kun menet Idhimmfiisesi viini- 
mfikeen, niin saat syddd viinimar- 
joja niin paljon kuin halultaa, ettfi 
tulet ravituksi; mutta filft pane ml- 
tAAn astiaasi. 

25. Kun menet l&himmfiisesi lai- 
boon, niin saat katkoa tShkSpfiitA 
kfidellftsi, mutta filfi sirpillA miiim- 
mfiisesl lalhoa niitfi. Mattl2:i. 

Mark. 2^23. lAiuk.6d. 

24 Lukti. 

Broklrja. SpitalL Pantti. KOybftin bol- 
iiooniineQ y. m. 

Jos joku ottaa vaimon avioksensa, 
ja tapahluu, «ttei hftn ^ilt^n Idy- 



dA armoa hfinen silmfiinsfl edessfl, 
koska han on lOytfinyt jonkun hft- 
piAn hAnessA, niin kirjoittakoon hfi- 
nelle eroklrjan, ja antakoon sen hft- 
nen kAteensA, ja laskekoon mene- 
mAAn huoneestansa pois. Matt. 5:31. 

19.7. Mark. 10:4. 

2. Jos se vaimo, slttenkuin hAn hA- 
,nen huoneestansa lAhtenyt on, me- 
nee pois ja tulec jonkun toisen mie- 
hen vaimoksi, 

3. ja taas se toinenmiesrupeaahAn- 
tA vlhaamaan, ja kirjoittaa hAnelle 
erokirjan, ja antaa hAnen kAteensA, 
ja laskee liAnen huoneestansa pois; 
tahi jos se toinen mies, joka bAnet 
vaimoksensa otti, kuolee, ~ 

4. niin hAnen ensimmAinen mie- 
hensAJoka antoi hAnen mennApois, 
ei saa hAntA jAUeen ottaa vaimok- 
seen, siUckuin hAn tuli saastaiseksi. 
SillA se on kauhistus Herran edessA; 
ja Ala saastuta sit A maata,jonkaHer* 
ra, sinun Jumalasi, antaa sinulle 
perinndksi. Jer. 3:1. 

5. Jos joku on AskettAin vaimon nai- 
nut,ei hAnen tar\'itse mennA sotaan, 
eikA pidA hAnen pAAllensA milAAn ra- 
situsta pantaman; vaan olkoon va- 
paanahuoneessansaajastajanpAivAt, 
ettA hAn saisiiloitavaimonsakanssa, 
jonka hAn nainut on. 5Moo8.20:7. 

6. Ei saa kukaan molempiamyllyn- 
kiviA. eikA pAAllis-kiveAkAAn kellAAn 
pantiksi ottaa; sillA se olisi ottaa 
nengcn pantiksi. 

7. Jos joku tavataan, joka jonkun 
veljistAnsA, Israelin lapsista, varas- 
taa, ja pitAA hAntA orjana taikka myO 
hAnet, sen varkaan pilAA kuoleman ; 
ettA eroittaisit pahan luotasi. 

2Moos.21:16. ITim. 1:10. 

8. Karta spitalilautia, etlA visusti 
teet ja pidAt kaikki, mitA LevilAisct 
ja papit opettavat sinulle; mitA mi- 
nA heille kAskin, se pitAkAAt ja sen 
jAlkeen tehkAAt. 3 Moos. 13:28. 14:3. 

9. Muista, mitA Herra, sinun Juma- 
lasi, teki Mirjamille, tiellA, kuin te 
EgyptistA lAksilte. 4 Moos. 12:10. 

10. Ja kun jotakin lalnaat lAhim- 
mAisellesi, AlA mene hAnen huonee- 
sensa panttia ottamaan, 

11. vaan seiso ulkona, ja se, jolle 
lainasit, kantakoon itse pantin si- 
nulle ulos. 

12. Vaan jos hftn on kOyhft, filft me- 
ne maata hAnen pantillansa, 

13. vaan anna pantti takaisin hA- 
nelle jAlleen ennen auringQn laske- 
maa, ettA hAn makaisi vaatteissansa 
ja siunaisi sinua; la se luetaan si- 
nulle vanhurskauaeksiHerran,sinuii 
Jumalasi, edessA. 9Moof,»;99r 



204 



5 MOOS. 24. 25. 



14. Aia lee vfifiryytta kOyhfille ja tar- 
vitsevalle pSivfimiehelle, loko hAn 
on sinun veljifisi, tahi muukalainen, 
joka on sinun maallasi, sinun por- 
teissasi; SMoos. 19:13. Mai. 3:5. 

15. vaan.maksa hSnelle palkkan^a 
sinS pdivfinft , ennen' aurfngon las- 
kemaa; silI5. hdn on kOyhfi, ja sitft 
h3Q halajaa ; ettei hSm huutaisi Her- 
ran t^^kO sinun tShtesi, jaseluettai- 
siin sinulle synniksi. 

16. Ei pida isSn kuoleman lasten 
(5hden, eikS: myOs lasten isfiinsfi tfih- 
den; mutta kunkin pitfig kuolemaii 
Oman syntinsft tfihden. 2Kun.i4:6. 

2Aik.25:4. Jer. 31:30. Hes. 18:20. 

17. AIS kafinnfi muukalaisen eikft 
orvon oikeutta; 9121 myCskAdn l^s- 
kelta Ota vaatteita pantiksi ; 
2Moos.222l8. ^:9. 5 Moos. 27:19. Je8.1:17. 

Jer. 528. Hes. 2229. Sak.7:98. 

18. vaan muista, ettfi sinSkin olit 
oija Egyptissd, ja Herra, sinun Ju- 
malasi, sieltH sinut johdatti ; sentHh- 
den minft 'sinua kfisken nditfl teke- 
mMn. 5Mo'os. lo:15r' 

19. Kun pelloltasi elon leikkaat, la 
lyhde sinulta sinne unhohtuu, MSl 
palsga sitH ottamaan, vaan ollcoon 
se muukalaisen, orvon ja lesken o- 
ma, ettA Hcrra, sinun Jumalasi, siu- 
oaisi sinua kaikissa sinun kdttesi 
i6issh, SMoos. 19:98. 23:22. 

20. Kun olet poiminut (^Ijypuusi jie- 
delmftt, niin SH^ sit^l uudelleen va- 
rista; vaan se j3§k65n muukalaisel- 
le, orvolle ja leskelle omaksi. 

21. Koska viinimfikesi korjannut o- 
let,aifi uudelleen j&AneitS hae; vaan 
ne pitail muukalaisen, orvon ja les- 
ken omat oleman. 

22. Ja muista , ettfl olet oija ollut 
Egyptin maalla; sentfthden kSsken 
minS sinua n&itfi tekemdfln. 

25 Luku. 

Oikeuden tuomioista. Veljen nimen 
herftttftmisestft. Mitoista, y. m. 

Tos riita onmiesten vftlillfi, niin tul- 
y koot oikeuden eleen, ja tuomitta- 
koon niiden vdlillS ; ja tuomittakoon 
harskas hurskaaksi,ja syyllinen syyl- 
liseksi. 

2. Ja jos syvUincn oti ansainnut 
naavoja, niink9skek00n tuomarilas- 
kea h9nen maahan,jaantakoonn&h- 
Icnsft lySda hanta, senjfilkeen kuin 
jiftnen pahatekonsa on, luvun mu- 
kaan. 

3. Neljfikymmentfi kertaa saa h9ntfi 
>y0d9,eikftenenip99,etteihdntfiylOn- 
palltisesli WGtfiisi,ja sinun veljesi tur- 
meltuisi siimftisi edessfi. 2Kor. liiU. 



4. Alfi sido kiinni riihtft lappavnu 
hSrjfin suuta. lKor.9:9. lTfin.5:lS. 

5. Kun veljekset asuvat yhdessfi, ja 
yksi heistfi kUoIee lapsitonna, niin 
ei saa sen kuoUeen veljen vaimo ot- 
taa muukalaista mlestfi toisesta su- 
vusta; vaan hfinen mieliensfi veli 
nienkG()n hSnen tyk()ns9 jaottakoon 
veljensfl sijassa hfinet avioksensa. 

Bunt 4:5 s. Matt 2224. Mark. 12:19. 

Luak. 20:28. 

6. Jaensimmfiinen polka, jonkahSn 
synnyftSfi, nimitetlak()On sen kuol- 
leen veljen nimeltfi, ettei hfinen ni- 
mensfi per9ti hfiviSisi Israelista. 

7. Jos ei se mies tahdo ottaa vel- 
jensft vaimoa, niin menkGOn. hSnen 
veljens9 vaimo porttiin vanhimpien 
eteen, la sanokoon:' „minun kytyni 
ei tahdo herfittfifi veljellensA nimetl 
Israelissa, eikft tahdo minua kyty- 
lain mukaan naida.'* Runt. 4:4 ss. 

8. Niin kaupungin vanhimmat kut- 
suttakoot hfinet edes , ja puhukoot 
hfinen kanssansa. Ja jos nfin siinfi 
pysyy ja sanoo: ,^n minfi tahdo ot- 
taa hfintfi," 

9. niin hdnen natonsa astukoon hfi- 
nen tykGnsfi vanhimpien nfihden, ja 
riisuKoon kengfin hfinen jalastansa, 
ja sylkek60n hfinen kasvoihinsa, ja 
vastatkoon hfintfi, sanoen : „nfiin jo- 
kaiselle pitfifi tehtfimfin, kuin ei vel* 
jensfi huonetta rakenna;** 

10. ja hfinen nimensfi olkoon Israe- 
lissa: „paljasjalan huone.'* 

11. Joskaksimiestfikeskenfinsfitap- 
pelevat, ja toisen vaimo tulee pelas- 
tamaan miestfinsfi sen kfidestfi, joka 
hfintfi ly(), ja ojentaa kfitensfi ja tart- 
tuu hfinen hfipyvnsfi, 

12. niin hakkaa hfinen kfitensfi-poik- 
ki; filkOOn silmfisi sfiSlikO hfintfi. 

13. Alfi pidfi kahtalaista vaakaa sft- 
kissfisi, suurempaa ja pienentrpSfi; 

3 M008. 19:358. San. 2023. He& 45:ia 

14. filfi mydskfifin pidfi huoneessasi 
kahtalaista efa-mittaa, suurempaa 
ja pienen^pfifi. 

15. Mutta sinulla pitfifi oleman tfiy- 
si ja oikja vaaka , ja tfiysi ja oikia 
mitta, ettfi olisit pitkfiikfiinen siinfi 
maassa, jonka Herra, sinun Juma- 
lasi, sinulle antaa. 

16. Sillfi iokainen, joka nfiitfi tekee, 
on Herralle, sinun Jumalallesi, kau- 
histus, kaikki, jotka vfifiryyttfi tekc- 
vfit. San. 11:1. 

17. Muista mitfi Amalekilaiset teki- 
vfit sinua vastaan tiellfi, kun Egyp- 
tistfi Ifiksit, 

18. kuinka he kohtasivat sinua tiel- 
lfi, ja lOivfit sinun jfilkijoukkosi, 
kaikki ne, jotka heikommat olivat 



205 



5T400S. 25. 2G. 



ja j51innA kdvivflt, koska vfisyksiss^ 
ja mfifintyncenfi olit; ja heeivflt Ju- 
malata peljfinneet. 2 Moos. 17:8. 

19. Sentfihden kun<Herra,sinun Ju- 
malasi, anlaa sinun saada levon kai- 
kilta vihamiehiltdsK jotka ympfiril- 
15si ovat siinfi maassa, jonka Herra, 
sinun Jumalasi, antaa perinnOksi 
sinulle, omistetlavaksesi, niin sinun 
pitdfi perdii hSvittdmSn Amalekilais- 
ten muiston taivaan alta. Al&sitfiun- 
hota. 18am. 15:2 b. lAik.4:43. 

26 Luku. 

Ensimmfiiset hedelro&t. Eymmenesten 
vuosl. 

Kun tulet siihen maahan, ionka 
Herra, sinun Jumalasi, sinuHe 
perinndksi antaa, ja sinil seir omis- 
tat ja asut siinS, 

2. niin otakaikkinaisten sinun maa- 
si kasvujen ensimmaisifl hedelmiS, 
joita koKoat maasta, jonka Herra, 
sinun Jumalasi, sinulle antaa, ja pa- 
ne koriin, ja mene siihen paikkaan, 
jonka Herra, sinun Jumalasi, valit- 
see hflnen nimensfi asumasijaksi, 

2 Moos. 23:10. 34:26. SMoos. 23:108. 
4 Moos. 15. :18 b. 5 Moos. 16:10. 

3. ja mene papin tvkO, joka siihen 
aikaan on, ja sano hdAelle: „min2i 
tunnustan tSni^pAnfi Herran, sinun 
Jumalasi. edessS, eiifi mind olen tul' 
lut siihen maahan, jonka Herra, mei- 
ddn isillemme vannoimeilleantaak- 
sensa.** 

4. Ja pappi ottakoon korin kSdes- 
t§si, ja laskekoon sen maahan, Her- 
ran; sinun Jumalasi, alttarin eteen. 

5. Niin lausu sinfl, ja sano Herran, 
sinun Jumalasi, edessd: „minun is&- 
ni oil kuljeksiva Syyrlalainen, ja me- 
ni Egyptiin vflhmm joukolla, ja oli 
siellfi muukalaisena,ja h2in tull siel- 
13 suureksi, vfikevSksi ja mojiilukui^ 
seksi kansaksi. iMoos. 11:31. 46:58. 

2 litOOS. 1 *1 8 

6. Mutta Egyptilfiiset ahdistivat ja 
vaivasivat meitS, ja panivat kovan 
orjuuden meidfin pfilillemme. 

7. Niin me huusimme Herran, mei- 
ddn isHimme Jumalan, tykO, ja Her- 
ra kuuli meiddn Hdnemme, ja katsoi 
meidfin tuskaamme, ty6t5mme ja 
ahdistustamme. 2 Moos. 2:23 a. 

8. Ja Herra veil meiddt ulos Egyp- 
tistfi voimallisellakfidellS, ja ojenne- 
lulla kftsivarrella,^uuren peljfistyk- 
sen, merkkein ja ihmeitten kautta, 

9. ja johdatti meidflt tShSn paik- 
kaan ja antoi meille tftmfin maan, 
maan, jossa rieskaa ja hunajata vuo- 
taa. 



10. Ja nyt, katso, minS kannan tfts- 
sS maan ensimmdisiA hedelmifl. jot- 
ka sinS, Herra, minuUe annoit.** Ja 
niin pane ne. Herran, sinun Juma- 
lasi, etecn, ja kumarra Herran, si- 
nun Jumalasi, edessfi, 

11. ja ole iloincn kaikesta hyvtlstfi, 
ionka Herra, sinun Jumalasi, sinul- 
le ja sinun huoneellesi antol, sinfi 
jaXevilSinen ja muukalainen, joka 
sinun keskellSsi on. 

12. Kun olet maksanut kaikki vuo- 
dentuiosi kymmenekset kolmantena 
vuonna, joka on kymmenesten vuo- 
si, niin anna LeviIAiselle, muuka- 
lai^elle, oiS'olle ja leskclle, etta he 
s6isivfit porteissasi ja ravittaisiin ; 

3 Moos. 27:30. 5 Moos. 14:288. 

13. ja sano Herran, sinun Jumala- 
si, edess21: „minfi olen eroittanut 
huoneestani sen, mika pyhitetty on, 
jaannoinLeviliiiselle,muukalaisellc, 
orvoUe ja leske)le,kaiken sinun kfi^- 
kysijaikeen, jonka sinS minulle kfis- 
kenyt olet; en minfi harhaillut si- 
nun kftskyistSsi, enkfi niitft unhot- 
tanut. 

14. En minS silta syOnyt surusslini, 
enka ot^anut siit9 saastaisena olles- 
sanf, en myds niistH mitaSn antanut 
kuoUeille; minfi olen ollut Herrgn, 
minun Jumalani, aSnelle kuuliai- 
nen, ja tehnyt kaiken sen, minkft 
sin9 minulle k3skenyt olet. 

15. Katsahda tdnne pyhSstA asuma- 
sijastasi taivaasta, ja siunaa sinun 
kansaasi Israelia ja sita maata, jon- 
ka sina meille antanut olet, niin- 
kuin sina vannoit meidan isillem- 
me, sita maata, jossa rieskaa ja liu- 
najata vuotaa." Jes. 63:15. 

16. Tanapana H«rra, sinun Juma- 
lasi, kaskee sinua tekemaan naiden 
saant6jen ja oikeuksien mukaan, 
niin etta pidat ne ja teet niideii mu> 
kaan kaikesta sydammestasi ja kai- 
kesta sielustasi. 

17. Herralta olet sinft sen lupauk* 
sen ottanut tanapana, etta hfin on 
oleva sinun Jumalasi, jos tahdot 
vaeltaa hanen teissansa, ja pitaa hS- 
nen saantdnsa, kaskynsa ja oikeu- 
tensa, ja olla kuuliainen fianen fill- 
nellensa. 

18. Ja Herra on sinulta tfihapfinS 
lupauksen ottanut, etta sinun pitftll 
oleman hanen oma kansansa, niin- 
kuin han sinulle on puhunut, ettfi 
pidat kaikki hanen kaskynsa; 

2 Moos. 19:5. 5 Moos. 7:6. 14:2. 

19. ja han korottaa sinut kaikkein 
kansain ylitse, jotka hdn tehnyt on, 
ylistykseksi, kiitokseksi ja kunniak- 
si, etta olisit Herralle, sinun Juma- 



2oe 



p 



5 MOOS. 26. 27. 28. 



lailesi, pyhft kansa, niiiikuin hSn 
sanonul on. 5Moo8.28:l. Jer. 13:11. 33:9. 

8ef. 3*498. 

27 Luku. 

Lain mulstokivet. Gerisimin Jft Ebalin 
▼uoret. 

Ta Mooses ia vanhimmat Israelista 
«' kaskival kansaa, ja sanoivat „pl- 
takaat kaikki ne kSskyt. jotka mina 
Ifinflpann teille kflskcn. 

2. Ja sinfi |[)niv5n.1 kun te menetlc 
Jordaiyin ylitse siihcn muahan, jon- 
ka Herra, sinun Jumalasi, sinulle 
anlaa, niln pyslyW suurel kivet, ja 
sivua ne kaikilla. Jos.8:3as. 

3. Ja kun olel ylilse pflassyl, niin 
kirjoita niihin kaikki nftmii lain sa- 
naf, elia luiisil siihcn maahan, jon- 
ka Hcrra, sinun Jumalasi, sinuHc 
anlaa, siihcn maahan. jossa rieskaa 
ja liunujuta vuotaa, niinkuin Hcrra, 
sinuii tsHisi Jumala , sanoi sinulle. 

i. Kun Ic siis olctic mcnnecl Jorcla- 
nin ylitse, niin pyslylinkailt nc ki- 
vcl, joista miuA teille tannpiina kils- 
ken, Ebalin vuorelle^ ja sivutkimt 
nc kaikilla, Jos 4 3 

5. ja nikenna siinS Herrallc, sinun 
Junialallesi, altlari kivistA, Am satu- 
la miiaSn niulaa niihin. 2. Moos. 20:25. 

Jos.'8;30s. 

6. Hakenna sicllfi alttari Herrallc, 
sinun Jumulallesi , kokonaisista ki- 
visia, ja uhraa Herrallc, sinun Ju- 
malallcsi, poltlouhria sen pnAllii. 

7. thraa myOs kiilosuhria, ja sy6 
sielia, ja ole iloinen Hcrran, sinun 
Jumalasi^ cdessti. 

8. .la kirjoila kaikki tnman lain 
sanat sclkiasti kaivetluna niihin ki- 
Min " 

9 Ja Mooses ynn:! pappicn ja Le- 
viKiisten kanssa puhui kaikelle Is- 
faclin kansallc. sanoen* ,,ota vaarin 
ja kuule, Israel! Tanapana olet sinfl 
tullut Herran, sinun Jumalasi, kun- 
saksi. 

JO. Niin ole siis kuuliainen Hcrran, 
sinun Jumalasi, aanelle, ja tee ha- 
nen knskyjensa ja saanlOjensa mu- 
kaun. jotka nnna tanapana sinulle 
"J^skcn" 3MOOS2GI7 

11 Ja Mooses kdskl kansaa stna 
pSivSna, ja sanoi : 

12. NHma seisokoot Gcrlslmin vuo- 
rella, ja siunatkoot kansaa, kun te 
olclle kayncet Jordanin ylilse: Si- 
meon, I^vi, Juudu, Isaskar, Josef 
ja benjam in. 5 Moos. 1 1 :29. Jos. 8:33 s. 

13 Ja nama seisokoot Ebalin vuo- 
^la kirousla lausumassa Ituben, 
Gad, Asser, Sebulon. Dan ja Naflali 

U. Ja Leviiaiset alkukoot ja sano- 



koot jokahclle Israelissa korkiaUa 

aanciia; 

15. Kirotlu olkoon, joka tekee kai* 
vetun lahi valetun epajumalan ku* 
van, Herrallc kauhistukseksi, tai- 
leellisen miehen kasialaa, ja asettaa 
sen salaa! ja kaikki kansa vastal- 
koon ja sanokoon : amen. 

16. Kiroitu olkoon, joka isansa tahl 
aitinsa ylOnkatsoo! ja kaikki kansa 
sanokoon: amen. 2Mooft.2i:i7. 

3 Moob. 20:9. San. 20:20. Matt 15:4. 
17 Kirottu olkoon, ioka lahimmai* 
sensa rajan siirtaa ! ja kaikki kansa 
Siuiokoon: amen. 5 Moan. 19:14.. 

San. 23: 10. 

18. Kiroitu olkoon, joka laskee so- 
kiancksymaan ticliai ja kaikki kan- 
sa sanokoon: amen. 

19. Kirotlu olkoon, joka muukalal* 
sen, orvon ja lesken oikeudcn vaan- 
taa * ja kaikki kansa sanokoon amen. 

20. Kirottu olkoon, joka isansa vai- 
nion makaa, silia han nostaa isansA 
pcittocn' ja kaikki kansa sanokoon 
amen. 3Moos. 1S:S. 20.11. 5Moos. 22:30. 

Hes. 22:10. 

21 Kirottu olkoon, joka johonkuhun 

ciaimeen r>'htyy! ja kaikki kansa 

sanokoon: amen. 3 Moos. 18:23. 

22. Kirotlu olkoon, joka sisarensa 
makaa. joka on hancn isansa lahi 
aitinsa Tytar! ja kaikki kansa sano- 
koon: amen. SMoos. i$;9. 

23. Kirottu olkoon, joka anoppinsa 
mukua! ja kaikki kansa .sanokoon: 
amen. • .'(Moos. 1S:17. 

24. Kirottu olkoon, ioka lahimmai- 
sensa saluisesti niurnaa! ja kaikki 
kansasanokoon amen. 5Moos. I9:ii8. 

25. Kirottu olkoon, joka lahjoja ot- 
taa, vuodattaaksensa viatonta \ertal 
ja kaikki kansa sanokoon: amen. 

2 Moos. 23 78. 

26. Kirottu olkoon, joka ei taman 
lain sanoia tayta. cika tee niiden 
mukaan! ja kaikki kansa sanokoon. 
amen. Jer. ii:3. Don. 9:11. Gal. 3:10. 

28 Luku. 

Siunaukset ja kiroukset. 

J a jos sina olet Herran, sinun Ju- 
malasi, aanelle kuuliainen, pitaen 
ja tehden kaikki hanen kasKynsa, 
jotka mina tanapana sinulle kasken, 
niln Herra, sinun Jumalasi. tekee 
sintin korkeimmuksi kaikkia kanso- 
ja maan paaiia. 3Moos. 2G:38. 

5 Moos. 26.188. 
2. Ja kaikki nama siunaukset tule- 
vat sinun paailcsi.jasalluvat sinuun, 
jos olet Herran, sinun Jumalasi, aa- 
nelle kuuliainen: 



207 



5 MOOS. 28. 



3. Siunatlu olet sinfi kaupuhgissa, 
siunattu pellolla. 

4. Siunattu on ruumiisi hedelmS, 
ja maasi hedelmfl,- ja karjasi hedel- 
mS, ja lammaslaumasi hedelmfit. 

5. Siunattu on korisi ja taikinapur- 
tilosi. 

6. Siunattu olet sinfl kSydessSsi si- 
sfille, ja siunattu kfiydessdsi ulos. 

Ps. 121:8. 

7. Ja Herra langettaa sinun viholli- 
ses sinun edessfisi, jotka sinua vas- 
taan nousevat; ylitft tietfi he tulevat 
sinuavastaanjaseitsemfltatietfipitfift 
heid&n pakeneman sinun edessSsi. 

8. Herra kliskee siunauksen olla si- 
nun kanssasi aitassasl ja kaikissa 
mitfl yritfit, ja siunaa sinua siinA 
maassa, jonka Herra, sinun Juma- 
lasi. sinulle antaa. 

9. Herra asettaa sinut itsellensft py- 
hSksi kansaksi « niinkuin hfin van- 
noi sinulle, jos pidftt Herran, sinun 
Jumalasi, kAskyt ja hflnen teissflnsfi 
vaellat, 

10. ettS kaikki kansat maan pSfiUfi 
nfikevfit sinun olevan Herran nimeen 
nimitetyn, ja pelkSSvUt sinua. 

11. Ja Herra lahjoittaa sinulle run- 
saasti hyvyyttd, sekS kohtusi hedel- 
m&S, karjasi hedelmSft Ja maasi he- 
dclm&li, siinS maassa, jonka Herra 
vannoi sinun isillesi, antavansa sen 
sinulle. 5Moos.90'.9. 

12. Herra avaa sinulle hyvfln varas- 
tohtioneensa., taivaan, 'antaaksensa 
maallesi sadetta ajallansa, ja siuna- 
taksensa kaikki sinun kSsialasi; ja 
sinA lainaat monelle kansalle, mutta 
et sinft keltfikfifin lainaa ota. 

5 Moos. 11:14. 15:6. 

13. Ja Herra asettaa sinut pfifiksi, 
eikS hfinnfiksi ; sinJl olet aina ylim- 
in5incn, etkfl alimniainen, jos olet 
Herran, sinun Jumalasi, kEskyille 
kuuliainen, jotka minft tdnApSnfi si- 
nun knskcn pit Aft ja tehdd, 

14. etkn poikKea niistd sanoista, jot- 
ka minA tftnApAnA teille kfisken, el 
oikialle eikA vasemmalle puolelle, 
muitten junialien ji&lkeen vaeltaak- 
sesi ia heitd palvellaksesi. 

15. Mutta jos et kuule Herran, si- 
nun Jumalasi, ASntft, etkA pidft ja 
tee kaikkia hdnen kftskyjAnsfi ja sdSn- 
tCjSnsA, jotka minfi tfinSpAnn sinulle 
kflsken, niin kaikki nfimfi kirouks^t 
tulevat sinun pfifillesi ja sattuvat si- 
nuun : SMoos. 26:14 s. Val. v. 2:17. 

Dan. 9:11. Mai. 2:2. Bar. 1:208, 

16. Kirottu olet sinA kaupungissa, 
kirottu pellolla. 

17. Kirottu on sinun korisi ja tai- 
kinapurtilosi. 



18., Kirottu on ruumiisi hedelmfi, 
maasi hedelmil, karjasi hedelmA, 
lammaslaumasi h'edelmft. 

19. Kirottu del sinft kftydessAsi si- 
sAUe, kirottu kfiydessfisi ulos. ; 

20. Herra Ifihettftil sinun sekaasi kin 
rouksen, hfimmenriyks^n ia rangais-, 
tuksen kaikissa sinun yritykslssftsi, 
siksi ettA hukut ia Akisti katoat pa- 
hain tekojesi tAhden, kun niinut hyl- 
jAsit. 

21. Herra antaa ruttotaudin tarttua 
sinuun, siksi ettA hAn* sinut hukut- 
taa siita maasta, jota menet omista- 
maan. 

• 22. Herra lyd sinua kuivataucUlIa, 
kuumeella ja polttotaudilla , tuleh- 
duksella ja kuivuudella, nokipAillA 
ja laihon kellastumisclla ; ia ne vai- 
vaavat sinua, siksi ettA hukut. 

8 Moos. 26:16.- Am. 26:19. Hagg. 2:17. 
^ 23. Ja taivas pAAsi pAAllA on ole- 
va kova kuin vaski, ja maa, joka al- 
ias! on, kuin rauta. 8Moos.26:i9. 

6 Moos. 11:17. 

24. Herra antaa maallesi tomun ja 
tuhkan sateen verosta; taivaasta 
s6 tulee pAAllesi, siksi ettA hukut. 

25. Herra lyO sinua vihoUistesiedes- 
sA. YhtA tietA sinA. menet heidAn ty- 
kdnsA, mutta seitsemAA tietA heidAn 
edeltAnsA pakenet; ja sinA haioite- 
taan kaikkien valtakuntain sekaan 
maan pAAUA. 

26. Sinun ruumiisi joutuuravinnok- 
si kaikille taivaan linnuille ja kai- 
kille maan pedoille, eikA kenkAAn 
heitA karkoita. 

27. Herra ly6 sinut Egyptin paisu- 
milla, hApiAllisillA ajoksilla, ruvella 
ja syyhelmAllA, niln ettet voi paran- 
tua. 2 Moos. 9:9. 

28. Herra lyO sinut mielenvikaisiiu- 
della, sokeudella ja sydAmmen tyh- 
myydellA. Room. 1:28. 

29. Ja sinA koperoitset puolipAivAnA 
niinkuin sokia pimiAssA koperoitsee, 
etkA menesty teissAsi, ja smA kArsit 
vAkivaltaa ja vAAryyttA, niin kauan 
kuin elAt, eikA kenkAAn sinua aula. 

30. Vaimon sinA kihlaat, mutta toi- 
nen sen makaa; huoneen sinfi ra- 
kennat, mutta et sinA saa siinA asua ; 
viinimAen sinA istutat, mutta et si- 
nA saa siitA hedelmAtA koota. 

6 Moos. 29:5 8. 

31. Sinun hArkAsi teurastetaan sil- 
niAisi nAhden, mutta et sinA saa sli- 
tA syOdA. Aasisi otetaan vAkivallalla 
sinun nAhtesi , eikA sitA sinulle an- 
neta takaisin. Lampaasi annetaan 
vihoUisillesi , eikA KenkAAn sinua 
aula. 

32. Poikasi ja tyttAresi annetaan toi- 



208 



5 MOOS. 28. 



selle kansalle , ja silmSsi sen nSke- 
v9(. ja siml ikavfiit hcitS joka p5i- 
v5, mutta et voi siinA mitafin tehdfl. 
33.Sinun maasi hedelmftn jakaikki 
sinun varasi se kansa sy5 , Jota et 
lunne, ja sinun tfiylyy vaan vfiflryyl- 
15 kSrsia la sorrettuna olla koko si- 
nun elinaikanasi. 

34. Ja sina tulet mielettOmSksi niis- 
tS mitft silmftsi nSkevfit. 

35. Herra lyO sinua pahoUla paisu- 
mllla polvissasi ja pohkeis^asV, jal- 
kap5ydfislft pfi$si lakeen ast'i , niin 
ettet Voi niistfi parantua. 

36. Herra vie sinut Ja sinun kunin- 
kaasijonkas itseltesi asetat.sen kan- 
san luo, jota et sinfi eikft isSsi tunne, 
ja siellS sinft i^alvelet muukalaisia 
jumalia, puila ja kivifi. 

37. Ja sinft tulet kauhistukseksi, sa- 
nanlaskuksija pilkkapuheeksi kaik- 
kien kansain seassa, johon Herra 
aiaa sinut. i Kun. 9:7. Jer. 24:9. 25:9. 

38. Sinft kylvflt paljon siemcntfi pel- 
toon, mutta vfihfin korjaat; sillfi nei- 
nSsirkat sen sydvSt. Mik. 6:15. 

Hagg.l:6. 2:17. 

39. Viinimfien sinS istutat ja ruok- 
koat, mutta viinia et saa siitS juoda, 
etkft tallelle koota; sill5 madot sen 
sydvfti. 

fO. Oljypuita sinuUa on kaikialla 
sinun maasi paikoissa, mutta et si- 
nfl saa vbidella i tseSsi Gljyllfl ; slim 01- 
jypuun hedelmat karisevat maahan. 
41. Poikia ia tyttariflsinasiitat, mut- 
ta etkuitenkaan saa niita pitaa; silia 
ne viedaan vangtttuna pois. 
42.%aikki sinun puusi ja maasi he- 
deloiat omistavat sirknt.' 

43. Muukalainen, joka sinun luona- 
« on, ylennetaan sinun ylitsesi, ala- 
H ylemmaksi; mutta sina alenne- 
wah alati alemmaksi. 

44. Han lainaa sinulle, mutta et si- 
nS voi hanelle lainata. Han on paa, 
ia sina hanta. 

45. Ja kaikki nama kirouksel tule- 
val paailesi ja sinua vaivaavat , ja 
sinuun saltuvat, siksi etta hukut; 
sentfihden ettet Herran, sinun Ju- 
malasi, afinta kuuUut, etka pitanyt 
nanen kaskynsa ja saanfdnsa, jotka 
Mn sinulle on kaskenyt. 

46. Ja ne ovat sinussa merkiksi ja 
ihmeeksija sinun siemenessasi ijan- 
kaikkisesti, 

47. koska et palvellut Herraa, sinuri 
Jumalatasi, iloisella ja riemuisella 
sydammelia^kun sinulla kaikkinais- 
ta kylia oli. 

48. Ja sina olet palveleva vihoUi- 
nasi, jotka Herra lahetlna sinun paai- 
Mt naijassa ja janossa, alastomUu- 



dessa ja kaikkinaisessa puutteessa. 
Ja han panee sinun kaulaasi rau- 
taisen ikeen, siksi etta han sinut hu- 
kuttaa. 

49. Herra lahettaa kansan sinun 
paailesi kaukaa maailman aaresta, 
niinkuin kotka lentaisi, kansanjon- 
ka puhetta et sina ymmarra. 

Jer. 5:16 a. 6:228. 

50. kovan kansan, joka ei kartavan- 
haa eika armahda nuorukaista, 

Val. v. 4:16. 5:128. 

51. ja syO karjasi hedelmat ja maa- 
si hedelmat, siksi etta hukut. eika 
jata sinulle mitaan jyvista, viihista, 
aijysta, karjan tahi lammasten hedel- 
masta, siksi etta han sinut lopettaa. 

52. Ja se ahdistaa sinua kaikissa 
porteissasi, siksi etta korkiat ja vah- 
vat muurisi, joihin sina luotit, ku- 
kistuvat maahan kaikissa maakun- 
nissasi ; ja se ahdistaa sinua kaikissa 
porteissasi, koko sinun maassasi,jon- 
ka Herra, sinun Jumalasi, sinulle 
antanut on.' 

53. Sinun taytyy syOda oman ruu- 
miisi hed^lml^a, poikaisi ja lytartesi 
lihaa,jotka Herra, sinunJumalasi, si- 
nulle antanut on, siina ahdistuksessa 
ja vaivnssa, jolla vihollisesi sinua ah- 
distavat. 2 Kun. 6:29. Val. v. 2:20. 4:10. 

54^ Se mies, ioka ennen sapgen her- 
kullisesti.ja hekumassa teidan seas- 
sanne ell, on karsaasti katsova vel- 
jcansa Ja vaimoansa, joka on hanen 
sylissansa, ja vieia jaaneita, tallella 
olevia poikiansa, 

55. antamatta kellekaan niista poi- 
kainsa lihaa , jota han syO , koskci 
hanelia ole mitadn jaielia siina ah- 
distuksessa ja vaivassa, jolla vihol- 
lisesi ahdistaa sinua kaikissa portei.s- 
sasi. 

56. Vaimo teidan seassanne, joka 
ennen ylellisesti ja hekumassa eia- 
nyt on, niin ettei han malttanut jal- 
kaansalaskea maan paailemukavuu- 
den ja hekuman tahden, on kndeh- 
tiva mieheltansa, joka hanen sylis- 
sansa on, ja pojaltansa ja tyttarel- 

tansa 

57. jaikimaisia, jotka hanen kohdus- 
tansa lahtencet ovat, ja poikiansa, 
jotka han synnyttaa ; silia han syd 
ne, kaiken puutteessa, salaise5ti,siina 
ahdistuksessa ja vaivassa, jolla vihol- 
lisesi ahdistavat sinua porteissasi. 

58. Jos et pida ja tee kaikkia naita 
lain sanoja, jotka tassa kirjassa ovat 
kirjoi(etut,nfin etta pelkaattatakun- 
niallista ja peljattavaa nimea: Her- 
raa, sinun Jumalnasi, 

59. niin Herra ihmeeUiseksi tekec 
sinun ja siemenesi rangaistukse), 



209 



5 MOOS. 2S. 29. 



sxuriUa ja pitk^llisilin vitsauksilla, 
pahoillu ja pifliailisiim taudcilla, 

GO. ju kHaniail sinua vastaan kaik- 
kinaiset Egyplin (audit, joita pclkaAt, 
ja lie sinuun (arltuvat. 

61. Ja kaikki muul sairaudef ja vit- 
sauksel, jolka civAt ole kirjoitolut 
tilssa lakiraamatussa, laskee Herra 
sinuil pAAllesi, siihcnasti ctlA luikuL 

C2. Ja (eis(2,jotkacniien otitic moiii- 
Iukuiset,ku;n tUhdct taivaassajaa v5- 
hainen joukko,cttet kuuilut Hcrraii, 
sinua Jumaia.si,i\nntn.5Moo8.4:27 10:22. 

G3. Ja tapaiituu, ettil iiiinkuin Hcr- 
ra cniien iloitsi teista, leillc hyvail 
tchdessAnsA ja cncntfiissaiisti tcitd, 
niin Hcrra on iloilscva leislil,hukut- 
taissansa ja kadotlaissansa tcil5, ja 
tc syOslaan pois siita maasla, jota le 
menetteomistamaan. San.i:26. Jes.i:24. 

64. Ja Hcrra hajoittaa sinut kaik- 
kicn kansain sekaan^ toisesta maaii 
fiilrestil toisccn ; ja sicllA sina palve- 
Ict niuukalaisia jumalia, joita c( si- 
nd civHtkn isHisikiirui oie tunteiiect, 
kaiitoja ja kiviil. 5 Moos. 4:27. Neh. l:8. 

05. Ja niidcn kansain seassa ei si- 
nulla ole yhtihln vahvaa koloa, cikH 
jalkais pdytil yhtAAn lepoa saa; sillH 
Herra antaa smulle siellA vapisevai- 
sen sydAmmen, hivellynecl silm5l 
ja niurhcesta nAilntyvtln niielcn, 

66. ja cHlmnsi on niinkuin riippu- 
massa sinun edcsstlsi; ydllH ja iKli- 
vaiia sinfi pelkant ja olet elflmAsta- 
si lietdmiltdn. 

67. Aamulla sin5sanot: ,,ah, joska 
ilta olisi!'' illalla sind sanot: „ah, 
joska aamu olisi!** s^'ddmniesi suu- 
ren pelvon lAhdcn, joka sinua pel- 
jAttDS, ja sen tdhden, jota silmdsi 
nahdd taylyy. 

68. Ja Herra vie sinut taas haak- 
silla Egyptiin, sitft tietA, josta mind 
sanoin sinulle: ,,et ole sit5 cnAA nA- 
keva." Ja le myOtte itsenne sielia 
vihollisillenne palvelijoiksi ja piioik- 
si, eikA ole sielm ostajaa. 6Moos. 17:1G. 

29 l.uku. 

Liitio uudlstettu. 

NAmfit ovat liiton sanat, sen liiton, 
jonka Herra kSskiMooseksen tcIidS 
Israclin lasten kanssa Moabin maas- 
sa.paitsisitA liittoa, jonka hAnheidAn 
kanssansa tcki Horcbissa. 5 Moos. 5:2. 
2. Ja Mooses kutsui koko Israclin, 
a sanoi hcile: 'Te olette nAhnect 
alkki, mitA Herra silmAinnc edcs- 
sA tekl EgyptissA Faraolle, kaikille 
hAnen palvelijoillcnsa ja koko hAnen 
maallensa, 2Moos. 19:4. 

^. ne suuret koeltelemukset, jotka 



i' 



7 Ja kun te tulitte tAhAn uaikkaan, 
niin tuli Sihon, Hesbonin Kuningas, 



silniAsi nAkivAt, ja ne suuret mer* 
kit ja ihmcelliset tcot oMoos. 7.19. 

4. Mutia Hcrra ci viclA nytkAAn til- 
han |)aivAAn asli olc antanut tcille 
sydanlA ymmartaniaAn,silniia nAke- 
niAAn.jakorvia kuulemaan. Je$. C:iO. 

5. Ja mina annoin teidAn vaeltaa 
korvcssa neljakymmenlA vuotla ; 
\aattcenne eivAt vanhcntuncct >i- 
tAnne, cikA kenkAsi kuluncet jalois- 
sasi 5 M«*08. 8:4. 

6. Ette syOncet loipAA, cttekA juo- 
ncct viiniA taikka vAkcvatA juomaa, 
cltA tictaisitte minun olcvan Hcrran, 
teidAn Jumalannc. 

naikkaa 
Kuningi 
ja Og, Basanin kuningas, soliniaan 
mcitA vastaan, ja me loininic hci- 
dAt, 4 Moos. 21:21s. 33.<«. 5 Moos- 2:30. 3.1. 

8. ja omistimme hcidan inaansa, 
ja annoimme sen lUibcnilaisillc ja 
Gadilaisillc, niin my6s puolcllc Ma- 
nasscii sukukunnallc pcrimiscksi. 

4 Moos. 32:33. 5 Moos. 3:12. 

9. Niin pitAkAAt nj^l nAmA liiton 
sanat, ja tehkAAt niidcn niukaan, 
ettA tc toimclliscsti tckisitte kaikki, 
mitA tcette.5 Moos. 4:0. Jos. 1.7. 1 Kun. 2:3. 

10. Tc st?isottc kaikki tAnapAnA Her- 
ran.tcidan Jumalannc, cdcssA. ylim- 
maiset suvuistannc, teidAn vanhini- 
pannc, ja teidAn esimiehcnnc, joka 
mics Israelissa, 

11. teidAn lapscnne, teidAn vaimon- 
ne, ja sinun muukalaiscsi, joka lei- 
rissAsi on, puusi hakkaajasta niin 
vetcsi animcniajaan asti, 

12. kAydAkscsi Herran, sinun Ju- 
malasi,Iiittoon ja siihcn valaan, jon- 
ka Hcrra, sinun Jumalasi, tekee si- 
nun kanssasi tAiiApAiiA. 

13. SillA hAn tahtoo lAnApAnA ko- 
rottaa sinut itsellensiT kansaksi , J& 
hAn on sinun Jumalasi, niinkuin 
hAi\ sanoi sinulle, ja niinkuin hAn 
vannoi sinun isillesi Abrahamille, 
fsaakille ja Jaakobille. 5Moos. 2S:9; 

14. Ja minA en tee tAtA liittoa ja tAtft 
valaa ainoastaan teidAn kanssanne, 

15. vaan sekA teidAn, jotka^tAssA lAs- 
nA lAnApAnA olette jascisottc mcidAn 
kanssamme Herran, mcidAn Juma- 
lammc edessA, ettA my6s niidcn kans- 
sa , jolka eivAt tAssA tAnApAnfi niei- 
dan kanssamme ole. 

16.SilIatctiedAtte,kuinkameasulm- 
me Egyptin maalla , ja kuinka me 
vaclsimme pakanain lApitse, joitten 
kautta tc vaelsitte, 

17. ja nAittc heidAn kauhistuksensa 
ja epajumalansa, kannot ja kivet, 
hopcat ja kullat, joita heillA oli; 

18. etlei vaan joku olisi teidAn seas- 



210 



5 MOOS. 29. 30. 



sanne.mies talii vaimo,perhetaikka 
sukukunta; joka syddmniensd tSnti- 
piina kfi5nl5isi pois Herrasta, meid0n 
Jumalastamine, menTiAkscnsS palve- 
lemaan tHmSii kaiisan jumalia ja tu- 
lisi (eille juureksi, joka kasvaa sap- 
pea jakoiniohoa; Ap. U 8:23. H<ebr. 12:15. 

19. ja tapahtuisi ,, kun hAn kuulee 
namii kirouksen sanal, ettu h:ln siu- 
naa ilsednsa sydammessAiisS, jasa- 
nQor.rauhaonminuUa oleva, vaikka 
minS vaellan syddmmeni kovuudes- 
sa ; ja niin juopunut janoovan kans- 
sa hukutetlaisiin. 

20. EiHerraole hftnelle armollinen, 
vaan silloin syttyy suuri Herran vi- 
ha ja kiivaus sitH 'inicslfi vastaan, 
ja kaikki nSma kiroukset. jolka tt\s- 
sa kirjassa ovat kirjoitetut, tulcvat 
hSnen p^SIlensil; ja Herra pyhkii 
pois hSnen nimcnsll taivaan alta. 

5 Moos. 28:158. 

21. Ja Herra eroittaa h(lnet onnet- 
tomuuteen koko Israelii! suvusla, 
kaikkien tamiln liiton kirouslenmu- 
kaan, jotka tSssil lakikirjassa on kir- 
joitettu. 

22. Niin sanovat jdlkeentulevaiset, 
teid§n lapsenne, jolka teidiin j&U 
keenne tuievat, ja vieraat, jolka Itau- 
kaiselta maalta tulevat, kun he nS- 
kevat tSman maan rangaistukset ja 
sairaudel, joilla Herra Ty6 hcilS, 

23. ettS koko heidSn maahsa on lu- 
likivi, suola ja poUeUu, niin cllei 
kylvetaeikSsevihoita.cikdyliiakann 
niohoa kdy siitd ylGs, niinkuin So- 
doma, Gomorra, Adania ja Seboim 
kjukisfetliin maahan, jotka Herra vi- 
hassansa ja hirmuisuudessansa ylds- 
aluisin kukisti, — i Moos. 19.*24 s. 

Hos. 11:8. 

2t. silloin kaikki kansal sanovai: 
..miksi Herra niin teki t»Ile maalle? 
mikS on tSmS suuri lidnen vihansa 
luli?" 

^. Silloin sanotaan: ,,sentai)den 
em tie hyljdsivft I Herran, isdinsi) Ju- 
malan, liilon, jonka linn teki heiddn 
kanssansa, kun hSn heidnt johdatti 
Egyi^tin maalta, 1 Kun.9:9. Jer.22r88. 

%. ja oval menneet ja muita juma- 
lia palvelleet, ja kumartaneet nii- 
19, senkaltaisia jumalia, jotta eivSt 
he tunteneel, ja joita ei hfin heiUe 
mSfirfinnyt. 

27. Sentdhden on Herran vlha syl- 
lynyt t3t9 maata vastaan, niin ellfl 
Han antoi tulla heidikn pft511ens5 
kaikki kiroukset, jolka tSssfi kirjas- 
sa Jcirjoitetu I ovat. 

28. Ja Herra on heidSt hfivitlftnyt 
heidSn maastansa suuressa vihassa, 
jalmuudessa ja nfirkSstyksessfi , ja 



on heidftt heittfinyl vieraasen maa- 
han, niinkuin nyt on tapahtunut.** 
29. Salaisuudel ovat Herran, meidhn 
Jumalanime, liallussa; multa ilmoi- 
tuksel ovat meillu Ja nieidOn lapsil- 
iamrne alati, etia me kaikki nftiiifi' 
Iain sanat tekisimme. Ps. 25:14. 147:1^1^. 

30 Laku. 

Mooses varoittaa edelleen kansaa. 

r 

J a piiaA tapahtuman, kun kaikki 
nSmA tulevat .paSllesi. siunaus 
tahi kirous, jotka min5 panin eteesi, 
ja sind rupeat ne panemaan .sydfim- 
meesj, kaikkien pakanoitten keskel- 
ld,johonHerra,siniinJunialasi,sinut 
on ajanu t,3Moo8. 26:40 s. oMoo8.28:2 8., 15 s. 

2. ja sinS kdOnnyt Herran , sinun 
Jumalasi, tykO, ja oiet kuuliai;ien 
liftnen fidnellensji kaikissa niiss3. 
mitSi minA sinulle l&nllpdnil kSskcn, 
sin A ja lapsesi, koko sydaihmeslAsi 
ja koko sielustasi, 

3. niin Herra, sinun Jumalasi, kSfin- 
isn vankeutesi, ja armahlaa sinua, 
ja kokoaa sinut jiilkeenkaikistakan-, 
soisla, joiliin Herra, sinun Jumala- 
si, sinul hajoiltaiiut on. Ps. 106:45. 

Jer. 20:14. 31:23. 32-.37. 2Makk. 1.29. 2:18. 

4. Jos sinA olisit ujettu vaikka tai- 
vaan SSriin, niin sietldkin Herra, si- 
nun Jumalasi, kokoaa sinul, ja tuo 
sinut sielta. Neh, 1:9. 

5. Ja Herra, sinun Jumalasi, joh- 
dallaa sinut siilien maahan , jonka 
isflsi ovat oniistaneel, ja-sinft sen 
omistal; ja hfin tekee hyvfi0 sinulle, 
ja enenlAft sinul enemmAn kuin 
isifisi. 

6. Ja Herra, sinun Jumalasi,' ym- 
pdrileikkaa sSddmmesi ja sicmenesi 
sydftmmen. rakaslamaan Herraa, si- 
nun Jumalaasi, koko sydftmmest&si 
ja koko sielustasi, etlft elAisilv 

5Mo6s.lO:16. Jer. 4:4. 32:30. lies. 11:19. 
36:26. Room. 229. Fil.Sd. Kol.2;ll. 

7. Ja kaikki nAmA kiroukset anlaa 
Herra, sinun Jumalasi, tulla vihollis- 
tesi pSdlte, ja kaikkcin niiden pfiSl- 
Ic,' jolka sinua vihaavat javainoovat. 

8*. Ja sinA, sinii kdSnnyt ja kuukt 
Herran AAnen, lehddksesi kaikki hd- 
nen k(\skyiisd, jolka min& sinulle 
tftnSpdnli kSsken. 

9. Ja Herra, sinun Jumalasi, antaa 
sinulle runsaan onnen kaikissa kit- 
lesi tdissft, kohlusi hcdelmAssft, kar- 
jasi hedelmAssA, ja maasi hedclmds- 
sd..cttd ne sinulle prieneslyisivdt ; sil- 
13 Herra iloitsee jAllecn $inu&ta, si- 
nulle hyvdksi, niinkuin hAn isistSsi 
iloitsi, -SMooK; 28:11. JeTi 32^1. 

10. ettft Herran, siaun Jumnlasit oA* 



2U 



5 MOOS. 30. 31. 



nelle kuuliainen olet , ja pidSt hd- 
nen kSskynsft ja sfifintOnsa, jotka o- 
vat kiijoitetut tftssfi iakikiijassa , ja 
palajal Herran, sinun Jumalasi, ty- 
K() koko sydfimmestSsi ja koko sie- 
lustasi. 

11. Sillft tamfi kfisky, jonka ininfi 
sinulle tfinfipftnfl kflsken. ei ole liian 
raskas, eikfi my6sk&|ln kaukana, 

Jes. 45:19. 

12. eikfi se ole taivaassa, ettfi sanoi- 
sit: „kuka astuu y46s taivaaseen, ja 
luo meille sen« kualiaksemme sitft 
ja tehd&ksemme sen'mukaan?'* 

Boom. 10:68. 

13. Eikfl se ole tuolla puolen me- 
ren, ettfl sanoisit: ^kuka menisi me- 
ren vHtse noutamaan meille sen, 
kuullaksemnie silfi, ja tehdfiksemine 
sen mukaan?^* 

14. Slllfl se Sana on sangen Ifisnfi 
sinua-suussasif ja sydflmmessSsi, et- 
Ifi voit sen tehdS. 

15. Katso, minfi panen tfinSpftnfi si- 
nun eteesi elfimfin ja hyvfln« kuole- 
man ja pahan, 

16. kun minS sinMH tfinApfinfi kfis* 
ken rakastamaan Ifo.rraa, sinun Ju- 
malaasi, ja vaellamfian liAnen teis- 
stlnsn, ja pitfimSfin hdncn kfiskynsfi, 
sAHntOnsA ja oikeulensa; etUl suisit 
clAS ja enenisil, ja Herra, sinun Ju- 
mulasi, siunaisi sinua siinft maassa, 
jotion menet, sitd omistamaan. 

17. Mutta jos sinA kAAnnAt syddm- 
mesi, clkA ole kuuliainen, vaan an- 
nat vietcUA ilsesi, niin ellA kumar- 
ral vieraita jumalia ja palvelel liei- 
lA, 5M008. 8:198. 

18. niin teen minA teille tanApAnA 
tieltAvAksi, ettA te perAli hukutte et- 
tekA kauan pysy siinA maassa . jo- 
hon menet jQ[rdaninyIitse,sitA omis- 
tamaan. 

19. Minfi otan tAnApAnA taivaan ja 
maan todistajaksi IcistA. ettA olen 
pannut eteenneelAmAnjakuoIeman, 
siunauksen ja kirouksen; niin va- 
lilse elAmA, ettA elAisIt, sinA ja sie- 
menesi, 5 Moos. 426. 1126. Syyr. 15:178. 

20. rakastaessasi Herraa, sinun Ju- 
malaasi, ja kuullessasi hAnen AAn- 
tAnsA, ja nippuessasi hAnessA kiinni ; 
sillA han on sinun elAmAsi ja pitkA 
ikAsi, ettA pysyisit siinA maassajon- 
ka Herra sinun isillesi, AbrahamlUe, 
Isaakille ja Jaakobille, vannoi , an- 
tavansa sen heille. 

31 Luku; 

Mooteksen JUliyvUsetkansaUe. 

J a Mooses meni Ja puhui nAmA sa- 
oat koko. Uraeulle* 



2. ja sanol heille. „mihA olen tA- 
nApAnA sadan ja kahdenkymmenen 
ajastaikainen ; en minA vol enflft kAy- 
dA ulos ja sIsAlle; ja Herra on sano- 
nut minulle: ,el sinA ole menevA tA- 
mAn Jordanin ylitse.' 4 Moos. 20:12. 

27:128. 5 Moos. 327. 32^2. 34:7. 

3. Herra, sinun Jumalasi, kAy itse 
sinun edellAsi; hAn itse hukuttaa 
nAmA pakanat sinun edestAsi , niin 
ettA. sinA ajat heidAt pois, ja Josua 
kAy' sinun edellAsi sen ylitse, niin- 
kuin Herra on sanonut. SMoos. 27:18. 

4. Ja Herra tekee heille, niinkuln 
hAn teki Sihonille ja Ogiile, Amori- 
laisten kuninkaille, ja heidAn maal- 
lensa, jotka hAn on hukuttanut. 

4 Moos. 21 .'24, 36. 

5. Kun Herra antaa heidAt teidAn 
kAsiinne, niinUehkAAt heille kalk- 
kien kAskyien mukaan, jotka mifiA 
teille olen kAsk^nyt. 5Moos. 72. 

6. Olkaat vahvat la hyvAssA turvas- 
sa, AlkAAt peljAstyKd ja kauhlstuko 
heitA; sillA Herra, sinun Jumalasi, 
itse vaeltaa kanssasi, hAn ei jAtfi si- 
nua, eikA hyljAA sinua.*' 6M00B. 7*.2l. 

J08. m. Hebr. 13:5. 

7. Ja Mooses kutsui Josuan, ja sa- 
noi hAnelle koko Israelin silmfiin 
edessA: „ole vahva ja hyvAssA tur- 
vassa, sillA sinA johdatat tAmAn kan- 
san siihen maahan, jonka Herra hei- 
dAn isill6nsA on vannonut heille an- 
tavansa, ja sinA jaat tAmAn heille 
perinnOksi heidAn keskellAnsA. 

4 Moos. 27228. 5M008. 328. 

8. Mutta Herra, joka itse kAy edel- 
lAsi, on sinun kanssasi; ei han jAtA 
sinua, eikA hyljAA sinua: AlA pel- 
kAA, AlAkA hAmmAsty." 

9. Ja Mooses kirjoitti lAmAn Iain, 

!a antoi sen papeille. Levin pojille, 
otka kantoivat Herran liifon ark- 
Lia, ja kaikille Israelin vauhimmillc. 

10. Ja Mooses kAski heille, ja sanol: 
v,aina joka seitsemAn vuoden pcrAs- 
tA, kun on vapaavuosi, lehtiniajan 
juhlana, SMoos. i5:i. 

11. kun koko Israel tulec osoitta- 
maan itsensA Herran, sinun Juma- 
lasi, eteep, siihen paikkaan, jOnka 
hAn valitsee, pitAA sinun tAmAn Iain 
lukeman koko Israelin edessA hei- 
dAn korvainsa* kuullcn. Neb. 8a 8. 

12. Kokoa silloin kansa, sekft mle- 
het ettA vaimot, lapset ja muuka- 
laisel, jotka sinun portelssasi oval, 
kuulemaan ja oppimaan ja pelkAfl- 
mAAn Herraa, teidAn Jumaiaanne, 

{>itAmAAn ja tekcmAAn kaikki tftquAn 
ain sanat, 

13. ettA myOs heidAn lapsensa, jot- 
ka eivAt silA UedA, kuulisivat ja 0|>- 



212 



5 MOOS. 31. 32. 



fisivat pelkfiftmfiftn Herraa, teidfln 
umalaanne, kaikkenatcidSnelinai- 
kananne, kuin te clfitle siinfi maas- 
sa. Johonka te menette Jordanin y- 
Utse siUI omistamaan.** 

14. Ja Herra sanoi Moosekselle: 
.,katso,sinuh kuolinpftivftsi on Ifisnfi ; 
kutsu Josua, ja seisokaat seurakun- 
nan mi^assa, ettil minJl antaisin hil- 
nelle kflskyn.** Ja Mooses men! Jo- 
saan kanssa, ja he seisoival seura- 
kunnan majassSi. 

15. Ja Herra ilmestyi mz^assa, pil- 
ven patsaassa , ja pilven patsas sei- 
soi majan ovella. 

16. Ja Herra sanoi Mooseksellei 
Hkatso, sinft olel lepSdvA isflisi kans- 
sa; ja tfimfi kansa nousee ja iuoksee 
huoruutcen maan epiijumaiien pe- 
rSSn, siellii mihin he menevfit, ja he 
bylkdiivni minut, ja rikkovat sen lii- 
ton, jonka minS tein heidAn kans- 
sansa. 

17. Ja minun vihani silloin syttyy 
heihin, ja minil hylkASn heidflt, ja 
peitdn kasvoni heillA , etifi he jou- 
tuvat saaliiksi, ja paljo pahuutta ja 
ahdistusta kHy heiddn pflAllensA; ja 
he sanovat sinA p5iv0nA: ,eik6 nA- 
mSt onnctlomuuuet ole tapahlunect 
minulle, senlAhden ctlei minun Ju- 
malani ole minun kanssani?' 

18. Mutfa niinO pcrAti peilAn kas- 
voni silia ajalla, kaiken sen paliuu- 
den (dhden, jonka he tehnect ovat, 
etl3 he oval kailntyneet muiden ju- 
malicn puoleen. 

19. Niin kirjoittakaat nyt ilsellenne 
tuin.1 virsi, ja opeta sc Israelin lap- 
silic, aseta se heidAn suuhunsa, et- 
tii laniA virsi olisi minulle todista- 
jaksi Ismelln lapsia vastaan. 

20. SillA minu johdatan hcfdAt sii- 
hen maahan, josta minA vannoin 
heidAn isillensA, jossa rieskaa ja hu- 
najala vuolaa. Ja kun he sy6vAt ja 
tulevat ravituksi ja lihavaksi, kAAn- 
ly\'9t he muiden jumalien puoleen 
ja palvelevat niitA; ja pilkkaavat 
minua, ia rikkovat minun liittoni. 

21. Ja kun suuri onnettomuus ja 
ahdislus kAsittAA heidAt, niin tAmA 
virsi vastaa heitA todistajana, sillA 
ei silA pidA unhoteltaman heidAn 
siemencnsA suussa. MinA tiedAn liei- 
diin ajntuksensa, joita he lAnApAnA 
ajaUefevat, ennen kuin minA jolida- 
tan heidAI siihen maahan, jonica mi- 
nfi valalla heille luvannut olcn.*' 

22. Ja Mooses kirjoitti tAmAn virren 
sinA pAivAnA, ja opetti sen Isrt^elin 
lapsille. 

a. Ja HAn kAski Josuaa, Nunin pol- 
)(aa, ja sanoi : „ole vahva ja urhool- 



linen, sillA sinA iohdatat Israelin 
lapset siihen maahan , jonka minA 
vaialla heille lupasin; JaminA^olen 
sinun kanssasi.*' 

24. Kun Mooses oH nAmA lain sa- 
nat kiijoittanul kiijaan. ja pe lopet- 
tanut, 

25. kAski hAn LevilAisiA, jotka Her- 
ran todistuksenarkkiakantoivat,8a* 
noen: 

26. ,.Ottakaat lAmfi lakikiijd Ja las- 
kekaat Herran* teidi|n Jumafaniie, 
liiton arkin sivulle, cttA se olisI siii 
nA todistukseksi sinua vastaan. 

2 Kun. 22:8 1. 

27. SillA minA tunnen tottelematto- 
muutesi ja niskuruutesi : katso, lAiiA- 

f>AnA vielA cIAessAni tctdAn keskel- 
Anne olelte te tottelemattomat Her- 
raa vastaan, kuinka paljoa enem- 
min minun kuolemani jAIkeen? 

28. Niin kootkaat minun eteenikaik- 
ki vanhimmat leidAn sukukunnis- 
sanne ja esimiehenne, eltA minA pu- 
huisin nAmA sanal heidAn korvain- 
sa kuullen, Ja ottaisin taivaan ja 
maan todistajaksi heitA vastaan. 

29. SillA minA tlcdAn, cItA te minuii' 
kuolemani jAIkeen perAti turmel- 
laan, ja poikkeutlc siltA tiellA, jonka 
minA teille kAskcnyt olen; sentAh- 
den kohtaa leitA onnettomuus vii- 
mcisillA ajoilla, etIA te leitlc pahaa 
Herrnn silmAin edessA, ja vihoititle 
hAnen kAttenne l6illA.'' 

30. J a Mooses puhul koko Israelin 
seurakunnan kuullen tAmAn veisun 
sanat hamaan loppuun asti. 

32 Luku. 
Mooseksen muistovirsl. 

Kuulkaat, te taivaat, minA puhun. 
ja maa kuulkoon minun suuni 
sanoja. 5Moo8.3i28. Jes. 1:2. 

2. Minun oppini tiukkiikoon niin- 
kuin sade, puhecni vuolakoon niin- 
kuin kastc, niinkuin sade vihannon 
pAAllc, ja niinkuin pisarat ruohon 
pAAllc 

3. SillA minA ylistAn Herran nimeA; 
aniakaul meidAnJumalallemmesuu- 
ri kunnia! 

4. HAn on kallio, hAnen tyAnsA b- 
vat lailtamattomat, sillA kaikki hA- 
nen lien.sA oval oikiat; uskollinen 
on Jumala. ilman vAAryyltA, hAn on 
vanliurskas ja oikia. 

5. Kelvottomasti tekee hAnlA' vas- 
taan nurja ja sekaseurainen suku; 
ei ne ole hAnen lapsiansa, vaan nil- 
den hApiApilkut. 2Moos.32:0. Jes. 1:4. 

Matt. 12:30. 

6. Niiuk<^ te ^erraa klitAtte^ bulla 



2i9 



5 MOOS. 32. 



ja tyhmfi kansa? EikOHfin ole sinun 
Isdsi JA sinun Lunast^jasi , joka si- 
nut luonul ja valmistanut on? 

Mai. 1.-6. 

7. Muis(a muinaisia aikoja, luikis- 
tele vuosikaudet suvusta sukuun; 
kysv isfiitdsi, ja h5n ilmoittaa sinul- 
le, ja vanhemmiltasi, niin he sinul- 
le sanovat. 

8.^ Kun kaikkein Korkein jakoi pa- 
kanat ja hajoitti ihmisten lapset, sil- 
loin hdn mAdrHsi kansain rajaf, Israe- 
lin lastenluvun mukaan. i Moos. ii:8. 

9. Silia Herran osa on liftnen oma 
kansansa, Jaakob on hHnen perin- 
tOnsS. 2 Moos. 19:6. 1 Piet 2:9. 

10. Han I6ysi hanet eramaassa ja 
auliossa ulvonla-korvessa. Han ym- 

Kari piiritti-. ban suojeli, ja varjeli 
anta niinkuin silniateraansa. 

2 Moos. 20:1 8. 

11. Niinkuin kotka kehoittelce pe- 
saansa« ja laulcuelee poikainsa paai- 
la, Icviltaa silpcnsa, ottau kunkin 
heista, ja kantaa silpcinsa paaiia; 

, 2 Moos. 19:4. Jes. 63:9. 

12. niinHcrrayksinarisa laluttihan- 
ta« eika ollut hancn kanssansa muu- 
ta Jumalaa. 

13. Han vei hanct hamaan maan 
kukkuloille, ja ruokki hdnta pellon 
hedelmdlia, ja anloi liAnen imea liu- 
najala kalliosta, ja dljya kovasia ki- 
vesia, 

14. yolta lelimisia, ja rieskaa lam- 
paista, ynna karltsain liliavuudcn 
Kanssa, ja anloi lianellc Basanin oi- 
naat, ja lihavat kauriit, ja parliaan 
nisun: ja viinia sina joit, viinimar- 
jan verla. Ps. 8i:i7. 

15. Ja Israel lihoi, ja lull vikuriksi« 
lihavaksi, paksuksi ja vakevaksi; 
hdn hylkasi Jumalan Joka hanet leki, 
ja piti autuutensa kalliot halpana. 

16. He yllyltjvai hanel kiivauleen 
muukalaisten jumalain kautta, kau- 
histuksilla .vihoittivat he hanet. 

17. He uhrasival perkeleille, eikft 
Jumalalle, niille jumalille, joita ei* 
yat he tuntcneet, uusllle, asken tul- 
icille, joita teidan isanne'eivat pel- 
janneel. Ps. 106.37. i Kor. 10:20. 

18. Kallion, joka sinut siitti, sen si- 
na hylkasit, ja unhotit Jumalan, jo- 
ka sinut loi. 

19. Ja kUn Herra sen ndki. hylkasi 
han hetdat, silia han yihastui poi- 
kiinsa ja lyltariinsa, 

20. ja isanol: ,,mina peitan kasvoni 
heilta, ja kalson mika heiddn lop- 

f>unsa on; silia nurja suku he ovat, 
apsia, jolssa ei ole uskoa. 

21. He harsyttelivat minua sen kaut- 
ta, joka ei ole jumala; turhilla ju- 



malillaan ovat he minut vihoitta- 
neet; ja mina harsyttelen heitd jai- 
leen kansan kautta. joka ei ole kan- 
sa, hullulla.kansalla minfl heiia vi- 
hoitan. Room 10:19. 

22. Silia tuli on syltynyt minun vi- 
hassani, ja polttaa hamaan alim- 
maiseenhelvetliinjakuluttaaniaan, 
ynna sen hedelman kanssa. ja polt- 
taa vuorten pcrustukset. Jer. 15:I4. 17:4. 

23. Mina kokoan onhettomuudct 
heidan paailensa.minS ammun kaik- 
ki minun nuoleni heihin. 

24. Naijasta he hiukahtuvat ja ku- 
lutctaan poltetaudilla ja myrkylli- 
selia rutolla; mina lahetan metsHn 
pctojen hampaat heidan keskellcn- 
sa, ja kyykarmeen niyrkyn. 

25. Ulkona havittaA miekka ja si- 
saiia huoneessa pelko seka nuoru^ 
kaiset etta neitseet, imcvaisct ja ha'r- 
maapaat. 2 Kor. 7:5. 

26. Mina sanoisin: ,mina havitSn 
heidat, mina lakkautan heidan muis- 
tonsa ihmisten kesken,* 

27. cllen mina vihollisten vihaa kart- 
taisi, ettei heidan vainoojansavSarin 
tuomitsisi ja sanoisi: ,meidan kor- 
kea katemmeon kaikki nAmd tchnyt, 
eika Herra.' 4Moos. I4:l5s. Hes. 20:14. 

28. Silia se on kansa, jossa ei mi- 
taa^ neuvoa ole, eika ymmarrystd. 

29. Jospa oHsivat viisaita, niin he 
namat ymmartaisivat ja ajattelisivat 
loppuansa. Jer. 9:12. 

30. Kulnka yksi ajaisituhatlatakaa, 
ja kaksi karkoitlaisi kymmenen tu- 
hatta pakoo:**, ellei heidan kallionsa 
olisi heidat mydnyt ja Herra olisi 
heidat saaliiksi antanut? 

31. Silia meidan kalliomme ei ole 
niinkuin heidan kallionsa, meidnn 
vihollisemme ovat tuomarit. 

32. Silia heidan viinipuunsa on So- 
domanviinipuusta jaGomorran pel- 
loista, heidan viinimarjansa myrlcyl- 
liset vifnimarjat, heilia ovat karva- 
himmat marjat. Hes. 1G:40. 

33. Heidan viininsa on lohikarmeen 
kiukkuvahtoa, ja kyykarmetten hir- 
muisla myrkkya. 

34. Eikd se liene katketty minun 
luonani? ja slnetilia lukittu minun 
varaslohuoneessani ? 

35. Minun on kosto, min& kostan 
silia ajalla kun heidan jalkansia kom- 
pastuu; silia heidan Kadotukjsensa 
aika on lasna, ja mika heille tarjon- 
telee, serientaa. Koom. I2:19.. Hebr. 1030. 

36. Silia Herra tuomitsee kansansa, 
ja armahtaa palvelijaansa; sill&Han 
nakee, etta kasi on poissa, eikA ole 
keiaan jaielia, ei vapaata eika orjaa. 

1 Kuu. 14:10. 2 Kun. 14:20. 



214 



5 MOOS. 32. 33. 



37. Silloin Hfln sanoo: „iniss5 hci- 
diin jumalansa oval ? heidiln kallion- 
sa. johonka he uskalsivat? 

38. joika sdiv5l heidAn lihavimmal 
uhrinsa ja joivat viinin heidAn juo- 
mauhristansa , nouskoon ne ja aut- 
takoot teitii, Ja varjelkool teita ! 

Tuoin. 10:14. 

39. Nahkaat nvt^etta mina itseolen, 
eik9 ole iuinaiia minun kanssani. 
Minfi kuoielan ja teen elSvAksi. mi- 
n5 lyfin ja minh parannan, e\kf\ kc- 
ld9n ole, joka minun kftsislfini va- 
pahlaa. 5 Moos. 4:3a. 1 Sam. 2:6. Jes. 45:5. 

Hos. 6:1 8. 

40. Sillfi minS noslan kflteni taivaa- 
sen, ja sanon; nfinfl elSn ijankaik- 
kUesti! Ilm. 10:55. 

41. Kun mind hivon vfilkkyvSn 
miekkani, ja kflteni rupeaa rangals- 
tukseen, niin minS kostan viholTisil< 
leni, ja niille palkitsen, jotka minua 
viliaavat. 

42. Minfl juotan nuoleni verellfl, ja 
mickkani syd lihaa — lapettujen ja 
vangittujen veressfl, — ja viholllsen 
paSmiesteii p5flstfi. 

4.3. iiiemuitKaat, te kansat, jotka 
olelte liAnen kansansa ; sillfl hfln kos- 
taa palvelijainsa veren. Ja hfln kos- 
(aa vihollisillensa, ja sovittaa maan- 
sa ja kansansa.** P8.9:13. Room. 15:10. 

Ilm. 19:3. 

44. Ja Mooses tuli ia puhui kaikki 
nSmfl veisun sanat kansan kuullen, 
hfln ja Josua, Nunin poika. 

45. Ja kun Mooses oli lopettanut 
kaikki nflmfl sanat Israelille, 

46. sanoi hfln hei^lle: „pankaat sy- 
dflmmeenne kaikki ne sanat , jotka 
iDinfl teille tflnflpflnfi todistin, ettfl 
kftskisitte lapsianne lekemflfln ja pl- 
tfliDflfln kaikki tflmfin laih sanat. 

5 Moos. 6:6. 11:18. 

47. Sillfl ei siinfl ole teille yhtflfln 
tarhaa sanaa, vaan se on teidfln elfl- 
mflnnc; ja sen sanan kautta te pi- 
dennfltle ikflnne siinfl maassa, johon 
te menette Jordanin ylitse, qmista- 
maan sitfl.*' H«br.4:i2. 

48. Ja Herra puhui Moosekselle sa- 
mana pflivflnfl, ja sanoi: 

49. „Nene tfllle Abarimin vuorelle, 
Nebon vuorelle. joka on Moabin 
maaHa, Jerikon kohdalla, ja katsele 
Kanaanmaata , jonka minfl Israelin 
Upsille omaksi annan. 4Moos.27:i28. 

5 Moos. 34:1. 

50. Ja sinfl kuolet vuorclla, johon 
penet, ia kootaan kansasi tykO, niin- 
kuin sinun veljesikin Aaron kuoli 
Horin vuorella, ja koottiin kansansa 

tykfl ; 4 Moos. 20:25. 83:38. 

9l. tentfihden, ettfl rikoitte minua 



vaslaan Israelin lasten keskellfi. Hi- 
taveden . tyk6nfl Kadekses.^a Sinnin 
korvessa; etictte minua pyhittflneet 
Israelin lasten keskcllfl. 

4 Moos. 20:12. 27:14. 

52. Sinfl olet nflkevfl maan cdessfl- 

si; multa et sinfl ole tuleva siihen 

maahan, jonka minfl Israelin lap* 

sille annan.'' 

33 Luku. 

Mooses siunaa kutakin Israelin suku- 
kuntaa. 

J a tflmfl on se ^iunaus, jolla Moo- 
ses, Jumalan mies, siunasi Israe* 
lin lapsia ennen kuolemalansa; 

1 Moos. 40:1 s. 

2. hfln sanoi; Herra on lullut Si- 
naista, ja noussut heillc Scirislfl, ja 
ilmestynyt Faranin vuorelta, ja on 
tullut kymmcnen luhannen pyhfln 
seurasta, ia tulinen lakl hflnen oi- 
kiassa kfldessflnsfl hcitfl vartcn. 

l).in. 7:10. Hab.3:3. Ap. t. 7:53. Gal. 3:19. 

3. Hfln pitflflhuollakansoista; kaik- 
ki hflnen pyhflnsfl ovat sinun kfldes- 
snsi,ja he asettavat itsensfl sinun 
jalkaisi juureen, ja ottavat opin si- 
nun sanoistasi. 

4. Mooses on meilletoimittanut lain, 
Jaakobin sukukunnalle perinn5n. 

5. Ja Hfln oli kuningas Israelissa, 
kun kansan pflflmichet kokoonluivat 
ynnfl Israelin sukukuntain kanssa. 

0. „Huben elflkfldn. ja fllkflOn kuol- 
ko; fllkdOn hflnen kansansa olko vfl- 
hfllukuinen.*' 

7. Tflmfl on Juudalle siunaus: ja 
hfln sanoi: „kuu]e, Herra, Juudan 
flflntfl, ja johdata hflnlfl kansansa 
tyk6; ja hflnen kfltensfl sotikoon sen 

guolesta; ole .sinfl hflnen apunsn vl- 
ollisiansa vaslaan.** iMoos. 49:Ss. 

8. Ja hfln sanoi Levistfl: „tflydelll- 
syytesi ja valkeute^i oikoon sniun 
pyhfln miehesi lykflnfl.jota sinfl kiu- 
sasit Massassa.ja nuhtclit riilavedcn 
tyk5nfl ; 2 Moos. 23:30. 17:7. 4 Moos. 20:13. 

9. joka sanoo isflllensfl ja aidillen- 
sfl: ,en minfl nfle hcitfl;* eikfl tunne 
vejjiflnsfl.eikfl liedfl pojisfansa, vann 
he pitflvflt sinun sanasi, ja kfllkevflt 
sinun Tiittosi; 

10. he opettavat sinun oikcuksiasi 
Jaakobille ja Israelille sinun lakisi, 
he kantavat suitsulusta sinun ne- 
nflsi eteen, ja kaikkinaisct uhrit uh- 
raavat sinun alttarillasi. 

11. Siunaa, Herra, hflnen voiman- 
sa, ja anna hflnen kflttcnsfl tyd si- 
nulle kelvaia; riko heidfln lanleen- 
sa, jotka karkaavat hSn^ vastaan 
ja hflnlfl vihaavat, niin etteiyflt he 
voisi enflfi nousla.** 



215 



5 MOOS. 33. 34. 



12. Ja Bcnjaniinillesanoi hSn: ,,Hcr- 
raii rnkaslama asukoon turvalliscsli 
hfiiicn tykOnnnsS; h5n suojelcc h^n- 
ta kaiken pHiviln, ja h9n asuu hd- 
nen kukkuloittensa vaiill9.** 

13. Ja hi&n sanoi JoscHsIa: „hdnen 
maansa olkoon siunatlu Herrnlta, 
parhailla taivaan hede1mill3, kas- 
teella ja syvyj'den hcdclmillfi, joka 
maan alia makaa, i Moos. 49.23. 

14. ihanimmilla aurlngon hedel- 
millcl ja Ihanimmilla kuitteu tuol- 
teilla, 

15. ja ikulstenvuorlenkalliimmilla 
ja ijaisten kukkulain parhailla he- 
delmilin. 

16. ja kalliimmllla maan hcdelmilia, 
ja sen kyllyydellH Hnnensuosionsu, 
joka asuu pensaassa, tulkoon Jose- 
fin pddn pHAlleJa nasirin pAHnlaclle 
veljeinsH keskellS. iMoos 49:2S. 

2 Moos. 32. Ap 1 7:3a 

17. Ja hdncn kauncutensa olkoon 
niinkuin esikoiscn hArj9n, ja hSnen 
sarvensa niinkuin yksisarvisen sar- 
vet, joilla h5n kansaa kuokkil yh- 
teen, hamaan muailman 3:lriin asti; 
namat oval Efraimin kymmcnen 
luhatta, ja nftmii Manasscn tuhan- 
net." 4 Moos. 2352. 

18. Ja hnn sanoi Sebulonlsia- „iIoil- 
sc, Sebulon, sinun uloskfiydessilsi, 
ja sinH Isaskar, niajoissasi.' 

19. He kulsuvat kansoja vuorelle. 
ja siellii vanhurskauden uhria uh- 
raavat; sillH he imevjll mcren kyl- 
lyyden ja santaan kaiketyt lavarat." 

20. Ja h{\n sanoi Gadista* ^siunat- 
lu olkoon so, joka levitldft Gadin, 
h9n asuu niinkuin hotkajalopeura, 
ja raastaa seka k5sivarren ettft paSn- 
laen. 

21. Ja hSn katsoi ifsellcnsfi ensim- 
mfiisen osan niaasta, etta hSn siina 
lainopettajalla annetussa osassaolisi 
suruton; kuitenkin tuli hdn kansan 
panmiestcn kanssa, ja teki Hcrran 
vanhurskaulta, ja hSnen oikeutensa 
Israelin kanssa.'* 

22. Ja Danista sanoi hSn* „Dan on 
jalopeuran pcnikka, joka karkaa 
Basanisla.*' 

23. Ja Naflalista sanoi hSn: ^Naf- 
tali! armolla ravillu, ja Idyletly Her- 
ran siunauksella; omisia ISnsl ja 
ateia.*' 

24. Ja Asserista sanoi han. ,,Asscr 
olkoon siunatlu pojilla; han olkoon 
veljillensa olollincn, ja kastakoon 
jalkansa 51jyyn. 

25. Rauta ja vaski olkoon sinun sal- 
pasi; ja niinkuin sinun ikasi, niin 
olkoon voimasi.'* 

^. j>i ^ksikaan olc niinkuin Israe- 



lin Jumalajoka istuu taivaassa,han 
olkoon sinun auttajasi.ja hanenkun- 
niansa on pilvissai Ps. 104:3. 

27. Turvanasi on Jumala ijankaik- 
kincn ja tukeenasi katoomattomat 
kasivarret. Han ajaa ulos viholliscsi 
cdestasi,ja sanoo: hukuta hcidat! 

28 Israel asuu Icvollisesti yksinan- 
sa, ja Jaakobin silma katselee siia 
maata, jossa jyvia ja viinia on, sii- 
hen myOs taivaat kastetia vuodatta- 
vat. Jer.23:C. 33:16. 

29. Autil^ olet sina, Israel: kuka 
on sinun kaltaisesi? Oi sina kansa, 
joka Herrassa autuaaksi tulet, joka 
on sinun autlava kilpesi ja kunnia- 
kas miekkasi' Vihollisesi liehakoit- 
sevat sinun edessasi« ja sina astelet 
hcidan kukkulainsa paaiia. 

34 Luku. 

Mooseksen kuolenia. 

Jn Mooses astui Moabin kedoilla 
ylOs Nebon vuorelle, Pisgan kuk- 
kulalle, joka on Jerikon kohdalla; 
ja Herra navtti handle koko Gilca- 
din maan Daniin asti, 

6 Moos. 3:27. 32:49. 

2. ja koko Naflalin ja Efraimin ja 
Manasscn maan, ja koko Juudan 
maan vilmeiseen mereen asti, 

5 Moos. 11.24. 

3. ja ef%ia-maan, ja Jerikon, Palmu- 
kaupungin lakcuden, hamaan Son- 
riin asti. Tuom.i:l6. 2 Aik. 28:1.".. 

4. Ja Herra sanoi hanelle: ,,tama 
on se maa,jonka minaAhrahamille, 
Isaakillc ja Jaakobille talalla lupa- 
sin ja sanoin: ,mina annan sen si- 
nun siemcnellesi ;* sina sail sennah- 
da silmiliasi, vaan et sina sinne tu- 
le." 1 Moos. 12:7. 13:15c 15:18. 26:3. 28:13. 

5. Ja Mooses, Herran palvelija, kuo- 
li sielia Moabin maalla, Herran sa- 
nan mukaan. 

0. Ja Han hautasi hanet laaksooii, 
Moabin maalla, Bet-Peorin kohdal- 
la. Eika olc yksikaan saanut tietfia 
hancn haulaansa tahanpaivaanasti. 

Juud. V 0. 

7. Ja Mooses oli kuollessaan sadan 
ja kahdenkymmenen ajastaikainen; 
ei hanen silrnansa olleet pinienncet, 
eika hanen ciamdnsa neste lakas- 
lunut. 3 Moos. 312. 

8. Ja Israelin lapset itkivat Mooses- 
la Moabin kedoiila kolmekymmen- 
ta paivaa: ja ilku- ja valituspaivat 
Mooseksesta paailyivat. 4 Moos. 2029. 

9. Mutta Josua, Nunin poika, oli 
taytetty vii.sauden hengclia, silia 
Mooses oli katensa laskenut hflnefi 
paaUensa; ja Israelin lapset o]|vat 



;216 



5 MOOS. 34. JOSUA 1. 



kuuliaiset hfinelle, ja tekivfit niin- 
kuin Herra oli Moosekselle k&ske- 
nyt. i Moos. 27 :18. 5 Moos. 1 -.88. 31 .-23. 

10. Ja sitten ei yhtikSn profettaa 
noussut Israelissa Mopseksen ver- 
taisfa, jonka Herra tunsi kasvoista 
kasvoihin, 

11. kaikkinaisissa tunnustShcJeissfi 



ja ihmcissS, joita Herra hfineti 1ft- 
helti tekemdfin Egyptin maalla Fa- 
raolle la kaikille ndnen palvclijoil- 
lensa, koko hdnen maallcnsa, 
12. ja kaikes.sa vSkevfissft kftdessfi, 
ja kaikissa suurissa, peljflttftvissfi 
tOissd, jotka Mooses teki koko Israe- 
lin silmdin edessfi. 



JOSUAN KIRJA. 



I Luku. 

Hena kSskee Josuan menemSftn yli Jor- 
danin Ja robkaisee b&nt&. 

la tapahtui Mooseksen, Herran pal- 
" velijan , kuoieman jSlkeen , eltfi 
Herra puhui Josualle, Nunin pojal- 
le, Mooseksen palvelijalle , sanoen * 
2 Moos. 24:13. 83:11. 4 Moos. 1128. 27:18. 

5 Moos. 1*38. 

2. „Minun palvelijani Mooses on 
kuoilut; niin nouse nyt ja mene td- 
mSn Jordanin ylitse, sinftja kaikki ta- 
ma kansa, siihen maahan, jonka mi- 
D3annanlsraelinlapsille. 5 Moos. 34:5. 

3. Jokaisen paikan, johon jalkanne 
astuvat, annan minA teille, niinkuin 
minS plen Moosekselle sanonut. 

5 Moos. 11:24. Jos. 14:9. 

4. Rorvesta ja IHstft Libanonista 
suuren Fratin virtaan asti, koko He- 
UlSisten maa, hamaan isoon mereen 
asti 13nteen p§in, ovat teid5n maan- 
ne rajal. 2 Moos. 23*31. 4 Moosl 34 :2 s. 

5. Ei kukaan vol sinua vaslaan sei- 
soakokoelinaikanasi: niinkuin mi- 
nil olin Mooseksen kanssa, niin olen 
inin3 sinunkin kanssasi; en minS 
hylkSdr sinua, enkS luovu sinusta. 

6Moos.'31A Hebr. 13:5. 

6. Olerohkia javahvista itsesi.silla 
sinS olet jakava t^Ile kansallc sen 
maan, josta min3 vannoin lieiddn 
Isillensd, sen heille antavani. 

5Moos. 31:23. Jos. 19:51. 

7. Ole vaan rohkia ja aivan vahva, 
varoen, ettd teklsit kaiken sen lain 
mukaan, jonka Mooses, minun pal- 
velijani, sinulle kdskl ; filA siitii har- 
haile oikialle eikil vasemmalle puo- 
lelle, em toimellisesti tekisil kai- 
kissa teissSsi. 5Moos. 5:32s. 17:1 1,20. 

28:14. 29:9. Jos. 23:6. 

8. Alk5dn tftmft lakiraamnltu inh? 
tekd suustasi pois, vaan ajallele si- 
19 ydt pdivSt, varoen, elhl tekisit 
s^n mukaan, miia siinft on kirjoi- 
leltu; sillfi niin sinS menestyt teis- 
sdsi, ja teel tyOst toimellisesli. 

5M008. 17.19. Ps. 1:2. 



9. EnkO minft kftskenyt sinun olla 
rohkeana ja vahvana? Alfl pelkfift, 
ftlftkA hfimmftsty, silI5 Herra, sinun 
Jumalasi, on sinun kanssasi kaikis- 
sa teissftsi.** 1 Sam. 10:7. 

10. Silloin kSski Josua kansan pdd- 
miehiif, ja sanoi: 

11. „KllykAfit leirin Iftpitse ja kl\s- 
kekdftl kan.saa, sanoen: valmisla- 
kaa( itsellenne evSstS, sillS kolman- 
nen pdivdn perSsta pitlift teidflnkfty- 
m^n tdmdn Jordanin ylitse, mennfik- 
senne valloiltamaan sitii maata, jon- 
ka Herra, teidSn Jumalanne, teille 
antua omistettavaksenne.^* Jos. 3:1 s. 

12. Ja Josua puhui Rubenilaisille, 
Gadilaisille ja puolelle Manfi^sen su- 
kukunnalle, sanoen: 

13. „Muislakaat se sana, kuin Moo- 
ses, Herran palvelija, (eille kdski, 
sanoen: ,Herra, leiddn Jumalanne, 
on saattanut teidftt lepoon, ja anta- 
nut teille Idmiin miaan.* 

4 Moos. 3220 s. 5 Moos. 3:18 s. 

14. JfittSkfiSt vaimonne,^ lapsenne 
ja karji^nne siihen maahan, jonka 
Mooses teille antoitdllH Ruolella Jor- 
danin. Mutta kdykHatveljeinneedel- 
Id varustcltuna, kaikki jotka vahvat 
miehet olette, ja autlakaat heilil, 

15. siksi etta Herra teidAn veljillcn-, 
ne anlua levon, niinkuin teillenkin, 
ettu hekin omistaisivat sen maan, 
jonka Herra, leiddn J umalanne, heil- 
le antaa; sittepalatkaatomaileniaal- 
lenne ja omistakaat se, jonka Moo- 
ses, Herran palvelija, teille antoi, 
taihl puolella Jordanin, auringon 
nousuun pdin.** 

16. Ja he vastasivat Josualle, ja sa- 
noivat; „kaikki mita meille kaske- 
nyt olel, sen me teemme, ja kuhun- 
ka ikdna lahetfit meiddt, sinne me 
menemme. 

17. Niinkuin me plemme olleet 
Moosekselle kaikissa kuuliaiset, niin 
me myds olemme sinulle kuuliaiset; 
ainoastaan oikoon Herra. sinun Ju- 
malasi, kanssasi, niinkuin hdn olt 
Mooseksen kanssa. 



217 



JOSUA 1. 2. 



18. Jokainenjokaaseltuusinunsuu- 
tasi vaslaan. eikfi ole kuulinincn sa- 
noillesi kaikissa miia kSsket, hSncn 
pituS kuoleman ; ole vaan rohkia, ja 
vahvista itscsi.** 

2 Luku. 

Vakoojat IfthetetMn. Raliab kiitkee beidUt. 

J a Josua, Nunin poika, IHhetti sa- 
laisesti kaksi vakoojaa SiMimisia, 
sanoen : ,.TnenkS.^t ja katsclkuat maa- 
la ja Jerikoa." Niin he inksivfll mat- 
kaan, ja tulivat porton huonceseen« 
jonka nimi oli Hahab, ja lep&siv5t 
sielia. 4Moos.25:l. Hebr.ll:31. Jank.2:25. 

2. Mutta Jerikon kuninkaalleilmoi- 
tetliin, ja sanottiin: ,.katso, tAnii yd- 
n& tuli tnnnc niiehiA Israelii! lap- 
sista, vakoamaan maata.*' 

3. Niin inhetti Jerikon kuningas 
Rahabin tykd, sanoen: ,Juo ulos ne 
miehet, jotka tulival tykdsi, sinun 
huoneeses, silia he oval tulleet va- 
koamaan koko maata.** 

4. Mutta nainen otti molemmat mie- 
hel ja kiilki heidnt; ja hAn sanoi 
ndin: „miehet tulivat minun t^'ko- 
ni,enkaniinntietdnyl.niistiiheolivat, 

5. ja kun portti pimeHssA pantiin 
kiinni, niin Iftksiv&t miehet ulos, 
enka ticdn, mihin he menivat. Aja- 
kaat nopiasti heita takaa, niin saatte 
heiddt kiinni/' 

6. Mutta hfin oli kAskenyt heidiin 
astua katon pdAlle, ja oli peitttlnyt 
heidnt pellavain varsilla. jotka hiln 
oli hajoittanut katon pHalle. 

7. Ja miehet ajoivat heitS takaa, 
Jo'rdanin tiettl, hamaan luotuspaik- 
kaan; ja portti pantiin kiinni koh- 
ta, kuin he ISksivdt, jotka heita ajoi- 
vat takaa. 

8. Mutta ennenkuin miehet panivat 
maata, meni hfin katolle heidfln ty- 
kfinsS, 

9. ja sanoi miehille: „minS tied5n, 
ettfi Herra antaa teille tSmSn maan; 
silia teidfin pelkonne on langennut 
meiddn pdailemme, ja koko maan 
asuvaiset oval hflmmdstyneet teidiin 
edessfinne ; 2 Moos. 15:14 s. 23:27. 

5 Moos. 11:25. Jos. 5:1. 

10. sillft me olemme kuulleet, kuin- 
ka Herra kuivasi Punaisen meren 
vedet edestdnne Idhteissfinne Egyp- 
tistfl, ja mit& te olette tehneel nlille 
kahdelle Amorilaisten kuninkaallej 
jotka olivat tuolla puolen Jordanin, 
Sihonille ja Ogille, jotka te tapoitte. 

2 Moos. 1421 8. 4 Moot. 21 -34. Jos.423. 

11. Kun me sen kuulimme* niin 
sydfimmemme raukesi, eikd ole yh- 
delldkddn robkeutta teiUAn edessdn- 



ne; sillft Herra, teidiin Jumalanne, 
on Jumala yIhA51lil taivaissa ja al- 
haalla maassa. 6 Moos. 4:39. Jos. 5:1. 

Ps. 135:6. 

12. Niinvannokaat nytminuUeHer^ 
ran kautia, koska mind osoitin lau- 
peuden teitii kohtaan, ettA te myos 
osoitatte laupeutta isiini huoneellc, 
ja annatte minuUe varman merkin, 

Jos. 6:22. 

13. ettn eldrnddn jntntte minun isil- 
ni, ja dilini, ja veljeni, ja sisareni, 
ia kaikki, jotka' heidnn omansaovat, 
javapahdattesielummekuolemastat* 

14. Ja miehet sanoivathanelle: „sl(^• 
umme kuolkoot teidan edestdnne, 

, OS ette petil t5t9 nieidAnasiatamme; 
(un Herra antaa tnm5n maan nieil- 
le, niin me osoitammc sinulle lau- 
peuHa ja uskollisuutta.*' 

15. Ja hHn laski heidtlt kdydellA ak- 
kunasta alas; sillil hiinen huoncen* 
su oli kaupungin muurissa, ja hSn 
asqi.juuri muurissa. 

10. Ja han sanoi heille: ^menkHAt 
vuorelle, eltei nc teitfi kohtaisi, jot- 
ka teitS ajavat takaa, ja oikaat siellil 
lymyssH kolmc pilivaa, siksikuin tn- 
kua-ajajat puIajavat,jamenkSdt sitte 
tietdnne.'^ 

17. Ja miehet sanoivat hSnelle : ,,me 
tahdomme kuitcnkin olla vapaat 
tnstd valastasi, jolla meitfi vanhotit. 

18. Katso, kun me maahan sisSUe 
tulemme, niin sinun pitdd ripustn- 
man tamdn punaisen kdyden akku- 
naan, josta meldDt laskit alas, ju ko- 
koa tykdsi huonecseen isSsi ja iiitisi 
ja vefjesi ja koko isfisi huonc. 

19. Jo^ joku kSy huoneesi ovesia 
ulos, hdnen verensd olkoon hflnen 
pHdnsA piiAUd, ja me olemme viat* 
tomat ; ja joka ikdna sinun kanssa* 
si huoneessa on, hAnen verensS ol- 
koon meidan pSAmme pAdllii, jos 
jonkun kdsi hSneen sattuu. 

Matt. 27t2b, 

20. Mutta jos sind petSt tdmdn mci- 
ddn asiamme, niin me olemme va- 
paot sinun valastas, jolla olct mcitA 
vannottanut.'* 

21. Hiln vastasi: ^olkoon niinkuin 
te sanotte,'' ja pdflsti heidAt niene- 
mSdn; ja he menivSt pois. Ja hfln 
ripusti punaisen kdyden akkunaan. 

22. Ja ne menivHt poi.s, ja tulivat 
vuorelle, ja olivat siellfi kolme pHI- 
vfiS, siksi kuin nc olivat palannecl, 
jotka heitS ajoivat takaa; sfllil takaa- 
ajajal olivat heitft etsineet kaikiUa 
teillA, eivfttka Idytdneet. 

23. Ja ne molemmat miehet pala- 
sivat, ja astuivat vuorelta alas, me- 
nivfit yUtse, ja tulival Josuan, Mu* 



2ia 



JOSUA 2. 3. 4. 



nin pojan, tyk5 : ja he kertoivat hfi- 
nelle kaikki, mitfi heille oli tapah- 
tunut. 

24. Ja he sanoivat Josualle: „Her- 
ra on antanut kfisiimme kokomaan, 
slIlAkaikki maanasuvaisetovat hSm> 
mastyneet meid&n edessamme/' 

3 Luku. 

Israelin kansa k&y Jordanin yli. 

Ta Josua nousi aamuUa varhain.Ja 
^'he Ifiksivfit Sittimistft ja tulivat 
Jordaniin asti, hfin ia kaikki Israe- 
lin lapset; ja he olivat siinA y6tfi, 
ennenkuin he menivfit ylitsc. 

4Mo08.25:l. Jos. 2:1. 

2. Ja tapahtui kolmen p5iv&n pe- 
rfistfi, elta p&amiehet meniv&t leirin 
mpitse, 

3. jakSskivStkansaa,sanoen: „kun 
te nSette Herran, teidAn Jumalan- 
ne, liiton arkin, ja Levilfiisel papit 
kantavan sii5, niin IfihtekSfit tekin 
sijaltanne ja seuratkaat hfintft, 

4. kuitenkin niin, ettft teid&n ja sen 
vfilillfi on liki kahden tuhannen kyy- 
nArftn matka; filkfiftt tulko sitfi 1ft- 
hemmfiksi^etta te tietfiisittetienjota 
teidfin pitftS matkustaman ; sillfi et- 
te ennen ole sitft lielfi vaeltaneet.'' 

5. Ja Josua sanoi kansalle: ,,pyhit- 
tdkdilt itsenne.silia huomenna tekee 
Herra ihmeellisift t6ita teid&n kes- 
wUflnne.'* 2Moos.l9:10,l4. 

6. Ja Josua puhui papeille,8anoen : 
nditakaat liiton arkki, ja menkSftt 
kansan edellft.*' Niin he ottivat lii- 
ton arkin, ja menivftt kansan edel- 
ij' 4 Moos. 4:16. 

7. Ja Herra sanoi Josualle : „t&nft- 
pSnS rupean minft tekemSftn siuut 
suureksl koko Israelin edessft, cttft 
ne tietfiisivfit, ettft niinkuin minft 
olin Mooseksen kanssa, niin mlnft 
olenmyGs sinun kanssasi . Joa. i :5. 4 :14. 

8. Ja k&ske papp^a, jotka kantavat 
uiton arkkia, ja sano : kun te tulette 
Jordanin vetten ftftreen, niin seisah* 
tnkaat Jordanissa/* 

9. Ja Josua sanoi Israelin lapsille: 
H^stukaat tftnne, jakuulkaat Herran» 
teidftn Jumalanne, sanaa/^ 

JO. Ja Josua sanoi: „tftsta tietftkfiftt 
wftn Jumalan olevan teid5n kes- 
keUftnne ja ettd h&n varmasti ajaa 
pois teidfln edestftnne Kananealaiset, 
HetiUUset, Hevilftiset, Feresiiaiset, 
pergesilftiset, Amorilaiset ja Jebusi- 
laiset: 

11. Katso, koko maailman hallitsi- 
JSQ liiton arkki menee Jordaniin 
tddftn edellilnne. 

12. Niin valitkaat nyt kaksitoistii 



miestii Israelin sukukunnista, jokai- 
sesta sukukunnasta yksi mies. 

^os. 4:2 8. 

13. Ja on tapahtuva, ettft kun pap- 
I>ein jalkapOy tft, jotka kantavat Her- 
ran, kafken maailm&n hallitsijan^ 
arkkia, tulee Jordanin veteen. niin 
se vesi, joka Jordanissa ylft puolelta 
juoksee, croitetaan, niin ettft se sei- 
soo yhdessft Iftjilssa." Ps. ii4:3. 

14. Ja kun kansa Iftksi majoistansa 
meneniftftn Jordanin ylitse, ja papit 
kantoivat liiton arkkia kansan edel- 
la, Ap. t 7:45. 

15. ja kun arkin kantajat tulivat 
Jordanillc, ja pappein. arkin kan- 
tajainjalat peittyivat veden reunaan, 
— mutta Jordan oli tftj^nnd partaa- 
sen saakka koko elonajan -, 

1 Aik. 12:1S. 

16. niin seisahtui se vesi, joka ylft- 
puolelta iuoksi; se seisoi koottuna 
yhdessa Ifijfissa kaukana Adamin 
kaupungin puolessa, joka on Sar- 
tanin luona; mutta se vesi, joka 
juoksi alas korven mcreen, Suolai- 
seen mereen, vfiheni ja juoksi pois. 
Niin meni kansa ylitse Jerikoa Koh- 
den. 

17. Ja papit, jotka kantoivat Herra n 
liiton arkkia« seisoivat kuivalla alal- 
lansa, keskellft Jordania; ja koko 
Israel kftvi kuivaa niyOten sen Ift- 
pitse, siksi kuin kaikki kansa tuli 
Jordanin ylitse. 

4 Luku. 

Kaksitoista kiveft Jordanissa ja Gilgalissa. 

J a kun koko kansa oli tullut Jor- 
danin ylitse, puhui Herra Josual- 
le, sanocn: 

2. „ Valitkaat kansasta kaksitoista 
niiesta, jokaisesta sukukunnasta yk- 
si mies, Jos. 3:12. 

3. ja kftskekaat heita, sanoen: ,ot- 
takaat keskeltft tfttft Jordania, siitft 
paikasta, jossa pappein jalat seisoi- 
vat alallansa, kaksitoista kiveft, ja 
viekaat ne mydiannc ylitse, ja aset- 
takaat siihcn paikkaan, jossa te ta- 
na ydna pidatte majaa.** 

4. Niin kutsui Josua kaksitoista 
miesta, jotka han oli maarannyt Is- 
raelin lapsista, jokaisesta sukukun- 
nasta yhden miehen. 

5. Ja Josua sanoi heille : „menkaat 
Herran, teidftn Jumalanne, arkin 
eteen keskelle Jordania, ja jokainen 
nostakoon yhden kiven oIalIensa» 
Israelin lasten sukukuntain luv4ia 
mukaan, 

6. etta ne olisivat merkiksi teidan 
keskelianne, kun lapsenne tastedes 



219 



JOSUA 4. 5. 



kysyvftt ja sanovat : ,mit5 nfima ki- 
vel teillfl?* 2 Moos. 1226 s. I3:ii. 

5 Moos. 6.20 s. 

7. ettft silloin sanoisitte heille : ,Jor- 
danin vcsi jakauiui Herran liiton 
arkin edestd; sen mennessd Jorda- 
nln ylitse jakautui Jordanin vesi; 
ja nHm^ kivcl oval Israelin lapsille 
ijankaikkiseksi muistoksi.'' 

Jos. 3:13,16. 

8. Ja Isnielin lapsel tekivfll niin- 
kuin Josua hcitd kaski, ja knntoivat 
kaksitoista kivei) kcskclUl Jordania, 
niinkuin Herra oli JosuuIIc sanonut, 
Israelin lasten siikukuntain luvun 
mukaan, ja he veivfil nc ylilse my6- 
tnnsd yOsijaan asti , ja panivat ne 
siihen. 

9. Ja Josua pystylti niy5s kaksitois- 
ta kivea keskclm Jordania, missA 

f^appein jalat seisoneet olivat, jotka 
iiton arkkia kantoivat; ja ne oval 
sielin tahnn paivniin asti. 

10. Ja papit, jotka arkkia kantoivat, 
seisoivat keskelia Jordania, siksi 
kuin kaikki toimitettiin, mitii Herra 
kdski Josuan kansalle sanoa, kaiken 
sen mukaan, mita Mooses Josualle 
kHskenyt oli ; ja kansa k&vi kiirees- 
ti ylitse. 

11. Kun koko kansa oli kHynyt vlit- 
se, mcni my5s Herran arkki ylitse, 
ja papit knnsan eteen. 

12. Ja Ruhenilaiset ja Gadilaiset ja 
puoli Manassen sukukuntaa kAvivHt 
ascincnsa Israelin lasten edelhl, niin- 
kuin. Mooses heille sanonut oli. 

4 Moos. 32:29. 

13. Liki nelj^kymmentS tuhatta so- 
taan varustettua kHvi Herran edellii 
sotaan Jerikon kedoille. 

14. Sin5 pHivAnft teki Herra Josuan 
suureksi koko Israelin edessA ; ja he 
pelkasivDt hnntd. niinkuin he pel^ 
K^sivSt Mooscsta koko heidiin elin- 
aikanansa. Jos. 3:7. 

15. Ja Herra puhui Josualle, sa- 
noen. 

16. ,,K5skc pappein, jotka kantavat 
todistuksen arkkia, astua Jordanis- 
ta ylfis.'' 

17. Niih kaski Josua pappeja, ja 
sanoi: ,.astukaat yl6s Jordanista.*' 

18. Ja Kun papit, jotka Herran lii- 
ton arkkia kantoivat, astuivat Jor- 
danista yl5s, ja pappein jalat nou- 
sivat kuivalle maalle, niin tulivat 
Jordanin vedet paikoilIensa,ja juok- 
sivat niinkuin ennenkin kaikkein 
ayrSitlensa yli. 

19. Ja kansa astui Jordanista yids 
ensimmaisen kuun kymmencntena 
paivanfi, ja he sijoittivat itsensa Gil- 
galiin, Jerikon iia-mjalla. 



20. Ja ne kaksitoista kivea, jotka 
he ottival Jordanista, pystytti Josua 
Gilgalissa. 

21. Ja han puhui Israelin lapsille, 
sanoen: „kun teidan lapsenne ta.st- 
edes kysvvat isiliansa, ja sanovat: 
,niiia nama kivel?* 

22. niin antakaat las'tenne tietaa, sa- 
noen: , Israel kavi kuivaa mydtcn 
Jordanin ylitse, 

23. kun Hcrrn, teiddn Jumalanne, 
kuivasi Jordanin vedet teidan edes- 
tannc, siksi kuin te kavitte sen ylitse, 
niinkuin Herra, teidan Jumalanne, 
teki Funaisessa meressa, jonka han 
kuivasi meidan edcstamme, siksi 
kuin me kavimme sen ylitse; 

2 Moos. 14.-21 s. 

24. etta kaikki kansat maan pSSLllft 
tuntisivat Herran kaden, kuinka va- 
keva se on, etta pelkaisitte aina Hcr- 
raa, teidan Jumalaanne." 

5 Luku. 

Israelii! lapset ymparileikataan. Paasifiistft 
pidet&Mn. Manna lakkaa. 

Kun kaikki Amorilaisten kunin- 
kaat, jotka toisella.,puolella Jor- 
dania lanteen pain asuivat, ja kaik- 
ki Kananealaisten kuninkaat nieren 
tykdna kuulivat, etta Herra kuivasi 
Jordanin vedet Israelin lasten eteen, 
siksi kuin ke kavivat sen ylitse, niin 
hcidan sydammensa rankest, eikft 
ollut heissa enaan mitaan rohkeut- 
ta Israelin lasten edessa. 

Jos. 2:9, 11, 24. 

2. Siihen aikaan sanoi Herra Jo- 
sualle: ,,tee itsellesi kiviveitset, ja 
ymparileikkaa taas Israelin lapset 
toisen kerran.** 2 Moos. 4:25. 

3. Niin teki Josua itsellen.sa kivi- 
Neitset, ja ymparileikkasi Israelin 
lapset Anilotin kukkulalla. 

4. Ja tama on syy, jonka tahden 
Josua ymparileikkasi heidat: kaik- 
ki se kansa, joka laksi ulos Egyp. 
tista. miehenpuolet, kaikki sotamie-- 
het, kuolivat tielhl korvessa, mat- 
kustaessansa Egyptista. 

5. Silia kaikki kansa, jotka ISksivftt 
ulos, olivat ymparileikatut; mutta 
kaikki se kansa, joka korvessa syn- 
tyi matkalla, .sen jaikeen kuin oli- 
vat laiiteneet ulos Egyptista, ei ol- 
lut ymparileikattu. 

6. Silia Israelin lapset vaelsivat nel- 
jakymmenta ajastaikaa kor\'essa, 
siksi kuin kaikki sotamiehet, jotka 
Egyptista lahteneet olivat, kuolivat, 
koska eivat kuulleet Herran aantft, 
niinkuin Herra oli heille vannonut, 
ettci heidau pitanyt nakeman sitA 



220 



JOSUA 5. 6. 



maata, jonka derra valan kautta oli 
heidSn isillensA luvannut, antaak- 
sensa meille maan , rieskaa ja hu- 
najata vuotavan. 4 Moos. 14:21 8.,28 s. 

7. Mutta heiddn lapsensuJotkaH&n 
herfttti heidfin sijaansa, ympftrileik- 
kasi Josua; sIWSl heillfi oli esinahka, 
eivitkft oll6et ympfirileikalut mat- 
kalla. 

8. Ja: kun koko kansa oli ympfiri- 
leikattu, pvsyivftt he alallansa lei- 
riss9 siksi Kuin he paranivat. 

9. Ja Herra sanoi Josualle: „tftnft- 
pSnS oleiv minft teistfi kflfintfinyt 
pois Egvptin hfivftistyksen;'' ja se 
paikka kutsutaan Gilgal t&h&a p&i- 
vflftn asli. 

10. Ja kun Israelii! lapset olivat si- 
joiftuneet Gilgalissa, pitivfit he pAfi- 
siSista nelj3ntenStoista pflivftnfi sinfi 
kuukautena, illalla, Jerikon kedol- 
la, 2M008. 12.*28.,148. 4M008.9'^ 

11. ja sOivSt sen maan jyvistll tol- 
sena pfifisifiis-pSivftnd, happamat- 
tomia leipia ja korvennettigA tfih- 
kSpiUtS, juurl sinft pfiivfinft. 

8M0O8. 2;14. 23:14. 

12. Ja manna lakkasi toisena pfii- 
vSna, sittekuin he olivat sydneet 
maan jyvistS. niin etlei Israelin lap- 
silla endjl ollut mannaa, v^an he 
s6ivdt Kanaanmaan hedelmftstft si- 
nil vuonna. 

13. Ja tapahtui, kun Josua oli Ifl- 
hellS Jerikoa, nosti hftn silmfinsft ja 
katseli; ja katso, mies seisoi slellft 
hflnen edessSnsft, paljastettu miekka 
kfidessS; ja Josua meni hSnen ty- 
kOnsfi, ja sanoi hfinelle : „oletko si- 
nft meidfih vai vihamiestemme puo- 
lella?" * 2Moo8.23:23. 

14. Hdn sanoi: ,,en, vaan minfi o- 
len Herran sotajoukon pftflmies, ja 
olen nyt tuUut.'* Silloin Josua lan- 
kesi maahankasvoillensajakumarsi 
hflntS, ja sanoi hfinelle: „mitfi Her- 
rani sanoo palvelijallensa?'*Ps. 148:2. 

15. Ja Herran sotajoukon pfifimies 
sanoi Josualle: „riisu kengat jalois- 
tasi, sillfi paikka, jossa seisot, on 
pyhft." Ja Josua teki niin. 2 Moos. 8:5. 

6 Luku. 

Jerikon valloitus. 

Ta Jeriko oli suljettu ja visusti va- 
^ rustettu Israelin l^psia vastaan; 
ei kukaan kfiynyt ulos , eikfi tullut 
tisftfin. ^ 

2. Mutta Herra sanoi Josualle: „kat- 
80, minft olen antanut Jerikon, sen 
kuninkaan , ja vflkevftt sotajoukot, 
sinan kfiteesl.*' 

3. KfiykfiSt kaupungin ympftri, fcaik- 



ki sotamiehet, yksl kerta koko kau- 
pungin ympftn; ja tee niin kuusi 
pfiivfifi. 

4. Ja seitsemftn pappia ottakoot seit- 
semfin riemuvuoden pasunaa ark'in 
eteen ; ja seitsemfintenfipfiivfinfikfiy- 
k60t seitsemftn kertaa kaupungin 
ympfirija papitsoittakootpasunilla. 

5. Ja kun he soittavat nemuvuo- 
den pasunaa pitkfifin, ja te kuulette 
pasunan fifinen, niin nostakoon ko- 
ko kansa suuren fifinen ja huuta- 
koon ; ia niin kaupungin mtturi ha- 
joaa alallensa ja kansa astukoon 
sinne sisfifin , kukin suoraan eteen- 
pfiin." 

6. Silloin kutsui Josua, Nunin poi- 
ka, papit,ia sanoi heille: „ottakaat 
liiton arkki , ja seitsemftn pappia 
kantakoot seitsemftn riemuvuoaen 
pasunaa Herran arkin edellfi.** 

7. Mutta kansalle sanoi hfin: ,Jfih- 
tekfiftt matkaan ja kfiykftftt kaupun- 
gin ympftri, ja jotka oval sota-«seil- 
la varustetut, kfiykMt Herran arkin 
edellft." 

8. Ja kun Josua nftmflt oli kansalle 
sanonut, niin ottivat ne seitsemftn 
pappia seitsemftn riemuvuoden pa- 
sunaa, ja kftvivftt Herran arkin eael- 
1ft, ja soittivat pasunoilla; ja Herran 
liiton arkki seurasi heidfin jftlissftnsfi. 

9. Ja ne, iotka olivat sota-aseilla 
varustelut , kftvivftt pappein edellft, 
iotka soittivat pasunoilla ; mutta muu 
Kansa seurasi arkkia, pasunain ali- 
nomaa soidessa. 

10. Mutta Josua oli kftskenyt kan- 
saa, ja sanonut: „filkfiftt huutako, 
ftlkftftt antako ftftnenne kuulua, ftl- 
kQ5n Sanaa suustanne lfthtek6, sii- 
henpfiivflftn asti, jolloin minft sahon 
teille : ,huutakaat !' ; silloin nostakaat 
sotahuuto.*^ 

11. Ja niin kftvi Herran arkki kau- 
pungin ympftri, koko kaupungin 
ympftri yhden kerran ; ja he tulivat 
leinin, ja pitivftt yOtft leirissft. 

12. Ja Josua nousi huomeneltain 
varhain; ja papit kantoivat Herran 
arkkia. 

13. Ja ne seitsemftn pappia kantoi- 
vat seitsemftn riemuvuoden pasu- 
naa Herran arkin edellft, ja kftydes- 
sftnsft soittivat alati pasunaa; ja jo- 
kainen, joka oil sota-aseilla varus- 
tettu, kftvi heidfin edellfinsft, vaan 
muu kansa kft\'i Herran arkin jft- 
lissfi pasunain alati soidessa. 

14.Toisena pftivfinfi he kfivivfit my6s- 
kin kerran kaupungin ympfiri, ja 
tulivat leiriin jfilleen; ja sitft he te- 
kivfit kuusi pftivftft. 

15. Mutta seitsemftntenft pftivfinfi 



221 



JOSUA 6. 7. 



nOUSiVat hfe varhain aamuruskon 
koilfuessa ja kfwivat samalla tavalla 
scilsemnn kerlaa kaupungin ympji- 
ri : ja ainoasfaan sinti pUivilna kavi- 
vat he scitseman kertaa kaupungin 
y 111 pari. 

16. Ja scHsemannclla kerralla, kuii 
papit soilfivat pasunaa, sanoi Josua 
kansallc: ,,hiiutakaat, silla Hcrra 
on antanul teillc kaupungin! 

17. Mutia kaupunki ju kaikki, mi- 
tii siinH on, olkoon kirollu Hcrralle; 
ainoastaan portlo Rahah jaiikodn 
elaniaan, lisin ja kaikki, jolkaliiincn 
kanssansa huoneessa ovat, sillii hiin 
katki sanansaaltajat, jofka me liilie- 
timnie. Jos. 2:3s. Hi'br. 11:31. 

18. Ainoastaan karltakaat kirotlua, 
etietle tuotlaisi ilsellennekirouksen, 
jos le jolakin siila kirolusla olalle, 
ja saatatte Israelin leirin kirouksen ja 
onnellomuudenalaiseksi.a Moos. 27:28- 

11). Mulla kaikki liopia-ja kulla-, vas- 
ki-ja raula-kalul olkool Herralle piy- 
lYilelyl , ja tulkool Herran tavara- 
huoneesen." 4 Moos. 31:54. 

20. Ja niin kansa nosti sotaliuudon, 
ja pasunilla soilettiin. Kun kansa 
kuuH pasunanHancn^huusival kaik- 
ki suurella dSnell^, ja muurit hajo- 
sivat alallensa; ja kaikki kansa, ku- 
kin suoraan kohdallansa, astui kau- 
punkiin, ja he voittjvat kaupungin, 

2 Miikk. 12:15. Hebr. 11:30. 

21. ja hukultivat kaikki, jolka kau- 
pungissa o]ivat,miekan ter{ilin,seka 
miehet elta naiset, nuoret ja vanhal, 
karjan, ja lampaat ja aasit. 

22. Ja Josua sanoi niille kahdelle 
niiehelle, jotka olivat olleet maata 
vykoamassa: ,,menkaat sen porton 
huoneesen , -ja tuokaat vaimo sieltti 
ulos, ja kaikki, mitA hnnelin on, 
niinkuin te olette hSncIIe vanno- 
neel." Jos. 2:14. 

Zi. Niin menivnt nuorel niiehel, 
jotka maata oh'vat vaonncet. sinne 
ja toivat Hahahin ulos, ja h5nen 
isSnsa, ja i\itinsil, ja vcljensii, ja 
kaikki mita hAnelia oli, koko httnen 
sukunsa toivat he ulos; ja hesijoitti- 
vatheitUttulkopuolellelsraelinleiria. 

24. Mutta kaupungin he poltfivat 
tulclla, ja kaikki tiiita siellii oli; ai- 
noastaan hopian, kullan, vaski- ja 
rautakalut panivat he tavaraksi Her- 
ran huoneesen. 4M00.9. sirio. 

25. Mutta portto Hahabin, ja hdnen 
isi1ns§ huoneen ja kaikki, jotka sii- 
hen kuuluivat. antoi Josua ela3;ja 
h;ln on asunut Israelin keskelld tH- 
hiin paivfian asti, sent5h(1en eltA 
hiln katki sanansaaltajat, jotka Jo- 
sua Ifthetti Jerikou vakoamaan. 



26. Ja Josua vannoi, ja sanoi: ,,ki* 
rottu olkoon Herran edessH se mies, 
joka nousee ja rakentaa tiimtin Je- 
rikon kaupungih; kun hiin laskee 
siihen perustuksen, niin kadotta- 
koon esikoisensa, ja kun hiln ra- 
kentaa sen portit, niin kiidottakoon 
nuorimman poikansa.*' lKun.tn:34. 

27. Ja Ilerra oli Josuan kanssa, ja 
han tuli kuuluisuksi kaikissa niaa- 
kunnissa. 

7 Luku. 

Akanin varkaus. 

Mutta Israelin lapset oliv/it uskot- 
tomat kirotun kalun sulitecn; 
silla Akan, Karmin poika, Sabdin 
pojan, Serakin pojan, Juudan suku- 
Kunnasta, otti jotakin kirotusta, ja 
Herran viha syttyi Israelin lapsiin. 

•Jos. 22:20. 1 Aik. 2:7. 

2. Ja Josua Liihetti miehiil Jerikos- 
ta Ailiin piiin, joka on Betavenin hV 
hellii, itailn pain Betelistii, ja puhui 
heille, sanoen: ,,menkaal ja vako- 
kaat maa.**" H€ menivat ja vakosi- 
vat Ain. 

3. Sitte palasivat he jalleen Josuan 
tyko, ja sanoivat hnnellc: „51ii an- 
na koko kansan sinne mennil; lahes 
kaksi lahi kolme tuhatta miestil vol 
sinne menna ja ]y5diiAin,eUei kaik- 
kea kansaa hukkaan sinne vaivat* 
taisi; sillilheitS on vdhfin.'* 

4. Niin meni sinne kansasta liki 
kolmetuhatta miestll; mutta he pa- 
kenivat Ain kaupungin miesten e- 
dest5. 

5. Ja Ain miehet loivAt heistfl liki 
kuusineljiitlAkymmentli miestiij ja 
ajoivat heitS portin ulkopuolella ta- 
kaa Sabarimiin asti, ja ICivdt heltd 
sieI15 rinteellii. Silloin kansan syddn 
hiimmlistyi ja tuli niinkuin vesi. 

6. Ja Josua repiiisi vaatteensa, ja 
lankesi maahan kasvoillensa Her- 
ran arkin eteen hamaan iltaan asti, 
hdn ja Israelin vanhimmat; ja he 
heittivat tomua pilansA pi\iillc. 

1 Moos.- 37:34. lSnin.4:12. Est 4:1. 

Job. 1:20. 2:12, 

7. Ja Josua sanoi: ,,ah Herra, Her- 
ra, miksi annoit tdman kansan ol- 
lenkaan tulla Jordanin ylitse, an- 
taaksesi mcidat Amorilaisten kftsiin, 
hukuttaakses mcitil? joskaolisimme 
tyylyneet ja pj'sahtyneet sille puo- 
leii Jordania! 

8. Voi, minun Herrani,mif$ minun 
pitii5 sanoman, kun Israel selkfinsil 
kiii\nta5 vihollisillensa? 

9. Kun Kananealaiset ja kaikki 
maan asuvaiset sen kuulevat. niin 
he piiriuavftt meidftt, ja hiivittlivat 



222 



JOSUA 7. 8. 



nimemme maan pfidltft; mitfi siis 
leet suuren nimesi tfihden?** 

10. Niin sanoi Herra Josualle : „nou- 
se,iniksi sinfi makaat kasvoillasi? 

11. Israel on svntifi tehnyt, Ja rik- 
konut minun liittoni , jonka minfi 
kSskin heille ; ja ovat ottaneet siitft 
kirotusta, ovat varastaneet Ja valeh- 
delleet, ja panneet kaluinsa sekaan. 

12. Israelii! lapset eivflt vol seisoa 
vihamiestensfi edessfi, mutta kfidn- 
UlvSt selkfinsfi viholUsillensa ; sillfi 
he ovat kirouksessa. En minfi enfifi 
ole teidfin/kanssanne, ellette huku- 
ta siia kirottua teiddn keskeltfinne. 

13. Nouse, ja pyhitfi kansa ja sano : 
.pytiittfikSfit itsenne huomiseksi : sil- 
la niin sanoo Herra, Israeli n Juma- 
la: kirous on sinun keskelldsi, Is- 
rael, sentShden et sin3 ole seisovai- 
nen vihamiesfesi edessfi, siks! kuin 
te sen kirouksen siirrfitte pois kes- 
keltanne.* 2 Moos. 19:10. Jos. 3:5. 

14. Ja varhain huomeniia kfiykfifit 
edes sukukunnittain ; ja se suku- 
kunta, jonka Herra arvalla valitsee, 
kSykOOn edes perhekunnittain; ja 
se perhekunta, jonka Herra arvalla 
valitsee, kfiykOOn edeshuonekunnit- 
tain* ja se nuonekunta, jonka Herra 
arvalla valitsee, kfiykfiOn edeskukin 
perheenisfintfi toinen toisensa jfil- 
keen. 

15. Ja se, joka lOydctfifinryhtyneek- 
si kirottuun kaluun, pitfifi tulella 
poltettaman ja kaikki mitfi hfinellfi 
on, koska hfin Herran liiton on rik- 
konut ja tehnyt hulluuden Israelis- 
sa.'* 4M008. 15:30,35. 5 Moor. 13:158. 

16. Ja Josua nousi varhain hr.ome- 
nelfain, ja toi Israelin edes, toisen 
sukukunnan toisen jfilkeen ; ja arpa 
lankesi Juudan sukukunnalle. 

17. Ja kun hfin Juudan sukukun- 
nan toi edes, lankesi arpa Seraki- 
laisten perhekunnan pfifilie; ja kun 
h3n toi Serakilaisten perhekunnan 
edes, toisen perheenisfinnfin toisen 
j3Ikeen, lankesi arpa SabdiUe. 

1 Moos. 46:12. 4 Moos. 2f6.'20. 

18. Ja kun hfin toi edes hfinen huo- 
neensa miesluvun jfilkeen, niin lan- 
kesi arpa Akanin, Karmin pojan 
pSfiUe, Sabdin pojan, Serakin po- 
jan, Juudan sukukunhasta. 

19. Ja Josua sanoi Akanille : „poi- 
kani, anna Herralle, Israelin Juma- 
lalle, kunnia, ja anna hanelle ylis- 
tys,ja ilmoita ininulle, mitfi olet 
tehnyt, ja filfi salaa sitfi minulta.'* 

20. Silloin vastasi Akan Josuaa, ja 
sanoi: „totisesti minfi olen syntifi 
tehnyt Herraa, Israelin Jumalaavas- 
taan; nfiin oleh tehnyt: 



21. minfi nfiin saaliissa kalliin Ba- 
belin hameen, ia kaksi sataa siklifi 
hopiata, ja kultaisen kielen, joka 
painoi viisik]^mmentfi siklifi; niitfi 
teki mieleni, ja minfi olin ne; jakat- 
so, ne on kaivetut mauhan keskellfi. 
minun majaani, ja hopia alinna.** 

22. Niin Josua Ifihetti sinne sanan- 
saattajat, ja ne kiiruhtivat majaan ; 
ja katso, ne olivat kaivetut hfinen 
majaansa, ja hopia alinna. 

23. Ja he ottivat ne majasta, ja vel- 
vfit ne Josuan ja kaikklen Israelin 
lasten tyk6, ja panivat ne Herran 
eteen. 

24. Niin otti Josua ja koko Israel 
hfinen kanssansa Akanin, Serakin 
pojan, ja hopian, ja hameen, ja kul- 
taisen kielen, hfinen poikansa ja t>i- 
tfirensfi, hfinen hfirkansfi, aasinsa ia 
lampaansa, hfinen majansa ja kaik- 
ki mitfi hfinen omaansa oli, ja vei- 
vfit ne Akorin laaksoon. 

25. Ja Josua sanoi: y,miksi oletmei- 
tfi murheelliseksi saattanut? Herra 
on sinut saattava murheelliseksi tfi- 
nfipfiivfinfi.** Ja koko Israel kivitti 
heidfit kuoliaaksi , ja polttivat hei- 
dfit tulella, ja heittivfit kivifi heidfin 
pfifillensfi. 

26. Ja fTe tekivfit heidfin pfifillensfi 
suuren kiviroukkion, joka vielfi on 
tfihfin pfiivfifin asti. Niin lakkasi 
Herran vihan tuli. Siitfi kutsutaan 
se paikka Akorin laaksoksi tfihfin 
pfiivfifin asti. 

8 Luku. 

Ain kaupunkl valloitetaan. Alttari raken- 
netaan Ebalin vuorelle. 

J a Herra sanoi Josualle: „filfi pel- 
kfifi, filfikfi hfimmfisty; ota kans- 
sasi kaikki sotavfiki, ja nouse ja mc- 
ne ylds Aihin; katso, minfi olen an- 
tanut Ain kuninkaan kansoinensa, 
kaupunkinensa ja mainensa sinun 
kfiteesi. 5Moos. 121. 7:18. 20:3s. 31:3$. 
!2. Ja sinun pitfifi tckemfin Aille ja 
sen kuninkaalle, niinkutn sinfi teit 
Jerikolle ja sen kuninkaalle ; ainoasti 
sen saaliin ja karjan jukakaat kes- 
kenfinne. Pane nyt vfiijyjfit kaupun- 
gin taakse.** 5Moos. 20:H. Jos. 6:21,24. 

3. Silloin Josua nousi kaiken sota- 
vfien kanssa mencmSfin yI5s Aihin. 
Ja Josua valitsi kolmekymmentfi 
tuhatta vfikevfifi sbtamiestfi, ja Ifihet- 
ti heidfit yOllfi ulos, 

4. ja kfiski heitfi, sanoen: „kat.so- 
kaat, teidfin tulee vfiijyfikaupunkia, 
kaupungin takana; filkfifityldn kau- 
as menKd kaupungisla , ja olkaal 
kaikki valmiina. 

5. Ja minfi ja kaikki kansa, joka 



223 



:fOSUA 8. 



minun knnssani on, lAhcstymme 
kaupunkia. Ja kun he tuleval ulos' 
meitd vastaan niinkuin cnncnkin, 
niin me pakenemmc heidHn edel- 
IfinsA, Jos. 7:5. 

6. ettA he tulisivat mciddn jAlkeem- 
me niin kauas, ettiV snisimme hei- 
dAt eroitctuksi kaunungista; silhlhc 
Ajattclcvat: ,he pakenevat meidnn 
edellAmme niinkuin ennenkin.' Mal- 
ta kun me pakencmme heidAn edel- 
lAnsA, 

7. silloin te nouskaat vAijyksistA ja 
ottakaat kaupunki ; sillA Hcrra, tei- 
dAn Jumalanne, antaa sen teidAn 
kAsiinne. 

8. Ja kun te olette saancet kaupun- 
gin, sytyttAkAAt .siihcn tuii, ja tch- 
kAAt Herran sanan mukaan: katso- 
kaat, minA olcnsen kAskenytteiile.*' 

9. Niin Josua hlhctti heidat, ja he 
menivAt sinnc ja kAvivAl vAijyksiin 
Belelin ja Ain vAlillA, lAnncn puo- 
lella Aista. Mutta Josua yOtyi kan- 
san keskcllA. 

10. Ja Josua nousi varhain ja aset- 
ti kansan, ja hAn ja Israelin van- 
himmat mcnivAt ylOs Aihin. 

11. Ja kaikki sotavAki, jotka hAncn 
tykfinAnsA olivat, mcnivAt, kAvivAt 
edes ja tulivat kaupungin kohdalle, 
ja sijoittivat itsensA ponjan puolelle 
Aista ; ja laakso oli heidAn ja Ain 
vAlillA. 

12. Multa hAn otti liki viisituhatta 
micstA, ja pani ne vAijyksiin Bet- 
elin ja Ain vAlillA, lAnnen puolclla 
kaupunkia. 

13. Ja kun kansa oli asctettu, koko 
Iciri, joka oli pohjan puolella kau- 
punkia, ja vAijyjAt lAnnen puolella 
kaupunkia, niin meni Josua sinAyO- 
nA keskcUc laaksoa. 

14. Kun Ain kuningas sen nAki, kii- 
ruhtivat kaupungin miehct, varhain 
huomencltain, mcnivAt ulos Israe- 
lia vastaan sotaan, kuningas ilse 
kaiken vAkensA kanssa, mAArAtyllA 
ajalla, lakialle kedolle; mutta ei hAn 
tietAnyt, ettAoltiin hAntAvAijymAssA 
kaupungin takana. 

15. Mutta Josua ja koko Israel an- 
toivat lyOdA itscnsA, ja pakenivat 
tietA m^'dtcn korpecn pAin. 

16. Nim kaikki kansa , joka kau- 
pungissa oliihuudettiinkokoon hei- 
tA ajamaan takaa; ja he tgoivat Jo- 
sua ta takaa ja eroitettiin kaupun- 
gista, 

17. niin ettei ^^htAAn miestAjAAnyt 
Aihin ja Beteliin , joka ei mennyt 
ulos Israelin pcrassA; ja he jfittivAt 
kaupungin avoimeksi, ja ajoiyat Is- 
raelia takaa. 



18. Niin sanoi Herra Josualle: .,o- 
jenna keihAAsi, joka kAdcssAsi on, 
Ain puoleen. silla minA annan sen. 
sinun kAsiisi." Ja Josua ojensi kci- 
hAAnsA, joka oli hAnen kAdcssAnsA, 
kaupungin puolecn. 

19. Silloin vAijyjAt kiiruusti nousi- 
vat paikastansa ja ricnsivat, kun 
hAn oli kAtensA ojcntanut, ja tuli- 
vat kaupunkiin ja voittivat sen; ja 
he kiireella sy ty ttivAt kaupungin pa- 
lamaan. 

20. Ja Ain michet kAAntyivAt ja 
katsoivat taakscnsa, ja nAkivAt sa- 
vun nousevan kaupungista taivaa- 
sen pAin. Ei ollut heillA tilaa paeta 
sinne eikA tAnnc, kun se kansa, jo- 
ka pakcni korpeen pAin, kAAntyi 
takaa-ajajiansa vastaan. 

21. Kun Josua ja koko Lsrael nAki- 
vat, ettA vAijyjAt voittivat kaupun- 
gin ja ettA savu nousi kaupungista, 
palasivat he ja IdivAt Ain miehel. 

22. Ja toiset tulivat kaupungista u- 
los heitA vastaan, ja he joutuivat 
kcskelle Israelia molemmilta puo- 
lilta; ja he loivAt hcidAt siksi ettei 
yhtAAn heistA elAmAAn jAAnyt, eikA 
im'ds pAAsnyt pakoon. 5 Moos. 7:2. 

23. Ja Ain kuninkaan ottivat he 
elAvAnA kiinni, ja veivAt hunet Jo- 
suan tykO. 

24. Ja kun Israel oli ly6nyt kuo- 
liaaksi kaikki Ain asujal kedolla ja 
korvessa, johonka he heitA ajoivat 
takaa, ja he olivat kaikki kaatuncct 
miekan terAllA, siihcn asti ettA lop- 
puivat, niin koko Israel pnlasi Ai- 
hin ja Idi sen miekan terAlla. 

25. Ja kaikki ne, jotka kaatuivat 
sinA pAivanA, sekA michlA ettA nai- 
sia, heitA oli kaksitoista tuhatta, ko- 
ko Ain kansa. 

26. Ja Josua ei vetAnyt kAttAnsA ta- 
kaisin, jolla hAn oli ojentanut kci- 
hAAn, ennen kuin hAn oli tappanut 
kaikki Ain asuvaisct. 2Moos. I7:iis. 

27. Mutta kaupungin karjan ja saa- 
liin jakoi Israel keskenAnsA, Herran 
sanan mukaan, niinkuin hAn oli 
kAskenyt Josualle. 4 Moos. 31:23 s. 

28. Ja Josua poltti Ain ja teki siitfi 
kiviraunion aniaiscksi ; ja se on au- 
tiona vielA tAhAn pAivAAn asti. 

29. Ja hAn antoi ripustaa Ain ku- 
ninkaan puuhun iltaan asti ; ja kun 
pAiva oli laskenut, kUski hAn hAnen 
ruumiinstt ottaa puusta pois, ja he 
heittivut sen kaupungin portineteen 
ja kokosivat suuren kiviraunion h5- 
nen pAAllcnsA, joka siellA on vielil 
nyt tahAn paivAAn asti. oMoos.21:23« 

Jos. 10:27. 

30. Silloin rakensi Josua Herralle, 



224 



JOSUA 8. 9. 



Israeltn JumalaHe « alttarin Ebalin 
vuorella, 

31. niinkuin Mooses. Herran pnlv«- 
lija.oli Israelii! lapsille kftskenyt, ja 
niinkuin Mooseksen lakiklijassa kir- 
joilettu on, alttarin kokonaisista ki- 
vista^ joihin ei ole rauta sattunut. 
Ja he uhrasivat sen pflilllfi poltto- 
uhria ja kiitosuhria Hcrralle. 

2 Moos. 2025. 5 Moos. 27:2 s. 

32. Ja hSn kirjoitii sielhl kiviin sen 
lain sanat, joaka Mooses oil Israelin 
lapsille kirjoittnnut. 5 Moos. 27:38. 31:9. 

M. Ja koko Israel vanhimpainsa, 
piiSmiestens^ ja luomareinsaknnssa 
seisoivatmolenimilla puolin arkkia, 
pappein, Levililisten vastup55tn, jot- 
ka kantoivat Herran liitou arkkia, 
niin muukalaisel kuin kotonakin 
syntyneet, puolct heisla Gerisimin 
vuorella ja toinen puoli Ebalin vuo- 
rella, niinkuin Mooses, Herran pal- 
velija, edelt(lp5in oli kiiskenyl siu- 
naamaan Israelin kansaa. 

. 5Moos. 11:19. 27:12 s. Dan. 9:11 

34. Sitte julisti Mn kaikki lain sanat, 
siunauksen ja kirouksen,aivan niin- 
kuin sc on kirjoitettu lakikirjassa. 

33. £i ollut yhtdkildn sanaa kaikis- 
ia, mitd Mooses oli kflskenyt, join ei 
Josua julistanut koko Israelin seu- 
rakunnan edessd , naistcn ja lasten 

t'a muukalaisten ede^ sS, jotka olivat 
leid^Q keskelinhs3. 5J4oos. 3l:il s. 

9 Luku. 

Gibeonllaisten kavaluus. 

|a kun kaikki kuninkaat sen kuu- 
^ livat, jotka sillli puolen Jordania 
olivat, vuorilla ja laaksoissa ja kai- 
kissa ison meren satamissa, Liba- 
nonin vuorelle p5in , Hetil5isel , ja 
Amorilaiset , Kananealaisei , Feresi- 
Iftiset. Hcviliiiset ja Jebusilaiset, 

2. kokoontuivat he yhteen yksimie- 
lisesti sotimaan Josuata ja Israclia 
vaslaan. 

3. Kun Gibeonin asuvaiset kuuli- 
vat, mild Josua oli tehnyt Jerikolle 
jaAiUe, 

4. niin turvautuivat hckin pctok- 
seen, menivSt ja tekeytyivAl sanan 
saatlajiksi , ja ottivat vanhat silkit 
aaseinsa p^lle, ja vanhat kuluneel 
ja ravistuneet viinileilit, 

5. ia vanhat , paikatut kengfit jal- 
koihinsa, ja vanhat ia rikkindiset 
vaatteet yllensfi, ja kaikki heiddn 
evfisleipdnsfi olivat kovia ja homeh- 
tuneila; 

6. jahemeniv&t leiriin Josuan lvk5 
Gilsaliin, ja sanoivat hdnelle ja kai- 
kelle braelille: k,me olemme kau- 



kaiselta inaalla tulleet, tchkfiftt nyt 
liilto meidiln kanssamme.'" 

7. Niin sanoi .koko Israel Hevildi- 
sillc: .,elik21 sin5 asut meid&n kes- 
kcUftmnic. kuinka me Ickisimme 
liiton sinun kanssasi?'* 
2Moos.2332s. 34.12. 5Moos.l:2s. Jo8.11:19. 

8. He sanoivat Josualle: „me olem- 
me sinun pnlvelijasi." Ja Josua sa- 
noi heille: „kutka tc olette, ja mis- 
ta tuicttc?' 

9. He sanoivat hfinelle: „sinun pal- 
vclijasiovatsangenkaukaiseltamaal- 
ta tulleet Herran, sinun Jumalasi, 
nimcn tdhden; silla nic «lcmmc 
kuullect hSnen sanomansa ja kaikki 
mita htin Eg^ptissii on tehnyt, 

10 ja kaikki mita hSn on tehnyt 
kahdelle Amorilaisten kuninkaalle, 
jotka olivat silia puolen Jordahin, 
Sihonille, Hesbonin kuninl^aalle, ja 
Ogille, Basanin kuninkaalle, joka 
asui Astarotissa. 4Moos. 2i:23s. 

5 Moos. 2:31 s. 

11. Sentahden sanoivat meille mei- 
dan vanhimmat ja kaikki maamme 
asuvaiset: ,otlakaat evdsta myOtan- 
iie, ja menkaat heiia vastaan ja sa- 
nokaat Iieille: me olemme teidan 
palvelijanne , tehkaat liitto meidan 
kanssamme.* 

12. Tama meidan leipamme, jonka 
m^'Otammcevaaksi otimme kotoam- 
me, oli vieia tuores, kun laksimme 
tulemaan teidan tyk6nne,mutlakat- 
so, se on nyt kova ja homehtunut. 

13. Ja nama viinileilit olivat uu- 
sia, kun me ne taytimme, ja katso, 
ne ovat kuluneet; ja nama vaal- 
teemme ja ken kdm me ovat vanhaksi 
tulleet aivan pitkan matkan tahden.'' 

14. Niin otlivat paamiehet heidan 
cvaastansa, mutta he eivat kysyneet 
Herran suuta. 4 Moos. 27:21. 

15. Ja Josua tekl rauhan heidan 
kanssansa, ja teki liiton heidan 
kanssausa, eltn he saisivat eiaa; ja 
kansan paamiehet vannoivat sen 
hcille. Jos. 11:19. 2 Sam. 21:2. 

16. Mutta kolmcn paivan perasta 
sen jaikcen kuin olivat tehncet lii- 
ton heidan ^^anssansa, kuulivat he, 
etta he olivat laheltu, ja asuivat hei- 
dan keskeliansa. 

17. Ja Israelin lapset laksivat mat- 
kaan ja tulivat kolmantena paivana 
heidan kaupunkcihinsa , jotka kut- 
sutaan Gibeon, Kafira, Beerot jaKir- 
jatjearim. 

18. Ja Israelin lapset eivat lydneet 
heita ; silia kansan paamiehet olivat 
vannoneet heille Herran, israelin 
Jumalan, kautta. Ja koko kansa na- 
pisi paamiehia vastaan. 



mmiirii] 8 



225 



JOSUA 9. 10. 



10. Niin sanoivat kaikki kansan 
piii\miehet kaikelle joukolle* „me 
olemme vannoneet heille Herran, 
Israelin Jumalan, kautia, ja sent&h- 
den emme voi heitd ahdistaa. 

20. Mutta sen me teemme heille : an- 
takaamme heiddn eldd, ettei viha 
tulisi valan lAhden meidfln pSSlIem- 
me. jonka me heille vannoneet o- 
lemme.*' 2Sain.21:l. 

21. Ja p^amiehet sanoivat heille, 
etta he saavat eina. Ja he tulivathal- 
kojen hakkaajiksi ja vcden kanta- 
jiksi kaikelle kansalle^niinkuinpafi- 
mrchet olivat heille sanoneet. 

22. Niin Josua kutsui heidflt ja pu- 
hui heille, ja sanoi: „miksi olette 
pctt5neet meiddt ja sanoneet: me 
asumme aivan kaukana teistS; ja 
kuitenkin te asutte meid&n keskel- 
lamme? 

23. Olkaat sent&hden kirotutl Ette 
suinkaan ikinS lakkaa oleniasta or- 
jina, halkojen kanlajina ja veden 
kantajina minun Jumalani huo- 
neelle.** 

24. He vastasivat Josuata, ja sanoi- 
vat: ,,sinun palvelijoillesi on mo- 
nesti kerrottu, ettft Herra, sinun Ju- 
malasi, on kfiskenyt palvelijansa 
Mooseksen antaa teillekaikentfimrtn 
maan ja hJlvittUd edestSnne kaikki 
mann asuvaiset ; niin me sutiresli pel- 
klisimme henkeftmme teid&n edes- 
s5nne ja teimme tflmftn. 5Moo8.7:i8. 

25. Mutta katso, me olemme nyt 
sinun kSsissSsi ; minkfi ndit hyvfiksi 
ja oikeaksi meille tehdd, se tee.'^ 

26. Ja h9n teki heille niin, ja va- 
pahti heidat Israelin lasten kftsistS, 
etleivfit he lyOneet heitd kuoHaaksi. 

27. Ja Jbsua teki sinfi pSivfinfi hei- 
dat halkojen hakkaajiksi ja veden 
kantajiksi seurakunnalle ja Herran 
alttarille t5hfin pftivfidn asti, siinS 
paikassa, jonka nftn oil valitseva. 

lo Luku. 

Viisl kuningasta lyOd&ftn Gibeonlssa. 

Kun Jerusalemin kuningas Adoni- 
Sedek kuuli Josuan voittaneeksi 
Ain ja havittfineeksi sen, ja niin teh- 
neeksiAille ja sen kuninkaalle, kuin 
h5n oli tehnyt Jerikolle ja hdnen 
kuninkaallensa, ja ett& Gibeonin a- 
suvaiset olivat tehneet rauhan Is- 
raelin kanssa ja asuivat heidfin kes- 
kell&nsa, Jos. 6:21,24. 8568. 9:1ft. 

2. pelk&sivfit he suuresti; sillfi Gi- 
beon oli suuri kaupunki, niinkuin 
^ joku kuninkaan kaupunki, ja suu- 
rempi kuin Ai. ja kaikki sen asu- 
vaiset olivat vdhvat sotamiehet. 



3. Ja Adonl*Sedek, Jerusalemin 
kuningas, Ifthetti Hohamille, Hebro- 
nin kuninkaalle, ja Pireamille, Jar- 
mutin kuninkaalle, ja Jafialle, I^« 
kiksen kuninkaalle, jaDeberille, Eg- 
lonin kuninkaalle, tAmdn sanan: 

4 „Tulkaat ylOs minun tykOni fa 
aultakaal minua, ja lyGkfiflmme Gi- 
beon; silld he ovat tehneet rauhan 
Josuan ja Israelin lasten kanssa.** 

5. Silloin kokoontuivat ja menlvfil 
yl6s ne viisi Amorilaislen kuningas- 
ta, Jerusalemin kuningas, Hebronin 
kuningas, Jarmutin kuningas, La- 
kiksen kuningas ja Eglonin kunin- 
gas, he ja kaikki heidftn leirinsfi, ja 
piirittivftt Gibeonin ja sotivat sitfi 
vaslaan 

6. Mutta Gibeonin miehet Ifihetti- 
vftt Josuan tyk6 leiriin Gilgaliin, sa- 
noen: „fiia ota kfittUsi pois palveli- 
joiltasi, tule nopiasti ylOs meidfin 
tykOmme, vapahda meilA ja aula 
meita ; sillS kaikki Amorilaisten ku- 
ninkaat, jotka asuvat vuorilla, ovat 
kokoontuneet meitd vastaan.** 

7. Ja Josua meni ylOs Gilgalista, 
ja kaikki sotavdki hdnen kanssansa, 
ja kaikki vahvat sotamiehet. 

8. Ja Herra sanoi Josualle: „fil& 
ensinkftftn heitfi pelkfift; sillfi minfl 
olen antanut heid&t sinun kflsiisi; 
ei yksik&fin l^eistfi ole seisovainen 
sinun edessasi.^* 6 Moos. 3:2. 

Jos. 62. 8:1. 

9. Niin Josua tulifikisti heidftnpaai- 
lensfi; silia hfin matkusti kaiken 
yOsen Gilgalista. 

10. Ja Herra peljatti heitft Israelin 
edessa ; ja he tuottivat heille suuren 
tappion Gibeonlssa, ja ajoivat hcita 
takaa sita tieta, jota ylds Bet-Horo- 
niin mennaan, ja 16ivdt heitft Ase- 
kaan ja Makkedaan asti. 2 Moos. 14:24. 

2327. Tuom. 4:1&. 

11. Ja kun he Israelin edellA pake- 
nivat alas Bet-Horonin tieta, antoi 
Herra taivaasta tulla suuret kivet 
heidan paailensa Asekaan asti, niin 
etta he Kuolivat; ja enempl oU nil- 
ta, jotka kuolivat raekivien kautta, 
kuin niita, jotka Israelin lapset mie- 
kalla lOivat. 2 Moos. 9:178., 22 a. 

12. Silloin puhui Josua Herralle,si« 
na paivana, jona Han antoi Amorf* 
laiset Israelin lasten kasiin, ja sanoi 
Israelin lasna ollessa* „aurinko, sei- 
so alallasi Gibeonissa, ja kuu, AJa- 
lonin laaksossa!** Jes. 28:21. 

13. Ja aurinko seisoi alallansa ja 
kuu seisahtui, siksi kuin kansa kos- 
ti vihamiehiUensa. EikO tamfi ole 
kirjoitettu „hurskaan kirjassa?** Ja 
aurinko jAi seisomaaa keskellfl tai- 



226 



I 



JOSUA 10. 



vasia ilman laskematla koko pfii- 
van. 2 Sam. 1 :18. Jes. 38.8. 

14. Ja ei ole yksikdiln paivd oUut 
senkallainen, ei ennen eikd siltem- 
min, ella Herra kuuli yhden mie- 
hen SSnen; sillil Herra soti Israelii! 
puolesta. 

15. Ja Josua ja koko Israel -hAnen 
kanssansa palasi jaileen leiriin Gil- 
gnliin. 

16. Mutta ne viisi kuningasla pa- 
kenival ja lymyivSt luolaan Makke- 
dassa. 

17. Niin Josualle ilmoitettiin ja sa- 
notliin: „ne viisi kuningasta ovat 
loydeiyt kStkettyna luolaan Makke- 
dassa." 

18. Ja Josua sanoi : ,,vieriU5k5ilt 
suuret kivet luolan suulle, ja asetta- 
kaat miehet heitfi vartioitsemaau. 

'19. Mutta aikaat te alallanne seiso- 
ko, vaan ajakaat vihamiehilinne ta- 
kaa ja lydkSflt heid&n viimeisiflnsd; 
alkdSt salliko heiddn tulla kaupun- 
keihinsa, silia Herra, teldi&n Juma- 
lanne, on antanut heidSt teid5n k&- 
siinne!'* 

20. Run nyl Josua ja Israelin lap- 
set clival lopettaneet sen ylOn suu- 
ren tapon ja perdti olivat heiddt 
surmanneet, — mutta jSaneet heists 
p3[isivat ja tulivat vanvoihin kau- 
punkeihin, — 

ii. niin palasi kaikki kansa jfillcen 
leiriin Josuan tyk& Makkedaan rau- 
hassa,eikfikenkll£in rohjennut Israe- 
lin lasten edessft hiiskuakaan. 

22. Mutta Josua sanoi: ,^vatkaat 
luolan suu , ia tuokaat ne viisi ku- 
Aingasta luolasta minun tykOni.** 

23. He :ekivfit niin, ja toivat ulos 
ne viisi kuningasta hfinen tykdnsS 
luolasta, Jerusalemin kuninkaan, 
Hebronin kuninka^n, Jarmulin ku- 
ninkaan, Lakiksen kuninkaan, ja 
Eglonin kuninkaan. 

21 Ja kun n&mil kuninkaat olivat 
tuodul Josuan eteen , kulsui Josua 
kaikki Israelin miehet, ja sanoi so- 
tajoukon pSflmiehille, jotka hfinen 
kanssansa kulkivat: „tulkaat tSnne 
ja asettakaat jalkanne nditten kunin- 
kaitten kaulalle.'* Ja he tulivat, ja 
asettivat jalkansa heidilnkaulalleen. 

25. Ja Josua sanoi heille . ,,illkft5t 
peptkG, SIkaatka hammSstykO, vah- 
viitiBkaat itsenne ja olkaat rohkiat; 
siBfl nSin tekee Herra kaikille viha- 
niehillenneoolta vastaan tesodilte *' 

2S. Ja Josua 101 heidat sitten , ja 
nmnasi heidat, ja ripusti vliteen 
pBuhun; ja he riippuivat puissa ha- 
naan iltaan asti. 

27. Ja kun aurinko laski, kfiski Jo* 



sua heita, ja he ottivat heidai puisla 
alas ja heittivat luolaan, johonka he 
olivat lymynneet. ja panivat suuret 
kivet luolan suulle, jotka sielia vie- 
la tanapanaovat.5Moos.2i23. Jos.S:29. 

28. Sina paivana voitti mvOs Josua 
Makkedan, ja \6i sen miekan terfil- 
la, ja tappoi sen kuninkaan, ja kaik- 
ki ne sielut, jotka hanessa olivat, 
eika yhiakaan iaitunyt eiamaan; ja 
han teki Makkedan kuninkaalle niin- 
kuin han oil tehnyt Jerikon kunin- 
kaulle. Jos. 6.-21. 

29. Ja Josua vaelsi ja koko Israel 
hanen kanssansa Makkedasta Lib- 
naan, ja soti Libnaa vastaan. 

30. Ja Herra antoi senkin Ja sen 
kuninkaan Israelin kasiin, ja han 
lOi sen miekan teraiia ja kaikki ne 
sielut, jotka sielia olivat, eika ketaan 
eiamaan iattanyt; Ja han teki sen 
kuninkaalle niinkuin han oil tehnyt 
Jerikon kuninkaalle. 

31. Sitten matkusti Josua ja koko 
Israel hanen kanssansa Libnasta 
Lakikseen, ja piiritti sen, ja soti si- 
ta vastaan. 

32. Ja Herra antoi. Lakiksenkin Is- 
raelin kasiin, niin etta han voitti 
sen toisena paivana ja Idi sen mie- 
kan teraua ja kaikki ne sielut, jotka 
siina olivat, juuri niinkuin han oli 
Libnalle tehnyt. 

33. Siihen aikaan men! Horam, Je- 
serin kuningas, auttamaan Lakista; 
mutta Josua 15i hanet kaiken jouk- 
konsa kanssa, niin ettei hdn yhia- 
kaan henkiin jattanyt. 

34. Ja Josua meni Xiakiksesta ja ko- 
ko Israel hanen kanssansa Egloniin, 
ja he piirittivat sen ja sotivat sita 
vastaan, 

35. ja voittivat sen sina paivfinfi, ja 
lOivat miekan teraiia, ja surmasivat 
kaikki sielut, jotka sielia olivat, si- 
na paivana, juurl niinkuin hdn oli 
tehnyt Lakikselle. 

36. Sitte meni Josua ja koko Israel 
hanen kanssansa Eglonista ylds Heb- 
roniin, ja he sotivat sita vastaan, 

37. ja voittivat sen ja Idivat sen mie- 
kan teraua, ja sen kuninkaan ja 
kaikki sen kaupungit, ja kaikki sie- 
lut, jotka sielia olivat, eika han yh- 
takaan jattanyt, juuri niinkuifk han 
oli tehnyt Eglonille; han havitti sen 
ja<.surmasi kaikki sielut, jotka siel- 
ia olivat 

38 Ja Josua ja koko Israel hanen 
kanssansa palasi Debiriin, ja soti 
sita vastaan, 

39. ja voitti sen kuninkainensa ja 
kaikki sen kaupungit, ja lOi ne mie- 

i kail 



kan teraiia, ja tappoi kaikki sielut. 



227 



JOSUA Id. 11. 



)otka sielia olivat, eikfi ketfiksnn jfit- 
tfinyt; niinkuin han oli Hebronille 
tehnyt, niin teki h9n myfis Debirille 
}a sen kuninkaalle, ja niinkuin hdn 
oil tehnyt Libnalle ja sen kunin- 
kaalle. 

40. Niin Josua 15i kaikki maan asu- 
vaiset vuorilla, ja eteld«maassa, ia 
lanksoissa , ja alangoissa , ja kaikki 
heid0n kuninkaansa, eikfl yhtakdtin 
jAttfinyt, vaan tappoi kaikki « joilla 
hcnki oli, niinkuin Herra, Israelin 
Jumala,oIikflskenyt. 5Moos.7:2. 20:16. 

41. Ja Josua Idi heidat, ruveten Ka- 
des-Barneasta Gasaan asti, ja koko 
Goscnin maakunnan Gibeoniin asti. 

Jos. 11:16. 15.51. 

42. Ja Josua voitti kaikki namd 
kuninkaat maakuntinensa yhdelld 
rupeamalla; silin Herni, Israelin Ju- 
mala, soti Israelin puolesta. 

43. Ja Josua palasi leiriin Gilgaliin, 
ja koko Israel hSnen kanssansa. 

II Luku. 

Pobjoiuen osa maata valloitetaan. 
Enakilaiset b&vitet&an. 

J a tapahtui, kun Jabin, Hatsorin 
kuningas, sen kuuli, 15hetti h^n 
sanan Jobabille, Madonin kunin- 
kaalle, ja Simronin kuninkaalle, ja 
Aksafin kuninkaalle, 

2. ja niille kuninkaille, jotka asui- 
vat pohjan puolella, vuorella, ja la- 
keuaella, etelaSn'pfiin Kinnerotista, 
ja laaksoissa,-jaDorinNafoUssa, me- 
ren puolella, 

B. Kahanealaisllle id&u ja Iftnnen 

fuoleen, Amorilaisille , Hetilfiisille, 
eresilSisille ja Jebusilaisille vuo* 
rella,niin myOs Hevil&isille ala puo- 
lella Hermonin vuortaMitspan maa- 
kunnassa. 

4. Ja n&m& Iftksivftt kaiken sota- 
joukkonsa kanssa, joka oli sangen 
suuri kansan paljous, niin lukuisa 
kuin santa meren reunalla, ja san- 
gen monta hevosta ja vaunua. 

5. Kaikki nSmfi kuninkaat kokoon- 
tuivat, tulivat ja sijoittivat itsensS 
Meromin vetten tykO soliaksecn Is- 
raelia vaslaan. 

6. Ja Herra sanoi Josualle : „aifi hei- 
tfi ensinkdfin pelkfiS, sill& huomen- 
na tfillfi ajalla minfi annan heidfit 
kaikki lyOtynfi Israelinkansan eteen ; 
heid&n hevosensa pitdS sinun rivi- 
nomaksi tekemfin jaheidftnvaunun- 
sa tulella poltlaman.'' 

7. Ja Josua tuli ja kaikki sotajouk- 
ko hfinen kanssansa fikisli heidan 
pflfillensft, Meromin vetten tykOn&, 
Ja karkasivat heid&n p&ftUensft. 



8. Ja Herra anloi he!d2H Israelin 
k5siin, ja he lOivfit heidm, ja ajoivat 
heita lakaa isoon Sidoniin asti, la 
siihen IfimpymASn veteen asti , ja 
Mitspan laaksoon asliitCifin pftin,.ja 
lOivnt heidai niin, ettei yksikftiin 
heists jS5nyt. Jos. 13:6. 

9. Ja Josua teki h'eille, niin kuin 
Herra oli h!inelle kfiskenyl ; heidSn 
hevosensa teki hfin rivinomaksi, ja 
poltti heiddn vaununsa tulella. 

10. Ja Josua palasi sillfi ajalla, ja 
voitti Hatsorin, ja Idi sen kunin- 
kaan miekalla; silUI Hatsor oli en- 
nen kaikkein nftiden valtakuntain 
pCifikaupunki. 

11. Ja he lOivlit kaikki ne sielut, 
jotka sieim olivat, miekan terfilia, 
ja tappoivat,niin ettei yhtftk&fin Jft&- 
njyt, jolla henki oli; ja hftn poltti 
Hatsorin tulella. 

12. Kaikkein niiden kuningasten 
kaupungit ja niiden kuninkaat voitti 
Josua, ja lOi heiddt miekan terftllu, 
ja tappoi heidat, niinkuin Mooses, 
Herran palvelija, oli kSskenyt. 
2Moos.23:328. 4Moo8.33:528. &Moo8.20:l6s. 

13. Mutta Israelin lapset eivdt polt- 
taneet yhtftkai&n kaupunkia, joka 
seisoi korkealla tdyrftallfl, paitsi ai- 
noata Hatsoria, jonka Josua poltti. 

14. Ja kaiken saaliin ja el5imet, jot- 
ka he nftistfi kaupungeista olivat dt- 
taneet, jakoivat israelin lapset kes- 
kenSnsa. Ainoasti kaikki ihmiset 
tappoivat he miekan terSllfi, ja hu- 
kuttivat heidat, niin ettei yhtfik&iln 
henkiin jfifinyt. 

15. Niinkuin Herra palvelijallensa 
Moosekselle oli kiiskenyt, niin oli 
Mooses Josualle k&skenyt, ja niin 
teki Josua; ettei niisl& yhtakfian te- 
kemftttfl isanyt, mitfi Herra oli Moo- 
sekselle Mskeiiyt 2 Moos. 34:128. 

6 Moos. 72. 

16. Ja niin Josua otti koko tSmSn 
maan, vuorimaan, ja koko eteia- 
maan, ja koko Gosenin maan, ja la- 
keuden ja alankomaan, ja Israelin 
vuorel laaksoinensa, 

17. siitfi siledstS vuoresta, joka me- 
nee ylOs Seiriin pliin Baal-Gadiin asti 
Libanoninlaaksossa, Hermonin vuo- 
ren alia; kaikki niitlen kuninkaat 
hfin voitti, Idi ja tappoi heidfit. 

18. Kauan aikaa kfivi Josua sotaa 
kaikkein ndiden kuningasten kanssa. 

19. Ei oUut yhtilkiifin kaupunkia. 
ioka rauhalla antoi itsensfi Israelin 
lasten alle, paitsi Hevilfiisift, jotka 
asuivat Gibeonissa ; mutta kaikki he 
ottivat sodalla. Jo8.9:i&.]8. 

20. Ja Herralla se oil, ettft heid&n 
sydftmmensfl paatuivat kohtaamaan 



228 



JOSUA 11. 12. 1?. 



Israelia sodnUa, cUd niin hukkuisi- 
vat, eiku yhtfikaan armoa hciilc ta- 
pahtuisi, vaan he perati hdvileUai- 
sUn, niinkuia Herra Moosekselle oli 
kSskcnyt. 5 Moos. 2.30. 

21. Siihen.aikaan tuli Josua ja hd- 
vilt! Enakilaiset vuorella, Hebronis- 
ta, Dcbirista, Anabisia ja kaikilta 
Juudan vuorilta, ja kaikilta Israelin 
N-uorilta, ja hSvitti heidikt kaupun- 
keinensa. 4 Moos. 13:34. Tuom. 1:20. 

22. Hfin ei antanul yhlakaan Ena- 
kilaistajiiadd Israelin lasten maalle; 
ainoastaan Gasassa, Gatissa ja Asdo- 
dissa oli niita jaielia. iSam. I7:4s. 

2 Sam. 21 -.20. 

23. Ja niin Josua oUi koko maan, 
aivan niinkuin Herra Moosekselle 
oli sanonut, ja antoi sen Israelille 
perinnOksi, kullekin sukukunnalle 
osansa. Ja maa sai sodasta rauhan. 

12 Luku. 

Yoitetut kuninkaat )a maakunnat 
luetellaan. 

la nSmSt ovat maan kuninkaat, jot- 
^ ka Israelin lapsel Idivat, ja joiden 
maan he ottivat tuolla puolen Jor- 
danin, auringon nousuun p^in, Ar- 
nonin ojasta Hermoninvuoreenasti, 
ja kaikki lakeuden itIISn p&in : 

2. Sihon, Amorilaisten kuningas,. 
joka asui.Hesbonissa ja hallitsi A- 
roerista iShtien, joka on Arnonin 
joen rannalla,keskelld joen laaksoa, 
ja puolen Gileadia, Jabbokin jokeen 
asb, joka on Ammonin lasten raja^ 

1 Moos. 32:22. 4 Moos. 21:24. 
6 Moos. 2:36. 3:6,16. 

3. ja lakeutta Kinnerotin mereen 
asU it^Hn pdin, ja korven mereen, 
Suolaisecn mereen astt UMn pMn, 
Bet-Jesimoiiin pftin, ja Lounaan puo« 
lelta Pisgan rinteiden alle. 

3 Moos. 14:3. 4 Moos. 34:3. 

4.Ja0gin3asaninkuninkaan,maan 

ngat, joka vieia oli Refalaisten jaU- 

neitft, ja asui Astarotissa ja £dreis« 

S^ 5 Moos. 1:4. 

6. ja hallitsi Hermonin vuorella, 
Salkassa ja koko Basanissa, Gesurin 
iiMaakatin maan rajoihin, japuo- 
loi Gileadia, joka Sihonin, Hesbo- 
tdtk kuninkaan, maan raja oli. 

fi. Mooses, Herran palvelija , ja Is- 
raelin lapsct Idivilt heidat; ja Moo^ 
Ms« Herran palvelija, antoi sen Ru- 
benilaisille, Gadilaisille ja puolelle 
M a n asi e n sukukunnalle omaisuu- 
dfksl, 6 Moos. 3.16. 

7. NSmfit ovat ne maan kuninkaat, 
jolka Josua ja Israelin lapset IGivdt 
tWa puolen Jordanin Itoteen pfiin, 



Bnal-GadistaLibanoninvuorenlaak- 
sossa,silcdSn vuoreen asti, joka ulot- 
tuu Seiriin pain. Sen maan antoi Jo- 
sua Israelin sukukunnille omuisuu- 
deksi, itsekullenkin osansa jAlkeen, 

8. vuorilla, alankomaissajakcudel- 
la,vuorlen rinteilla, korvessa,ja lou- 
naan puolisessa maassa: HctilSiset, 
Amorilaisct, Kananealaiset , Feresi- 
laiset, Hevilaisel ja Jebusilaisel; 

9. Jerikon kuningas, yksi ; Ain ku- 
ningas, joka on Bclclin IShella, yksi ; 

10. Jerusalemin kuningas,yksi; Hcb- 
ronin kuningas, yksi; 

11. Jarmutin kuningas, yksi; La- 
kiksen kuningas, yksi, 

12. Eglonin kuningas, yksi; Gese- 
rin kuningas, yksi; 

13. Debirin kuningas, yksi; Gede- 
rin kuningas, yksi; 

14. Horman kunii?gas,yksi; Aradin 
kuningas, yksi; 

15. Libnan kuningas, yksi; Adul- 
lamin kuningas, yksi; 

16. Makkedan kuningas, yksi; Bet- 
elin kuningas, yksi; 

17. Tappuakin kuningas, yksi ; Hefe- 
rin kuningas, yksi; 

18. Afekin kuningas, yksi ; Lassaro- 
nin kuningas. yksi; ^ 

19. Madonin kuningas, yksi ; Hatso- 
rin kuningas, yksi; 

20. Simron-Meronin kuningas, yksi; 
Aksafin kuningas, yksi; 

21. Tanakin kuningas, yksi; Megid- 
don kuningas, yksi; 

22. Kedeksen kuningas, yksi; Jok- 
neamin kuningas Karmelin luoua, 
yksi; 

23. Dornafol-Dorin kuningas, yksi ; 
ja pakanoilten kuningas Gilgalissa, 
yksi; 

24. Tirtsan kuningas, yksi. Kaikki 
yhteensa oli yksineljfltlakymmentfi 
kuningasta. 

13 Luku. 

Herra kHskee Josuan jakaa maata. Rubenln, 
Gadin ja puolen Manassen perint6maat 

Kun Josua vanheni ja ijailiseksi 
tuli, sanoi Herra hanelle; „sina 
olet vanhcntunut ja ijAlliseksi tullut, 
ja maata on vieia aivan paljo jaa- 
nyt omislamatta. 

2. Tamfi on se jaijellS oleva maa 
kaikki Filistealaisten maan aaret ja 
koko Gessuri, l Sam. 27:8.. 

3. Sihorista , joka juoksee Egyptin 
cditse, Ekronin maan aariin asti, 
pohjan puoleen; se luetaan Kana- 
nealaisten maaksi. Ne viisi Filistea- 
laisten paamiesta ovat: Gasilainen, 
Asdodilainen, Asklonilainen , Gati- 



22a 



JOSUA 13. 



lalnen, Ekronilainen ja Avilainen. 

Jos. 15:4. 

4. Mutta etelAQn pflin on koko Ka- 
nanealaisten maa ja Mcara« joka on 
Sidonilaislen, Afekiin saakka ja ha- 
inaan Amorilaisten maan fiftriinasli, 

5. ja myds Gibliltlisten maa, ja ko- 
ko Libanon, auringon nousuun p3in, 
Baal-GacHsIa Hermonin vuoren alta, 
siihen asti kuin Hamatiin tullaan; 

6. knikki, iotka vuorella asuvat, Li- 
banonista ifimpymAan veteen asti, 
kaikki Sidonilaiset. Minft aian ne 
Israelin lasten cdestfi pois; ja*a ne 
vaan Israelille perinn5Ksi, niinkuin 
minA olen sinulle kfiskenyl. Jos. 11:8. 

7. Niin ja'a nyt tftmfi maa perin- 
nOksi yhdeks9)le sukukunnalle, ja 
puolelie Mahassen sukukunnalle.^' 

Ps. 133:118. 

8. Rubenilaiset ja Gadilaiset oval 
saaneet loisen puolen Manassen su- 
kukunnan kanssa perintOnsS, jonka 
Mooses heille antoi silia puolen Jor- 
danin itfifin pfiin, niinkuin Herran 
palvelija Mooses heille sen on anta- 
nut, 4 Moos. 32:33. 5M008.3:12. 

Jos. 1:128. 20:8. 22:4. 

9. Aroerisla, joka on Amonin joen 
reunalla, la siitfl kaupungista, joka 
on keskelifi joen laaksoa, ja koko 
Medeban lakeuden Diboniin asti, 

10. ja kaikki Sihonin, Amorilaisten 
kuninkaan, kaupungit, joka hallitsi 
Hesbonissa, Ammonin lasten maan 
rajoihin asti, 

11. ja Gileadin ja Gessurin ja Maa- 
katin maan fi9ret, ja koko Hermo- 
nin vuoren, ja koKO Basanin Sal- 
kaan asti; 

12. koko Ogin, Basanin kuninkaan, 
valtakunnan, joka hallitsi Astarotis- 
sa ja.Edreissfi, joka vielfi oli Refa- 
laisten jSftneitfi ; ja Mooses lOi hei- 
dat ja sgoi heidat pois. 

13. Mutta Israelin lapse! eiv&t iga- 
neet GessurilaisiajaMaakatilaisia u- 
los, vaan Gessurilainen ja Maakati- 
lainen asui Israelin lasten keskelifi 
tfihSn pfiivftfin asti. 

14. Mutta Levilfiisten sukukunnalle 
ei hfin antanul mitSfin perint6ft; sil- 
1ft Herran, Israelin Jumalan, polt- 
touhri on heidfin perintfinsft, niin- 
kuin Hftn heille oli sanonut. 

4 Moos. 1824. 5 Moos. 10:9. 18:18. Hes. 44.-28. 

15. Ja Mooses antoi Rubenin lasten 
suvulle, heidftn sukukuntainsa jfil* 
keen, 

16. etlft heidfin alueensa oli Aroe- 
rista, joka on Arnonin joen reunal- ' 
la, kaupungista keskelifi joen laak- 
soa, kaiken sen tasaisen kedon kans- 
sa Medeban tykOnfl; 



17. Hesbonin kaupunkelnensa, jot- 
ka ovat tasaisella kedolla ; Dibonin, 
Bamot-Baalin ja Bet-Baal Meonin, 

18. Jaksan, Kedemotin, Mefaotin, 

19. Kirjataimin, Sibman, Seret-sa- 
harln, vuorella laaksossa, 

20. ja Bet-Peorin, Pisgan rinleet ja 
Bet-Jesimotin, 

21. ja kaikki lakeuden kaupungit, 
ja koko Sihonin, Amorilaisten ku- 
ninkaan, valtakunnan, joka hallitsi 
Hesbonissa, jonka Mooses 15i, hfi- 
net, ja Midlanin pfifimiehet: Evin, 
Rekemin , Surin , Hurin ja . Reban, 
Sihonin ala-ruhlinaat, jotka maassa 
asuivat. 4 Mqos. 31:8. 

22. Ja Bileaminkin, Beorin pojan, 
lietfijfin, lOivfit Israelin lapset mie- 
kalla kuoliaaksi muitten lyOtyjen 
mukana . 4 Moos. 22*.5u 

23. Ja Rubenin lasten n^a oli Jor- 
dan ja sen ala. Tfimfi on Rubenin 
lasten perinto heidfin sukukuntain- 
sa jfilkeen, nfimfi heidfin kaupun- 
kinsa ja niiden kylfit. 

24. Ja Mooses antoi Gadin lasten 
sukukunnalle heidfin sukujensa jfil- 
keen, 

25. ettfi heidfin alueensa oli Jaeser, 
ja kaikki Gileadin kaupungit, ja 
puoli Ammonin lasten maata Aroe- 
riin asti, joka on Rabban kohdalla, 

&M008. 2:19. 

26. ja Hesbonista Ramat-Mitspeen 
ja Betonimiin asti, ja Mahanalmista 
Debirin alueesen asti, 

27. ja laaksossa: BetaramjaBetnim- 
ra, Sukot ia Safon, joka jfii Sihonin, 
Hesbonin kuninkaan , valtakunnas- 
ta, Jordanin alue Kinneretin meren 
fifireen asti, toiseUa puolella . Jorda- 
nia itfifin pfiin. 

28. Tfimfi on Gadin lasten perint6 
heidfin sukukuntainsa jfilkeen, nfi- 
mfi heidfin kaupunkinsa ja niiden 
kvlfit. 

29. Ja Mooses antoi puolelie Manas- 
sen lasten sukukunnalle; ja puoli 
Manassen sukukuntaa sai osan hei- 
dfin sukujensa mukaan. 

30. Ja heidfin alueensa oli Maha- 
naimista koko Basan, koko Ogin, 
Basanin kuninkaan, valtakunta, ja 
kaikki Jairin kylfit, jotka ovat Ba- 
sanissa, kuusikymmentfi kaupunkia. 

5 Moos. 3:14. 

31. Ja puolen Gileadia,ja Astarotin, 
ja Edrein, Ogin valtakunnan, kau- 
pungit, Basanissa, antoi hfin Maki- 
rin, Manassen pojan, lapsille, loiselle 

£>uolelle Makirin lapsia, heidfin su- 
Luiensajfilkeen.4Moo8.32:30s. Jo«.i7:i». 
SR2. Tfimfi on sc, minkfi Mooses pe- 
rinnOksi antoi Moabin kedoilla, til- 



230 



JOSUA 13. 14. 15. 



la puolella Jordania Jerikon koh- 
dalia, itfllln pflin. 

33. Mutta Levin sukukunnalle ei 
Mooscs anianut yhtfinn perintO-osaa ; 
Herra. israclin Jumala, on heldSn 
perintO-osansa, niinkuin HSn heille 
oli sanonut. ' 4 Moos. 18:^. 

14 Lukti. 

Msa l&nsipuolella Jordania jaetaan. 
Kalebin perinto-osa^ 

J a nSin((t ovat ne perintd-osat, mit- 
kfl Israelin lapset saival Kanaan- 
maalla,jotka heille perinndksi ja- 
koi pappi Eleasar ja Josua , Nunin 
poika, ja Israelin fasten sukukun- 
tain ylimmfiiset isfit, 

2. arvan kaulta kunkin sukukun- 
nan perint5-osasta , niinkuin Herra 
oil kfiskenyt Mooseksen kautta, yh- 
deksfille sukukunnalle. 4 Moos. 26-.55. 

83:54. 34:13s. Apt 1 13:19. 

3. Sillfi Mooses oli antanut kahdelle 
sukukunnalle ja puolelle sukukun- 
nalle perinn(>n tuolla puolella Jor- 
dania. Mutta Leviiaisille ei hfin an- 
tanut yhtSftn perintOfl heidSn kes- 
kellfinsa. 5 Moos. 3:128. 

4. Mutta Josefln lapsia oli kaksi su- 
kukuntaa, Manasse ja Efraim; ja 
I^evilflisille ei annetlu yhtdSn osaa 
maassa.vaan ainoastaan kaupungit 
heidflnasuaksensaja esikaupungit, 
heidftn kaijaansa ja tavaraansa var- 

ten. iMoos. 48'.5. 4 Moos. 35:2 s. 

5. Niinkuin Herra oli Mooseksellc 
kiskenyt, niin tekivAt Israelin lap* 
>€lt ja jakoivat maan. 

•6. Silloin menivtit Juudan lapset 
Josuan tykd Gilgalissa, ja Kaleb, Je- 
funnen poika , Kenisil&inen , sanoi 
hfinelle: ,,sinfi tiedfit, mitft Herra 
sanoi Jumalan miehelleMoosekselle 
minun ja sinun suhteen Kades-Bar- 
neassa. 4 Moos. 14:24. 32:lS. 6 Moos. 1:36, 38. 
7. MinSolinneljfinkymmenenajast- 
aikainen, kun Mooses, Herran pal- 
velija,minut Idhetli Kades-Barneasta 
vakoamaan maata, ja mind toin hA- 
nelle jfilleen vastauksen sydSmmeni 
jAlkeen. 4Moos. 13:7. 14:6 s. 

S. Mutta veljenl, jotka minun kans- 
sani olivat siellS kfiyneet, saattoivat 
kansallevapisevansydammen; mut- 
ta minfi seurasin Herraa, minun Ju- 
malaani, uskoUisesti. 4 Moos. 13-.31 s. 

5 Moos. 1:28. 

9. Ja Mooses vannoi sinft pdivAnA 
ja sanoi : ,se maa, jojdka pfifille sinfi 
jaloHlas olet astunut, on totisesti si- 
nun ja sinun lastesi perittSvft ijan- 
kaikkisesti, etifiolet uskoUisesti seu- 
rwmul Herraa, minun Jumalaani/ 
SMooa. 11:24. Jos. IS. Taom. 120. 



10. Ja nyt kalso, Herra on anfnnnt 
minun efftS, niinkuin Iidn oli sano- 
nut. Tfimfl on viides ajustaika vii- 
dettdkymmenia, sittckuin Herru nAi- 
td sanoi Moosekselle, kun Israel vael- 
si korvessa. Ja katso, minA olen iA- 
nfipfiivfinfi viiden ajastajan vanha 
yhdeksSttfikymmentS, 

11. ja olen vielfi iaaSpiiiv5nft niin 
vdkevS, kuin minli sinS paivdnH o- 
lin, jona Mooses minut lahetli; niin- 
kuin voimani oli silloin, niin on se 
vieia nylkin vahva sotimaan ja kHy- 
mHHn ulos ja sisdile. 4Moos.27:i7. 

5 Moos. 31:3. Syr. 46:11. 

12. Niin anna nyt minulle tamA 
vuorimaa, iosta Herra puhui sinA 
pAivSnA; sillA sinA kuulit sen siihen 
aikaan, ettA Enakilaiset ovat siellA, 
ia suuret ja vahvat kaupungit. Eli- 
kA on Herra minun kanssani, ja mi- 
nA ajan heidAt pois, niinkuin Her- 
ra on sanonut.*' 

13. Ja Josua siunasi hAntA ja antoi 
Kalebille, Jefunnen pojalle, Hebro- 
nin perinn()ksi. Jos.2i:i2. iMakk. 2:56. 

14. SiitA tuli Hebron Kalebin, Je- 
funnen pojan, KcnisilAisen, perin- 
nOksi tAhAn pAivAAn asli, scntAKden 
ettA hAn oli uskoUisesti seurannut 
Herraa, Israelin Jumalaa. 

15. Mutta Hebron kutsuttiin mui- 
naiseen aikaan Kirjat-Arba; hAn oli 
suurin mies Enakilaisten joukossa. 
Ja maa sai sodasta rauhan. 

15 Luku. 

Juudan sukukuanan rajat ja kau-^ 
pungit . 

Juudan lasten sukukunnan arpa, 
heidAn sukujensa jAlkeen, tuli E- 
domin maan rajallejonkaelel A puo- 
lella onSinin korpi^lounaisen maan 
AArestA asti; 4 Moos. 34:3. 

2. niin ettA heidAn etelA rajansa oli 
Suolameren alipAAstA, se on, siitA 
lahdesta, joka antaa etelAAn pAin, 

3. ia lAhlecsieltA etelA puolella A- 
krabiimin kukkulaa, ja menee Sin- 
niin, ja nousee Kades-Barnean ele- 
lApuolella, ja menee Hesroniin, ja 
nou$ee Adariin, ja kAAnlyy Karkaan 
pAin, 

4. ja menee Asmonin ohitse, ja tu- 
leeEgyptin ojaan, ja se raja loppuu 
mereen. „TAmA olkoon teille maan 
raja etelAssA.** 4 Moos. 343,5. 

5. Mutta raja itAAn pAin on Suolai- 
nen meri Jordanin suuhun asti; ja 
raja pohjan puolella on siitA meren 
lahdesta, jossa on Jordanin suu. 

6. Se menee ylQs Bet-Hoglaan, ja 
I kulkcc pohjan puolelta Bet-Arabaa, 



231 



JOSUA 15. 



ja menee yl5s Rubenin pojan Boha- 
nin kiven lykO. Jos.i8:i7. 

7. Sitten ku ikee sc ylOs Debiriin Ako- 
rin laaksostaja kaHnlyy pohjanpuo- 
leen Gilgaliin, joka on Adummimin 
kukkulun kohdalla, joka on etelA 
puolclla jokca; sitlc se menec En- 
Semcksen vcdclle, ja ulos Hogelin 
lahtccllc. 

8. Sille menee raja Hinnomin -po- 
jan laaksoon, Jcbusilaiscn kukkulan 
etein puolella, se on Jerusalem; ja 
raja nousee vuoren kukkulalle. joka 
on Hinnomin laakson kohdalla 19n- 
tcenp^lin ja Refaimin laakson p59s- 
sS pohjaan p5in. 

9. Siite kfly se siilil vuoren Icukku- 
lasta Nefloakin Idhtcellet ja mene^ 
Efronin vuoren kaupunkein lykO, 
ja kndntyy Baalaan, joka on Kirjat- 
Jearim. 

lO.Baalasta k55ntyy selanteenpdin 
Seirin vuorelle, ja menee ponjan 
puolclla Jearimin vuoren vierilse, 
se on Kcssalon; ja siirtyy alas Bet- 
Seniekseen, ja menee Timnaan, 

11. ja tulee ulos Ekronin vieritse 
pohjan puolellcjavet&ypi Sikroniin 
asti, menee Baalan vuoren ylitse, 
ja tulee Jabneeliin; ja r^jah loppu 
on meri. 

12. >Iutta* raja 15nleen pAin on 
suuri meri ; se on rajana. TfimS on 
Juudan lasten maan raja joka ta- 
holta ympfiri, heid(in sukujensa jfll- 
keen. 

13. Mutta Kalebille, Jefunnen po- 

i'allGi annetliin osaksi Juudan lasten 
Leskellft^ niinkuin Herra oil kdske- 
nyt Josualle, Kirjat-Arba, Enakilais- 
ten isSh kaupunki, se on Hebron. 
4 Moos. 14:24. Jos. 14:138. Tuom. 1:20. 

14. Ja Kaleb ajoi sieltfi pois kolme 
Enakin poikaa, Sesain, Akimanin 
ja Talmain, Enakin lapset; 

4 Moos. 13:23. Tuom. 1:108. 

15. ja meni sieltfi ylds Debirin asu- 
vaisia vastaan. Debirin nimlolimui- 
nen Kirjat-Sefer. 

16. Ja Kaleb sanoi: ,Jo1ca lyO Kir* 
jat-Seferin ja voittaa sen, hSnellc 
annan mlnft tyttfireni Aksan val- 
moksi.'* 

17. Ja sen voitti Otnlel, Kenaksen, 
Kalebin veljen poika; ja bfin anloi 
tyttfirensS Aksan hfinelle vaimoksi. 

Tuom. 1:13. 3:9. lAik.4:13. 

18. Ja tapahtui, kun Aksa lull, neu- 
voi hfin miestdnsfi anomaan peltoa 
isftltft; ja hSn heittaysiaasinselifistd; 
niin sanoi Kaleb hfinelle : „mikfi si- 



nun on? 



1 Moos. 24:64. 



19. Ja hfin sanoi: ,,anna minullc 
siuhaus, sill& sinft olet antanut mi- 



nullc kuivan maan; anna mifiulle 
my5s vcsildhteitn.'' Ja hfin antoi hd- 
nellc Idhteitfl, korkeilla ja alhaisilla 
mailla. 

20. Tdmd on Juudan lasten suku- 
kunnan perintd, hcidSn sukujensa 
jAlkeen. 

21. Ja kaupungit Juudan lasten su- 
kukunnan Hilrimmnisessfi maassa, 
Edomin rajaIla,cteh1ss9.olivat: Kab- 
secl« Eder, Jagur, 

22. Kina, Dlmona, Adada; 

23. Kedes, Hasor. Jitnan; 

24. Sif, Telem, Bealot; 

25. Hasor-Hadata, Kerfjol, H6sron« 
se on Hasor; 

26. Amam, Sema« Molada; 

27. Hasargadda, Hesmon, Bet-pa- 
let; 

28. Hasarsual, Beerseba, Bisjotja; 

29. Baala, Ijim, Asem; 

30. Eltolad. Kesil, Horma; 

31. Siklag, Madmanna, Sansanna; 

32. Lebaot, Silhim. Ain, Rimmon: 
yhdeksUn kolmattakymmentS kau- 
punkia kylinens5. 

33. Mutta lakialla maalla oli Es- 
taol, Sora, Asna; 

34. Sanoa, Engannim, Tappuak, E- 
nam; 

35. Jarmut, Adullam, Soko, Aseka ; 

36. Saaraim, Aditaim, Gedera, Ge- 
derolaim : neljfltoistakymmentfikau- 
punkia kylinensft; 

37. Senan, Hadasa, Migdal-Gad; 

38. Dilean, Mispe, Jokteel; 

39. Lakis, Boskat, Eglon; 

40. Kabbon, Lakmas, Kitlis; 

41. Gederot, Bet-Dagon, Naama, 
Makkada: kuusitoistakynunentftkau- 
punkia kylinensft; 

42. Libna, Eter, Asan; 

43. Jiftak, Asna, Nesib; 

44. Kcgila, Aksib, Maresa: yhdek- 
sfin kaupunkia kylinensft; 

45. Ekron tyttarinensfi ja kylinensil ; 

46. Ekronista mereen asti, kaikki 
mikil ulottuu Asdodiin, ja niiden. 
kyiai; 

47. Asdodtyttfirinensftjakylinensfi; 
Gasa ty ttArinensfi ja kylinensil, Egyp- 
tin ojaan asti; ja se suuri men on 
sen rajana. 

48. Ja vuoristossa: Samir, Jatir, 
Soko; 

49.Danna, Kirjat-Sanna,8e.onDcbir; 

50. Anab, Eslemo, Anim; 

51. Gosen, Holon. Gilo: yksitoista- 
kymmentd kaupunkia kylinensft; 

52. Arab, Duma, Esean; 

53. Janum, Bet-Tappuak, Afeka; 

54. Humta. Kirjat-Arba, se on Heb* 
ron, Sior: yhdeksftn kaupunkia ky- 
linensft; 



232 



JOSUA 15. 16. 17.. 



55. Mfton, Karmel, Sif, Jula ; 
56 Jisreel, ^okdeam, Sanoak ; 

57. Kain, Gibea, Timna : kymme- 
nen kaupunkia kylinensfi; 

58. HalhuJ, Bet-Sur, Gedor; 

59. Maarat, BeUAnol, Eltekon: kuu- 
si kaupunkia kylinensS ; 

60. Kirjal-Baal,seoti Kirjal-Jearim, 
Harabba: kaksi kaupunkia kyli- 
nensfi; 

61. Jakorvessa: Bet-Araba, Middin, 
Sekaka: 

62. Nibsan, la suola-kaupunki , ja 
En-Gedi* kuusi kaupunkia kylinensfl. 

63. Multa Jebusilaiset asuival Je- 
rusalemissa, eikS Juudan lapset voi- 
ueet ajaa heitfi ulos. Ja Jebusilaiset 
ovat asuneet Juudan lasten kanssa 
Jerusalemissa tiihan p5ivfi9n asti. 

Tuom. 1*3. 2 Sam. &:6 8. 

x6 Luku. 

JoBefin lasten rajat 
Mfiin lankesi arpa Josefin lapsille : 
^^ Jordanista, Jerikon kohdalla, Je- 
rikon ildpuolisen veden tykO,sekor- 
pi, joka menee Jerikosta ylOs Bet- 
Elin m5keen. 

2. Ja raja Ifihtee Bet-Elistfi Lusiin, 
Ja menee Arkki-Atarotin rajnlle, 

Tuom. 1:26. 

3. ja antaupl alas Ifinteen pftin Jaf- 
letin rajalle, alemma Bet-Horonin 
nijaan ja Gaseriin asti; ja loppuu 
meressfi. 

4. Nflmfl saivnt Josefln lapsel, Ma- 
nasse ja Brraim, perinnOksi. 

5. Emiimin lapset saivatmaan-osan 
sukujensa jfilkeen, ja heidftn perin- 
tOnsft n^a itiiSn pfiin oli Atarot- 
Addar, ylimmfiiseen Bet-Horoniin 
asH, 

6. ja se aniaup! Ifinteen pfiin Mik- 
netatiin pohjanpuolella ; sieltfi kfifin- 
|yy se Hafin , Taenal-Silon puoleen, 
ja tnenee sen itfipuolella Janoakiin ; 
J.'ja Janoakista alas Ataroliin ja 
Naarataan, ja antaupi Jerikoa vas- 
laan ja menee Jordaniin. 

8.^ Tappuakista menee raja Ifinteen 
pflin nanalkaanaan, ja rajan pfifl on 
meressa. Tfimfi on Efraimin lasten 
sukukunnan perintO heidfin suku- 
jensa jAlkeen, 

9. ynnfi vielS ne kaupungit, jotka 
olivat eroitetul Efraimin lapsille kes- 
keim Manassen lasten perintOS. kaik- 
ki kaupungit kylinensfi. 

10. Mutta he elvfit njaneet Kananea- 
laisia pois« jotka nsuivnt Gaserissu. 
Niin pysyivfit Kananealaiset Efrai- 
min keskellfi tfihfin pfiivfifin asti ja 
tulivat veroUisiksi: jos. 17:13. 

Tuom. 1:28, I Kun« 9:16,21. 



17 Ltika. 

Manassen periiitO-^sa itfipnolella Jordania. 

J a arpa lankesi Manassen sukukun- 
nalfe, sillfi hSn oli Josefin esikoi- 
nen, Makirille, Manassen esikoiselle, 
Gileadin isfille, joka oli jalo sota- 
mtes ; ja hfin sai Gileadin ja Basanin. 
4 Moos. 26:29. 32:39 s. 5 Moos. 3:15. 

2. Muut Manassen lapset saivat 
myOs arvan sukujensa jfilkeen: A- 
bieserin lapset, Helekin lapsel, As- 
rielin lapsel, Sekemin lapsel, Hefe- 
rin lapsel ja Semidan lapset. Nfimfit 
ovat Manassen, JoseHn pojan, mie- 
henpuolisctlapsetsukujensa jfilkeen. 

S. Mutta Selofkadilla, Hcferin po- 
jalla, Gileadin pojan, Makirin pojan, 
Manassen pojan, ei ollut yhtfifin poi- 
kaa, vaan ty ttfirifi ; ja nfimfit ovat hfi- 
nen tytfirtensfi nimet: Makela, Noa, 
Hogla, Milka ja Tirsa. 

4 Moos. 26:33. 27:18. 86:108. 

4. Ja he menivfit papin Eleasarin 
ja Josuan,Nunin pojan, jaylimmfiis- 
ten tykO, ja sanoivat: „Herra kfiski 
Mooseksen antaa meille perinndn 
veljeimme keskellfi.** Ja hfin antoi 
heillekin perinnOn heidfin isfinsfi 
veljein keslcellfi, Herran kfiskyn jfil- 
keen. 4 Moos. 27:7,8. 

5. Ja Manasselle tuli kymmenen o- 
saa, paitsi Gileadin ja Basanin maata, 
jotka ovat tuoUa puolella Jordania; 

6. sillfi Manassen tyttfiret saivat pe- 
rinnOn hfinen poikainsa keskellfi, ja 
Gileadin man oli annettu muille Ma- 
nassen pojille. 

7. Ja Manassen raja oli Asscrista 
Mikmetaliin, joka on Sikemin edes- 
sfi, ja se menee elclfifinpfiin En-Ta- 
puaKin asuvaisten tykO. 

S. Tapuakin mna tuli Manasselle, 
mutta Tapuak, Manassen rajalla, Ef- 
raimin lapsille. 

9. Sitte raja menee alas Nahal-Kaa- 
naan, joen etelfipuolelle. Nfimfi kau- 
pungit olivat Efraimin omat Manas- 
sen kaupunkien keskellfi. Manassen 
nija oli pohjan puolella ojaa ja lop- 
pui mereen. Jos. 16:9. 

10. Efraimin maa on elelfin puolel- 
la, ja Manassen pohjan puolella, ja 
meri on sen raja; ja ne satluvat As- 
seriin pohjan puolella, ja Isaska- 
riin idfin puolella. 

11. Ja Manassella oli Isaskarissa ja 
Asserissa: Bet -Sean ja sen tyttfiret, 
Jibleam ja sen tyttfiret, Dorin asu- 
vaiset ja sen tyttfiret, Endorin asu- 
vaisel'ja sen tyttfiret, Taanakin asu- 
vaiset ja sen tyttfiret , ja Megiddoii 
asuvaiset ja sen tyttfiret, kolmen 
kukkulan maan. 



[FlnniBh] 8* 



239 



JOSUA 17. 18. 



12. MuttaMaiiassen lapset eivStvoi- 
neet ajaa niiden kaupunkien asu- 
vaisia ulos, vaan Kananealaiset ru- 
pesivat asumaan siinfi maassa. 

Tuom. 1:27 8. 

13. Mutta kun Israelin lapset vah- 
vistuivat, tekivdt he Kananealaiset 
verollisiksi , eivdtkd ajaneet heitd 
ollenkaan pois. 

14. Ja Josefin lapset puhuivat Jo« 
sualle ja sanoivat : „mikset minulle 
enempSfi antanut perinn6ksi, kuin 
vhden arvan ja osan ; ja minft olen 
kuitenkin suuri kansa, niinkuin 
Herra onf minut tShdn asti siunan- 
nul?" 

15. Niin Josua sanoi heille: „koska 
olet suuri kansa, niin mene metsfiSn 
ja raivaa siellfi itsellesi sij'aa, Fere- 
sildisten ja Refalaisten maalla, jos 
Efraimin vuori oh sinulle liian ah- 
das.*' 

16. Niin sanoi vat Jdsefin lapset: „ei 
\J\mSL vuori meille riitfi; ja kaikilla 
Kananealaisilla, jotka asuvat maan 
laaksoissa, ovat rautavaunul, niillH, 
jotka asuvat Betseanissa ja sen tyt- 
tdriss9, ja niilld, jotka Jisreelin laak- 
sossa asuvat.** Tuom.i:i9. 

17. Josua puhui Josefin huoneelle, 
Efraimille ja Manasselle, sanoen: 
ifSinfl olet suuri ja vfikevS kansa, ei 
sinulla ole ainoasti yksi arpa ; 

18. si}]fi vuori on oieva sinun oma- 
si. Koska se on metsfimaata , niin 



raivaa se, ja sinfi saat sen dfiret o- 
maksesi; slllS sind ajat Kananea- 
laiset pois, vaikka heillft on rauta- 



ills sinft ajat Kananea 
vaunuja, ja vaikka he vftkevfit ovat. 



iSLuku. 

Todistukaen-majfl Silossa. Edelleen maan 
jakamista. Beojaminin osa. 

J a Israelin lasten koko senrakunta 
kokoontui Siloon ja pystytti siellfl 
todistuksen-majan; ja maa oli heil- 
le alamainen. Jer.7:i2. 

2. Ja oli vieia jmillfi Israelin lap- 
sista seitsemSn sukukuntaa, joiden 
perintO ei oUut jaettu. 

3. Ja Josua sanoi Israelin lapsille : 
^kuinka kauan olette niin hitaat, et- 
tette mene omistamaan maata, jon- 
ka Herra, isSinne Jumala, teille on 
antanut. 

4. Ottakaat jokaisesta sukukunnas- 
ta kolme miestS, minft lahetfin hei- 
d9t menem§5n ja vaeltamaan maan 
lavitse, elta he merkitsisivflt sen kir- 
jaan kunkin perintd-osan mukaan, 
ja palajaisivat minun tykOni. 

5. Ja lakakaat maa seilsemfiftn o- 
saan. Juuda pysykOOn alueellansa 



etcliln puolella, ja Josefin huone py- 
syk5dn alueellansa pohjan puolella. 

6. Mutta kinoittakaat te maa seilse- 
mSiin osaan ia tuokaat tSnne minul- 
le, niin mind heitSn teille arpaa tdssft 
Herran,meidt\n Jumalamme cdessll. 

7. Silia Leviiaisiim ei ole yhtakfian 
osaa teidftn keskellAnne, vaan Her- 
ran pappeus on heidAn perint5-osan- 
sa. Mutta Gad ja Ruben, ja puoli 
Manassen sukukuntaa ovat saaneet 
osansa tuolla puolen Jordania, it&i- 
sella puolella; jonka Mooses, Her- 
ran palvelija, antoi heille.** 

4 Moos. 18:208. 32:33. 5Mooft.lO:9. 16:2. 

Jo8. 13:14. 

8. Niin miehet nousivat ja l&ksivfit 
matkaan ; ja Josun kfiski niitfi, jotka 
menivdt kirioittamaan maata« Ja sa- 
noi: „vaeltaKaat maan Iflvitse ja kir- 
joittakaat se, ja tulkaat takaisln mi- 
nun tykOni, ja minfi heitSn tfissfi teille 
arpaa Herran edessil Silossa.*' 

9. Ja miehet Idksiv&t, vaelsivat maan 
Ifivitse Ja kirjoittivatsen kirjaan,seit- 
semfiSn osaan, kaupunkein jfilkeen, 
ja tulivat Siloon, JosuantykOleiriln. 

10. Ja Josua heitti Silossa arpaa 
heille Herran cdessfi: ja Josua jalcoi 
siinfi maan Israelin lapsille, heid&n 
osansa jfilkeen. 

11. Ja Benjaminin lasten-sukukun- 
nalle lankesi arpa heictfin sukujensa 
jfilkeen ; ja hei.afin arpansa aluo oli 
Juudan lasten ja Josefin lasten vft- 
lissfi. 

12. Ja heidfin pohjainen r^jansa 
Ifiksi Jordanista, ja meni ylOs Jeri- 
kon viertfi myOten pohjan puolella, 
la nousi vuorella Ifinteen pfiin, Ja 
loppuu Bet-Avenin korpeen. 

13. Sieltfi raja juoksi Lusiin, elelA 
puolelle Lusia , se on Betel , ja las- 
kee Atarot-Adaniin sillfi vuorella, 

ioka on etelfipuolella alempaa Bet- 
ioronia. l Moos. 2S:iy. 

14. Sitte meni raja niin.ettfisekfifin- 
tyy Ifinteisellfi kulmallaetelfifin pfiin 
siitfi vuoresta, joka on Bet-Horonin 
etelfipuolella, ja loppuu Kirjat-Baa- 
lin tyk6nfi, se on Kirjat-Jearim, Juu- 
dan lasten kaupunki. Tfimfi on Ifin- 
nen-puolinen kulma. 

15. Mutta etelfinpuolinen kulma on 
Kirjat-Jearimin fifirestfi, ja raja lop- 
puu Ifinteenpfiin , ja menee NcAoa- 
kin Ifihteelle, Jos. 15:9. 

16. jalaskeesenvuorcn fifireen.joka 
on Hinnomin lasten laakson edessfi, 
Refaimin laaksossa, pohjan puoleen, 
ja menee Hinnomin laaksoon Jebu- 
silaisen kukkulan etelfinpuoleUa ja 
alas Rogelin Ifihteelle, Jos. 15:7b. 

17. ja antaupi pobjoiseen pfiin, Ja 



234 



JOSUA 1$. 19. 



juoksee Ensemckseen , menee Geli- 
loliin, jeka on vastapfifitS Adum- 
mim-mdkc5, ja laskee Bphanin* Ru- 
hcnin pojun Kiven tykd, Jos. 15:6. 

18. ja nieiice lakeuden vieritsepoh- 
juan pain, laskee alas lakeudelle, 

19. menee Bet-Ho^lan vieritse poh- 
jan puolella« ja raja loppuu Suolai- 
sen meren pohjoisecn lahteen, Jor- 
(ianin etelS panhdn. TdmA on ete- 
lan-puolinen raja. Jos.l3-.2. 

20. Mutta itapuolella oli Jordan ra- 
jana. TSimSk on Benjaminin lasten 

Eerintd-osa rajoinensa ylt'ympfiri, 
cidfm sukujensa jUIkeen. 

21. Mutta namdt ovat Benjaminin 
laslen sukukunnan kaupungit hei- 
dan sukujensa jJllkeen : Jeriko, Bel- 
Hogla, Emek-Resis; 

22. Bcl-Araba, Semaraim, Betel; 

23. Avim, Para ja Ofra ; 

24. Kafar-Ammoni, Ofn! ja Gaba: 
kaksitoistakymmentd kaupunkiaky- 
linensS; 

25. Gibeon, Rama ja Beerot; 

26. Mispe, Kefira ja Mosa ; 

27. Rekem, Jirpeel ja Tarala; 

28. Sela, Elef, ja Jebus, se on Je- 
rusalem, Gibeat, Kirjat: neljStoista- 
kymmentS kaupunkia kylinensS. 
TAma on Benjaminin lasten perin- 
t6-osa heid^n sukujensa j&lkeen. 

1 9 Luku. 

SimeoDln, Sebulonin, Isaskarin, Asserin, 
Kaftalin, Danin perintO-osat. Josuan eri- 
koinen osa. 

Toinen arpa lankesl Simeonin las- 
/- ten sukukunnalle, heiddn suku- 
jensa jaikcen : ja heidiln perintCnsa 
oli keskeim Juudnn lasten perintdA. 

1 Af oos 49*7 

2. Ja heidan perittfivfiksensd tiili 
Beerseba. Scba ja Molada ; 

3. Hasar-Sual, Bala ja Asem ; 

4. Eltolad, Betul ja Hornia ; 

5. Siklag, Bet-Hammarkabot ja Ha- 
sar-Susa ; 

6. Bel-Lebaot jaSaruhen: kolmetois- 
takymmenta kaupunkia kvlinensA; 

7. seka Ain, Rimmon, E'ter ja A- 
san- nelja kaupunkia kylinensa; 

8. siihen myOs kaikki kyiat , jotka 
naiden kaupunkein ymparilia ovat, 
Baalat-Beenin, ja etehlmaan Rama- 
liln asli. Tamil on Simeonin lasten 
sukukunnan perintd, heidan suku- 
jensa jnikcen. 

9. Keskelia Juudan lasten osaa on 
Simeonin lasten perinta; silia Juu- 
dan lasten osa oh beille liian suuri, 
sentahdcn perivat Simeonin lapset 
wan keskelia heidan perintddnsa. 



i' 



10. Kolmas arpa lankesl Sebulonin 
lasten sukukunnalle , Jieidan suku- 
jensa jaikeen, ja heidan perintdnsa 
raja oli Saridiin asti. 

11. Ja heidan rajansa nousi lantecn 
pain Maralaan, ja ulottuu Dabbase- 
tiin ja siihen jokeen, joka juoksee 
Jokneamin ohitse; 

12. ja kaantyy Saridista Itaan pain, 
auringpn nousuun pain, Kislot-Ta- 
borin rajalle, menee Dabratiin, ja 
nousee Jufiaan; 

13. ja menee sielta itaan pain Gat- 
Heferiin, Et-Kasiin, ja loppuu Rim- 
moniin, joka ulottuu Neaan asti; 

14. ja raja kiertaa sen pohjan puo- 
lella Hannatonia,ja loppuu J ifla-Kc* 
lin laaksoon; 

15. Kattat, Nahalal, Simron, Jidala 
a Betlehem: kaksitoistakymmenta 

aupunkia kylinensa. 

16. Tama on Sebulonin laslen pe- 
rint6, heidan sukujensa jaikeen, na- 
ma heidan kaupunkinsa ja niiden 
kyiat. 

17. Neljfis arpa lankesi Isaskarille, 
Isaskarin lapsillc, heidan sukujen- 
sa jaikeen. 

18. Ja heidan alueensa oli lisreel, 
Kesullot ja Sunem ; 

19. Hafaraim, Sion ja Anaharat; 

20. Rabbit, Kisjon ja Abes; 

21. Eemet, £n-Gannim, £n-Hadda 
ja Bet-Fascs; 

22. ja raja ulottuu Taboriin, Saha- 
simaan, ja Bet-Semeksecn; ja hei- 
dan rajansa loppuu Jordaniin: kuu- 
sitoistakymmenta kaupunkia kyli- 
nensa. 

23. Tama on Isaskarin lasten suku- 
kunnan perint6, kaupungit jak^iat 
heidan sukujensa jaikeen. 

24. Viides arpa lankesi Asserin las- 
ten sukukunnalle, heidan sukujen- 
sa jaikeen. 

23. Ja heidan rajansa oli: Helkat, 
Hali, Belen ja Aksaf ; 

26. Allammelck, Amad ja Miseal, 
ja ulottuu Karmeliin lunteen pain, 
ja Sihor-Libnaliin; 

27. ja kaantyy auringon nousua 
kohti Bet-Dagoniin, sattuu Sebulo- 
niin ja Jifla-Elin laaksoon, pohjan 

f>uolclla Bet-Emekia ja Negielia. ja 
oppuu Kabulin tyk5na vasemmalla 
puolella, 

28. jaEbroniin, Rehobiin, Hammo- 
niih ja Kanaan, aina isoon Sidoniin 
asti; 

29. ja raja kaantyy Raman puoleen, 
aina vahvaan kaupunkiin Soriin as- 
ti , ja palajaa Hosaan'pain, ja lop- 
puu mereen Aksibin seuduilla; > 

30^ Umma, Afek ja Rehob; kaks(- 



235 



JOSUA 19. 20. 21. 



kolniattakymmenta kaupunkia ky- 
linens^. 

31. TflmS on Asserin lastcn suku- 
kunnan perint6, heidati sukujensa 
jftlkeen, nama heidSn kaupunkin- 
sa ja niiden kylSI. 

32. Kuudes arpa lankesi Kaflalin 
lapsille, heidan sukujensa jaikeen. 

33. Ja heidan rajansa oli Helefisia, 
Saananimin lammesta ja Adami- 
Nekeb, ja Jabnecl, Lakkumiin asti, 
ja loppuu Jordaniin. 

34. Ja raja kaantyy lannen puolecn 
Asnot-Taboriin , ja tulee sielia ha- 
maan Hukkoklln, ja koskee eleliln 
puolella Sebuloniin ja mnnen puo- 
iella Asseriin ja Juudaan Jordanin 
tykOna idanpuolella. 

35. Ja vahval kaupungit oval: Sid- 
dim, Ser, Hainmal, Rakkal ja Kin- 
nerel, 

36. Adama, Rama ja Hasor, 

37. Kedes, Edrei ja En-Hasor, 

38. Jircon, Migda-EI, Harem, Bet- 
Anat ja Bel-Semes : jhdeksanloisla- 
kymmenia kaupunkia kylinensa. 

39. Tama on Naflalin laslen suku- 
kunnan perinlO, heidan sukujensa 
jaikeen, kaupungil ja niiden kyiai. 

40. Seilsemas arpa lankesi Dan in 
laslen sukukunnalle, heidan suku- 
jensa jaikeen. , ^ 

41. Ja heidan perinlOnsa raja oK 
Sorea, Eslaol ja Ir-Semes, 

12. Saalabbin, Aijalon ja Jilla, 

43. Elon, Timnala ja Ekron, 

44. Elleke. Gibbelon ja Baalal, 

45. Jihud, Bene-Berak ja Gal-Bim- 
mon, 

46. Me-Haijarkonia Rakkon, ja paik- 
kakunta Jafon kondalla. 

47. Ja Danin laslen raja kavi vieia 
elemmaksi. Ja Danin lapsel nousi- 
vat ja sotival I^semiS vaslaan, voil- 
tivat sen ja ISivai sen miekan lerai- 
la, valloillivat sen ja asuival siina, 
ja kulsuival Lesemin Daniksi, isan- 
sa Danin nimelia. Tuom.i:3^. 18-27 8. 

48. Tama on Danin laslen sukukun- 
nan perinia , heidan sukujensa iai- 
keen. nama kaupungit ja niiden 
kyiat. 

&, Ja kun he olivat lakanneet ja- 
kamasla maata rajojensa mukaan, 
anloivat Israelin lapsel Josualle,Nu- 
nin pojalle, perinnfin keskeliansa, 

50. Ja anloival hanelle Herran kas- 
kvn mukaan sen kaupungin, jola 
han anoi, Timnal-Serakin Efraimin 
vuorella: sielia hanrakensikaupun- 
gin ja asui siina. 

51. Namai oval nc perinnai, jolka, 
pappi Eleasar ja Josua, Nunin poi- 
ka, ja ylimmais^t Israelin laslen su- 



kukunlain isisia arvalla jakoivat Si- 
lossa Herran edessa, seurakunnan 
majan ovella; ja niin he lopetlivat 
maan jakamisen. 

20 Luku. 

Euusi vapaakaupunklR. 

J a Herra puhui Josuallc ja sanol: 
2. „Puhu Israelin lapsille, sanoen: 
maaraiuaai vapaakaupungit, joisla 
mina olcn leille puhunulMooseksen 
kaulta; 2Moos.21:13. 4Moo8. 35.-98. 

5 Moos. 19:2 s. 

3. elia sinne saisi paela miehenlap- 
paja, joka 1yd jonkun lapalurmasla 
ja lieiamaua, elta ne olisival teillc 
l^rvapuikoiksi vcrcn koslajalla. 

4. Ja joka pakcnee johonkuhun 
niisia kaupungeista , Mnen piiaa 
seisoman ulkona kaupungin porlin 
edessa ja puhuman asiansa laman 
kaupungin vanhimmille, ja naiden 
lulee otlaa hanel kaupunkiin lykGn- 
sa ja antaa hanelle sijaa, elia han 
saa asua heidan luonansa. 

5. Ja kun veren koslaja ajaa hanta 
lakaa, niin eivai he saa anlaa mie- 
henlappajaa hancn kasiinsa, koska 
han lieiamaua 15i lahimmaisensaei- 
ka ollul ennen hanenvihamiehensS. 

6. Ja asukoon han siina kaupungis- 
sa. siksi kuin hHn seisoo seurakun- 
nan oikeuden edessa, ^limmaisen 
papin kuolemaan astl, joka siihen 
aikaan on; sille miehenlappiga pa- 
latkoon ja tulkoon kaupunkiinsa ja 
huoneescnsa, kaupunkim, josta hdn 
pakeni. 4 Moos. 35-12. 

7. Ja he pyhillivat Kedeksen Gali- 
Icassa, Nartalin vuorella, ja Sikemm 
Efraimin vuorella, ja Kirjal-Arban, 
se on Hebronin, Juudah vuorella; 

8. ja tuolla puolella Jordania, Je- 
rikon kohdalla, iiaan pain, maflrfi- 
sivai he Beserin, korvessa lakialla 

'kcdolla. Rubenin sukukunnasla ; ja 
RamolinGileadissa,Gadin sukukun- 
nasla, ja Golanin Basanissa, Manas- 
sen suKUkunnasla* 5 Moos. 4:418. 

9. Namai olival ne kaupungil, jot- 
ka maaraitiin kaikille Israelin lap- 
sille ja muukalaisillc, jolka heidan 
keskeliansa asuival, ctta sinnc pake- 
nisi jokainen, joka jonkun tapatur- 
masta 16i. cllei han kuolisi veren- 
koslajan kaden kaulla, ennen kuin 
han seisoisi seurakunnan edeSsft. 

21 Luku. 

Kabdeksau vlidett&kymmentft Levilftis- 
kaupankia. 

Ta Leviiaislen ylimmAiset isAt me- 



nivAt papin Eleasarin Ja Josuan, 



236 



JOSUA 21. 



Nunin pojan, eteen, ja Israelin las- 
ten sukukuntain ylimmAisten isfiin 
eleen, 

2. ja puhuttelivat heita Silossa Ka- 
naanmaalla ja sanoivat: ^Herrakfts- 
ki Mooseksen kautta antaa meille 
kaupungeita asuaksemme, ja niiden 
esikaupungit karjallemme/' 

Jos. 18:1. 4 Moos. 35:1 8. 

3. Ja Israelin lapset antoival Levi- 
ISisille perinnOstnnsS , Herran kfis- 
kyn mukaan , nSmfi kaupungit esi- 
kaupunkeinensa : 

4. Ja arpa lankesi Kehatilaislen su- 
vuille; ja pdpin Aaronin lapsel Le- 
vilaisist5 saivat arvalla Juudan su- 
kukunnasia, Simeonin sukukunnas-^ 
la ja Benjaniinin'sukukunnasta kol- 
meloista kaupunkia. 

5. Multa muflle Kehatin lapsilletuli 
nrvalla Efraimin sukukunnasta, Da- 
nin sukukunnasla ja puolesta Ma- 
nassen sukukunnasla kymmenen 
kaupunkia. 

6. Gersonin lapsille tuli arvalla I- 
saskarin sukukunnasla, Asserln su- 
kukunnasla, Naflalin sukukunnasla 
ja puolesia Manassen sukukunnasla 
Hasanissa kolmetoista kaupunkia. 

7. Merarin lapset sukujensajaikeen 
saival Rubenin sukukunnasla, Ga- 
(lin sukukunnasla ja Sebulonin su- 
kukunnasla kaksiloisia kaupunkia. 

8. Ja Israelin lapsel anioival Levi- 
iSislIle arvalla nilm9 kaupungil csi- 
kaupunkeinensa, niinkuin Herra 
Mooseksen kaulta oil kdskenyl. 

9. Juudan laslen sukukunnasla ja 
Simeonin laslen sukukunnasla an- 
nelliin nSma kaupungil, jotka ni- 
melts nimiteltiin, 

10. Aaronin pojille, jotka olivat Ke- 
hatilaislen sukua Levin poikia; sillA 
ensimmainen arpa oil heidan. 

lAik. 6:54 s. 

11. Heille antoival he Arban, Ena- 
kin isan, kaupungin, se on Hebron, 
Juudan vuorella, ja esikaupungit 
ymp5risl61tfi. Jos. 14:15. 15:13. 

12. Mutia kaupungin pellon kyli- 
nensa antoival he Kalebille, Jefun- 
nen pojalle, perinndksi. Jos. 14:13 s: 

lAik.6:56. 

13. Papin Aaronin lapsille antoival 
ne miehenlappajaln vapaakaupun- 
RinHebronin esikaupunkeinensa ja 
Libnan esikaupunkeinensa, 

Jos. 20:7. lAIk.6:57R. 

14. Jallirin esikaupunkeinensa ja 
Estmoan esikaupunkeinensa, 

15^ Holonin esiKaupunkeinensa ja 
Debirin esikaupunkeinensa, 

16. Ainin esikaupunkeinensa , Jut- 
laan esikaupunkeinensa ja Bet-Se- 



meksen esikaupunkeinensa : yhdek- 
san kaupunkia niislfi kahdesta su- 
kukunnasla; 

17. Benjaminin sukukunnasla Gi- 
beonin esikaupunkeinensa jaGeban 
esikaupunkeinensa, 

18. Analolin esikaupunkeinensa ja 
Almonin esikaupunkeinensa: nelja 
kaupunkia. 

19.Kaikki panpein,Aaron{n poikain, 
kaupungit olivat kolmetoista ja nii- 
den esikaupungit. 

20. Multa muul Kehatilaislen suvut, 
Leviiaiset, Kehatin lapset, saivat ar- 
pansa kaupungit Efraimin sukukun- 
nasla. 

21. Ja he antoival heille miehen- 
lappajan vapaakaupungin Sikemin 
esikaupunkeinensa, Efraimin vuo- 
rella. ja Geserin esikaupunkeinensa, 

22. Kibsaimin esikaupunkeinensa 
ja Bet-Horonin esikaupunkeinensa* 
nelja kaupunkia. 

23. JaDanin sukukunnasla Elteken 
esikaupunkeinensa, ja Gibeonin esi- 
kaupunkeinensa, 

24. Aijalonin esikaupunkeinensa, 
Gat-Rimmonin esikaupunkeinensa: 
nelja kaupunkia; 

25. puolesia Manassen sukukunnas- 
la Tanakin esikaupunkeinensa ja 
Gat-Rimmonin esikaupunkeinensa: 
kaksi kaupunkia. 

26. Kaikki naiden Kehatin laslen 
sukukuntain kaupungit esikaupun- 
keinensa olivat yhteensfi kymmenen. 

27. Gersonin lapsille, jolka olivat 
Leviiaislen sukuja, annetliin puo- 
lesia Manassen sukukunnasla mie- 
henlappajan vapaakaupunki Golan, 
Basanissa , esikaupunkeinensa ,. ja 
Beeslera esikaupunkeinensa: kaksi 
kaupunkia. 

28. Isaskarin sukukunnasla Kision 
esikaupunkeinensa, Daberat esikau- 
punkeinensa, 

29. Jarmut esikaupunkeinensa ja 
En-Gannim esikaupunkeinensa: nel- 
ja kaupunkia. 

30. Asserin sukukunnasla Miseal e- 
sikaupunkeinensa , Abdon esikau- 
punkeinensa, 

31. Helkat esikaupunkeinensa ja Re- 
hob esikaupunkeinensa : nelja kau- 
punkia. 

32. Naflalin sukukunnasla miehen- 
tappajan vapaakaupunki Kedes, Ga- 
lileassa, esikaupunkeinensa, ja Ham- 
mol-Dor esikaupunkeinensa, Kartan 
esikaupunkeinensa: kolme kaupun- 
kia. 

33. Kaikki Gersonilaisten sukukun- 
tain kaupungit olivat kolmetoista ja 
niiden esikaupungit. 



237 



JOSUA 21. 22. 



34. Toisille LevilSisiHe, Merarin las- 
ten suvuille,annettiin Sebulonin su- 
kukunnastaJokncam esikaupunkei- 
nensa ja Kartta esikaupunkeinensa, 

35. Dimna esikaupunkeiiiensa. Na- 
halal esikaupunkeinensa: neljakau- 
punkia. 

36. Rubenin sukukunnasta Beser 
esikaupunkeinensa ja Jaksa esikau- 
punkeinensa, lAik. 6:788. 

37. Kedemot esikaupunkeinensa ja 
Mefnat esikaupunkeinensa: neljii 
kau punkia. 

38. Gadin sukukunn.ista miehen- 
tappajan vapaakaupunki Rainot,Gi* 
leadissa, esiKaupunkeinensa ja Ma- 
hanaini esikaupunkeinensa, 

39. Hesbon esikaupunlceinensa ja 
Jaser esikaupunkeinensa: kaikki nel- 
jn kaupunkia. 

40. Kaikki n9m5t kaupungit saivat 
LevilAistcn muut suvut, Merarin lap- 
set, ja heidan arpansa oli kaksitois- 
ta kaupunkia. 

41. Kaikki Levilfiistcn kaupungit 
Israel in lasten perinnOn keskelliloli- 
vat kahdeksan viidetldkymmenlil ja 
niiden esikaupungit. 4 Moos. 35:7. 

42. Ja ilsekullakin kaupungilla oli e- 
sikaupunkinsavmp3rist6ll5ns3;niin 
oli kaikilla niillft kaupungeilla. 

43. Ja niin anloi Herra Israelin lap- 
sille kailccn sen maan, jonka hdn 
oli valnlla luvannut antaa heidSn 
isillensfl; ja he omistivat sen jaasui- 
vat siin5. iMoos. 12:7. 13:15. 15:18s. 

26:3 s. 28:13. Jos. 1:3 s. 

44. Ja Herra antoi heille levonkaik- 
kialla ylt'ympSri; niinkuin hdn oli 
vannonut heidSn isiUcns^i; eikS yk- 
sik5Snkaikistaheiddnvihollisistansa 
scisonut heidSn edessdnsd^vaan kaik- 
ki heidan vihollisensa antoi Herra 
heiddn kSsiinsd. 

45. Eika jaanyt taj;tt3ninilft yksi- 
kaan sana kaikista niista hy vista sa- 
noista, jotka Herra oli puhunut Is- 
raelin huoneelle , vaan Kaikki kavi 
toteen. Jos. 23:14. lKun.8:56. 

22 Luku. 

Alttari Jordanin rannalia. 

Silloin kutsui Josua tykfinsa Rube- 
nilaiset, Gadilaiset ja puolen Ma- 
nassen sukukuntaa, 
2. ja sanoi heille: „te olette pita- 
neet kaikki, mita Mooses, Herran 
palvelija, teille kaski, ja olette kuul- 
leet minun aaneni kaikissa, mita 
mina olen teille k^skenyt. 

4 Moos. 32:20 B. 6 Moos. 3:18 s. Jos. 1:128. 

8. Ette ole hyljanoeet veliianne tai- 

la pitkaua ajalla tahan palvaan astl, 



ja te olette piianeet Herran, teidan 
Jumalannc, kaskyn. 

4. Ja nyt on Herra, teidan Juma- 
lanne,antanutveljillennelevon,niin- 
kuin han sanoi heille; palatkaat siis 
nyt ja menkaat majoihinne perintd- 
maahanne,jonkaMooses, Herran pal- 
velija, antoi teille tuoUapuolella Jor- 
dania .4 Moos. 32:33. 5Moos.3:12s. Jos.l3.S. 

5. Ainoastaan ottakaat visusti vaa- 
ri, etta teette sen kaskyn ja lain jai- 
keen, minka Mooses, Herran palve- 
lija, on teille kaskenyt, etta rakas- 
tatte Herraa, teidan J umalaanne.ja 
vaellatte kaikissa hanen teissansa, 
ja pidatte hanen kaskynsa, ja rii- 

Eutte hanessa kiinni, ja palvelettc 
anta kaikesta sydammestanne ja 
kaikestasielustannet*5Moss. 10:12. 13:4. 

6. Niin Josua siunasi heita ja an- 
toi heidan menna, ja he menivat 
majoihinsa. 

7. Manassen puolelle sukukunalle 
oli Mooses antanut perinnan Basa- 
nissa, ja loiselle puolelle antoi Jo- 
sua heidan veljeinsa keskella taiia 
puolclla Jordania lanteen pain. Ja 
Kun Josua antoi heidan menna ina- 
joihinsa ja siunasi heita, 

Jos. 17:1s. 18:7. 

8. puhui han heille, sanoen* ,.te 
tulette kotia majoihinne suurella 
saaliilla ja sangcn suurella karjalau- 
malla, hopialla, kuUalla, vaskella, 
raudalla ja aivan paljoilla vaalteil- 
la ; niin jakakaat vinamiestenne saa- 
lis veljeinne kanssa.*' 4Moos. 31:26s. 

1 Sam. 30:24. 

9. Ja niin palasivat Rubenilaiset ja 
Gadilaiset ja puoli Manassen suku- 
kuntaa. ja laksivat Israelin lasten 
tykoa Silosta, joka on Kanaanmaal- 
la, mcnemaan Gileadin maahan, pe- 
rintamaahansa , jonka he olivat o- 
maksensa saaneet Herran kaskyn 
mukaan Mooseksen kautta. 

10. Ja kun he tulivat Jordanin a- 
lueille, jotka Kanaanmaassa ovat, 
rakensivat Rubenilaiset, Gadilaiset 
ja puoli Manassen sukukuntaa siina 
lahelle Jordania suuren alttarin. 

11. Ja Israelin lapset kuulivat sa- 
nottavan: ,,katso, Rubenin lapset, 
Gadin lapset ja puoli Manassen su- 
kukuntaa ovat rakentaneet alttarin 
Kanaanmaan kohdalla , Jordanin 
seuduilla, vastapaata Israelin lapsiat' 

12. Kun Israelin lapset kuulivat sen, 
kokoontui koko Israelin lasten seU- 
rakunta Siloon, menemaan yl6s so- 
timaan heita vastaan. 

13. Ja Israelin I{ipset lahettivat Ru- 
benilaisten ja Gadilaisten ja puolen 
Manassen sukukunnan tyk5 Gileadin 



238 



JOSUA 22. 



nmalian PInehaan, papin Eleasarin 

pojan, 4 Moos. 25:7. 

14. ja kymmenen ylimmflistfl p&S* 
miestfi hSnenkanssansa. yhden Isfin- 
sfi huoneen pfiftmiehen kustakin Is- 
raelin sukukunnasla; nSmSt olivat 
kukin is3insil huoneen pSSmies Is- 
Taelin tuhanlen joukossa. 

15. Jahe tuHvat Rubcnilaisten, Ga- 
diloislen ja puolen Manassen suku- 
kunnan tykO Gileadin maahan ja 
puhuivatheidfin kanssansa, sanoen : 

16. ,,N5in koko Herran seurakunta 
kfiski leillesanoa: ,mink3tfihden o- 
jelte nSin rikkoneet Israelin Juma- 
laa vaslaan , kun oletle kaantyneel 
(Snapaivand pois Herrasta.rakentaen 
teillc alltaria, ja olette asetluneet tfi- 
napaivanS Herraa vaslaan? 

1/. VahakO meillfi on Peorin syn- 
nista, josta emme olc puhtaat vieU 
t&nakaan pfiivfind, ja josta rangais- 
lus tuli Herran kansan pSaile? 

4 Moos. 25'3 8. 6 Moos. 4:3. 

18. Ja te, te kaannytte tflnfipfiivanft 
pois Herrasta ! ja on tapahtuva, kun 
te panette itsenne tfinfipanfl* Herraa 
vastaan, niin hSn huomenna vihas- 
tuu koko Israelin seurakuntaan. 

19. Malta jos teidSn perintOmaanne 
olisi saastainen, niin tulkaat tSnne 
ylitse Herran perintOmaahan, jossa 
Herran maja on, ja ottakaat perlntO 
meidfin keskellfimme, mutta filkaat 
a3ettuko Herraa vastaan ja meita vas- 
taan, rakentaen itsellenne alttarin, 
toisen paitsi Herran, meiddn Juma- 
lamme, alttaria. 

20. £ik6 Akan, Serakin poika, teh- 
nyt suuresti syntifi kirotussa tava- 
nissa, ia viha tuli koko Israelin ylit- 
se? eika hfin yksinflnsA hukkunut 
synnissansa !'* Jos. 7:1 s. l Aik. 2:7. 

21. Silloin vastasivat Bubenin ja 
Gadiir lapset ja se puoli Manassen 
lukukuntaa ja sanoivat Israelin tu- 
hjnten paamiehille : 

22. „Herra, vfikevS Jumala, Herra. 
vSkeva Jumala tietflA sen, ja Israel 
myds itse tietfikOOn: jos me uppi- 
mskaisuudesta ja uskottomuudesta 
olemme tehneet Herraa vastaan, — 
mia m aula meitfi tanftpaivfinai - 

Ps.50:l. 

23. jos olemme alttarin rakentaneet,' 
kflfintyfiksemme pois Herrasta jauh- 
rataksemme sen pSfillfi poltto-uhria 
[a ruoka-uhria, laikka^ehdaksemme 
kiitosutiria sen pAflllfi, niin etsikddn 
sitft Herra! 

24. £mmek5 olisi paljon enemmin 
sitfi tehneet pelvosta, syvstfi, sanoen : 
.▼asledes sanovat ehka teidftn lap- 
s^one meidfln lapsillemme: ,mita 



leidfln on tekemista Herran, Israe- 
lin Jumalan, kanssa? 

25. Herra on pannut Jordanin ra- 
iaksi meidan ja teidan vaiille, teRu- 
benin ja Gadin lapset, ei ole teilla 
yhtaan osaa Herrassa!* ja niin tei- 
dan lapsenne saaltavat meidUn lap- 
semme pois Herraa pelkaamasta. 

26. Scntahden me sanoimme* tch- 
kaamme tama, rakcntakaamme alt- 
tari, ei poltto-uhriksi eika teuras- 
uhriksi, 

27. vaan lodistukseksi meiddn ja 
teidan vaiille, ja sukummc vaiille 
meidan jaikeemme, etia tekisimme 
Herran palvelusta hanen edessansH 

{>oltto-unreillamme, teurasuhreil- 
amme ja kiitosuhreillamme; ettei 
teidan lapsenne vasta sanoisi mei- 
dan lapsillemme: ,ei ole teilia yh- 
taan osaa Herrassa!* iMoos.3i:48. 

Jos. 24:27. 

28. Me ajattelimme: kun he niin 
sanovat meille taikka lapsillemme 
vastedes, niin me voimme sanoa: 
.katsokaat Herran alttarin kuvaa, 
Jonka vanhempamme tehneet ovat, 
ei poltto-uhriksi eika teurasuhriksi, 
vaan lodistukseksi teidan ja meidiln 
vaiilia.' 

29. Kaukana olkoon sc mcista, etlu 
asettuisimme Herraa vastaan, ja 
kaantyisimme tanapaivana pois ha- 
nesta, rakentamalla alttarin polllo- 
uhriksi, ruoka-uhriksi ja teurasuh- 
riksi, paitsi Herran, meidan Juma- 
lamme, alttaria, joka on hanen nia- 
jansa edessa.** 

30. Kua pappi Pinehas ja kansan 
ylimmaiset jalsraelin tuhanlen paa- 
miehet, jotka olivat hanen kanssan- 
sa, kuulivat namat sanat, jotka Ru- 
benin, Gadin ja Manassen lapset sa- 
noivat; olivat ne varsin heidan mie- 
leensa. 

31. Ja Pinehas, papin Eleasarin 
poika, sanoi Rubenin, Gadiil ja Ma- 
nassen lapsille: „tanapan^ olemme 
ymmartaneet Herran olevan meidan 
kanssamme, koska ette taiia rikko- 
neet Herraa vastaan; nyt te vapah- 
ditte Israelin lapset Herran kadesia.** 

32. Niin meni Pinehas, papin Elea- 
sarin poika, ja ylimmaiset Gileadin 
maalta, Rubenin ja Gadin lasten ty- 
koa, Kanaanmaahan jaileen Israelin 
lasten tykOja toivatheillevastauksen. 

33. Ja se kelpasi hyvin Israelin lap- 
sille, la Israelin lapset kunnioittivat 
Jumalata eivatka enaa ajatelleetsin- 
ne menna heita vastaan sotavaelia 
havittamaan maata, jossa Rubenin 
ja Gadin lapset asuivat. 

34. Ja Rubenin ja Gadin lapset an- 



239 



JOSUA 22. 23. 24. 



toivat sille aKtarille nimen. sanoen : 
,,se on todislus meidfin v(llill£iinme, 
ett5 Herra on Jumala.*' . 

23 Luku. 
Josna varoittaa kansaa. 

J a pitkAn ajan per^tfi, kun Herra 
oli antanut Israelin tulla lepoon 
kaikilta vihollisillansa, jotka heid^n 
ymparilldnsa olivat, ja Josua jo oli 
vanha ja ijAIliseksi joutunut, 

2. kutsui Josua koko Israelin ty- 
kdnsa, helddn vanhimpansa, pdft- 
miehensd, tuomarinsa ja esimiehen- 
sS, ja sanoi heillc: „niinii olen jo 
vanha ja ijdlliseksi joutunut. Jos.24:i. 

3. Ja le olette nHhneet kaikki, mitfi 
Herra, teidSn Jumalanne, on tehnyt 
kaikille ndille kansoille teiddn odes- 
s5nne; sillli Herra, tciddn Jumalanne, 
itse on sotinut teiddn puolestanne. 

4. Katsokaat, minS olen arvalla ja- 
kanut tcille nSmftt kansat, jotka Yie- 
ld jdljellSi ovat, sukukunnillenne pe- 
rinnOksi,hamasta Jordanista, ja kaik- 
ki ne kansat, jotka mind hJlvitin, 
suureen mereen asti auringon las- 
kuun p5in. 

5. Ja Herra, teidSn Juma1anne,sydk- 
see ne ulos teidUn edestSnne ja ajaa 
heidat ulos kasvoinne edestS, niin 
ettS te valloitatte heiddn maansa, 
niinkuin Herra, teidan Jumalanne, 
teille on sanonut. 2 Moos. 14:14. 23:27. 

6. Niin vahvistukaat tarkasti pitS- 
ml\5n ja tekemdSn kaikki, mith on 
kirjoitettu Mooseksen lakiraamatus- 
sa,ettett esiit5 poikkeaisi oikialle eikS 
vasemmalle puolelle, 5 Moos. 5:33. 

17:11,20. 2S:14. Jos. 1:7. 

7. ettekd joutuisi nSiden teidSnkes- 
kellenne jddneiden kansain sekaan. 
Alkddt mieleenne johdattako heidfln 
jumalainsa nimitl tahi vannoko nii- 
den kautta, Slkdnt mydsk(l3n pal- 
velko niitS tahi kumartako riiita. 

2 Moos. 23:13,24. Ps. 16:4. Jer.5:7. Sef. 1:5. 

8. Vaan riippukaat Herrassa, teidfin 
Jumalassanne , kiinni, niinkuin te 
tahAn pdivSSn asti olette tehneet. 

5 Moos. 11:22. 

9. Ja Herra on teidSn edestSnne a- 
janut ulos suuret ja vSkevSt kansat, 
eikfl yksikSSn ole kestdnyt teidSn 
edessanne tdhSn pSivSfln asti. 

10. Yksi teistn ajaa tuhatta takaa; 
siUJl Herra, teidSn Jumalanne, itse 
sotii teidan puolestanne, niinkuin 
han on teille sanonut. a Moos. 26:8. 

5 Moos. 28:7. 32:30. 

11. Sentahden ottakaat visusti vaari 
sielustanne, ettft rakastatte Herraa, 
teidlln Jumalaanne. 



12. Siim jos te ksannytte pois, ]a 
pitflydytte j5aneid.cn kansain puo^ 
leen , jotka oval jailjclla teidSn kes- 
kelianne, ja yhdistytte naimisessa 
heidan kanssansa,nfin etta te tulette 
heidan sekaansa ja he tulevat tei- 
dan sekaannc, 

13. niin todclla tietakaat. ettei Her- 
ra, teidan Jumalanne, cnha aja ulos 
naita kansoja teidan cdestanne ; vaan 
he tulevat teille paulaksi ja pahen- 
nukseksi.jaruoskaksikvlkcnnepaai- 
lc,jaorjantappuraksisilmiinne,siksi 
etta te nukutte siita hyvasta maasta, 
jonka Herra, teidan Jumalanne, on 
teille antanut. 2 Moos. 23:33. 

4 Moos. 33:55. Tuom. 2:3,21. 

14. Ja katso, mlna vaellan tana|)a- 
na kaiken maailman tieta ;. niin tie- 
takaat nyt koko sydammessanne ja 
koko sielussanne, ettei yhtaan sanaa 
ole jaanyt tayttamatta kaildsta niis- 
ta lupau*ksista, jotka Herra, teidan 
Jumalanne, on teille puhunut, vaan 
kaikki on tapahtunut teille, eika ole 

mitaanjaanyt tayttamatta. 

Jos. 21:45. lKun.^:2. 

15. Mutta on tapahtuva, etta niin- 
kuin kaikki se hyva on teille tullut, 
jonka Herra, teidan Jumalanne, on 
teille luvannut, niin Herra my6s an- 
taa tulla teidan ylitsenne kaikki pa- 
hat, siksi kuin han hukuttaa teidilt 
siita hyvasta maasta , jonka Herra, 
teidan Jumalanne, on teille anta- 
nut. Jos. 21:20. 

16. Jos te rikottb Herran, teidan Ju- 
malanne, liiton, jonka han teille kas- 
ki, ja menette ja palveletle vieraita 
Jumalia, ja heita rukoiletle, niin 
Herran viha syttyy teihin, ja te hu- 
kutte akisti siita hyvasta maasta. jon- 
ka han teille antoi. 3Moos.26:i4s. 

5M00S. 4.258. 11:16. 28:158^ 

24 Luku. 

Josua puhuu viiineisen kerran kansalle. 
Iditto uudistetaan. Josuan kuol«ina» 

J a Josua kokosi kaikki Israelin su- 
kukunnat Sikemiin, ja kutsui e- 
des vanhimmat Israelissa, paamie- 
het, tuomarit ja esimiehet; ja kun 
he olivat kokoontuneet Jumalan e- 
teen, Jos. 23:2. 

2. sanoi Josua kaikelle kansalle: 
„nain sanoo Herra, Israelin Jumala: 
toisella puolen virtaa asuivat enti- 
seen aikaan teidan isanne, Tarak, 
Abrahamin jaNahorin isa.ja he pal- 
velivat muita jumalia. iMoos. ii2G,3t. 

3. Ja mina otin isanne Abrahamin 
tuolta puolelta virtaa, ja annoin hn- 
nen vaeltaa koko Kanaanmaan Idpi c 



240 



JosuA ai. 



k minS enensin hUnen slemenensfi, 
ja annoin h&nelle Isaakin. 

1 Moon. 12:1. 21:18. 

4. Ja Isaakille annoin minSi Jaako- 
bin ja Esaun; ja annoin Esaullc 
Seirin vuoren asuttavaksi. Mutta Jaa- 
kob ja hfinen lapsensa menivfit alas 
Egyptin maalle. i Moos. 25:21,248. 96:a 

46:1,6. 

5. Ja minfi IShelin Mooseksen ja 
Aaronin, ja rankaisin Egyptia, niin- 
kuin minft heidfin keskelldnsft tein ; 
sitte vein minil teiddt uTos. 

2Moo8.3:10. 1.7—12. 

6. Minfi vein isfinne ulos Egvptistfi, 
ja te tuntte meren tykO ; ja Egypti- 
Ifiiset ajoivat teidfin isiSnne takaa 
vaunuilla ja ratsasmiehilia Punai- 
seen mereen saakka. - 2Moo8. i4.-9s. 

7. Niin he huusivat Herran lyk6, 
ja bfin pani pimeyden teiddn ja E- 
RyptilSisten v&lille, ja saattoi meren 
heidftn pdailensd ja peitti heidflt. Ja 
teid5n silmanne nfikivfit milfi minil 
tein EgyptissS ; ja te asuitte korves- 
sa luiuan aikaa. 2 Moos. 14:20,288. 

8. Ja mina toin teidfit Amorilaisten 
maahan , jotka asuivat tuolla puo- 
lella Jordania ; ja kun he sotivat (ei- 
tS vastaan, annoin minfl heidSt tei- 
d3n kfisiinne, ja te omistitte heiddn 
maansa, ja minU hdvitin heidSt tei- 
dan edcstilnne. 4 Moos. 21:21 s. 

9. Silten nousi Balak, Sipporin poi- 
ka, Moabin kuningas, ja soti Israe* 
Ha vastaan; ja hfin Ifihetti ja antoi 
kulsua Bileamin, Beorin pojan, ki- 
roamaan teita. 4 Moos. 22:2 s. 

10. Mutta en minfi tahtonut kuulla 
Bileamia; ja hfin siunaten siunasi 
teitfi, ja minfi vapahdin teitS hfinen 
kSsistfinsfi. 

11. "iz kun te menitte Jordanin ylit- 
se ja tulitte Jerikoon, sotivat J erikon 
asuvaiset teitfi vastaan, Amorilaiset 
ja Feresilfiiset ja Kananealaiset ja 
Hetilfiiset ja Girgasilaiset ja HevilAi- 
set ja Jebusilaiset ; mutta minfi an- 
noin heidftt teidfin kfisiinne, 

Jos. 3:16. 6:20. 10:8 s. 11:8,23. 

12. ja Ifihetin ampiaiset teidfin e- 
del13nne, ja ne ujoivat hcidfit ulos 
teidSn edestfinne, kaksi Amorilaisten 
kuningasla, ei sinun miekkasi cikfi 
sinim joutsesi kautta. 2 Moos. 23:28. 

5 Moos. 7:20. Ps. 44:4. 

13. Ja minfi olen antanut teille maan, 
iossa ette ole mitfifin tyfitfi tchneet, 

a kaupungit, joita ette rakenlaneet ; 
, a niissfi te nsutte ja sydtte viinipuis- 
te ja filjypuista, joita ette ole istut- 
tanect. 5 Moos. 6:10 s. 

14. Peljfttkfifit slis nyt Herraa ja pal- 
velkaat hfintfi-vakaa^ti Ja uskollises- 



ti, ja hyllfitkfifft ne jomalat, loita I- 
sfinne palvelivat tublla puolella vif* 
tffa ja Egyptissfi, ja palvelkaut Her- 
raia. 

15. Jollei teidfin kelpaa Herraa pal- 
vella, niin valitkaat teille tflnfipfii- 
vfinfi, ketfi te palvelettc, joko niitfi 
iumalia, ioita isfinne palvelivat tuoU 
la puolella virlaa, taikka Amorilais- 
ten jumalia, joiden maassa tc asut- 
te. Mutta minfi ja minun huoneeni 
palvelemme Herraa!'' 

16. Niin vastasi kansa ja sanoi : „pois 
se meistfi, ettfi hylkfiisimme Herran 
ja palvelisimme muita jumalia ! 

17. Sillfi Herra , meidfin Jumalam- 
me, on se, joka johdalti meidfit ja 
meidfin isfimme Egyptin maalta or- 
juuden huoneesta, jokaleki mei- 
dfin silmfiimme nfihden niilfi suu- 
ria tunnusmerkkejfi, ja .varjeli mei- 
tfi kaikella matkalla , jota me vael- 
simme. ja kaikkien kansain keskel- 
Ifi, joiden kautta me kuljimme. 

18. Ja Herra ajoi meidfin edestfim- 
me ulos kaiken kansan ja Amori- 
laiset, jotka asuivat maassa; niin 
me myds palvelemme Herraa, sillfi 
hfin on meidfin Jumalamme." 

19. Ja Josua sanoi kansalle: „te et- 
te taida palvella Herraa, sillfi hfin 
on pyhfi Jumala, hfin on kiivas Ju- 
mala, joka ei sfifistfi teidfin rikok- 
sianne ja synlejfinne. 

20. Jos te hylkfifiltc Herran ja pal- 
velette muukalaisia jumalia, niin 
hfin kfifintyy pois, ja tekee teiUc pa- 
haa, ja hukuttaa teidfit, sittekuin hfin 
teille on hyvfifi tehnyt.'' Jos. 23:158. 

21. Mutta Kansa sanoi Josualle: „ei 
suinkaan, vaan me palvelemme Her- 
raa.** 

22. Ja Josua sanoi kansalle : „te o- 
lette itse todistajat itsefinne vastaan, 
ettfi oletle valinneet Herran, palvel- 
laksenne hfintfi.** Ja he sanoivat: 
„me olemme todistajat.** 

23. „Niin pankaat nyt pois tykdfin- 
ne muukaluiset jumalat, jotka tei*. 
dfin keskellfinnc ovat, ja nOyryyttfi- 
kfifit sydfimmenne Herran, Israelini 
Jumnlan, puoleen.** 

24. Ja kansa sanoi Josualle: .,nie- 
tahdomnie palvella Herraa, meidfin) 
Jumalaummc, ja olla kuuliaiset hfi-, 
nen fifinellensfi.** 

25. Ja Josua tcki sinfi pfiivftnfi lii-' 
ton kansan kanssa, ja asetti lain ja! 
oikeuden heidfin eteensfi Sikemissfi.- 

26. Ja Josua kirjoitti kaikki nfinifi 
sanat Jumalan lakikirjaan, ja otti' 
suuren kiven, ja pystytti sen siihcn 
tammen alle, joka seisoi Herran py- 
hfikdn vieressfi. 1 Moo8.3&:4« ifuom.OrCw 



241 



JOSUA 24, TUOMARIT 1. 



27. Ja Jotua sanoi kaikelle kansal- 
le: „katso, tftmfl kivi on oleva to- 
distus meita vastaan^ sillfi se on 
kuullut kaikki Herran puheet, jotka 
h&n meidfln kanssamme on puhu- 
nut, ja on oleva todislus teita vas- 
taan, ettette kiellSisi teidfin Juma- 
laanne *' 

28. Ja Josua antoi kansan mennft, 
ilsekunkin perint60nsfl. Taom. 2:0. 

29. Ju sen jfilkeen tapahtui, ettfi Jo* 
sua« Nunin poika« Herran palvelija, 
kuoli, sadan ja kymmenen ajastai- 
kaisena. Tuom. 2:8. 

30. Ja hfin haudattiin omaan pe- 
rintO - maahansa , Timnat - Serakiin, 
joka on Efraimin vuorella, pohjan 
puolella Gaasin vuorta. Jos.i9:50. 

Tuom. 2:9. 



31. Ja Israel pal veil Herraa koko 
Josuan elinaikana, ja vanhimpain 
elinaikana, jotka elivflt kauan aikna 
Josuan jaikeen ja tiesivfit kaikki 
Herran teot« jotka hfin Israelllle oli 
tehnyt. 

32. Ja Josefin luut, jotka Israelin 
lapset olivat tuoneet Egvptistfi, hau- 
tasivat he Sikemiin, siihen pellon 
kappaleesen, jonka Jaukob osU He> 
morin, Sikemin isfin, lapsilta sadal- 
la penninglllfl. Ja se tuH Joselin las- 
ten perinn6ksi.lM008.33:19. 48:22. 50:25. 

2 Moos. 13:19. Ap. t 7:16. 

33. Niin kuoli myOs Eleasar, Aaro- 
nin poika, ja he hautasivat hanet Gi- 
beassa, joka oli hSnen potkansh Fi- 
nehaan oma, joka hfinelle Efraimin 
vuorella oli annettu. 



TUOMARIEN KIRJA. 



I Luku. 

Janda Ja Simeon voittavat Kananealaiset 
Otnielin urhollisuas Ja palkka. 

J a tapahtui Josuan kuoleman jiil- 
keent ett& Israelin lapset kysyivfit 
Herralta, sanoen: „kenen meistlien- 
sisti on mentavfl sotaau Kananea- 
laisia vastaan?*' 4 Moos. 27:21. 

Tuom. 20:18. 

2. Ja Herra sanoi: „Juuda men- 
k65n ; katso, minfi olen antanut maan 
hfinen kSsiinsfi.** 

3. JaJuuda sanoi veljellensASimeo- 
nille: „tule kanssani minun arpaa- 
ni, sotimaan Kananealaisia vastaan, 
niin minHkin menen sinun arpaasi 
sinun k^nssasi.*' Ja Simeon meni 
h5nen kanssansa. 

4. Kun Juuda meni sinne yI5s, an- 
toi Herra Kananealaiset ja Feresi- 
Ifiiset heidSn kfisiinsfi; ja he lOivfit 
Be.sekiss& kymmenen tuhatta mies- 

5. lahetnpasivatAdoni-BesekinBe- 
sekissft, ju sotivat hSnt3 yustaan ja 
lAivftt Kananealaiset ja Feresilftiset. 

6. Mutta Adoni-Be.sek pakeni, ja he 
ajoivat hfintA takaa, saivat hAnet 
kiinni ja leikkasivat hfineltfl peuka- 
lot ja isot varpaut jaloista. 

7. Niin sanoi Adoni-Besek : ,,seitse- 
mankymmentfi kuningasta, peuku-> 
lot leikattuna ktlsistAja isot varpaat 
jaK>ista, hakivat muruia minun pdy- 
titni alia; niinkuin min& tein, niin 
on Jumala minulle maksanut.'' Ja 
he veivfit hfinet Jerusalemiinja siel- 
lA hfin kuoli. 



8. Mutta Juudan lapset sotivat Je- 
rusalemia vastaan, ja voittivat sen, 
ja lOivfit sen miekan terftllil, ja polt- 
tivat kaupungin. 

9. Sitte menlvfit Juudan lapset alas 
sotimaan Kananealaisia vastaan, jot- 
ka asuivat vuorilla, etelfi maassa ja 
lakeudella. 

10. Ja Juuda meni Kananealaisia 
vastaan, jotka asuivat Hebronissa, 
— ja Hebronin nimi oli muinen Kir- 
jat-Arba. — ja Idivfit Sesain, Ahima- 
nin ja Talmain.Jos.iO*.868. ii:2i. 15:14. 

11. Sielta he menivfit Debirin asu- 
via vastaan : ja Debirin nimi oli mui- 
nen Kirjat-Sefer. Jos.i5:i58. 

12. Ja Kaleb sanoi: Joka Klrjat-Se- 
ferin lyO ja voittaa sen, hfinefle an- 
nan mina tyttSreni Aksan vaimok- 

Si.*'' Jos. 16:168. 

13. Niin voitti senOtniel, Kenaksen, 
Kalebin nuoremman veljen poika; 
ja hfin antoi tyttfirensft Aksan hft- 
nelle vaimoksi. 

14. Ja tapahtui, kun Aksa tuli, neu- 
voi hSn miestfinsfi anomaan peltoa 
isilllfl; ja hftn heittfiysi aasin seljfis- 
td alas; niin sanoi Kaleb hfinelle: 
„mik5 .sinun on?** 

15. Hftn sunoi hAnelle: ,«anna mi- 
nulle siunaus; sillfi sinfi olet anta- 
nut minulle kuivan maan, anna mi- 
nulle myOs vesilfihteitfi." Niin ante! 
Kaleb hfinelle vesilfihteitfi ylhfifillfi 
ja alhaalla. Jo8.l5:i0. 

16. Ja Mooseksen apen, Kenilfiisen, 
lapset menivfit Palmu-kaupungista 
Juudan lasten kanssa Juudan xor- 
peen, joka on etelipuolella Aradia : 



Si2 



TUOMARIT 1. 2, 



ja he mcnivfit ja asuivat kansan kes- 

kellfi. 2.M00S. 18:1. 4 Moo5. 10:29 s. 24:21. 
6Moo8.S4:3. Tuom. 4:11. iSatn. 1&:6. 

17. JaJuuda meni vcljens& Simeo- 
nin ktfnssa, ja he IGivfit Kannnca- 
laiset, jotka asuivat Scfatissa, ja liA- 
vittivSt sen, ja kutsuivat kaupungin 
Hormaksi. 4 Moos. 21 :3. 

18. JaJuuda voittiGasanalUeineen, 
ja Askalonin alucineen, ja Ekronin 
alueineen. ' 

19. JaHerra oli Juudankanssa^niiii 
etMhSn valloitti vuoret; sillS ei hftn 
voinut niitft ajaa ulos, jotka luak- 
soissa asuivat, sillfi hcillft olivat rau- 
taiset vaunut. Jos. 17:16,18. 

20. Ja he antoivat Kalebille Hebro- 
nin, niinkuin Mooses oli sanonut, 
ja ban ajoi siitfi ulos kolme Enakin 
poikaa. 4Moos. 14:24. Jos. 14.13 s. 15:13. 

21. Mutla Benjaminin lapset eivAt 
ajaneet Jebusilaisia |>ois, jotka asui- 
vat Jerusalem issa; ja Jebusilaiset 
asuivat Benjaminin las^en tykdnfl 
Jerusalemissa tfihAn pfiivfifin asti. 

Joe. 15:63. 18:28. 2 Sam. 5:6 s. 

22. Josefln huonc meni myds yids 
Beteliin, ja Herra oli heidSn kans- 
sansa. 

23. Ja Josefin huone vakosi BeteliA, 
jonka nimi muineii oli Lus. 

1 Moos. 23:19. 

24. Ja vartijat saivat nSlhdil michen 
(ulevan kaupungista, ja sanoivat hfi- 
nelle: „osoita'meiUe, mistA kaupun- 
kiin pfli&stSftn, niin me tecmme lau- 
piuden sinuUe.*' 

25. Ja h&n nllytti heille, mislSpaSs- 
tiin kaupunkiln; ja he lOivfit kau- 
pungin miekan ter511li; mutta sen 
miehen ja koko h^nen sukunsa las- 
kivat he menemSiin. 

26. Niin mies meni Hetilaistenmaa- 
kuntaan, ja rakensi kaupungin, ja 
kutsui sen Lusiksi ; ja tiimil on sen 
niroi t2lhSn pSivAHn asti. Jos. 1C:2. 

27. Mutta Manasse ei ajanut ulos Bet- 
seania tyttSrinensfl , eikft Taanakia 
tyttHrinensA, eikA Dorin asuvaisia 
tyttftrinensA. eikH Jibleamin asuvai- 
sia tyttarinensS, eikft Mcgiddon asu- 
vaisia tyttfirinensft. Ja Kananealai- 
set rupesl^'at asumaan siinft maas- 
*a. ^ Job. 17:11 s. 

28w Ja kun Israel tuli voimalHseksi, 
teki hftn Kanancalaiset verollisiksi 
eikft i^anut heitft ollenkaan ulos. 

Jos. 17:13. 

29. Eikft Efraimkaan ajanut ulos 
Kananealaisia, jotka asuivat daserLs- 
m; vaan Kananealaiset asuivat hei- 
dftn keskellSnsft Gaserissa. 

30. EiSebulonkaan ajanut Ritronin 
Ja NahaloUn asuvaisia ulos; voan 



Kananealaiset a.suivat heidan kcs- 
kellfinsft ja olivat vcrollisel. 

31. Ei Asserkaan ajanut niitft uIoa, 
iolka asuivat Akkossa, eikft niitft, 
jotka asuivat Sidonissa. Akelabifisa, 
Aksibissa, Helbassa, Afikissa ja Re- 
hobissa. 

32. Ja Asserilaiset asuivat Kananea- 
laisten keskellft, jotka siinft maassa 
asuivat; sillft ei he niitft ajaneet ulos. 

33. Eikft Naftali ajanut niitft ulos, 
jotka asuivat Bet-Semekscssft ja Bet- 
Anatissa, vaan asuivat Kananealais- 
ten keskellft, jotka olivat maan asu- 
vaiset ; mutta ne, jotka asuivat Bet- 
Semekscssft ja Bet-Anatissa , tulivat 
heille verollisiksi. 

34. Ja Amorilatset ahdistivat Danin 
lapsia vuorille eikft salllneet heidftn 
tulla laaksoon. 

35. Ja Amorilaiset tahtoivat asua 
vuorilla, Hereessfi, Aijalonissa ja 
Saalbimissa * mutta Josefin kftsi kfi- 
vi heille raskaaksi, ja he tulivat ve- 
rollisiksi. 

36. Ja Amorilaisten alue ulottui Ak- 
rabblmin kukkulalta, Selasta jaylOs- 
pftin. 

2 Luku. 
Israelin tottelemattomuus raagaistaan. 

J a Herran Enkeli astui ylOs Gilgn- 
lista Bokimiin ja sanoi: „minft 
johdatin teidftt tftnne Egyptistft ja 
toin teidftt siihen maahan, jonka mi- 
nft valalla lupasin isillenne , ja sa** 
noin: ,en minft tee liittoani teidftn 
kanssanne tyhjftksi ijankaikkisesti ; 
1 Moos. 15:18. 17:7ft. 5Moos.29:148. 

2. mutta te, ftlkftftt tehkO liittoa tft- 
man maan asukkaiden kanssa, mut- 
ta kukistakaat maahan heidftn alt- 
tarinsa;* te ette ole totelleet minun 
ftftntftni. Mitfi olettekaan tehneet? 

2Moos.23:32s. 34:12s. 4 Moos. 33:52s. 

5 Moos. 7 2 s. 123. 

3. Ja viclft sanoin minft : ,en minft 
aja heitft teidftn edestftnnepois,vaan 
he olkoot teille tuskaksi, ju heidftn 
jumalansa olkoot teille paulaksi.** 

5 Moos. 7:16. Jos. 23:13. 

4. Ja kun Uerran Enkeli oli puhu- 
nut nftmfi sanat kalkille Israelin 
lapsille, korotti kansa ftftnensft ja itki. 

5. Ja he kutsuivat sen paikan Bo- 
kimiksi, ja uhrasivat siinft Herralle. 

G. Ja kun Josua oli pftftstftnyt kan- 
san tykGftnsft, ja Israelin lapset oli- 
vat menneet itsekukin perintOOnsft, 
maata omistamaan, Jos. 24:28. 

7. palvcli kansa Jumalaa, niinkau- 
an kuin Josua eli ja vanhimmat, 
jotka Josuan jftlkeen kauan elivftt 
ja olivat nfthneet kaikkla Herran 



243 



TUOMARIT 2. 3. 



suuria tOit5, jotka hSn Israelille oli 
lehnyt. Jos. 24:31. 

8. Mutta kun Josua, Nunin poika, 
Hcrrun palvelija. kuoli, saaan ja 
kynimenen ajastaiknisena, Jos. 24298. 

0. ja he olivat haudunneet hftnet 
lianenoinaanperintOmaahansa,Tim- 
nal-Herekseen , Efraimiii vuorella, 
pohjan puolella Gaasin vuorta, 

10. ja kun koko se sukukunla oli 
koottu is5ins5 tykd, tuli toinen su- 
kukunia heidSn jftlkccnsS, ioka ei 
tuntenul Herraa eik9 niitA tOllA, jot- 
ka hfin oli tehnvt Israelille. 

11. Ja Israclin lapset tekiv3t pahaa 
Herran edessd ja palvelivat Baalia, 

4 Moos. 25:3. Tuoin.8:33. 2 Kun. 1:2,6. 

12. ja hylkAsivflt Herran, 'isfiinsa 
Jumalan, joka oli hcidSl johdatta- 
nut Egyptin maalta ulos, ja seura- 
si vat vieniila jumalia, niiden kan- 
sain jumalista, jotka heidUn j'mpS- 
rillSnsA asuivat, ja kumarsivat nii- 
la, ja vihoittival Herran. 

13. Ja he liylkasivSt Herran, ja pal- 
velivat Baalia ja Aslarotiat 

Tuoin. 10:6s. 1 Sam. 31:10. 1 Kan. 11 '.5, 33. 

2 Kun. 23:13. 

14. Niinsyttvi Herran vi ha IsraeliiiT, 
ja hSn antoi neidAtry5stajienkasiin, 
jotka heita rydstivat, ja mOi heidat 
vihollistensa KHsiin ymparisIOlle ; ja 
he eivat voineet enaa scisoa vihoK 
lisiansa vastaan. Tuom. 3:8. 4:2. 

Ps. 44:13. Je8.50:l. 

15. Vaan kuhunka ikana he kaan- 
[tyivat, oli Herran kasi heita vastaan 
'onnettomuudeksi,niinkuinHerraoIi 
,heille sanonut, ja niinkuin Herra 
;oIi heille vannomit; ja he olivat 
isuuresti ahdistettuna. 3 Moos. 26:17,33. 

5 Moos. 28:13 s. 

16. Ja Herra heriltli tuomareita, jot- 
ka vapahtivat heitS r>*5stajain ka- 
sista. Tuom. 3:10. 

17. Mutta hft. eivat tuomareilansa- 
kaan totelleet, vaan tekivat huorin 
vierasten jumalain kanssa, ja ku- 
marsivat niita; he poikkesivat no- 
piasti silia tielta, jota heidan isansa 
olivat vaeltaneet, noudattaen Herran 
kaskyja; he ei niin tehneet. 

18. Kun Herra heratti heille tuoma- 
reita, niin oli Herra tuomarin kans- 
sa ja auttoi heita heidan vihollisten- 
sa kasista, niinkauan kuin tuomari 
lell; silia Herra saaii heita, kun he 

huokasivat niitten tahden, jotka hei- 
ta vaivasivat ja ahdistivat. 
. 19. Mutta kUn tuomari oli kuollut, 
tekivat he taasvieia p:ihemminkuin 
.heidan isansa., noudattain vieraita 
jumalia, palvellen ja kumartain 
niita; he eivdt luopuneet teoistan- 



sa eikfi uppiniskaisesta menostan- 
sa. Tuom. 3:12. 

20. Sentahden syttyi Herran viha 
niin Israeliin, etta han sanot: „kos- 
ka tama kansa on rikkonut minun 
liittoni, jonka mina kaskin heidan 
isillensfi, eivatkaole kuulleet minun 
aantani, 4 Moos. 33:56. 

21; niin en minakaan tastedes aja 
pois heidan edestansayhtakaannlis- 
ta pakanoista, jotka Josua jatti kuol- 
tuansa ; 

22. etta koeteltaisiin niilia Israelia, 
pysyvatkd he Herran teilia vaeltaen 
niissa, niinkuin heidan isansft ovat 
pysyneet, vai eivaikO.** 

23. Ja Herra jatti nama pakanat, 
niin ettei han nopiasti heita ajanut 
ulos ; eika han antanut heitS Josuan 
kasiin. 

3 Luku. 

Otnlel. Ehud. Samgar. 

J a namat ovat ne kansat, jotka Her* 
ra jatti Israelia kiusaamaan,kaik* 
kia niita, jotka eivat mitaan tietfi- 
neet kaikisia Kanaan sodista, 

6 Moos. 7:22. 

2. ainoasti sentahden etta Israelin 
lasten sukukunnat tietaisivat ja op- 
pisivat sotimaan, ne jotka eivat en- 
nen sodasta mitaan tietaneet: 

3. viisi Filislealaisten paamiestfi ja 
kaikki Kananealaiset , Sidonilalset 
ja Heviiaiset, jotka asuivat Libano- 
nin vuorella, Baal-Hermonin vuo- 
resla Hamatiin asti. SMoos. 8:8. 

Jos. )l:a 1328. 

4. Ja he jaivat kiusaamaan Israelia, 
etta tiedcttaisiin, tottelisivatko Her- 
ran kaskyja, jotka han oli kaskenyt 
heidan isillensa Mooseksen kautta. 

6 Moos. 8:2. Tuom. 2:22. 

5. Kun Israelin lapset asuivat kes- 
kelia Kananealaisia, Hetiiaisia, Amo- 
rilaisia, Feresiiaisia, Heviiaisia ja Je- 
busilaisia, 

C. ottivat he heidan tyttariansfi vai- 
mokscnsa ja antoivat tyltaridnsa hei- 
dan pojillen^a, ja palvelivat heidftn 
jumaliansa. 2 Moos. 23:828. S4:16. 

5 Moos. 7:88. 

7. Ja Israelin lapset tekivat pahaa 
Herran edessa, ja unhottivat Herran, 
Jumalansa,ja palvelivat Baalia ja 
Astarotia. 

8. Ja Herran viha syttyi Israeliin, 
ja han mOi heidat Kusan-Risataimin, 
Mesopotamian kuninkaan kasiin; ja 
Israelin lapset palvelivat Kusan-RI- 
sataimia kahdcksan ajastaikaa. 

^. Ja Israelin lapset huusivat Her- 
ran puoleen, ja Herra heratti heille 
vapahtajan, joka heidat vapahtl, Ol- 



244 



TUOMARIT 3. 4. 



nielin. Ralfbin nuoremman veljen, 
Kcnaksen pojan. 

10. JaHerran hcnki(ulihllncnp5fil- 
lensd, ja liAn oH tuomari Israelissa 

1'a I2ksi ulos sotann ; ja Herra antoi 
(usan-Risataimin, Syrian kunin- 
kaan, h5nen kSstinsfl, Ja hSnen kA- 
lensfi voilli Kusan-Risataimin. 

11. Ja maassa oli rauha neljftkym- 
menlfl ajaslaikaa; ja Olniel, Kenak- 
sen poika, kuoli. Tuom. S2S. 

12. Mutln Israelii! lapse! tekivfit tans 
pahaa Herran edessft ; niin vahvisli 
Herra Eglonin, Moabilaisten kunin- 
kaan, Israelia vastaan« senlShden 
eltS he pahaa tekivftt Herran edessA. 

13. Ja n9n kokosi tvkdnsS Ammo- 
nin lapse! ja Amalekilaiset, ja meni 
ja lOi Israelin, ja he valloittivat Pal- 
mukaupungin. 

14. Ja israelin lapset palvelivat Eg- 
Ionia, Moabilaisten kyningasta, kah- 
deksanloista ajastaikaa. 

15. Niin huusivat Israelin lapset 
Herran puoleen, ja Herra herdtli 
heille vapahtajan, Ehudin, Geran 
pojan. Jeminin pojan , joka oli ku- 
riHu;ja Israelin lapset Ifihettivlit hfi- 
nenkanssansa lahjojaEglonille.Moa- 
bilaisten kuninkaalle. 

16. Ja Ehud tcki itsellensfi kaksite- 
rSisen miekan, kyynfirfifi pitkfin, si- 
loi sen vaatteensa alle, oikialle rei- 
dellensS : 

17. ja hdn toi lahjat Eglonille, Moa- 
bilaisten kuninkaalle. Ja Eglon oli 
sangen lihava mies. 

IS. Kun hfin oli kaikki lahiat an- 
tanut, paasti hSn kansan, jotka oli- 
vatlahjoja kantaneet; 

19. mutta itse Ifiksi hftn epf^uma- 
lan-kuvain paikusta, Gilgalissa, ja 
^noi: „minu]lft "on, kuningas, jota- 
kin salaista sinulle sanomisla.**Niin 
hfin sanoi: ,,vaiti!" ja kaikki me- 
nivSt ulos, jotka seisoivat hfinen ym- 
pftrillfinsft. 

20. Ja kun Ehud tuli hSnen tykdn- 
sfi« istui hSn suvisalissansa, vksindn- 
sft. Ja Ehud sanoi : ,,minulla on Ju- 
malan sana sinulle;** niin hfin nou- 
siistuimeltansa. 

21. Mutia Ehud ojensl vasemman 
UtensS ja olti miekan oikialta rei- 
(Mlfinsfi, ja pisti hfinen vatsaansa, 

22. nHn ettfi kahva meni sisfiUe te- 
rtn kanssa, ja rasva peitti terSn, sil- 
H d hfin vetftnyt ulos miekkaa hfi- 
M vateastansa; ja rapa vuoti ulos 
ntoestfi. 

23. Ja Ehud Iftksi ulos esihuonee- 
s«n. ja sulki salin ovet j&lkeensfi ja 

M' Kun hAn o|i tullut ulos, meni- 



vfit kuninkaan palvelijat sisillle, ja 
katso, salin ovi oli lukitlu. Ja he 
sanoivat : ,.ehkft hAn peittSfi jalkojan- 
sa suvisaUn kammiossa.** isam. 24-.4. 

25. Ja he odottivat niin kauan. eltft 
hfipesivfil; mutta katso, ei kenkllSn 
heille salin oveja avannut; niin ot- 
tivat he avaimen ja avasival : ja kut- 
so, hcidSn lierransa makasi kuol- 
leena maassa. 

26. Mutta Ehud pakeni heidfin vii- 
pyissAnsS; ja hlin menicpdjumalan- 
Kuvain ohitse, ja p93siSeiratiin asti. 

27. Ja kun h5n sinne tuli, puhalsi 
h;ln torveen Efraimin vuorclla. Ja 
Israelin lapset menlvdt hfinen kans- 
sansa alas vuorclta, ja hfin hcidfin 
cdellunsfi. 

28. Ja hfin sanoi heille: „seuratkaat 
minua, sillfi Herra on antanut vlha- 
michenne, Moabilaiset, teidfin kfi- 
siinne.'* Ja he seurasivat hfintfi, ja 
voittivat Jordanin luotuspaikat Moa- 
biin pfiin, eivfitkfi sallineet yhden- 
kfifin mennfi ylitse. 

29. Ja he tappoivat Moabilaisia sil- 
lfi ajalla Ifihes kymmenen tuhafta 
miestfi, kaikki parhaat ja vfikevfit 
sotamiehet,niin ettei yhtakfifin heis- 
ts pSfisnyt. 

30. Ja niin nOvrj'ytetlUn Moabilai- 
set sillfi ajalla Israelin lasten kfitlcn 
allc; ja maa oli rauhassa kahdek- 
sankymmentfi ajastaikaa. 

31. Hfinen jfilkeensfi tuli Samgar, 
Anatin poika; ja hfin Idi kuusi sa- 
taa Filistealaista karjan kaareksella; 
ja hfinkin vapahti Israelin. Tuoin.5:6. 

4 Luku. 
Bebora. Barak, Jael, Sisera. 

J a Israelin lapset tekivfit pahaa Her- 
ran edessfi, kun Ehud oli kuollut. 

2. Ja Herra mOi h^idfit Jabinin, Ka- 
nanealaisten kuninkaan, kfisiin, jo- 
ka hallitsi Hasorissa. Ja hfinen so- 
tajoukkonsa pfifimies oli Sisera; ja 
hfin asui pakanain Harosetissa. 

Jos. 11:10. 1 Sam. 12:9. 

3. Ja Israelin lapset huusivat Her- 
ran puoleen; sillfi hfinellfi olivhdek- 
sfin sataa rauta-vaunua, ja ban vai- 
vasi ankarasti Israelin lapsia kaksi- 
kymmcntfi ajastaikaa. 

4. Ja naisprofetta Debora. Lappido- 
tin vaimo, tuomitsi Israelia sirhen 
aikaan. 

5. Ja hfin asulDeboranpalmupuun 
alia, Raman ja Betelin vfilillfi, Efrai- 
min vuorella; ja Israelin lapse! tuli- 
vat sinne hfinen tyk6