Skip to main content

Full text of "Hippocratis Coi... Liber de locis in homine..."

See other formats

This is a digital copy of a book that was preserved for generations on library shelves before it was carefully scanned by Google as part of a project 
to make the world's books discoverable online. 

It has survived long enough for the copyright to expire and the book to enter the public domain. A public domain book is one that was never subject 
to copyright or whose legal copyright term has expired. Whether a book is in the public domain may vary country to country. Public domain books 
are our gateways to the past, representing a wealth of history, culture and knowledge that's often difficult to discover. 

Marks, notations and other marginalia present in the original volume will appear in this file - a reminder of this book's long journey from the 
publisher to a library and finally to you. 

Usage guidelines 

Google is proud to partner with libraries to digitize public domain materials and make them widely accessible. Public domain books belong to the 
public and we are merely their custodians. Nevertheless, this work is expensive, so in order to keep providing this resource, we have taken steps to 
prevent abuse by commercial parties, including placing technical restrictions on automated querying. 

We also ask that you: 

+ Make non-commercial use of the file s We designed Google Book Search for use by individuals, and we request that you use these files for 
personal, non-commercial purposes. 

+ Refrainfrom automated querying Do not send automated queries of any sort to Google's system: If you are conducting research on machine 
translation, optical character recognition or other areas where access to a large amount of text is helpful, please contact us. We encourage the 
use of public domain materials for these purposes and may be able to help. 

+ Maintain attribution The Google "watermark" you see on each file is essential for informing people about this project and helping them find 
additional materials through Google Book Search. Please do not remove it. 

+ Keep it legal Whatever your use, remember that you are responsible for ensuring that what you are doing is legal. Do not assume that just 
because we believe a book is in the public domain for users in the United States, that the work is also in the public domain for users in other 
countries. Whether a book is still in copyright varies from country to country, and we can't offer guidance on whether any specific use of 
any specific book is allowed. Please do not assume that a book's appearance in Google Book Search means it can be used in any manner 
any where in the world. Copyright infringement liability can be quite severe. 

About Google Book Search 

Google's mission is to organize the world's Information and to make it universally accessible and useful. Google Book Search helps readers 
discover the world's books while helping authors and publishers reach new audiences. You can search through the full text of this book on the web 

at |http : //books . google . corn/ 

Digitized by 



C o î 



Liber ckLocis intipmine: 




. . ^ Medico Philofopho* Ciue Romano 

'ROM^ , Apud Bernardinum Tanum . M. D C, X-XX^^I . 
S y -p E R I O R 7 M PER M I S S V. 

Pigitized by 





Maiori Pccnitendario. 


W^^H^^ Auddiîi animo mihi 

I cuoîuendumfuit^- 
minen cifs. Pri aceps , 

-^^ CUI p)tîis.imu meas 
jhas lucubrationes^ qualefcunq; 
carfint, offerre deberem : cum 
Tua €mm îînt genic^ in Aula , 

t 2 hoc 

Digitized by 


IOC cdyinRcgk Virtutis; Tuacţ 
muaiic^tia educata^ , noii nifi 
VniTibi iure omnideben tur. 11- 
iad 'pt)cius;n0n param me anct- 
pxem deti!iârir,îcilicet,num ran- 

tQ Pr iacipi , ■ V R B A N î -¥IIF 
ter Maximi-.Poati:n.ciS.G.eraiapo 
Fratri, noo taiii dignicatis fard- 
gio. 5 quam virtutum elarkate 
conipicuo, Hiinimuinidoîferre 
fas efTet. Verarn Tua h^cRe- 
galiş SaGerdoti|PurpuraSokîn 
iti omnibus emulatury qiJî^ et^^ 
fiiblimia ililiilret ^ ima nMG>mP 
DUS fou-ere lîo n rcnuir; . - loc€r m- 
iiurrîera prope religiofiisimi A- 
nimi Tui ocnamenta micantl- 

Digitized by 


bas rkcîijs mirifice fe^ ik Vtiâe-^ 
qaaque efîert JPietas , qua pati- 
perrimosquafque benefiGentif- 

fîrna caritate retpicis,profpicifqw 
eorumque myrfades adj^e^ ve-^ 
luc ad paoperum Patrem j ca- 
tar uaţirn/qlioSai^ confugiunt ^ 
kauddiibium ^onfecaturi €ub- 
l€uamentum.Quidigîrur rimeâ 
tKigauhoc mudufGulum offer- 
re,m qud laagoentibus , hoceft: , 
hominfi omnifr.milerrimis, fdc-^ 
ciirreredoc^turPEr^tereG^iaîfi iii 
lud^quodÎB rencm adeoabfîmili 
Plutarchasimpemtori foo^ixft, 
Magnattt eft i^t magtm^fefiios 
beneficia ccmferre , kk]& paî^â 


Digitized by 


eo^umciem liîlari fefenaq;lronte 
munufculaexcipere. Qualecuq 
ergo hoc meum fie , humiîicer 
dedico \ vtque ea , qua Ibles, ani- 
mi beaj^nica^accipias, fupplex 
obteftor , humillim^ feruitutis 
me ^ , perpetuarqiiie oB^raanti^ 
tibus fîmpîici laâe Ruftici> muî- 
t^que Gentesiupplicabatîf, hu- 
mii i q . î i cabant JFarre, quibus oon 
eranc Thura , nec vili fuft vi tio 
Superos quocunqf polTenc mo- 
do colerc.C^bd fi pr^clariisimo 
Hpmine Tuo înfigouum,muni- 
{umq;fueric,nihjil vcreor quin tu- 
tum â quibulqvprauiofis animi 

Digitized by 



inuafionibus quacunque pera- 
graturum fit-, fique minima Re- 
giarumTuarumApum pretio- 
fîlsimi Nedaris flillula confper- 
fum extiterit, amarulenţai^u^uis 
obcreâânum vi tiîigatorumque 
confilia lenirejnque dulcedinem 
vertere fatis aptum eric . Vale 
Cardinalis amplifsime, Nefto- 
reofq^ felix viue annoş, Ch^^ 
nar Reipubîic^ magiş fe^ 
magifque profuturus • V^e • 

Digitized by 



^ PP O^G-R AT IS Goiiibrum de Lo. : 

' ram ^ ingeniie Ledcnr , jioii eo guidcnţ ' 

^ ditiirus ciTem ; non diim cnlm tanţum 
^* coîiceperat Animits , fed vt mcas-potius lucubra- 

tîu^ciilâs, gualefcuhq; c^ Rntyjnjtliqncm dirigercrn 
ri[capum^neâkidmifct^iGcH^^'et;,quod de-Ocho fabii- 

iatiir Antiqnitas, cui^ dum llj nţm iparjaftreiîiîe con- ^ 
* toxcjtiere^iiseb>âir,*^a<iftaiis Afelk.kfiîăd tarcum eraî 

auide afo^denş, pînnia'iiaud^iplp a4^îei:Lenre ?v.bfiî- 
' meba^ ii^^t poft- dnitirfum; îââuâ-rimTicp:îe feodrem. 

poiîte mei mccrle4nb' iUtr^^ yioage-f. 

tur . Hinc fatius vifiimellinJibriimliunc, turn Au- 
tJiaris praeftantia > turn px^eceptorum grauitate in- 
£gncm, Medidnje tgtJLis cqiri a^ndium .vtq^ adiere- 

fupererat curiş 5 adiaibere; iperans^aiit iriemori.^ 
fublîdiiîin îd futurum , aut Mtcm lore , vt mn ixuiiri 
prorsiis me ibi înfudaiTe quandoq; intclUgcicm . Ar- 
diia niliilomînus vîdebatiirpxouinda, £0 quod per 



Drgitized by 



abditoscomplurcs NâriiTiSeTecelSiS , :perque:âbftrn- 
ikantiquK eruditioais ,monimi«nta^ nuHa .prjeciiirtc 
face ©berrandum crat -: imbeciiiickribus fîqiudenL» 
inaetiiis, cuiufmodi meum ingenue .fâteoT, aliqucra 
pr«ire neccffe cft., inqiiit Seneca ad Luciilian.,.: sen.tpifiai. 
Lazarus-enimSotas, qHcm-idipfujnpraiftidffe , ap^^ ^Jg "^^'-^ 
ZacuraBi LufîtaituHî de Medic.orum Principiim H- 
iloria-non feraeiiegeram, neq; ad mcas vaq-uam per- 
iTenerat manus, ^juamuis fiudiose apud plurimos per- 
quifittts> îî«c qiicmqiîarainuenire licuerât,qm cwn fe 
vidiffe affirînaret; quapropîer%fclnGn:abfoluiire, vel 
feltemininccm4ion-«diâii!e iurc fiiipicandum -erat^, 
¥erum taiîti Aiitkcxrfs mentem ia pulcixerrimQ adco 
ppwfculo affequendi incclTanter adiiuc vrgcbat a- 
fn or , HCinincmq; temeritatem cjcpfobraturion per- 
fliaîiim erat, vbi omnisabeâiambitio , Ynumqiîc vir- 
.tutis ftudiam inîenăimr : iŞxcolimus £quidem ing«» 
•îiium; Auda<fî-er inceptIimexiHnqueibrîaiîiaiaueî:; 
inqae magnis vobifFc tantum qtrandoq; fat^.vpr»- 
fertim quod raanis mtmqtîâ fiitimrsviddbaturlabor, 
vbia<^ri vbcftas jion^minim^mi virtutis meffem polH- 
cabatitc . începi i^tur, Dcoque .affiante , pcrva- 
rias aggreffiones , atque interuallatim , ytcimiq; tan- 
dem abfolui. Atyix ad caicem-perduxcram , cum 
inopinatim en cspuslra^ari Sola, quâd diăvfruftrâqtie 
cx -miikis toţiiK Btxbpse, EmpoTijsXibrarioriap opc 
cOTîqiîi^lum , D, AngeH Colij induftria. Afcl^ia- 
dei eruâiciftinii , qiii , Hippocraâs citkor:eximius , in 
cbliigenais egregijs qwibafqîie viîdeqtîa.qu« Axtthor 
ribus -neinim iiabeciiir feciindiis;,Matâtollomamad- 
ferfair;faifkq;videnda copia,iK>îî.kgi.<îuide3n>fcdîî4' 
ittoniun moxc de«oraitt,,Fateox-> nomleuitcramni^ 

Digitized by 


conS:ctn2Ltui hm > turn qixdd locunj îam prius o ccu- 
pâmmcognoui, (juem liber um prorfus crcdideram; 
tun^ quod tantf Virikboribusmişiîm lakem aliquan- 
tifper leuiof^m reddere npn îic trifîet : iubortaq; ic- 
circo quadam in partum opus deipicicnîia,rie dicam 
odio> fiipprimereprorfiaîi,abylterioriqucabftiiie- 
rcpoBturaftatutummiiaiomninderat. Sed re poft- 
Hiodum maturius difculTa > imdc ammiiş demum ac- 
ceffit, qabd megrcghhoc dâucidzndoAuthorc, âi- 
uerfa meinceffifîe via confpiccrcm : qnandGqiîideni 
fînguiis non modo eontextibus paraplirafîjni atte- 
xueram > vcrum fynthaxi addicius , fîngnloruai fere 
^crborum explanationem adieceram ; quaproptcr Se 
me noui aliqiiid attuîifîc., omni procuî dubio îperari 
poterat ; (de quo tamcn aKj$ iiidiciiim relicîîfi iam fit ) 
poftremam proinde manum vtcimqne adliibiii , Do- 
<fî:prumq;Vironim izortatu fu aderi tandem paiuis fum 
publici iJlud îuris fierir etii difcrijiiiniş id plenum non 
ignorem , quando tam varia fim t Jipminum ingenia^ 
iudiciaq;>&ad obtrecfîandupotius,qiiam ad proban- 
dum perpetuo parata;¥ltrd eqyidem fateor in mxiltis 
deficere me potuifle,& reipfa forsam erîraui; iiiimanu 
enim id eft: Venim ElinianoiamiîlQ ytar . Res ardua 
^linjnprz^ joe Ujfils nomtalemdar^^nouîs auîboriîatţm^ obfoUtis 

^my omnibus %}^ranatumm > ^natura fu£ amnia : 
Itctque iam non ajjecutis -^ x/olut/^ j abunde ţulchrum 
atqt^magnificum dî. ^quipres certe me excufatum 
Jiabebunt, pix)b:^imtqiie faltem> quod cţiofiis viue^ 
reifâluerini, ied&cultati ^ cui addielus ium , pro k- 
genif tenuitate vtcumq; prodeffe laborauerim . Re^ 
iiquis non {crifco>î acproiadc jiulîa eum ijs miiii reş 


Digitized by 


feabetur-Cxterian îion eftciir âiutmsmAuthom hth- 
îu$ cogmtîone iînmor^r , cum £t Hippccratcs Goiîs ^ 
magîUîm iMud Gx^ci^ OractdiJin & NumcnMcoxnm 
Kegumque affiiiitate îion lîuniis , quam virtumm orn^ 
nium pr^ftantia vbigHc terraiiira coiilpicuuâ v^csffis 
fapientiam tota admirata eilÂRtîqmtas^^tota^^îie- 
rata Pofteritas ; cumqiie humznitztis (zM^um^h^tx-^ 
^edi videretur^ Aras^Tcîi^îaqt^ei erigqre,3^^ 
offerre Jionores,€adcm Graecia îioîi dabitaiiit. Tant^ 
iic poiiuit pietate iii Deos , c^rk^tc în proximum^ 
Clipiditatum omîiîiim anQderaaon^ in fe ipfi> ^ vt îîOll 
irffi Cliriffiana Re%io ad dus perfediQnedcfîife 
lît, Copliira de Ep Poikrîtati :d:^i(fct5dram^ Cqus» 
€uiC0ornm bibîiotecfias emoîiierc dattîmAîiti H^- 
rod^tiîs HaiicarnafTcus > Pei^carum renim^riptor 
Tctailiiîimus ^ nii prorîîis eius încîiimerit , fortaiic 
miăâ 5 vt ex mnltîs faGMe conîjci poteft > viz/ii^a fei^c- 
eiMc Hippocratîs adoIeJcentiam attigerîtYîîusîliu^ 
cy tîdes ab îmiîdentîas nota vindicari mîiiiîîre poteft :- TărfeiTm. 
TLzm ctimHippocratî caeras vîxeiit;(ambx) initn ^jx^ine^th, hi. 
ca oduageiunam primam Olyirîpîadem Boniewnt* jj'^^ 
aimo vîddiGettrecentefimo ab ¥rbe coiKÎita , D«^ 6- txpith. 
cemîiiratu Hempublicam admînîftraiite; apnd Pcrfaş ^^^^^^^ 
vero^regnaîîte iCrtaxerfeioii^mano* iiuiKriipata 
foero ^ qnod eftmniHS cicciter i^gscingefîâs tri^t^ 
po^^'roîae excîdaui^^ciQuadrîngcî^ik.^cpii^^ 
diiobcis aîîte GJmfl^ ^ucnmm , ^Qui^geirds 

fe^agrntaduobiîs^ poft Homerii5i[^)cximqti^ Bdbpoî^ 
Heiaci b^lli Sciiptc^ade6:exkdHS tabim^Sfî^ cae-;* 
ţea^XSriecîs oiîînîbtis îiiln^^ 
c^l€ăît;femiîmaii t^ 

^ ^ 2 gîftra- 

Digitized by 


aiter acimoduir^ inAthenienres omnes del)ac€ata eftj 
eaque t^deni Hippocratis induflria depulfa > Diiri- 
HOS^a^cutnÂfuii:lion:Qres);mcertuni fcame efl: anglo- 
^as eîmiIati0iie^;^rtLintei|pra^krioi:a ingenia pfeîriîîn* 
qtte^:v an aHa^ jîofeis ignotiori cattla , tanti Yiri iip- 
Hfe^^f^emt^iiibtictieinî. Eiiistamen fiimmis tonori- 
bîisi^ieminipSi^ Strabo , Mac]oobiiis > 
Flimus^^ijquenoii pauci ;: nam Plato ciufdem velut 
abvEfculapij ffîrpe ciiundi , Medîciqu€ eximi) men- 
tion em iiah^iiiiîi P^at:;^goxa;âc ia. Pka^ daro .Hie n amq; 
bdn4îrum.oinmxnuartriîm-Earens , naturali non modo 
fefentisefaiîd^aitaledtifiyt ainpl? inter c^tera te- 
ftatur'^aiîreiîs iILe de Natura Humana libeliu^, ex quo 
& Aeliad^2nia..ditataefl:v. ScâmplifliHiae Eeripateti- 
corum diuitia^prroinanaruntivncle Gal.j^de viu part. 
eap;8 £lato., inqtiit, M'bp.o<^utis- mh^Jar fiquis alius 
^f^mm^fturit ,- c^. ahiUa ^dugmaîa^ muPmtus rndr- 
.. ' .? -T ^Ihm'^t 'eom.3.ih. irb4eAlîm.'5%/^/i: anqiiit * ^*« '-ArU 
2^^ - ^o^eîis^Theophmfii Uhnijk ^m^tmJs commentams 
.; :,: , l^yfi^ogi^J£îppi)cvaUsilIos\cm^mpdS^e^ 

vix^fdnei :pbirer^criib:7;, Poiit:cap;.4i/. i^ 
Senis^raeminerit.;) S£;dr Mcdicinain ab ea^ feianxiţ , 
i55t retiiit-Gclfus, aiiîpHffimi% 'Afckpiaauri^Dogma-^ 
tibxis -mocit ar^jne pcxfcb^^ mMzcxiimz Per- 

dit ciţ^Regi carittîmbit, OT5C^igi3i:1iieIsăjia,qu6,Pa- 
mk 4:dbâiiciiâi!^ÎQ:pi:iH^tr$î^^ ibiqti^ qua- 

*t-iî^r p^îMmunx£oiîib£ipf^ :tcfiatiîr jSitidas ,, 

«^uâvdhqpaaffiomaăa^Âi^ )C;elG-î 

branîter^ iafii:irandu9KM^ddam5 J^K^^4^^^^ 
a&icsiif,&:adinirabîlcqoaocE4^:^ liijîoruiu^ 



Digitized by 


Qpns>oixmiimMtădkx fcicntitîm e6pre<3:ens,qao4 
aut tcflîpflsrkvoiacitate amiiunus , aut »( quod magis 

©ptandum eft),in miaoreş alios di&ibutum fuit Ebel- 
los, qm fînguîaia DiuiniNiuninis munifîc.eiitia iiuc • 

v%ue adferuantur . ;. * 

. Xnferibimr yeroiuc , quem pr« ma«i]bus iiabemits,. 

miscred <Ju6d:tn:ipfo de partibus agatur, quibuş 
tuinanttîa eorpus cp^mentatum: eft.tuHt naturaîiterj 
turn praeţcE-natur^i^aledis,; quae. loca ex coimnui)i 
î4edieoî:umyfiiiapp.eUantxir, vtpluries doeuiţGale-r g^^- ^^- -; 
nus; ipfeifkaa librum d€Locis>Afe<aţ^ân?î ţi^ii^" 
lcripfîi;..DefcnbitnaiîîqiJîofi:er iicAutJioriiumaRi 
CQîpom opificiuim^morbos pariter obiter ^xpîieapsQ 
qîîi^tSvCP^mponentes illud partieuiîeconflidajji eon^ , 
jtoe»erunt :.QuapropterqMKdain ;e^ totkis^Medieiq 
ii^c^iafi: epiciiojne V fecompeiidii^/JPiiyfî 
liQiKaiDM.iîaturalemqite partei«;e5?plicaft5 , veyum 
e!tmmmffe.<Sbs p^setey r^aţurajpi'-oEx quo intieiligi pOr 
îfiâq^afflta fîtlibti «uius yţiHfâs ..Bubitafit atîa^ieş 
teQnuliilauiB.magni. HippQC^atis genui:nus:^QmniH6 &t, 
tiîmqudd advnguemekboraţus neutiqua appareat;, 
aîm^t^ddrsfequâ; cmj:£iT:«3-eimd«Sttîir ^qţţ^ lîipp 
£i340^îBâin<»ii»iffîi^ î-ei<3l4s£:îquifii»îî».^.apeEte y.§r 
îitâti cdfraga»-j»idcî^»r i:¥.er^m.f Qflis Aidiofe i^^ 
^ki«fcAttăw>jrcm^^&uM âtîSîăpşEte pmdit:0piife 
, tentiarum, vigflE; :^€jritâti- -a'-iteiit, Afck|)iâdinn<p*e 
dbgmatibus, eonfentanearliabţie;, -iaea fa^is^aii*^^ 
«î, cainnachtarijs) aiHtî^rsiiiSîrfejuaîiijps^ei^isîsi 

mGt&c^i omiiîa- :pK2muiifceiţitui;5* Cim -M^s .^it 


Digitized by 



<yeîrîj akcxttas &prGmpîiti^ 
?e in lcribeii<lo. Ornată quidein^^t minus vtîgeta &rt 
• jbuentus . Şuauiora prsemamraq; 4^t:¥irilicaşş Aî> 
foiuta dcmiixti , perfedaque viridisS^necim ; nam^, 
j>iato hu Yt doctiit Bata iniiontriiiio^ t^^ 
f i>»«, i» £«/. acu^d indfit cernere ^ cum primum ^corpmis octdus 
hud^îdk ^^y^^iiiua certe noninfc^^^ > ab Ero^ 

tiano, GâienoyCeifo, Rufo Epii^fîo ,:aIiifî5;iiiuftrio- 
Ies quafdam vt Hippocratis fententias non nifî vno' 
ex'ioc iibro depromptas , paffim citări , -^a:^in>Com- 
mentari;^', prout re& ^ tiiiit > pliwries annotatum eft , 
proindeqiieiegitimui» quoms tempore liabitian fuiil- 
le , pro certo iiabendum : Vnde â -Mercuriali in^fua 
îibroriun Hippocxatis cenfuray inter eos^^quiabilip- 
pacrate fcripti qnîdem funt , nan autem editi ^^entt. 
nieratiir;quatî vlterîus adhuc perfici potuilfet. Atqtii 
nil aded claboratum eft, quin perJfedîtis-adJuiCTeddi 
poflît:, fi otium fuppetat, atque îngenium., 'Satisso* 
bis erit, fi ex eodem emanaiiit Tripode: Yixnamque^ 
fieif px^erit :, quinaliquaceuDimnitatfe^j^^ 
carttlcet, . > 

C)pţis itaqn^ înli^âime Kbi^s^x^^ 
iusdiuifîonisi^tfe^şeîtefetcat, îcîas'ex mateiise^ya- 
Tictate , de qaaa^ui? v^^s^^pqoie pro^ 
imtînni duxii$c:nam^pMnĂ^in Hiimanî Carpbm^ 
^ra enarranda naagims Sen^d/detinctui^ omnîunK^ 
fere- partium Jiiftoriam recenfet ; mox morborum 
co^c^uimmmăM^ explicat, qui- 

apharilfe:as pic^MDî^^ 
turn ad Biagscdîm^^atqxife^^ 

Digitized by 


quibus totumOpusabfoIuitur : Hînc &îpfc,per^i- 
quitadinferuiens , tres conftitui Dbro&, quorum Pri- 
mura iure Anatomicum âicei£s , Secundum Tiiera- 
peut«:um , Tertium Aphoriftieum hzuâ inepte ap- 
pellares . Breuitati cum claritate fermonis , quoadii- 
cuiţv ftudiă . AbHippocratisPogmatibus nelatoi» 

qiiidem vnguem difceffi : QHi"i«^«^^^Pf^°^ ''''? ^^ 
ipfo,ybicuni:qnefastoit, interpretări conatusluîH, 
Marinelli partitionein , feii dinumerationem.iecants . 
Neqjin C&num, vtnonBulIis , quiieHippocrap 
acriternimis prafîtentur , in more eft , contui»eMpt«s 
fui : qxrin etiam vt magr^îm altcrum Medicîn» Nt:- 
men vbique'piHrimî-mihi facfhim eft , Verităţi ta- 
men primasfemperproporsedeferens. Quod iî in 
partium hiftoria nonniilla prastermifsa videantur , 
ideofktftum fcias , ne opasnimium excrefeeret, ti- 
bique pfoinde moleftior efficerer: Praefertim cum 
meum fit inftitutum Authoris mentem aperire ; vbi 
Mcdicorum confenfu alieiîtim 'proponefe TÎdctur : 

erc^olias ingenioli iioftri primitias boni coniulenSj 
vec^etiora fortalTe quandoque offeremus . "V' ale . , 


Digitized by 


R E V E R EN D rS SI M E ^F ATER ^ A C Rî 
Palati) ApditalicrMăgiflex . 

/'^ Vando in Arte Medica noua iniîgnirc :> aut 'mipbffibfle ^ aut certe 

litar^ fi AlHcpiadamm mgema in'indagattdis vetenin?- Aut^^ 
dogmatibus exerceantur j vc-pr<> cicplicatîonc Hippocm^^ 

'îiOcisin Komine ^ dirficdcatis ^^ vtiliratis p^eniiSm :, laudabiiiter ,, 
ac feliciterFrancifcus Perla dcftLffimusgenip:, & ingempjxrseftidt 
hoc opere, qiiodnunqHamnonprobâbîtur^fediempereomrnienda' 
bimr abiis, ^ui folidam^ vberemoue do^ftnnam-ieâaBtnr, qiîod Hu- 

, manon;m cprpomm^JPiorbis curandis oonduca^ :<»i^^ J?^îpii^RL_«^ 

Sacri PalaciJ Apoitolici* 
Fr»NkoIau$IUccar4iust Sacri PaIatiiAp<:^*:M^* 

Digitized by 






Liber Primus. 

eoiifAf£ATr.^a7/5 j'ii^^rK^^fTf'^ ^%.>V^*^' 

^ FU^^CISCCi PE^A CALVÎE'^SI '^'^""^'"'' 



Mihi quidem videtur principîum Corpofis nuîluffl corp«isâa 
effe î fed oraqia fimiliter principium, & orania finis : ^%^ 
circuloenimfcdptoprmcipiumnonreperiturv S"*^ 

^VMANI corporîs fabricam , qax mcdî. ' 
' cina totiiis fubiedum eft, particulatim de- 

icriprarus Hippocratcs , priusquam ad iîa* 

^ gulariadeueuiat, vniucrfalem quandamco- 
5ş tins cognitionem proponit, Pictoruin cxem- 
U pio , qiii cotam prius imagineîn ruditer ia 
tabula delineanoiînguJa quzque pigmeata, coloribufque 
poftraodumexprcfluxi; quando & ad ioram pariterexem-: 
plaripfatnfit ctiâm natura, vtannotauitAda.2. de gen. anim. îîatarxdm» 
cap. 4. , dum animal condit , Jineamentis omnia prinitim de, gene»t iins 
fcribic, mdxfînguîa perficic, acque elaborat. Mirabilcm S"Se 
itaquemnumcrafum partiumiii humano corporevnionem,^''^" ■"*»* 
^onnexionemque Mc nobis «xponere iatendici vt caufanî foff*^*"" 
hmc admirandi eonfenfus 8c fympathiîE,qu2 Inter -omnes 
fiorporis bmuspartes intcxccditjintcJIigerepoftmodumvav 

A leaaius. 

Digitized by 



îeatmis • Fuîgct namque in homîiie ; wt fcke ac^rîdt;|^ft» 

înhomîne^^e motu anim. cap. j., c^xdmcmîli^ 

Săt quemadmodnm m xcăl inftimta Republica alij qmdtm im- 

enago, peraiit j alij vero obediunt , cQmmunem omnes feiicitatem 

interim > confcruationemq; intenduilt : Quinimmo ea fub 

focietatc communiq; inftituto itâyniuntur> vt nihil prorsus 

boni , maliue cuipiam Reipublicse tnembro accidere poffit, 

quin tota illico Refpublica qyodammado coafficiatur ; nil 

i^ Reipublicx ^ quod'ad merribţa, qu^libet mox non ex- 

yattîumdi- teiîdatur. Sicprorsiîs &inhumanocorporeinnumera? pro- 

fo«?& S (tăd func partes, natura, fitu, nu , a6iionibuiquedifFerentes t 

^et^reimr ^2xumquc a!i^ principes aunci^pancur > eo quod publicum 

^^^or ]j3canc officium , omniqu^corporifacuîtatemimpertiantur; 

ali^defercndo > prseparaiidouepriiîcipibus fiibferuiunt; aîi^ 

fâ^ţrop«r dcnîqj alium vfum pra^ftant; (nulla jtquidem pars hahetur, 

fdpfam tan inquk Gal. 1 7- de vfu part. cap, i .ţroţter fe ipfam ; aliterejfet 

"**^" fru^ra dr alfcindenda ) omnes attamen continuata quadam 

feric fie inuicem mutuo neruorum^ arteriarum, venarumq; 

ampicxu iiî circuli niarem vniuntur, vc nulla reperiatur par^, 

qu^ ita dterius fit princîpium r vt c^îerarum mu^ 

iptâ non fir : idq^ vt {ups onancs inuicem vfu^ cojnimunicare 

Partesom. poifent, inque vnum commune opiis , indiuidui niminim 

^ffSi' totîusconieruationem> ciqr debitas^p^ratîones-, perpetue 

maiişbonu confpirarent : ac proinde io patticvil^ vnius Iseiione totum 

înţamcuîi la^ditur indiuiduum; in toţius indiuidui tefîone particula qu^- 

^Z^f^ liheccoafficitur, & cQmriitracur:^ytin&aţex.Ş. Scp. pecu^ 

dlmindt li^rius expiicabitur . Daârinani hanc> velutfacrum natu-. 

tiiduum. j.^ arcanum , verbis oraculo iîmiUimis fummus Diâ:aîor 

lib. de AUmşn. regilţrauiîL : vbi poflquam docuiflec tuni nu.^ 
f^idaru^ partium , tum ipirituum alimentum mira qua^ 
dam facilitate âb intimis ad extremas quaicunque papes, 
ad pilos vfque & vngufs deferri : & âb extim^ ruriiis ad 
intimas 5 vc eftaer incorporis ambitu âb artcrijs attraâus; 
quod certe non aliam^ ob caufam contingit> quâm quod 
corpus vniuerfum venis , arterijs, alijfquc innunieris mea^ 
îibus^ ceu fiftuliş>. quâque versus interfeptum fit , proin- 
4e<^e totum fluxilţ cft aj; g:?mfpirabile 5 cumque tribus con% 

Digitized by 


h3tcmmx3i namţaii qm<hmcQnmxionG kk inter £c vniunmr , ^ ' ^* 
vt in quauîs op^ratione , qu^ in corpore celebranda fit, eam 
conirauncm velut fcopum afllimant , ad quem dumtaxat ob- 
dnendum mira quadam fympatKia confluunt omnes humo 
res ,-conlpirant omnes {piritus, confentiunt coadiuirantque 
omnespartes; itautiiire dicacurconftiixiovîia, coi^piracio ^Ş^^'^^9 
vna,confentientiaomnia; Quem profeâd^onfenfunx fie ta^^^^ râtk> vn^.^' 
^iem exprimit* Juxta fotius '^uidmz corparis naturcm mmia^ tumm^T 
luxtâ par tem ^ero ţartes in vna^uaq; parte ad opis , 'Prin- 
cipium magnum ad extremam part&m p^rumit , ^ extrmia ad 
magnrnn principîum peruenit , Vna natura ejfei^ mn ^ffe ^ .Quod h Jppocratis 
cft dicere * In to rius quidem corporis 3iamra> feu ftruiSibira > ^^licarL ^ 
omnia quajcimque iHudxomponunt , iîbî inuic^m confev» 
tientia funt; vel ^ yt exponicGal. > in fajuuîatujn yiiius ope- cai. s.4e 
rationis omnes pardculse conipirant , :ed\ninairiini ^ quod ^^P^^-^*^* 
omilia in ilio Tniaijtur &c coh^reant ^ In parte vero p hoc 
t&, in determinato quoîibet membro,partesomnes, qui- 
hus merE^rum illudcoagmentammeâjxonfpirantinuicem, ^^.^^^^â 
intendu&tq; opus atque adioncm jnemjbro ilU principi- x^omsomt' 
tcr debitam^ vt in oculo ad viiîoncm ^ in auribus ad audioum^ ]^^|^f^|^ 
& fie de fingulis j ob eam videlicec , quam in organo illo ha- 
Bent connexionem & cohserentiam * Ex qua toc partium in 
vrip corpore vnione fiţ, vtprincipium magnum, <uiufm.o- 
di Ger c% Cerebrum Se Hepar, ad minimam quamuis,atque 
poftremam perueniat partem , non modo faqultatum particip 
patione, venim etiam fadaper neruos, arterias , venas; aliasq; 
intermedias partes continuatione; & exTÎtiraa parte ad prin-; 
cipium magmim. Quoquidempaâoprinc^es. non modo Panesoin- 
partes quoddam quafi circuluminter fe conftimunt, eo vide- ^^^^^6^ 
licet, quod Cerebrum Cordi Hepatiq; ncruos ; Cor Cere- ^^^^r fc dr- 
broatque Hepatic arteriasj Herpar Cerebro iSc Cordivenas St^^Si^*^^' 
impertiancur^ verikn fingiâx etiam particulae ea vaforum cir- 
culacipnecompkiShintur. Ex quofitvtynadumtaxâtnaţu- ^^^i^^^ 
ra eflfe & non cf Fe yideatur i non effe quidem vna ob midti" ^^^^^ ^ «^ 
plicem adeo partium varietatem s^fTe aucem vna pb mirabi- 4o S^^u^ 
lem iUarum vnionem & coafcnfum # Inquit itâqu^. ^*^* 

A z UM . 

Digitized by 


4 niPîPCicKJtistmî.:MW6^^^m^ 

Mihî quîdem videtur ^(^ app^t fi tcd^oczm mm^ 

nierarum panium vnionemjvaforum duâ;us ^ae labyrinthcas 
ambagcs primo intuim infpiciamus r 
^^^ . ., . f» ^ ţKririmmfciîîcetatquc 

Prmcipiumcorponsnuliome& . 

eîpiumfecandum partiumfimationem: nani, cum ex fvm 
Pmcipîum taphx. I .principium fitprimum ynde aliud,fequiturj quod de 
«Sft mo<S ijs fiT, qu^ ad alia dicuntur> quodq; varios poffit habere refpe- 
ieatur, tius,Ccrtum aute cft hîc noii iatelligi d^ principijs intrinfecis 
8c in eflrendo> vt funt materia & forma, aut elcme ta & humo- 
res,vt femcn & feiguis: hxe fiquidem > vtbabetur nat^ J^;|; 
kumanv> &de fbuâ. hom.> Gongenitafţmt, neceflkioq^fe 
V -a ifi P^^ reperiunturin honvne > dum vixerit . Neque de extrinfe-' 
«JfeaS^^cott ds principijs, &inficri5quemadmodum:ptiuario&fmiSjqua5 
l^c^4i?^^ ncceâkia oftenduntur â Peripatetkis- quacunque in muta- 
^^^' tione. Multa miniisintelligi potcft d^ principio prioritate 
gcneriso feu nobilitate, ciîm iam fiiprâ difîumfit, partes 
quafdam princ^s dici 6b officij prseâaatiam^ qua^.cseteris 
imperant. Neque de principio prioritate originiş^^fiue radi- 
fettaiuradî. ^ationis: libro enim de alimento, venarum radicationcm nu.7* 
catio hcpar. ^^^^^^ artetianim cor effe afferuit . Neqn^ d^miim de prio- : 
Andr. Laur- citate temporis , vt aliqui opinaţi funt 6b ea verba Ommctftmi^ 
anau-8.q.i5 j^^^ ţrîncipiiwi ^ fy omnio. finis : nam ^ quamuis contra Ari* 

ftoteiis& Galeni fentex^tiam lib- 1. de di^t-nofterAuthor ^'^^^ 

affcrueritibtus partes omncs^ fimul dif9riniinari&aug£ri> 

tf^o^i^" neque prius akeras aiteris , nequepoilerius : V^rtîm maiorcs 

fimaî diferi f^atura ptiores app^rere minoribus, ciim non priores exiftant : 

Sgcnto^ Qnx prafeâofententia, yeriorictiam cenfenda eft> cum ar-. 

crumenta^qps' pro contraria afferuntur opinione , turn Ârifto* 

^^^lâf"^ teîis âfferentis cor prim6 generări , turn Galeni > quihepar 

ccq. cerdc, primo generări voluit, â neceflitate defumptavel vitalis in-* 

ia2g«r^^ fluxus, velditionîs,exiguiprorsusmomenti eflfe videantur : 

^'^'^'^f Fcstus namque > dormconcipitur primoque formatur , pro*^n. pno ha'ud mdigct naturali , vitahq; mtiuxu , cum hsec corn* 

%^mcdCm\ modiffime â Matrc pcr^^mbilicalia vafa:excipiat; proinde 

Gâieiî. de-; nccjuc hepate> nequecordc prius csetcris partibus indiget^ 

Digitized by 



Vef dm f timo illo vit^ exordio formatrix facultas , fîue per fe, ^^^^/^^ 
feparataab anima , ipiritofain fcminis parte reiîdens ^ lîue cUita^^^. 
anim^ adiunda, qu^ fcmen animauerat ,jt ex Themiftio> pg,'^"^/^ 
atquc Scaligero mordicus tuetur dociiilimus Sennerms : piadt. phi. 
(Anima fiquidcm fui eft domiciîij archicecla , illudq; perfi- senHcLuM 
cit, atque vndequaque exoniat, dum omniscorporisratio ^^y?^^ţ.^ 
eo comparata eft 5 vr animo tanquam domino feruiat, nu- ceps,&^au. 
tuq;regaturiIlius)p€rfeminisparticulasdiiTeminata,inomni |^^^^^^ 
parte ^que operator, iînguîaeodem tempore delincans:>cum 
animal intendat, de cuius corporis integritate omnes partes 
exiftunt . Quamuis ,inquam> haecHippoeratisgermans fit 
atque verior iententia ^ citato libro de diaeta apertis verbis re- 
aiftrataj eam aitamen in pr^fenti texm ncquaquam ijs ver^ 
bis doceri, fatis teâantur ea , qu^ fequuntur . dradoemm 
âefmpU ţrincipiumnonveţeritur. Vukliquidem inhumano 
corpore nullum reperiri prîhcipium primum & abfolute, ied 
cmnia principium cfîe , & omnia finem , non fimpiiciter, 
fedfecundum quid, velutfcilicetih circuîo, quod iamde^ 
fcriptumeft . Atdefcriptumcircuîum non ideo caret prin- 
<ipio fineque , feu omnes eius partes principium funt , & 
omnes finis ^ quod omnes fimiîl inchoentur , &:fimul per- 
ficiantur , cum certum fit ab vno determinato pundo inci- circula* 
ţscre , atque in idem defînere : vnde â Mathematicis iic quidiit^ 
^tiam definiri confueuit v Figura plana, qu^ defcrihiturâ Unea 
rcBafinita p circk alterum punBum quîefcens circMnâuBa , cum 
4n eum^^m rurjus locum rejîituţafuerit , r:mde moueri eterat * 
£x quo patet circulu in fuo fieri principium habere &: finem; ^^^^^f ^ 
fed quod in eo iadefcripto defignabiies omnes partes itâ dif- l^'^'^'^L-ct 
.pofitsefunt, vtynaquîsque in ordine principium fit iubfe- ^^^^^J^- 
quentis , finis yero antecedentis : vnde > vt aduertit Anft. in los , atc^ue 
problematibus rl>rincipio Se fine caret; proindeque ^ternita- ^^^,'^î^,f^ 
cis fymbolus fuit-Sgyptijs , atquc in hoc vno secernum cieri î^^^^J^o^*^^; 
xnotum poăe , docuit idem Arift. 8. phyf Quo quidem paâo ^i^^{\ . 
iumano etiam in corpore fingul« partes itâ inuicem con- Lib^s.pbya 
neâuntur , tum per fc , turn per neruos , artenas > venafque , 
vt nulla parsita fit vnius principium > vt alcerius finis etiâm non 
fît,modo ha^enus expUcato^Quo circuU ea^emplo^eodemque 

Digitized by 


pîorsus feafii vfiis eft Hipp. lib. de olH varias yafomm »^. t% 
' circulationes> diuaricationefque declarandas, fie inquien$^ 

Vm£ per corpus diffujk fpiritum ^ &fluxum, & motum exhihent 
ah vncL mdtdt germinantes ; atque hMvnâ vndş oriatur , fy vU 
defimt nonfcio icircuh enimfa^o primifiumnmrepmtur ♦ 

II * Sîmîliter etîam iBorborum în toto corporcv 

«n^tf '"^ /*X Vicquid confident Medicus , ( etfî omnîa , qu^cum« 

oGnfiderac > \^ ^^^ Creata iuîit^ aliquo pacto fpecuîetur) ad huma- 

wporiTva- *^^^ tutandamvaletudinem/velmorbosdepellendos, diri- 

ktudincm^ git . Hiiîc eft, quod Hippocrates 3 yţ Medicmn decebat 3 pr©- 

^^°^^* poficaparciiun humani opificij harmonia^ ad morbo^^ftatim 

explicandos accedit, quos partesill^^ ob niutuam„ conne- 

xioaem > mucud iîbi imperciuntur 3 ytobj(eruaui|€uaiîi„ia 

libello de horn. ilrudt. Morbi %uidem jsciimaccîdensiînţ, 

fuumhabenteffe dependenterâfubie^p ^iilkifque iiaturam 

fcquuatur . AfTerit ergo, quod quemadmodum corporis miî^ 

luiîi abfoluce că, principiilm ordinîs > ai^t fîtus , fed partes 

<)mnes principium funt^ & pmnes ^ fi^^^ 

^ctuicilic^t^ieterarum vel aatecedenţium^ -vel iubfequen^ 

^a ^^ ^iujjî^ ik^m^Scmojhoxnmnu^ abiolute 

abroiuţ^LJ' principiuai dici poteît ; fed iingulse priiKJpium quandoqtîc 

ES «fife q^^^iî^t^ aut iinis^ NuHa etenim pars eft , qu^: aut conna- 

omniumor-Jiurali , .aut adfcititia imbecaîJitate iiipcruacaneos aliquos 

*''''^- .cocige^ens humores ; xzmfocys pambuş 3 aut alijs quibuf- 

cunque , prout aliqua iuppedimturopportunitas >^os inter* 

diim traafiBiâere iion pofîît , morbique cuiufpiam ori^o 

txiâere ; au t j, vice verfa jib alijs excipiens , moi;bi^qiw> c^. 

ter^ iafeftabantur , fiiiis cifenon queat: Cuks porr^ 

sis nonalia vtîque yerior adducipo^teft ratio 3 quam artificios 

fa omaium partium xonaexîo , qua <:orpus totum fluxile , 

-confpirabileque reddimm eft : ex quonamra 3 nuîlo edaâa 

ma^iftro 3<5ccultas adeo 3 iiemiuique co^nitas yias iîbi inue* 

nire confpiciojr, dum altera parte Jaboran^^ altera coaffi- 

ciimrur 3 yel morbificas ^terutrim tnaterias excipîentes ^ al- 

;.xerutriin4 morbis vindicantur . lila namque primum cft ^ 


Digitized by 


pr^cipuuiîique fuhdameniuîîi cuiiiftiiş mcch^ftafis , necîxoti ArîiŞciofaj 
fyjmpathise cuiufque & confeufuş , quem humano in corpore nîum c5^I 
paJSim qiiotidie obfeuamus . Aţqiii , propofitioni huic iple- ^,^1^^ 
au. 40. niet videtur aduerfari Hippocrates > turn in epiftola ad 0c- fyin'paihicia 
memum Regcm, ybi caput humanorum morborum radix ^.e^ţr^l- 
ceribetur ; turn hic inferius > vbi vterus morborum omnlum p^i^m fan. 
caufa in Mulieribus afleritur , vt lam illud terneîij lubticeam ea. 
FâmiciQfa^0impduinfintin,<L efiAhdomm infaţurahikyOmniumttmz Hk lih. j* 
corparis tmnmmdmtiormnfinsi^ origoNcmm hmc de ijs^quas' «• 56. 
feBenumeTOfiunt,di<aaaccipidebcnt.Caput namque obca- -J^^- ^-Jp 
lidam humidamque temperitm ; ob cucurbitularem îiga- c.i4.imdo. 
ram , trahendo aptiflîmam ; ob fitum elatum > tenaibus exci- caput . v:e. 
picndis humoribus, vaporibufqueperopporcunum> obam- '^^f ^^ 
plam fubilantiae molem, fuperuacaneis congarendis obno* morbTscom* 
xiam > fepefepitt$ morborum occafîo membris ommbusr|^j^^'- 
cxiftit . ica & Yterus gignend^e nou modo proIi> fed corpori pr«beâat . 
vniuerfim expiandanon rard dicacus , communis qusedam 
cloaca cum fiî > ft â munere quandocunque dellftat^ vel prauc 
cperemr,compIurium morborum prsecipuam caufammu^ 
îieres eum experiuntur . Abdomen denique > in cuius cauita- 
tîbus vari«e pro corpore vniuerfo nutriendo coCÎiones cele- 
brantur , fi quid erroris in viciu perpeorecur , complura fepe 
congeritrecremcnta^qu^ cuiufque generismorbis prompţii- 
iunam pra^bere caulam confiieuererattamea inde nonfit^ 
quin c^tera? etiam partes , ecfî minusirequenter, morborum 
principium finiique , & ipf? quaadoque eflfe poffint , 

jjj Quo4quidemfîcciuseft>mQrbos^m 

& ma^is doîereâ aaîurafbkt,bumidam vero minus. ^ 
Morbusenîm ^qulia ficco eft, ftahilitur^ & non cef- LSSL* 
fatîqui veroiii hamidoidiffluît::»^ alias aîiamcor* vero minus' 
poris parte© occu pat , & fempertranfmîgrans > re- 
quîem facît, & ciiius qucque fedatur> vtpotc non 

Articulam i^^y , quam Cornarius ew:?» tranftulit> nos 
^uidcm vertimus ; nam^lcum vtrumque fignificare pol- 

. fiţi 

Digitized by 


tia: nam cum diâio mint caiilaiis Rtcomunăinz ^ inepţi pom 
nitur j nifî vbi rcdditur raţio* prsecedencis iermonis > quod 
i mniime fit in propofîta contexcu • Caufii iîquidem cur om* 
rtes corporis partes principium cflc poffint , iîniique quorum'*: 
uis morborum^non eftearuin lîccitas>aut humiditaSyfcd ' 
conaexio potius & vnio. At fî Quidem vertamus> quas comun-» 
âiua diftincliua câ, planaomnino^ atque confpkua reddi* 
tur: Nam 3 ciîm fupcrîus dixifTet Hippocrates fitigulascor- 
î poris partes prhicîpium effe pofTeSc fînem morborumom*^ 
. nium in vniuerfo corpore ; diilinâiuam modo apponit > in- 
quiens ^ fîcciorcs quidem partes faciliiis caeterarum morbo- 
fos apparatus recipere > tenaciufque retinentcs > non de âcili 
tranfmidlere : vnM &ciîiuş finem , difficiliils principium cffc 
poflfe alieni morbi : velut e contrâj humidiores difficilius re-» 
dnendoreciperc, feciliuscranfmiâere, proindeque âcilius 
principium eiîe pofle > difficilius finem confocijs partibus • 
Qiiod VI namintelligendumfit, iam pîanuna fict : etcnimfî 
quis minus attente ^ atque , vt dici folec, fuperficietenus , te- 
xtum hune intueatur , pr^terquatn quod nuîlamcumfupe*' 
rioribus eonnexionem habere dixeric.^^paradoya, ne dicam 
abfturda^ continere afîîrmabit; fiquidem, quodiîcciuseft, 
eft magiscompâiSum, morbolxfque caufis miniis expoiîcum; * 
maioris ptoinde roboris , magifque reiîftens, morbos ergâ 
miniis recipere debet , non contra : vtque docct Gd. liKd^ 
K&m$£moU confuetud. czp» 2. rarum -^ molie corpm facile patitur incaU^ 

le corpus^- - j r - n ^ r* > # i^ ,» . 

cUh^titm, jcens i^jngejcens-i-denpm âutem^ ^durum tol£r0t Jpermtquâ 
4^^v€id mniayquaipJiextnnfe€usoc:Curmnt. Extatpra^tercâipiîufmec: 
Hippocratîs auâoritas aph. 1 5 , fee. 5 • , vbi fîccitatcs humidi- , 
tacibus iaîubriores nMnufque tethaks affirmati H«&c ctenim 
qualitas maxime aduerfaturpntredini ; eam quinimmo pror-. 
siis expuguatsdum madorem abfumir, cuius pro^ri^p putredo r 
eli ; denfandoque^ inuâtumxaloremil) excraneo metur, ne, 
per poros edu<âus , euanefcat . Quod ergo fîccius eft , minus 
eric morbis obnoxium , cum morbi fepiffime putredinera 
fcquantur > qu^ facillime excitatur infaumidis : Hxc namq; 
obporoium laxitatcextraneo calori nimis pcrmafunt> â<iuq ^ 


Digitized by 


îî^tiis^ cdor cbrrumpitur > cx quo ficca âb humîdis hc^. 
licaotioia mixto diffoîui centingk ; M cur ficeius magis d(> 
le^? Doterfiquidem eftpaflîoicnfus ta(S:us^ cuius prc^pmm 
mfirumentum cft caro > feu partes omnes animata moUes, 
vt docuit Arift; iib* 3. de part. cap. i. &5. &iib, i. de 
Jiift*amm4^ca^4.Acaro autemb^ 
mamdokr^f^î crk , noa ficca i C^nimmofi 
ta magis doier^^pnfueuii xcur iigamenta&^^ 
«i^mficciffimafiint , fenfus experuahabentar > Quod fi ncr.- Nemr.qaâ* 
ui, quamuis fîcci^ cxaaiffime fenfîtint, id indâ protiemt,^ SSdî 
quod comm ficcîtas , atquc > vt ita dicam , terrefbeitas > ao- i^aat . 
ammalium fpirituum copia maxime attemperatur. Huc acce* 
dît, quod eâdem prorfus ratione > qua Hippocrates videtur 
probare dofcrrem fifck^rib^s IfwpartibHs magis excitări, ^^^^^ 

tb in Tim^ ,:vbivoiuptads > dolorifquc caufas imieftigons r 
diftin^^mt p^imd partium corporis naturam in eam > quas fa- 
cile mouemr > hoc eft , aîceratur , vt funt moHia & huraida ; 
^ ineam, quasdifficile,v£jdura& ficcavTubditqae quod 

pa£f<> s farsdm^udlibetfiqumîihtisţ^^ xmM^ue faQionem 
ipfăm transfmdity^jmufyue ad ţnidmî:i^€.fidempmtâniatur^^^ -oU - 
ţerhosqmfînunm hiSulihtiofciiur^ 

Qu(^vero contra efia^^ 

^ ; drcuJarem. ilh^îransfujîon^m n^hahst^&iţfiimy. ^uoâ 
patitur» folum y ţroxima'vero minime mojîeî : Quaproţter cum 
pi^eS'^i^aŞspaffimimprifnamnm i77^erti47tt:yiMiimque.did*^ 
Jjrpmfi^o- circa, o^a^ caţillofqtiei^h^cUqms'pmU^^ 
"t^r^urifmun mmUsŞmU , 4cci4if ;.B3^qmbuş verbis fam^a-. 
tcty vt ex Platoîîis fentf ntia quofi^ciores imm partes ^ ed tcr-*' 
reflriores efie > ac miniis alterabil^s ; 4<>]Q):iqw proinde mi- 
iHiS obnoxias* Casierum quQdhumida minus dokant,.h 
aîduum eft peifuadeie : HuimdiţiLsnamqueimajdmi^ad 
fatur dolorij vt patet ex Cal* :^^ cataţopvCap^ i* qtîippe quaî doiocu 
t^ntum abcft, vt <;^pfî6i0tmm foîueadQjfquodaddoiorefa 
escitaKdum nec^l&rid^fW^ţeqoî^^ioft ) ipium; 

B pro^ 

Digitized by 


X0 HJP^(m^I^m li:MJ^ 

<k> 4iueîkadoq^c>ingi3s :¥crd conrrahcnda *ja^ilqî|<^>4f n- 

lândojyc dmiîa.potiiisia vriiim glutinei:> partiyniqp^^iiC^ţi 

{umuippei:e profit, eas defendcns , nefacile defeifcaot; Vj^ 

giudno^r ^^%^^ ^^^^^^ gî^^^î^^^oî hafeere îiumidiţatem: o^erua- 

S'^^i ^^p^^^iîi tamerî ficcâe contra âcilc difcoM^)^iiJWîi^ 
ibiutionciii p^JîWî^^li^bjsauE^hucaklt iilius , jquo tcrreae pase^> Qc^ ghma? 
auenuiît. eModat^,vniuntur.^t€ademhumidamorfâ$^OT^ 
\ î^e<îuaquamJrationabacjeft^cumVvt%râvidjm 

fiŞmas iîiic humidar natura? . Hssc funr > qu^xontextui hui^ 

primo in tuicti aducrfari videntur:, quibus aafe prarbecur ijs> 

qukde iummo hoc Au tliore non vndequaq. optima ftnfiMnf > 

Hippocrati emn,neque ordini adnixum>*&:qtto ad:plcraqMC:W: iiicopfo* 

SinXca ^^^ proclamare, aiiafque ei nota$iiitirerc>.¥t Q^e^umf^pg^ 

icnas, %>ias fcciflc oftendit Valeriolâ Jib*^^* • ^fîarr,^^* ;¥en|mrJ:^ir 

GaL 2. Aph, giofiuşjagendum eil cum anciquitate, vtque afeuir ipfe Gal* 

uefque Aul hendamijs ypQîius duUtaThhim e^ nos ndmnteUig^e ^qmm ijhs 
tcm?e ""re"! ^^H^^^ ţ^^o dn*^: proiiideque.;attenta admoduiia^^îe^ipiic 
prehenden- medxt^iionequc eorum mens qualî e îatebrisy vbirnon xarq 
t Im^ ^elsd maieftatem^^ recondiî^Jacitat ; vel idiomacis transladoii.: 
ne xaîiginibus oJ&ia eft , erticndă • Scd agc .dum> & ad pen^ 
&mxedcumes;magnumSenem amice interpretemur,qia 
poft expJanatâin fiiperiori eontexcn vniuerfilicerartifiGipfa*^ 
partium omnium in himiano coEpore vmonenx> cx qua op» 
pon;iînitasoritur in partibns ijfdem morbos quoslibet ad in^ 
uiccm coaimin^candi , indeqne coiifecOToneqnadam qua^ 
neceiîkriaproniîntiaiîet i mbîabonmi iimijiter nalkm humani 
coq>bris parten^ abibîatc priiîcipium dicendara^fle>&dfîn-^ 
guîas &: principiam & finem qaandoque effe poife^iam inter 
eafdem dijftinâionem apponit, yniucrfalitcrexplican&y qu^^ 
nam partes difficilius , qua: iaciEus aîias coafficere , aur âb 
^^ij^CQzBcis^t^fmt^ communicatâ materia morbifica • Ex 
quofuctdc ijs prseciptie mortws in hoc lifcro agi.;, qui^ fin* 
xionibus , variaquc partium inter fe âîrerc^tione in nox^ cx- 
peHcndiş materijs<^utmir^Aâfrog?iofimrprastercâŞ^^ 


Digitized by 


Gaoâimmoă6-a.nîiih.xc fgiKeiiţia «q^a ex îaborantispattis 
nawra'prxâicere-^iocemttr'mprbQiyîîi-eoB axodo; brcuiu^ 
tem, audoagitudinera; verum: eciamquinam exipfefad; 
lias, fepiufqueimm«£ari, & affines latdereparces vakant . 
Diuidicur textus ia duas partes, in quarum prima parriuni fau- 
manixorporis idiuifio^ropcaHtur, qmtmns fcilicetcj^ aat 
minus difpofîtas a natura' funt aîterutwm îadere aut işEdi:^ 
InrecUnda Jer» diilinâiohis ratio add^citur, -QHftd :crga:fic, 
clus eft ,ob&amienSta£emdutitiepique«onfociiş;parăbas 
quam^ile caafficirur, cumque Iahorw,-co.Htmnaifcer£ţîam 
laborat; nequefimiliter, eademque&cilitac^, alias aftcir. 
Coafficitur quidem faciie eo quod. adueaientem quepius 
tv65dumiiuaip.rem a&nmuc fua4eBfîtM:*^ud fefifiic, ne îVii 
teriiîs pJaetedalţaatt^r-inqHe fuisr p^rec(âatib«spaulaEiin â&,-: 
iadeiofeâunt> rednet* Coatuiiwcitefcvadiabor^^^ 
modificam aliquaiaiivfeiiabueiit roatedamjSuc âiînxione,. 
fiuecoingeftioneconocptam; îenaâtcriasişay.îum ob mea- 
tuum aiigAjftiami, tamoljMuîmeai^qtti «^s^ttilfiuaî gonaci-: 
husiiabt-^editi retincţ, "Kcdj€caiime£fflocrei aliafquc ad 
pattes:adhfaiilna£:î Indequ^perâuaciceta^Qtaţ^nequeadca' 

licetiaolîaao v«e£usaccidit in ImmiiUs » qea5^îa:»^«lm 
ja^aqoe, Ci-qaid recipiunt, -Ysl fadli-ehbi 
TOtiuatut. Adlabcntibus vero JnfefHs inaterijs,aibenu» pk- 
xmni^ tKuilîainiiConccduHt . Bxquoiît;jivc.hequeaded fa- 
cile focîammjaruum.mo3âîps.coBJţakaatţ,nequeJpIâ^ 
»timch:er4^ai«nr,fî quandiâ p? «tesnamralicer eas ^ci cob- 

' -■ i^-^{' v; v;i•v-^.o4*..> *.o.:jtfl:-<îucmad«3K)dom:^ Memorai 
^ Qudd quidemficcms eft^J^ .^^g^^^^^g^-^^^, 

matîcîB-parties *':■■■--' .^ :■.;'::.: :'.\-^-.:-: >.-■ 
, V, , ■ . ;-. • thoQeft> &&pius, &firmîus 


certe tji^dîiţpi^ aiiucmcnd ipa6şri3e/ai:iUojxm |>4:ie|^t 
aditirai intîifiUDpriamfiAikntîami riam 

rum dci^catematiUB.Qb:iGalaua]^5hofi^ 

jB s vbi 

Digitized by 


12 siPBQCRATis mm i. nm^mG^mmoM. 

vbicartiofâs partcs, <|^oniaaî^eâ3mmfiibftamîai&TOoHior & 
rarior eft ligamentis , citiâs teflâmm^riv &^iâiiari afferit^ 
Contrarium autcm eucnire itt Batiita ligamefitorum^chor^a- 
rum y atqu« ncruorum : Q^a enim ratione vix aliquid ixx fe 
feutnoris externi fufcipiunt, cum dura: fînt & dcnfae: huiufm<>*: 
diparces, hac ipfa rationecum-diâkakateiimittUQt; fe<i^ vt 
diâum:^ft,fepius promptiufque laborat 1 ftuxiaîiibus^ eo^ 
quiaadu^cţites humores vaporefi^ue , quibus humidiores:: 
particula raras laacsequelib^rumptemmqu^ 
cum^ namrîdi 4enfîc2U:e^ iuxta fer fiftutxc > atque vîcetius pro^ 
grediinhibent, eoiqîîeddndepauîatiminbibunt* Hocdo- 
cuie parker Gal, 2. de loc. aC c. j. circa £nem . Pruriginojmy 
inqniudohrre vem aâfilamjuperfki^npminet: mn tamenpn^ 
Ttt^aproratipmiţpusf^i^a, fii^ accidens'^ ea^ipmâdet^or. 
fuhieBisfii partăfm<c^ . Sicnbxij .non: la^ Jmmoj:es>;; 
vapaccfque âblntcrioribus ad extern depulfi;^carîîi^mmexîi-î^. 
branami adipcm,-aîiaf(yie fa»p^idio]^p3u::ECS hmop^^ 
feante$> dem^^a ficciorisxuds^defâiîtai:^ detemii^âbi e^oii^ 

genais. ^utaaeasiJa^s :|«^ 
32iius etîam V malorique ^hsfefîqne recipiunt^q^ 
piimţ,fîcd<M^s hse jiaitesj.quam Jiimide, eo^orsaspado:^! 
c^0;aâcs: înfeum -clauum maiorit^quadam inlisefionc 'excic 
piunc, rquai^faciant vel Igmm , vd aliud quid iîmile / vdiiise 
laxumque-, itaut illas per modum p^rmanentis > ha&|tcr mo;: 
di^iiB oanfeuuţis plerumqj^ recipea^e^isr^^ 

^ macia aîgroîare î.vtitur leia^^ yfâiia: 

A natura fokt ^^^^^^^^^^^^î^^*^^^ peculiariqueccmfiki 
;- . ^^ofne,;quarahabeud^quodiîcciu$jeft, 

s-i.oa . -rf :v:^i^r: ;.x t.^înmtoxaqxoiîUiajacialaborâU: 
A^aîÎ!)Qseaim,i}ui wfi(^a«ft,ftafeiiitttr&^K)îî ce^^^^ 
H^ie«amc^^pa^pa?op6fiu:^ ^ ia^au^atemiif : 

i^'^ 4 a ^ _ rado ' 

Digitized by 


explicata €xiftatrquod enimikcnxseft/morbdsprbmpriiî*?> : : - k^: 
ac proinde &piuv âb alijs excipcrc,îritehfîiii^u£ & contunia- ^^^^ ^^ <^ ' ;. 
cius^grotarc, confueuit, eo quod morbifica materia in îpfo^ _ -/^'^-^ ^^ 
^tin^tuf , iiBpingimr , atque itâ obfirmatur , turn 6b parris-^''^ ^ ^^^" 
focitatemvqua humores fiibinde magiscrai&fctint^tum 6b ..^-j-^-^^^-i^ 
porerumColiditatem & angtiftiam , qui n^qu« m^dicamenti^ 
iagreffum , neque coardatis humoribus eşreffam feciîc'co n- 
^^nt^vrillinc pc^tnodum difficiîlitti^^Kque 
Y^canţy c^m nequ^ expuliîu^ pulfîonibus , neque medica* 
, m^ntotrum traâiani cedant • Adde quod , cum ficciores a? 
foermaticse partes eo careant humido ^ quo ccf>iofus natuî^- 
Ks calerfuftentatur, frîggid^ plerumqueiutit , difiripanăi%c 
humoribusnMausaptas^/Hinccft > qiîodnonade^ficifccct ^..^^^^ ^^-^^ 
fcuc morbntî iicc&y M^nefuofls in partibus onrşţu diiEcilli^ r^^^^^^^ 
mos q^otidie experimur : €^^^^ etiam , neqtie adeo âcile^^^-;).^^^^^^,^^ 
commanicantiir cohfoeijs partibus , etfî eas fâc^îiaie mfym^p^^^ctK^c - 
patbiam «ahere nat^ fîiît^^nfe^fâ ptiitatino y€imâQ\ic€titi^^.^a' h'^^^J 
affeâs fueririt; Vt qucKl alij^ ex natute^ilftimco impemri^^^^^^^ /** 
î>€rentvn€<|uacpamimpemtotur ^ ^ . :-^ : - |^,K^^ . 

" QuI v«o în iuîîudoLî i^ &;aîi|s ^^ cpr^ 

. , mcrbus, morbique materia, quat 

mo^vfeîrt Vifcera , caetcrajque carnet partcs , veniş . cpşiplii^ 
^us , arterijfque intextie > diffluit , faciliimeque ad <=ogna« 
tas:mrtes j modd ^ ^maii|^:m<>d6Litd altciâm, cxcumt!, |irout 
feâc^ auciUac^uacumquei excaufiifacilius* 4iffluexea:mcedir 
m^ridquc ob piDromm iniiumiiiis paţtibiis hxitatem, vena^ 
lamiquc patcitfisii^fîdiulo^ >> qyiperfaaikmJiîgreflkn atque 
^eiTum exhibenr , piQiiîdeqiic v*f i^ morboriim tranfeau* 
tauoaes aţqm âbfceflus, laboirant^^ 
hemusrobhwpoîU0iediîil^myn;amm^multo^ ; . : ;'^ 

<^C0pI»res^ode.n:i tcmppre <ura^i ^on p.Qfife ^er^ti^ q^aiî 
h^, humoi^juip ioft^ifea^. copti^iua mdigeat:M^di^i #4ih^ 
ţi5fe,^9^kMs iUw ism€ţgc»ţg>m^mptom^«Si#<!f^^ 

Digitized by 



14 mFFQCRj^iszm.}ii'j>mmff.s^HOM. 

jtîiorbis:occtnrraţ • Quodipiiim^Hipp. îib»de<ke* jg^ un, io, 

-^p^iS^^tos 0^ adeceptisper errorem^j^ 

bea: . ' Ijamimfunt yqţminhunddis cwfiflunt : j^uapropte^^ 

ţufcLy ^ 4 fortuna trm^uţantur , nzm vt docet Gal, com^x^ 

iEt tranfîriigrans reqtiîem fedr '^"^ ^-^^^ î^am^ţ 
- •: \!^ ia?; -^ ;,.y^parteş^omae^ nmiu 

dpîere , vt dbcit 2. epid.fec. 5,;, cum raro accidac^/vt tant^ 
fiţuoxij.humoris vbertas, vtomnes, autpîures partes^ eodem 
teiî^pore abiidere poflic, fed dum aiccraiţLOcgupac» priar^puţ 
reliaguac-ixeccfle eft^atque id requiefc'cre^iinic . . , ' . , . ]^ a 

^ : . '^.<: : . DCL morbuş , qiu:'m;BUn>i4a 

«ft^^p ;quo4 cius n:^ateria ^fecillime .alip tranfmigret, f€4 
f itkis cti^m extinguiţur , ^tgue p^nituş; ^^xter^minatur^ ciua 
liequeat alţas itiijcere r^diceş Q.b cam tnobilitat^m^quam bu* 
mida quf uis cx fua natura febgntj^p^^tiuQîq;. peruiam fubr 
ftantiam, 6b quam' infeftus,humor ^& a natura^ Se a medica^ 
menco'quamfâciîcdilîîpabiîisieft* ^ > .- » ,^ . - 2 

I V. Co.rp0rîs autem finguk părtes altera dlten% vbl 
hîac^autilîiacprocefferif^morbumfiatimfacît. : 

^Xplicatism vmuerfunipambii5>. qu^ exfid natuta obp.Cf 
^ <niîiaremfnbfi:aatisB;.modam fitciiius^diiEcifîusuc ^a4 

rum morbe^ excipere, aaeprbpri^s impertiri nataî funţ; qua^ 

temisnimîrumapdotes>:autuaepti6t'ib €^^ 

matcrias ^apeflenda^ ^ retinendafqi alias niiiic rationcs pecu-». 
sympathfx îiariiis explicare aggi::c<£ttir^quibuspouffi 
^^^^- c<>rp<Mre^^^iip^iat .cxotiiftitur-:- Ciim enim ^^nobiliorimu 
porc . PbMoibpbG^mP^ fitT^miIkm^tirrâîe^ agci^^ 

%2r^ in M^;Mt66tăâumiIf^eto >î^|^^ 

n^ ^tfiemaşcum ^^^ aSionem iie£^i&rio pr^reqairi,vndc: 

Digitized by 


,<B;C6atimmmnec€îîee{î^ai&rmt, vjtindcomnisdikyirţus ^^;^^ 

li hiimana.armonia.iibi iiMc^m cornipariiintur^ ^eeuHari aii- 1^^^ , 
^uaeciamratione ;fîmM căngi atque connccfti : de oua^juir 
4iem conneîdonein prcsfcnti textu auncpccuîiaricerag 
Caterumnon inynoiiocduaitaxat comaOtuiym . 

^u. ^5;^,amumibt<^tafe5,4ficappeHatHipţ^iiP 

L^se continentul^ fedi s?ţ doctiifime.FmcafiQrius -<mxclea> ^^' 
^J^ipr^er agendsikultatcmi. -îmrori^ etam aptuuclopi^- tip.«^ ^r- 
^qakitur : ia vt> inipaid$ aaioB£> -vt ^^^r^^^ 

finem deduci poffit ,. î>ria omninafintncc^flariâ > Agemis la- Tda ad qui 
cultas, Aptimdo maieri^^Cohueniens applicatio.qu^ in ccn. ^^^ 
taduvfi^^ > ^ moraconfrlHt . J>Jcquemah^cîn ^Quali ieiT> i^io xe^ni- 
pcx euidentia & gradtiin.qualibctagenrium can^logtaiynTpa^ "^^î^ 
riiiaq; cxiftunt , etfi jomrua aîiquo/ pafipcTf^uiranW ^ kd |^Jf: 
Qusmddqpe appiieatta> întcrdumnaacerias^apiiimdo, eminei^ uenie^ a^ 
tiori in gradu conlpiciuncur, qiiâjnuis.rcUquse du^ i^ond^- pUcatio. 
ixnt .1 Hinc conieniiim laplici rmo^Die af cîdexepoflc nciemo- 
ri^ prodiditGaI..,€x vicmiajcilicct, feu . pr Aximuate y^ Go.hs.cfid. 
mtmeris fodetate ; ^s aifinitat^ gcatrris ;^|dque au t poiitiue , ^^^- ^•^;|:^ 
communicato ad inuicem prauo aliquo hymorc; v^pore,. aut ^^,^]^^ - /^: 
qualicatev vt in.ocijliMuiion£âvenmaUo^ia^pyl^tica ^;^^^^^^^- 
conmlfione exaurarţ^en^nata â crurc.> mxt&l^pxmQm fcepâr 
tisâ fcinho lienis ; aut pnuatme>nontranfmiflaTid^cet ma- 
teria , aut facultate , qu^ ad acKpncm aliqu^m,titi abeufc 
damexnaturseinftîtuto mi^i debebat, vt mcorpor^digiti 
ob neruum in dorfpiaefum , vtfcribit CaL i^ dcîcc.a£ c. 3. 
& 6. & alibi . In proximî<Sribus fiquidem y îjfque, qu^ mu- 
^idsfocietaţe cdnkntiunt ,appJicati©;px^.cipimtîit ,^ cum ea 
procufc4ubio mâgis applicata exilknt ^ qţi^priximiora ; ad 
proxhnitâtem. autem continuitas reducum:^^ ccntiguitas^ co- 
h^rentia> v^nioq; vafis aliquibîismedijscekbxaia : vnde ea,: 
quse munericuipianiobeundodicataiunr^ Ftprticulc^-o 
mş oculum coî»p<mentes > Vificni ; Yt^rus & inamcua; fio^ 
ligenexandas cducandaeque , proxima^ pr^q;£^ceris2ppli- 
Câta^diccndaiiint^^ae quidem , quia in eodena, ipembro co- 
B|tek j h^ vad ^ quad ¥afeîum comniufuone vniantur ; Ia 


Digitized by 


îjs autcHî y quţ gettetis âffinitate fbcîaţa exiftunt> imtmâfe 

AâTocMca- tiarimr - iiam<juen^iuTQduj3a:a(^on€s:omne;j&p^ 
Wau ^* fiiiHiaxiumpartmm> opera fiint > & effedusformaKs contra^ 
'îiiuf'^^i^ *^^^^^^^^ 9^f^^^^^ip^iî^^^^<^^<iit^^^^^^^ matetise a^mtas&;& 
mrsal'fac^^ militudo in ijfdem caufe eft vt pnomptius fequatur aâio>, feu 
^^^^^ tranlaiuaâa: vnd^qugademconftantil&lkn^ 
i^iiace ia; parker^pâtudinemhabefît ^ ^teoiem^morbo capiantur rita 
#e^ • , . Yt iî parsaliqua aliqwm morbtim eontram cdquod contra- 
âetateni: cum agente m,ca:bifico feabcret > & pecuiiarem aptî^ 
sxîdinem y vt pemciie^âb eodcm^patcretur ob materig fami-f 
feaofl'^ge^ ii-^ntatem ; feqmtuTvt altera etiampars:, qugeiufii^mfitra^ 
ceri, neruo. iionis^cafdem obcairfâs pcar^rfterispapţibtis facile âbepdem 
ib^fAcm^'^ afiSciaturi atqiic ita ncni^Hm j^eniofageneri , venofum ve* 
eopattamx^ Rofo facillime compadtur , eaadeaique contrabit lab^m.: 
A^onanaque fit inter contraria, qua^eunigenereybo^ 
fubie^o- idem f%ni>y fpeciev feu V accid^ntaM foriiia^^^ 
pîurimdm dif&rant i vmic formaliscontradetas caufa efi; cui 
l'equatyr aâioj {ubie6tiaucem identitâs&.fîmiUt^ 
eft cti.rpromptius^atdemfequat!iir * QHibusita.enarratiSycerk 
-^m eft in propoiîto textu de fympsthia^i, qu^^ ex proximi- 
tate prouejik,&exopcriscoînmumQne,cE^^ 
inunio cohţr^tiamt^ veLvaforum 4£x>mmunirâtem px^fup« 
|K>nât,.vtdiâam fiiit; quemadmodxîm inferius texm 9.& lOa 
de eafermoE^m babebit, quf generis affimtatem infequitmy 
Vnde iic dicit»- . -: . i . : ^^ ^ 

^^^??P9#^^9g^îi partea 

^- ff^|.jj^j hQ<^^ft^ vbiaftericoniun^a; &e^r^^^ 
,^, ; : . :.ratioBepr^cfterisappIkat^i.vicimtat£:pera^ 
tiguitatem., velcominuitatem, vel coEajiîoaemy velpecvaJ 
ioTUm cooMaunionen^ , x^pod venas aliquas,:ar£erias, aaii 
neraos infercosadinuicem habeant^vci a<icommunc aiiquod 
op^ obeiindum, vci^b aliiim^ quomcumque finem a^i^ 

.JQSi^i profioium ^ - ^ , : „: ..:. : ^'c:..^ '..•::;:.. f ■ ' 

"" — .../......,.,. .. -RKirQQte akerutrini apt 


Digitized by 



materia , aut^ualitate , aut 4ebita^âîiate , aut materia de- 
nec'ata. Sic ex vicinitatis iure ccrebrum confentit vtero, cui 
per fpinam conneaitur ; ynd^ occipitis doîor mulienbusfie. ^ 
quenofîîmus . Vcntricuio confeatiîiat inteftina , quae sicon- 
tinuanturî â: adredi inteftini , vteriq; ioiîammationcrn, ac- 
cedit ftrarK'Uiia ; Iccore inflammato , fuperuenit imgukus ex 
aoh. 58. fee. 5.Diaphragmacompaciturventricula, Hepati, Confirme, 
Keoiq; male afee^s, ijfque l^fis, & îpfalf ditur reipirano;e^ 
fcilicet, quod hgc omniaieter feproximafunt, aum vterus 
inter vefîcam,reaumqîinteftinum meditis refîdet; dnapţrag- 
maţi veto Ventriculus , Hepar , Sc lien adnediuncur. \ ato- 
rum pariter communione Yentriculus confeaEitcerefaro, cm 

per fexti coniagij neraîim vnicur : vnde capicis dc^or «x iabor 
ranteventricula; vomicaş.aucem excerebro, autjjv^nbra-» 
niseiusjinaîeaîfeais . Aiqueitaquemad?nodum»3JoaJa 
Mundo fummus-iUe rensm Opifex entimn varietate.mire 
delectams, prseter pdma ilhelementariacorpora, aaatuieitis 

fidentesjcreauic ; osinia , iuxtâillud fapienuf î i .,m Jnumero, ia vmuene 
pondere , & menfuraxoi^ituens ; vnutnquodque fcHket m '^^^'^ 
determinata ipecie, fuisabfoluta.numeris, atqueperfeaa; 
menfurara tamen,.atqueintrâfuaî effentigHmites quaficoer- 
cita, cum pondere^ feupropeBfîoneiQpropnaJn, fibique 
peculiare bonum : qua proutaaturâ vel cognatafunt Se &mi- 
haria, vel, plus quam par eft, diffident,ad pacem &aHaici^ 
tias,adodia,belIuraque excitactur-imutuo tamen federe 
vmu , ad mundi eiegantiam , pcrfeciroivemque mirifice con- 
feruat, &L quandamieubarmoniam difcordi xoncordupa- 
HUfiS. <Sicprorsusin.homjne, mino£imuiida,rerum om- 
Biumcompcndio<fineque. #, incpit V2&tiins,mt^mem- ^^^^^^^ 
tranofiray'dmfecMndTmmturamfehahent,^tîpatbia qu£- u,c'6.\ 
dam yqmm natura in bonum animantis creamt- Caîida nmirfoa ^ţ^ 
iemulpnt fri<raiâa ,frig§âa£aMomm feruorm. fidat^^Humt-r ^coipotiT 
iaemfllimtftmra ,ficca ^onfrmmt hwnidiorasitâ a fijffis ^^^^\^^ 
mum ţatimticCy-ac fihiiţfu mutuo ohfifieniia, conîmenî jeiţj4 mâţi 
inmdiomtiaemrndihii'otth^tmh^cmtiţaţhiAmiitraiise^^ »«« 

C Ai 

KlâtiS CICS- 

Digitized by 



prfternaatrali iaftatuconftimafunt» vtâidmnMc, itâ vt 
etfi panes amnes- in humani corporis compagefimiîiariter 
vnianturj_3hqugmhJomuius funtoccuJta quadam maiorioi 
anâîogiafociat2,vtinIâguoribujreipfaquoudia experimut 

* : VenterCapitI, Caputcarnibus ac Ventri>&reH- 
qu« omnes luxtâ eandem rationem.quemadmodiittt 
Venter capiti, & caput carnibus ac veatri . 

rlftrlfi^: P^""^^^'»^«^^acKo.>-/ ideff , Venter, vCus eftHip* 

cidum,qmaUmentaexcipit;mterdumLnfimumventrem,vbi - 
' ^^°^%"fl«:',.naddv^ 

temam. quamlibercaaitacem ciliain cerebro,tum ixiHepate. 

namqueagnolcic ventriculosinhumanacorporei quSm! 

liuepc.iicuîa , fme carne comegatur , reiitricuimu habere zi 

Im teftatus eft Jib . de corporis humanipartium appeUado, 
v-"«rf- "^ ••^!;:.r^"^^\^'^^"'»?^^^%capi«perpetipoftijăd^ 

cetalimenta coliiguncunmaximuiuqsficco & Jbumido orom 
ptuanum vocacuriib. i. dedice, \c gratia exemoH hS' "''•«• 

fuoenor ''"'î"" ^^^"^F^o ^«^ explicat Auchor,quod 

&penon contexm generalicer de fympachia docuerat^ eo- 

ioc. att. cap. 5. fub fincm: Vemriculus etenim . ciim nctnum 


Digitized by 



.îpatcntem viam, intemamq; paîati tunicam opitkpirtcs 
attiQ^, tantusiocer ip&m , cerebrwmque ,^mterce<iit con- 
fenful , vt nullus fit in capite morbus , qui ai) ipfomet venm- 
cu!o fympathica prouemr* non queat , vt funt vertigmes, fc 
pore/.Vigili^, Deîiria,£onuulfiu2onines,&apopleaicaî 

4. Lauifq;aîijsquaUtaribus;itâvtiureHipp.dehonu^ 

flLchc^r^ciţamtur. Caput «.contra , .cdauffimamcorpo. |-,|fr. 
ris parce fefideîis, orbiculariquc, quam obtmuit ,figura>0n>. ca^prouc 

^equaqîeattrâens, t<:ou«pra:fcmm,^tumhurnores, turn 
™es:,:aiiiinnaa leuimc fapmme^d^iiim^leuamur^n 
pmerrawalitgr Kpkri^oncingat j ^el ab fxjsrnaaîiqua vi 
ldmembranaş.yfquc>a«.sdcerebrifubfiauaamafficj; non 
o)od<iiphmctveninic«ao ,<inpecuîiarker loajmareft , fim 
iUico irapercimr affectiones ; id vt ipfo vulnerato , ilaam bi- opite -^ 
Hofus iuperueniat vomi»is , forsara quod iasfa pars^dum mov. ^^-^^^^^ ^. 
bumâfe excucere Duarar, .concucitur quodammodo , fo-: ^» ^^ 
ciumque Vemricuîum vnâ cominouet i cmbilis accurrens , «^ 
vomitum excim ; fed ad carnes etiam quicquid noxmmlia. 
bet,tranfmiciit, vt late videbimys lib. 2^ vbi de «rcbrali- 
busHuxiombus agemus . Adcarnes^> mquam , ţammuicu- 
lofam, quâmparenchyman, feu vifcerum propmm. <:a:te- 
rarumq. partiuin fubftantiam;, noa modo lob fnus oppo*- 
tunitatem; verumetiam, quod oşanibus per neruos, arte- , 

jiâSiSivenascolligatumfit. tt 

•coţr-municansvadeljcet ad inuicem 

luxtâ hanc rationem^Qjbof^s^aufis, 

ybi conneîuon^ aliquam peculiarc 

CaeterSB «mnes partes'^j^{juerint,fîue generis, iîue proxi- 

mitatis/iue munerisj in morbis inuicem fibi compatiuntur . 

VL EtenimvbiVentercgeftionem moderarăm noa-^ 

^ fecent,&iniprumobusiHgeraiuri iaimiidirate CI- 

borum ingeftorum corpus irrigaţ .Ipfa autem ţumi- 

ditâs â Vemre obOruda aceruatiro ad Caput viaţxw 

Digitized by 



fâck ;8c vbi ăd capue per uener ît, a vâfi s în Gapîte-i 
non recq>ta , fluit quocunqueconîîgerir>& crrcuni^ 
drcâcaput, & îîî cercbmm per os ceniie ; & partim 
quîdem os ipfam fiibit > partim vero crrcum Cerebru 
per m teaue ; Se fîquîdetn In ventrem rurfus perne- 
nerlr > Ventrî iBorbum indum . Si vero adaliquaiiL^ 
aliam pariem incubuerit f ilH jpfî morbum fack ♦ 
Itâeciamreîiquaepartesakeraalteri mo^bâ înd^cît €;. 

PErgit Hippocrates eodem FencnV exempîo patefac^rcvr 
nam afeâae partcs fuas inuicem afFectiones impertian-^ 
&Dc Dist. mr: efl iîquidem V^ntriemlii&y tc fo^ efl: C3S 

4. de morb* î • dcĂixtr Sc 4. dc moib. y mzgimm âcc^ &Jbiumido prom* 
iiu.3»&x5. ptuariiîm,qiiad ad mârisinftâr <fat omnibus, &accipitâb 
omnibus r aam eorpus^ipiî r€tribiuî,\^bi vacuiis fuerit^. & frui-*- 
mr de ipfo, vbi plenus cxi&k. Cdmqu^^vrhabetur €x Demo- 
f^li^' ^^^ libelL de nat. hum . , naturaliarinter vifccra mcdius om- 
Briafufcipkns^ chorumeducat^r&acciHnbat coâionem cru^ 
bernansr (naturali enim C£Conomlx ftxRckm , namr^eque 
mefaiims in-ip^aexcudi ineipit , quo infiti deinde Câloris di- 
ipendia feparantirr ) y diirtr ex vegctabilibus , animamibijfq;.' 
probata ^imeaca- in alibilem fuccun> excoquere nicicur , ftu- ■ 
dioindiget non vulgari, tmn in quaîitatis deîeâu.mmiu: 
quantitate > ordincy & tempore ^ qu<> propofitum fincm a&^ 
fequi vakâi: lîâ-aîioqui pi^e aliniemido humore varia gignun- 
tur excrementa,nîortK>ruiîîfere omm&, trnn aaimiitum cor- 
KGrat.îilî,2. p^oris-^feâîk caufaracque origov Vnde cecinitiîîc e. 
S*ryr.2^ , ^- . , , , At Jîmid offh' . 

DiiUia, fi m hiiem 'oiertent , flomaclkqne fumultum 
3>iGg,X£cn. ^*^^^^ j^^^^ fituiu. Vides ^t pallidus omnis 

c^-Jif^'^^' ^^^^ ^^fi^^ţ^^ ^^^^ Qm^ corpiî onufium 

venter' vita ' tieflemis mtys y anîmum quoqne ţr^grauat vna y 
Sq^oÎL /!^^ ^ff^^^^^ humlHmn^ particular aur^ • 

.-lisiackdi- Ilire igicur Diogenes cynicus Vcntrcm vkx Cliarybdim ap- 
^^^- pellabac r &Arae:€usJ)ucem&datorem omnis iucunditatis. 

Digitized by 



& iniucunaitatis . Huius kaque cxempk> vtitur , c6 quod ex 
hoc vnopartiumiere omnium morbiprouenir? quearîtr f'«> 
tnsmtnauefigmtiesimm videlicet in coquendo,tum in ege- 
ttnAo)onmum ccnfiifio ^v^orum mpiritas .cmmMmmîto ^^^^^^ 
fcripfit 6. cpid. fee. 3 . miuo i & Qj^Serenus » simoaitn» 

.tim ^mMhum'BiegmtoîimcoTfcmye^& 

Ccntendnnt, vera niti ratione vidmtur . 
Bum enimrodidus firmat tenor omăa tnemcn-a: 

ji contra eiufdmfragunturciinBaăoîore. _ 

Inter plurima autem , quae -in cibaadmiaiârando ccymtmttt 
«offunt errata, eius tantumodo meminit, quod m tepore con- 
fiftit,tamquam maxrHvi,atq.omm&frequeatiainii:fgpe namq. 
ciborum fuauiEace-itteai homines ^aouum.aflumunt aiimcn- 
tum,veteriflondum-elaBorato neq. digefto, nulîaqueadhuQ 
accedente neeeflkate. Neq.enim vcamculum coniolunc, cm veatricnius 
kftiaq. de fiia non minus , quâcii de csterarum partmm rndi- panium ia- 
<xenmindiciu.praebeat:vt enim tetulie Auie; mturafedtvmnz f^^ifj^ ^ 
^hvumpfofeăaŞsmetere ohm* alimentii^eahfentiamfen- j^^^^^ 
tire,vtoms aUoruntfilns.^feţortaret-y Qjiod pro niorecîegar> 3. 
tiusiam priusdocyeî diat.ijş ycihis.yentsi', quoâ 
'^ autefmtuScH^cxoh'msStcmMhusFateîjatmUasdid^V^^ 

ăuaft omne ayiimdfolus guhemam: namft ^grefiat^-oita in andpti M|crobJi^ 
eB,tituhmtedimoniematu;sîdniaura>tamquamratî<)ms cazaci, 'v 
veîk ac ndie contrihuit-iUnc ams Magiftruni/mgeni jq. largito- 
rem appofite eum appellauitSaiyricus illejquafipleraque ho. ^ 
minuntpais^vt diris huius.lâaatibus prffto effe poffit^induftri ^^g^^ 
vti labore aiTidue cogîitur . Prudcntcr itaq.Socrares apud Piu- 
tarchum monebat, cauendum effe icibis, qui non eiurientes 
<îenuo ad edenduminuisantî & canendum âpotubus,qui non 
ficientcs ad bibendum illeâănt:năm voluptas efia tTudorum ejh- 
iaquitPkto inîimasoj quandofciliceteaca^anturhoniines 'vt 
hamoţifces. Atqui magna fepe moleftia torqacnt, quz iecun- 
da aifegaataq^voluptate fiierunt afîuroptatQ^â-ex intemperan- 
tja moleftia Plimus acriier exprobrauic nat. hift. Iib.35.cap.§. 
FlHrimtmtatmtnegof^i inqmrdmihmimexhiheţ , adus-coMfa 


Digitized by 



22 HIPP0m4TISlI^.J^^lOQ.^}f.MOM. 

nare , vthomo mammlcîho permt . 'PsŞmum corpommVas inji^ 

ţrofundi ^ada exqwirtmur : -^ mmo viUm^mnm ^^.mâî con- 
JhnmmGnis fieditatL S^â^ ■ ,.; % :..' - , 

. ouid. lih. Jîeu quantum fidus^şfi. jn mfcere vifcera, conâh ' > ■: i 
morpiT ^ ' Congefloque amdum pngiiefcere corp^retorptis - : 4K 

-Altenufq^iâ AmmantemJnimmtk^^^^ . -Z 

Expîuribusergoerronbuş .q|ii ia lanţ^molis Xficommiâi 
pofliinîj illius tantumpdojairi memiiiJLî: ,, .qui congruornon . 
€xpedaro tempore commiâitiint^nquam fcaliccî: pr^cipui ^ 
ftcquentioris, & â quo vno^ lî quis ftudiosi fibicaueac, re* 
liqui , lî quando perpetrentiît , facile corrigiqueantîdebito 
namqueadhibito ţempore priufquar^ 
menîum^ & prauam cibor^m quaîitatem 
titatem , & pcrrurb^îum pir^in^în nou raro fuperabit mcura^ 
S^lS: ^^?^^^^^^^i^ vi^^^^^fe^^^^iîifecitHippocrates^^ 
De Dier.ub. promde pluribusregiftrauiţ in locisy vr libro de vet. med. de 
d^nf^f di^t. deviâuaaiti îîecnon4, de morb., :fymptomatade- 
^^^''ft'"'* icribens , quibus ij confli6iari.coiifueuerunt , qui prater 
De ' mor£ n^orcm ptandentes,tempas proindeanteuertuatjpfumque 
Ub.4- n^3. vencriculum > priwbus adbiic xibis moflum^ iterum ex- 
^ plent. Ergo^ _ 

Gur Venter egeftionem moderarăm non fecerît^^^ 

in ip&m cibusingeratun ^^^^^^^^^^^^^"^^^ adhiîc fer- 
. uente ; aut,qiiamuis£oao & 

per cnylofinad cremorem teda6io, non dum tamenegefto 
atqueeuacuato^ ^uperpyloron adgraciliorainteainadetni* 
io : itaut Ventriculus adhuc diftenaas , prioriqne fârcina^ 
onuttus :, noua excipiaţ alimenta . Vbi lîorandum dixiffe 


Digitized by LjOOQIC 


R'ceflTe eft Vcntiiculiim penitus exinanin pnuiqtiam dcnuo re- co cxiname 
pleatur i etfi id velle videtur Galenus ijs verbis , Vaais ţu~ ^^ f^';^ 
rufque Ventrimlmfecunâtm cihum excipiat i fed lacis eft fi maior cibus^ i»ge. 
chyli pars , quar îum qualitate , turn quancicatc molefta erat , Ga!.7.metii, 
fuenteuacuata, itâ vt interior veutrkuli tunica reliquiartiîn ''^' 
faitem beni^^nitate etiam num madeat : alioqui , vt notat Pe- 
tronius , hbfj . de vic. Romr cap. 1 2 . , ventriculo pemais exi- 
naniio , ea ftatim excitantur fympiomata , qus dcimpranfis 
T '5* retuiit.,iaipotenua videIicet,uemor, 
"■ animi deHquium, oculi paHidi, vrina craiTa & paHida, os ama- 
rum , & vifcera prs ficcitate quafi conuulfa pendere ipiis vi- 
dentur, vertigov iracundia, triftitia: pars etenim neruofa , 
vtpote ventrici^lus , cibi humiditate deftituta , ftaum âb m- 
terrro caloreexiccariincipiţ : ac dum contrahiiur , adnexa 
parirtîr vifcera trabit . fatis igitur erit , fi moderata fuerit ege^ 
iHoatque inamtio,modoiam expîicato 

. lîumidkate cibor corpus irrigat; 

ideft , repîet , & quafi inundat, femicrudo remanente chyloo 
pîurimifque gcnitis excrementis ob debitum tempus noa 
Luatuffîin viccus ratione : qua? excrementa ventnculus, vc 
fe exoneret, invenas, ac demumin omne corp^us trudiCv 
Ipla autem humiditasa Vehtre obftruaa , acer- 

. . - . non enimtotus cxcrementi- 
uautn-aacaputYiam racit.j^^5£y^^y5^jn^epjj.i(-uro ^^^ 

nitus,ad vifcera transfundicar, -fed pars eiusaliqua>crailioi! 
nem£« , rctinetur i.atqac h«c , parcimin vapores â calorc ex*. 
Knuata , ad cap ut ekuatur , ţartim vcro per a:fopliagum , in- 
terioremque palâto adhasrentem membranam , qua: his cru- . 
ditatibus pr^cipuâ madet, fursum ab ipfomet capite trahitur^ 
turn 6b coo-sationem ,quamhabetcurapitaitufa materia, 
eum«b figuram ,quam r«tert, cucurbiEulareHv> trabcndo ap- 
tiffimam i cd magis , quod pituita iiio len<âoredo<ailis ac ic- 
quax fit ; icavtvna pme attraâa, altera ctiandequatur . Hoc 

1 mtn.e. ipfUmU^iwi^4ocuitHipp.4. demoibanquicnsvQK^^ 

Digitized by 


îţ4 inppociUTis im i. : i)B loc. m noM. 

în dh ^pîupîuiuefi , ilM vU ai vmtrkulum pmiminpar^ ^- ^^ 
tim corpus adfi ipfumtrahit? ţ^irtim capit , ^t ^uoi câuumjit ^_ 
^ tmtquitm cuatrUtula corpori insumlat^ ad fi trahit^ vtpatem- 


Ecvbiad caputperuenerk > â vafîs is capke nan 
recepta 5 fluîc quocunque contingit ^ & circum circa 

CapUt o£C. ^^i^^y^am delegat in corporey ^Ufmgulisplus; ţmm 
cj>ortet\affuanty^cmtinerenonpoterit.^ - 

ybi humorem , vel qualitate , vel quanticate infeftum , fealc- 
. rit ;dtimmodo valida fit, eumillicoad imbecciliiorem par- 
^'^r^^^re^-^ tcm dcpelUt : itavtin humamcorporis regimiue, idipfum 
men ^oii^Sr- feruari aopareat , quod in oligarchia , pocentlorumque ixiipe^ 
rio > m quo ommz ReipubJics onera xn mnmam£ieDem 
reijcîuntur, pocentiffimis virisomntainfuumvlumreaenu-. 
bus . Hoc de'^capite docuit Hip. lib. de gîaai per h^c verbs. mm.^ 
Capntjiiprâ jitum eji^ furjum cauum ac rotundtim exjjims ^ hu'- 
^niditdtemexreliqm corpotecmfleBens 9 if corpmjwâPi>âp6res 
cmnis (fe'aerisfiirjumincaputdimittity ~^uos caput mrsusr^etra 
iimitîiî : non eyii'm comnwrm'i ac mânere poţejîid » ^odinfluît » 
nm habens pU fedm§nn$t , nipjane corpus agrotet : ţunc enim 
non remi^it 9 fid^ ifm-retind;,. flui c igitur (jupoingue conţin;^ 
gerit faciliores dări vias^ diredas videiicet, amplas y ingreiTui 
patentes> cgrefîui anguftas & coar6îatas , decliucs , per quas 
propria pondere materiîi dehbitur . Fluit (juâ minorem con* 
tkigerit dări refîftentiam oh excipientîs*parcis imbecoflira- 
tem > vel aaturalcm^ vt ad£:nym> cutis, J*uîmorramque ob 
raram IpongiQiamque texturam ; vel moriboxDatraCiam* y; 
parte coatuia > Tulnerata^ autalio^jucuis mQ4o afliâa#. 4C^: 

nc'^iib. de lorem^ăMt dhgrauiîatem , mt propti aliîddqmddamMenant^mt^ 
feiia\o£. 0-9* ^^^^ alysfmt communkationes.: Non modo itaque adfubie^t^^ 
partes^l0C0que diiîitas , pîuuiaj inâ^ > occre^eiiutia Uluums. 
ddabitur> fc^Q^i^dem ^apitis paj/ticute akerii^ pMgna no^nm, 
hximorem a iead pr9;^main 4ebîUorem^ue pa^rtjsm propel- 
Iţmt : ytque m ft^fţşii %mm hab^em? > itu!pî:<^lfti^aisjfxq:| 

Digitized by 


■■■■'■ '■'■%^v.. 

^ coumm-^us iiivsmÂrrs.. 25 

cffwiditur, & vel ciracapuc,& caîuarkm e«cumcîa:4^ 

vel, iicque ibi locum reperiens , incus reşredicur ad cere- 
brumpăos tenue/hoc eft. fmciputfagmdifuturadifcnmi- 
natum , omniaquc inter capiris offa tenuiffimum , ac promde 
facila permeabile; vnde&os tenue appelkturetum 
^u.v vulniapito & â Gd. I ^ meth. cap.22. Hu.^s mterdum h«. 
mons pars ali^ua caluaris fubftantiam inter cfcas lamin^fu. 
i,k, pars-adipfum cerebrum regreditur-per idem os Qjios 
^uideratamvarios cafus proponit Hipp., adoftendendam 
humoris inconftantiam, varidque, qu;E parit , accidentia ; 
cdm BOfl habet vbi fiftamr . Csterum" inter ofTeas duas^aU ^;j^^^ 
Hiariae fuperficies , feiiîaminas , medituMiu,-!! diploes aiCîum> 
^ontinetur ; venulis , arteriolis , cariHicuiifque iiuextunv «u- 
xionibusfuicipiendisapciffimum : VndeHip. 3. de-morb. ce 
""'''■ <,uadamoffis capitis carie mentionem habet, ex toperaemen. 
«eraituicâ, &iaterduaslamia3se«rîccata, oriutida. Atfica^ 
«ut perualidum fuerit , longius ad fubicaas partes noxiuna 
^epellit humorem adventremnimirum, t-uăi &peHorem., 
taminferiorem, mm medium, adcarnes, adarticulos^, ad 
• ^ vifceraquar-cumqueî&quocumqae peruenerit, ibi morbum 
excitat^Verum cum de fluxicnibushilcepîuriesinfraiimiis 

verba faduri , ad reliqua rame propercmus . 

Itâ £tiâm r£liqu« pa«es akera akerî moM îuducic i 

ausemadmodum caput fiue. congeflione repîetum , fiuc flu- 
jdonc, dummodo validum llt , fuperuacaneam nwtenam 
quâ poteft trudit, &-quocumque appulerit , morboium red- 
dit-; itâ ptorsds fecsEterat parteşlefeinuicem iîtdunt, dum 
fuperuacanea fibiinuicemtrâns&ndunt^ Qnmimvao ex hoc 
©ptimtmî prxdicendi geniis docuit Hipp. horoîn.4îat., ^ _ _ 
l^^' kvquiens. Morii mc^ic^ekfoîtiŞmăţarîe coif c^^s frmt ^p-a- ^^-^Z 
tdfjimiexŞunt :^aenim Ţt Şic , 'vhi iidtiimfumţfmnt,ţmna7in « prou.n|. 
ferint, neceip efi fortiffirm tarte ISoranîe tmm corfus la^rar^ : ^ ^^^^. ^ ^ 
iffia'vaMŞmaadquawdam d^UoremSranfierii^-, diffKulur «.nw. 
foluuntur . 'quzcumws âdeUliorihus fartihus adfortiores tranfie- 
'rint , commdimfikdţ^vM :ncmconfbie)itiaÂvliţf^^ 

Gimuntiir, ■..-:■■- ■ ■ -■'- '^ '•• '■ _, 

P Et 

Digitized by 



tâ m^POCRATIS Lin. h DBmcm HOM. 

VIL - Et optîmum fuerk fie curare asgrotas per has.qu^ 
$ m athko niorbosfadunt; ficenimquamoptinic principi um 
rum-mcrbo se^rctantis Quis fanaucrit . 

ruincuiano* ^ % , . * » 

Narrata partium fympathia&rconfenfu ex proximitate 
^ _ : & communioxie vaiorum , vniaerfaîem iam methodum ^ 
tradit > qtia morbi :hi Qrm^s iympathid y & ab alia parte 
prouemenieş> curari d^beant : peculiari iiquideiîî animad* 
uerfione indigent has aiFediones ; neque conimtiiiem cum 
casteris curationem admidunt . Ex quo fapientiiîîmus Senex 
d. epid. {cct. 8. eam protulit fententjam . Conflderandum qtioâ 
cogn^tum eflf^ quodţerfe^^ quanto inagts ac minus . Optimum 
kiiqi fuerit 9 plenumq. confilij, quemadmodum pars altera al* 
teri morbum induxit , lîc alteram per alteram curare r cum 
vera curăţia in ijs , quse a caufa pendent;, in caufa* ablatione 
coniîftatrmorborum etenim per confcnfum cortferuanş caulk 
cftpars primario afîeda; vnde huic potiffimum occurreib»- 
dum eft : ea n^mq; curata , eueftigio & confentiens pars cu- 
rabitur , velut vmbra deperit opaco dempto c^rpore . H^p'* 
lib- de aiE?ct. alui Fluxiones curare docţns > qu^e â cerfbw 
proueniunc j|;fîcJocutus eft. OportetipfisjtP:fi^^eyJti vtd^ 
fluxîim â capite î^Jupmorefvm^reintercipiaş^^^^ tuţmert^s, : i^m'T 
hi enim natura hinc ejly & nemo fenîentiam îuttm reprehendef^ 
Ferme autem <^ reliquos morhsjlc confiâerare opcrtet^ 'vndâtmî" 
cuiqiiencitMrafit ; ^jtjtc conjtderaueris , ac deţrehenderis pincîr 
pium ntorlorumymînimy^ierrammş> XP^u^^^ pxoţuîiţ 2« epid» 
fee 4* in fine , adcmptm d^mireop^^ieţr.^ cmţkprincipimn^ 
quod idem habeturbic etiam inferius 1. 18» iibrg» Quod fi 
feciisfacias, partiq. perconfenfum affe^^, remedia adbibeas> 
Gaî.i.dcio-^^^ nibiî proderis> vt de illQnarra,ţGaIeniiS3 -cuitriumdi- 
cisâ5cap.6. gitorum fcnfîficafacultas deperieraţ, nilque auxiîij percepe»» 
rat ex medicamenco per menfem ijs adbibito ; quod deinde 
fpinse appUcitum , breui integram aţtulit fanitarem . Vel iî 
Icuior interdiim rcddivxdeajur aife^io/ difcufEleuiaur^^^ 
aut bumoreâ locali medicamento ; fuperftite tamen morbi- 
ficâ remanente eaula^denudfubcrefcet, Ă: fbrrafse deterior 
6b labcfaâ:atam partem âb inutili medela ,, Ex hoc ta#nen 



Digitized by 


ot<iinc-eximehaiveniunt morbi, qui per deuthcropathiam *JJ*^^^^ 
oriuntus, &fecunaarij:appclianaiE5 hinaaique, Scfiapro^ raadi. 
thopathia ac primario morbo produdi fmt ; attamen , 
cum nequaquâm m continuo fint fieri , .yc morhus vere per 

parte affeaamfaaoeiTe, fed totaeftin£eri^-iotu%ue de. ,fy»S; 
pendens in conferuari â parte primario laborante ; preferam |ucft in- 
fi confenfus negaiiuus fit : tune enim cil penitiis prstematit- 
laiiter reperire eft in parte confenfiente,vt in oculo laboran- 
te fcecitatecxobftruâione opticorum neruorum; ied lunt 
in faa© efle ; ideo non curantur ad primarii affeâionis cura- 
tiojiem, fed peculiariindigentprouideada, vt apparet in 
pleuritide , qua: âb Angina per morbifics. materia metaftar 
simgenitaeft.Attamenrilentio minime prstcieiindumrym- ^y^^^^. 
p'aticos hos morbos , iî diurius pcrmanferint , in idiopa- âŞeaus, u 
îhiam,propriumqucaffeâumfepenumeroimnmtari, Izik f^^l^X 
panisiemperic.vitiataquefubâantia : ac mnc non iatis ent ^^^^_ 
ptimariumrcmoiiiflcmoxbumjiîqui^mnQnampIiiisâbeo ^^^"^ 
pendet in fieri, fed aliquid propria paffionisjrepcritur in par- 
te etiam confenfiente , quod per fe furări poftuiat, non per 
accidens ad alterius curatiojiem . In vniiterfum igitur itâ: - 
inftituenda curatio eft, vt habetur naţ.iiom.nimiium 
.i»ii.tî. ytmorborum.caufisnosiemperoppojaam'us. 

VTTx Corpus porro ipfuna fibi ipfî idem ac iîmile eft» Se corpu* h». 
€xijfdem eompofitum cft-îSimilic€râiitemliabet& ,^X«rf^i 
paruasj& magnaspartes; iteq; iniernaş acfupernas . ^iieea. 


Am incipit :Hipyo.crates iundamenta^tlerepto fympa* 
- thia exgcneris affinicate, ciîmlofcuiique fatis cgcrit ck ea ^ 
<Ki^ ex proximitateîprouenit^ & €x operis communione* 
Venim fermone Ytimr tamgraui , irthaud facile fitintcllige- 
re , quid ijs v,erbis fibi yoluerit . Corpus fihi iţŞ idem i^Jmilâ 
c/?* Si namqueeorumampleâeremur leîitentiam> qui tocum; 
âf artibus .calleâiue acocptis rea1itcr4iftinguî.affemnţ5ytiquc' 
non arduum effet hun<: contextum interpretări: ied quoniai» 
Medici ^ftfenfatam fequi doatinam,îiequc fophifticis ai- 

P ^ ientiri 

Digitized by 


" : {ţntin radonibus i ( vix emm coacîpi poţeft quid aîm4 
s'mîîîmdo ^^-p^ fîcquâmpaîtcs fîmiiî vute ) ideo aiiq^m^ negotij 
îBcer' ^ua; isiciiTit modiis iile îaquendi • Similkudo ctenim tmct ea 
^* tantummodo cadic^ quse cum non fine eadem fimpliciter nu*^ 

niero 3 iii aliquo tamen , vel in pluribus conueniunt : ex qua 
ad eain proprie requiriciii i^bflaaci^ diu€xfita$> vt docet Phi-' 
lofophiis î5. metaph. t. i3/yexpliqukq> Gal^ de fimpL 
med. facul. cap. 35. laanis pr^rcreâ vidctur oratio diccntis 
aîiquid eâe idem fihi ifB* Attamenomnis porro diluicuir 
^mbiguitas^ fîdicamus Hippocratem hie peculiarem quan-? 
dam partium hiimam corporis conditionem infinuare.> ex^ 
quahabeB*:, vt quamuis aii ^priaeipes fine > alise iafimae for* 
îis , quaelibet tamefî > &fi minima ^ ex ijfdem omaind corn-*; 
poFiicur 3 ex quibus qu^ maxima & pr^cipua eft;. ex carne vi-» 
âQÎîcciy ku mafcuîis, neruis ^ arterijs^yems , c^terifq; huiuC 
cemodi ^ irâ vt corpus totum idem fit y Cihiqac fimile, fecuu* 
dumomnesfuipartesiquaîfciîieet membri appellatione di* 
gnencur> cum omnes ex ijfdem compofîr^exiftant ♦ Ex qua- 
profedo pofidone>ipiimet feirfui manifefla j, perpislehra ck<. 
:3ide problemata^ipfamque ex^generis affiîutate ^aripatiuam^; 
iîîcuknter cxplicabit. ¥ade fie pergic a 

' Simifiter autcm haberi&pâmas& n:îşgnăspa:rre^^ 

kemqiîeinfcrnas atquefupfernas.^milirermm ardfici> 

pi^fiaada y turn componentibus pardbus, ad inftâr vide- 

îicct maiorii mundi ^ iu* quo c^iuit:Creatori?^ in res om n t & 

. creaus benigrutas^ vt mhil jneiFabili fui beneficentia deflixu* 

^ ^ _ tumreliqi!erit.D^:r,inqmtTrimegiftusinfuoPimandro,^(?« 

%ica<te ti^'-expers inmdi^-vhz^:^lmdet ;- nuUaqueres, quai^xilş' 

exiguaj eft natura* > ex AriftoteKsIbîtenda > in quamlrandiini; 

pâxt*c.5* ^ aliquod inditmi^ nor^ habeatur : nam omnibus^ natura^ »u^ 

mcn > & honefliîmpuîchrumxjue ineft ingcnium : vtqut fa^ 

v^ilcf. pienternotauîtGaien'Us >Sapiendam, Virmcemy & Proui- 

^Kioha. in denîiamin his iafexioribus iîmilem iaucaies, ac in fuperiori- 

^bd^reruin biîs Creaturis> aded ^qu2d:i pictate inamncs vfusJttit fum-» . 

cauf.cap. I. i^us illeopifex . Acque hmc faâum exiftimat Rio!aiiu$> 

cjudd Piuinse htimanseqs fepientiaî Proccrcs^omiiiumquc fa?- 

- - " picadC 

Digitized by 



picmilSmi Acgyptij , viîioca qaxthm vegeantiâ brutaque- ^^^:;^ 
non fiae rudiorum hominum k^fio^e^adorare^t; dequr- i^îi^ol 


Oppida fota Canem'venerantu}' , neom Dianamr ^îauen^ 

Fomm & c^penefas -oiolăfe^ M frângere m^rfu . ^^*^* 

îslumina. ' ^ .. . ^ 

Cumtamenrationabiîe iîtfagaciilîmos virosjbonarumgj ^ 
omni«marnumparemes> non eo ftupiditadsdeuemffe^vc 
rude fubftantiam:,qiiaî pafsim repericbatur in vi)s y veaerarcn- 
tur^fed myftico potius-sefu naturas numen^feu Diuinitatis vc« 
ftigium y quod ia re vnaquaquc ;> quamuis abicâ:iihmâ> quafi 
caelefte radium fplendet> & per quod s^egecare plantis ;, feiuU 
rcanimantibju^ > raitioâaari hominibiis d^um eft, refpexiflfc . 
IcâprofeiSld&humani^in^ corpus nonnîincriarcinciocotuoi 
fabre&clumeft > quâm membrum quodiibet iilud compo- 
licn^ : neque ttobiii^r par$ m^ius comlmcla eft, quâm igao- gxL 3- â%^ 
bilior > cum omniaf^da Imis; ad propcias particulariccr adio- ^^""^ ^^- 
nes obeun<iaş ^ Sim\ quemadrnaduai corpus, tccaie ipiius 
Animseir^ftrunKntum, tam affabre ad ilUus exigentiaai efior-. 
roatu appairewt nil aptius excogitari poiBt; itâ qusuis co?po- 
îis pârticula;,propriâ figură circumfcripta,pecuUariq:&^^^ 
dicata;»,vtocuIus>lingua, ca^teraq; huius generis , tam apta Pârsqaatii- 
figiirâVfîttipercomnaodo , decenţi magaajtudine ad proŞ#i^ dS?S^ 
aiâionis exigentiani fuit conftru6ta , vc nairam Creacoris pro- âruOacâ. 
uiAentiamatqiicartificiunipr^feferât . Atqui prseter haac^ 
artificij sequkatem, corpus eî:ianitomm3,fingii^lque eius- 
partcs 5 ijfdem coagmentare Creatori placuic : ac proindâ 
Corpus totâiiter accep turn fîmileeftiîbiipfî fecundumpar*» 
ttm quamlibet > ex qua componitur : fimiîe , inquam , n oa 
modo quatenus aequali prouidentia ingenioque^pro ad:ionri „ 
irequifittî^partcs omnes arqbe totum <;onftru6îa: £mM i vcrum 
€tîaalfîmiIeeftquiatenlîspartesci^sro^a^c^ vt 

caput & arttis ; fîue exîgu^ , vt miramus digitus, fîue fuperio- 
res 3 fîueiiîferipres , cx ijfdcm omnino conipontintur > caque 
4>flâîuah3bcnt, qua: totum corpus, carnem, Yxdelicec, Vc- 

Digitized by 



U3is,Arteriasj,Neruos, MembranâS* cseţeraque hiuulccrao- 
di I quae ia humaaa cpmpagine CQivfpiciuiitur . ; 

I X. Ec fi <îuis Hîinimara corporis partem âcceptaiti-. 

male afficere vdity tptum corpus afîedionem fen- 

qu^h'ţ^- tier,qualilcumque tandem ea fuerit, proptereâ quod 

fcft^Sn rainima corporis parsoinniahâbet,qu«cunqu€ & 

î'^^k'rî maxima^. 

POntionîs huius ratio partîm în textu contînetur hai^c^ 
nus enarrato , param in eo^ qui mox expîicabitur . Poli- 
tio verotalisfift/ Minima parte affecia, totumi:orpus aife- 
^ionemfentit. Oiiusquîdemxffeâus caufamPJiilofophus 
iaAnim^ dumtaxac vnicateiţi xeferret,cum yna. ^ademquc 
fit,qux corpus ^ocum ;, eiufque omnes panes informat &; 
animat, proinde vbicumque ea afficiatur> «ata femper affici- ' 
tur. P^^fletidctiamadlcribipardumconnexioni^ quemadi. 
modum primo Libriiîixiusconrexm diciumfuit. .Altera ta-^^^ 
men, «aque ingenîofîffima Mc afîertur ratio; ^iciiicet^uod i 
pars qu:£cimqae ea omniahabeat , ijfden^ue ronftet, qui- 
bus maxima atque ;totum corpus : quamfententiam videtur 
dcaffe Galenus lib. 6. de vfu par. cap. i â^ ¥erum vt aam xâ 
fiat y proximusxontextus Jiquido explicabit. 

Igfuper qmqmd tandem minima pars pertulerîf J^ 
^f ad geniilit^tcmiefcrty .&transfet>vnaqu2eque ad 
fuami fitie bonum > fîue malumid fuerit; & propte- 
tea eaq)as&doIet^ &l^tat uf cum minima gente^, 
qmain mînîmaomnes infunt pari^ > & ha? ad genti- 
les fîbi ipfîs fîngula trân$feniatj& omnîadeaunciat * 

HIctandc cxprefseproponîtur fympathiaexgenerîsa^r 
rinitatesex quailludfit ;, vt minima (juauis cor]^is j^ 
te aiîedla, totum corpus afficiaturvCumenim ccjiaxuraliSoc 
cQnfenfiiaccidat.> vt pars qu^Ubet in confenfum traharal^^ 
ăbi congeaercs , vt nerui neruofum genus , venx venofum ^ 


Digitized by 



ac fie de reliquis ; cum prstereâ particula quarlibet ea habeat 
omnia, qax maxima ac totam corpus, inde manifefte fit , vt 
aftecla quauis minima particula , reliqua: oînnes eiufdera - 
«^enerisvtotumque denique corpus , quod i)fdcm rekrtum 
Ift, 'coafficiantur: Quafi huiufmodi, fîaiiliue argumente , 
demonftrationequeytaturHippocratcs. /_ 

Minima quacuroqne corporis parte affedia , aftciuntur re- 

Iiqu£ omnes ei congeneres ; . i 

Sed totum corpus , fingateque corpors partcs habenc ei 

congeneres j ergo . _. . «- 

Totum corpus, fmguteque corporis partes afficmntur atte- 
âa minima quauis corporis particula. 
Maior argumenti huius propofitio exprefse continetur m 
prxfenci textu .in ijs.videlicet: vethisQuic^uid minima corpo- 
ris cars pmuUrit, ad gmtilitat£mrefert.Tm-iQ.2tiue: namque 
& per methaphoram voce o>s£9w«f hoc eft, gentilitatis;vtitur 
pro multitudine fcilicet rerum eiufdem rationis & effcntix , 
quafih^gcntilitatisiure quodam, focietateque coniungan- 
tur, defumpta methaphora â maiori mundo , qui vclut vanjs . ■- 
completur gentjbus, nationibufique j ita & minor,hoe eftj 
humana creatura, vawjs partiurageaeribus, venofo , arterio- 
fo, neruofoque &C. coagmeatati« & perficitur. Minor autem 
propofiti(^ habetur textu 8. Sc^. verbisijs. Minima ccrfons 
pars ea omnin hahet,qu^eŢimqM<>e S «îa»'»M!,vt ibidem expbcatu 
fuit.Supereffet viderequ^nam caufafit , cur parti cuilib^r 
con<^eneresomBes partes coafficiantur : quod tamen tex.4. Tanescon. 
faâumeâ : vbi cum Fj:*caftono diximus rationem cur aii- g^S^^aZ 
quid in aliquidagat ,.referrwn Agentemi, inMşţeţiam-i^in ciacmr. 
- applicatiQnem.:. trop«f q«« «o» oinuia^guM io cmm, ied f^^fvţ^ 
determinata in determinata, quas analoga dicunturi vbicuoi- psth.cap.ii. 
que enim eft Agentis facultas, aptitudo maieri* , conue- f^^^^flf 
nicnfqueappUc^io, ibi eft vera analogia, ixeceffarioque ie- 
quitur aâio . Gum auţem materia «pţiiudo conEftat potiffir ^^^^^.^^ 
mum iaafSnitate , fîmiiitudinequc, .quam habet cum mate- ,; "dowpt 
ria^Agcntisivnde contraria, inser qua natufâliter fequiuir ^;^»^"«^^v'»i 
aâio , dţfioiuntur âb Ariilatilcdfe genere , hoc eft, f«bicâ:c ^^^^^ ^/j^ 
idem ,fpeci€ autem, feufbimaacuua accidentali diuerfaise'^-_&"'- 


Digitized by 


&aic fequkur inter parteseiufderationisprompciffim«^io* 
aemfierij fîcarum aiiqua contrariam acquifiueritdifpofitîo- 
nem . Htic accedic, quod congeneres partes âb eodcm priii- 
dpiovţ plurimum^xoriuntur, vnde cum inter fc continua 
pler«4mque iint^ magis appiicata? âictndx cxmxt , quâm qu<e 
funt contigua tantiim: Ac maiorapplicatio^ vtdictumfuit^ 
prpmpdorem abfquediibioredditaciicHiem ♦ Nequcdicas 
cxdidis fequi morbos omnes effe ymuerfaics ^ <:um num- 
quam vna tanrumpars, fed corpiis yniucrfum femperaâî- 
ciatur : nam morbi vniuerfales fimt, qui in totd corpore^^î 
iiipluribus praî<:ipxiitque parcibus fijbie(5iantur : nosautern 
cum Hippocrace dicimusex morboy xjui in miiiima quauis 
parte refi4etvtiniubiefto> totmn corpus n$>ii quidemeflen- 
tîaîi^cer a^grotare, fedcoaffici > focia^que p^rds affecii^ncm 
fentire ob addu<^ racianes^ quod vcique yalde diuerfum eft ^' 

K^cura cor C^tcrom natura Corporis principium fermoais 
^SSS: martemedica. 


HAâenus vniuerj&Iia de îiumana corpore pra^lâtus eft 

_ Hippocrates ; cuiiique ad particularia iam defcende- 

îeiBtcndac> quafîanaîyci<;umy diflbîuduumquc feruecordî- 

Bem > â toto ad iînguîas procederxs partes^attentum prius red* 

^klecSerem rei necelîkatepropofita, auream hancprofcrens 

{cnîtntizm\ Natura CoTforisfrincipimnfirmmisin artetnedica ; 

: quafî âb^xa<5ta Baţuras cognitioaeexordin debeat Medicus ^ 

îîilquein prâeclariffima-iîac diicipîina difleri ^ iiediim xt&c 

operări B<?eat:> mfîjiumamcorporis natura quam-op^^ 

' cognita v ' Hinc Gajenus m îibro^ ^ ;qui Medicu€ infcribicur:, ^^* ' 

jbanc ip4m expîicans fenteiatiam 3. namrae ^ecuiationem , cx 

Aîhensei 5 aliorumqi vei^rum opinione, int^pretatioms> ku^ 

traditionis principiura vocat : nam â .tiatur^e infpeâione 

Bogmatici aufpicanmr, quoniam ex ijsj quas fccundum natu- 

• ramfimc^ ^iHa> ^aî xoncţâjiabents pofliint cognofeefe* 

Atqiti ş,-fî eft priEcipium^ certe non^ifi^xtrinfecum eflfe poi- 

jmc. fcn.i. il:ind^ apparet, quod, vt^We^e docef Auicemias> phyika 

cap. î, pocius eit natura coiitempiauo-j.ita n 41 (juid de xUa autxo- 


Digitized by 


gnt>fciCv^t^ ratK)cmat4ir Medkus > veî a Phyiîds ^cipiac > 
V^l^taiiquaiR Phyficus dMferăt» cum^extrâ medics artislimem 
■■ * omniHc^ fit /Natura itaqu^extrinfecum^k ferm 

tipium in arte medica > intrinfecus vero phyfîc^ finis, iâlcem 
pamaliter ; ex-quodicifoktMediciimipcipere, vbidei^^^ 
Phyficus . Quod fi ita eft > cur inter medifcinas partes Phyfîo- phyizoiogit 
Câp.7. l^iâ<dMumcramus?vt pater ^xeodemGâîeno^U^^ .trermedi- 

^ ^^â£o V ciim ilk'feumanse na turn prpximas , tumremo&^ dn^ parces 
tib^ie§ ^auâs ad-feipliciffima vfque principia , ftîKftantiarn^ connstmcre- 
temperamentum^ ftrucluram ^ operationes , viiifqiie ^juâin 
Muîd rimetur ? An ex fine diftindtio oritur inter diiciplmas^ Difcipiin^ i 
diftin^ninturque etiâm ex modo procedepdi ? A^it profectd £ae ^i^âir^ 
de %imiana natura Phyficus ; agit Medious . Ilie quidcmiui g^^^^^^ 
c^ieCti partem ( ehtis videlicec naturalii; > în cuitis iadcudine ccdcndi. 
&Homb eomp^eildicur) contaiapîat4Ar;,\îî!iuiq^ cauias 
cTihnes difcutit -, fanitatem- nihiîofeciuş -i^ atque moirbum sanitascos- 
confiderans tanquam iui obk&i p^fenes^: eo ţamen fiti^^ ^^î^o^ 
vtcoc^noicac taniumodo , qiioq\udempa<ăo Ipectilatiua^ â &âMeiiicoi 
praCticis, hcc cft , zămis vel faâiiii^ <?mnibus diftinguuntur; ^^J^"^^^ 
vtpatet ex6/ec}t.& j:dean.Hic veroeadfem proriii^ s.ethic-i 

fiderâts eoque exaSius , quo eius ina^is intereft ad indlui- ^[ ^^dc^^ 
duaîia vfque calkrey edm ncm' m^do ^ommunem omnium t. ^. 
-naturatii, fcd cumslibetpropriâ^fci^euiîvoporteat, vtex ipfo 
Hippocrace docuît Calen. %^ ad Glauc. circa indkiiduaenim Hip. r, s^ 
cperaturu^eft;alio tamenfine;vtmedicasfcilicet operaţie ^«<^3'^^«* 
nes inSanicate vel retinenda vel reftituendâ inde diri^t , 
ea%epafficfnes^4kutatemmmiriim^nK^ ^ nonfim^ 
^liciter \i Phyfîcu^ > ied quatenus^^ai^fîbiîem & recupera^ 
^^!^' Ociifideratr, vt^ îiqua: -ex Ai^r 
'^^^' ,Tioîî)k''<}md:er<^a^MedixHi$îîmti^ Ue^em 

-fundamenta; anicilicetfint, quotfint^; quoxîiodo iint, oc i^^^i^^^ 
qu^E fint, Eîementa, Complexiones , ttumores , Membra> 
Spiritus, Vîrtutes> & Operatiof^sv^pifeiiV^fiUiibus humana 
natUra BotnpIetur.H5ctarh5uam^ profer 
ijfdetuiiîam coiidit?pTjrfidlogiam^^€^aţ 
rationum moinentis dHquiritvEx-q^^^ariî ^ai^et diuerliîs 

agendi modus m his difciîte>^<:ain^Pliy&^^ 
^^> -^ E Medicus 

Digitized by 


f4 HJPPOfiRirJ^ |^|?.lf. J^>^«^^^ 

coflim^K * Ve cum. obfe< t^ai^ ip|e. Hippc^cr^ i^Ul^? 
Natursco- de vctmedo Gecftoii do^^cogakî *^"'3^ 

gnidoaiî^t dico jninime ne<;€(îariam> îi«e^U€ quid Viilc 4c ^a a Pbyfîciş 
c^iTaxa*"' muLUâre poffe z^mti^svcxhiş. Porr^J^dici^^^ 

->:.^- ::X", Jk : Egisiauiemmr^H^ dimi ',;; 

ri^. Judico autemje ncttţira diquod manifeflum ^ euidm$ C(>gno^ 

, ^ . Jcere,exnuilaparUaliundkc(Mtingere^^mm^e^ 
, V hoc tune CQndijcerepoffîhile efl > 'vU ^uis ipfam msdkinamţoţam 

' ' : rcBe compt^h^ideriţ ^Âi^o^^ 
' :■ . fj^r ^Qo^i4^e 4HU'^4i€Qn$rTaîicm.m hanc ^ Quidefi-homo., if 
ih/juas cmfa^: n^itur y^ r^Hqmdţlig^nţer ^ 
. .V cffav^f^ur^vţ^^'/ţilMpdicns den^ 
nit^iT'vt cognop:at ffiimdaeQrum ali^^ 
Bă^^pr^jîare sclinti quid eflhomo ad ea qu<ie cprmdmtur if hiunîur 
C^mparatîiSy^j^qHidcuiqHedhvnp/^uoq^^^ Vbivi- 

demi^ ai&r^e fkyfic^ ^o^idoaes de hqmine haud efle m-^ 
£e0ămsniedic;p^ iidpecular^spotiuscm 
<>pg!i:cer^ j::v;c nam fîyU^^ 

^Eopifeus 5-^ a quoKbc^j .tcI male afSciaw r Hiiif: jeniiş 
jElîQrborum cognitio aperitUf , qu^ via deindi ^e^^ 
nem . Qu<e' notio yt difficîilima eft^ neque , niiî îonga 
obff matioB^ , ^cqijiritur ; idîţie4ii;iţî^iacieud^ quâm plu« 
xtoum abfque dubio <^oti!^mi Viidc Galenys ^ , m ech, c-j ^ 
Jţmmfiu$ priuaţim natumi^ explorare ad pngu^Jliremy vfi^He 

\ h^mx*(^icunq.d£pţt^fabHns^r^^i^^ audirecon^ 

Jumitsqua dus ad medicifum pertinetyhuk non efl commodumiounc 
memtfmn0nmmMr€,^€.h&nt\im Cclfus hb. î. de re 


:^adABalc$ S^ ci^yrî^ş:|4^4icQS^ num rationaîis hsec difcipH- 
jaa ad Mc^cpn%|>^tij^eî:e%^ apflu^enri^ 
gttasitibu5><pa^;vfiiş foîypm^ 

- ^^■^^'-^-. c:. ' ^ tura '' 

Digitized by 


4ofeii%parshabebamr,yx&morboram^^^^ f^t"" 

iBatuîrş contemplacio^.iia>-i}fdcmAmh<Kto^^^ "^^^^ i>^^- 

tui- 37. :©emoc, in epiiiol. ad Hf j^acr. Sapientiam M^dicia^ ibro- 
-i^em iac cGâmtieî'n^eim. Me - exif toat •: ic^S^^iâ: p^|3^,ţ^^ 
ikt^^^^^î^v^fi^ă^'^^^ bena fey^ 

^rpînd^ ^ftonanms ,rHippocraî^m citarisJod^ lai:ii^^ >^i?S^ 
fiăfcadhominem^iioa videlicetxoiic^^ ^''^'ll* ^ 

tfemvcumsdşmtaxatmtinus^ft faommis, TC:eimaiiatiimli5 |^^^^- 
in^fod viiîiieifeli obicâro ^ompr^heniî^perfeâaniprafiere c<v 
^riiâbn^îBjr eîguecandenrhac in re credere tcacturJy^icdicu^ 
:vtlatc expljcâc Auicen*>Sique aliqua de.hiîmanammrafpeT 
4îIlâtur;idB<mtanquamMedicusi fedvtPhyfîcusagi , ^ 

Contra eos fophiftas^ Medicoique^q^î îniagmari}s.^kii; 
^m innixi raticmibus , vana ,& â fenfu alicjia de hominc Io- ^ - 

" " quebantuî5iUi^uideniiiom0eni^nu 

tomîî^ neBîpe acrcm , aut ignem-, aut aquam^ aut terrain ;^i 
^o aut tenguinem, âii^ bilemV aiit^k3âkam^ Q^îî 9^^^ 
^•^rtîones^ cujaaBulIamâpa^ leuide^iamlnbeaGr, 
^rdK pmrsus^ conductpitteedBâng^ quf fciifttis pl^umque 

vt 4dî^e â vferitate abert^ţdji-îjuicquam, conferant co^m* 

tioîâl^s ijs ad medicam fkculcatcmadipifc^^ 

tîus â^medîcinaveram aliquam de feomiac co^itione haurire 

^c^^endic>;Ad^C^^^'aîiî^^ r 

iîori^înd^Mfidifus^&rmaGcer^d^ . > 

IV,. i ' E ^ bet; ; 

Digitized by 


^fckau- Kăitîdnaleni V Omttes'iîmiîbonfbadere^.ao<luief fa imiUorum 

coJ^nSt^ Awh^umpi-se^epta fine vUaifatioiae eoUigore^ vt Rhetorem, 

cdl)»''*^ ^*^^ftor*^^c6ncinnaftor^OTiureidkeri$^^^ etfî 

in miik^ mîr^ ,, :eăîtenim;ăiaBc ditaciinuentiam 

Tt Hîp{)o^atis|eniia^^ Galinililxqmffle^fcuSiniţiiibitu^ 

^^ â<^pf^i^^iatci(ie.loc*imihomJibrun^ 

- " Tegîftrata ^rite; Hipf^£ratis jegmmum oafti^^^c^ft. 

- - <îenckt»cftj^EaiîdemqaereceQie^ 2:,:,\MJh^ 

, ^ ■ falumArefîîiejred^auix, cpMc<mxaMJiţ>.pQcx^t.Qm aiferere 

aufusfo^nanopartcreaeiiominisiiâim : ; s 

cîiiB^e ad fi^lbfîcaicm T^ueuîHîehiajrŞ; profeai^^ %im. 
tu^riQraiiiuîii: confenlit Jiemini fas ef& morjboş eoijimpdl 
-y^ . cipre^qoicoEpx^risvniuexfînatiiram aoaperlpe^riţ^^Quiâ 
,: . edâ;mip&AriftotdestumJîkfuprack^ 
Af, Jmor. î. morai.: Ndeomach. Cz^f^V facultas y iiiqîiit, t^i^^A^mm 
^" ^^' fţi^ant yOfpiofcere oportet yquemadw^dkm mulum^ ţ^tmz^(^^ 
fui^eumy^iamstums efi ^c.degdntes.qMpqzieMâdici multa cir^ 
ckj^ogAitiQmmcoT^QTis: p^traBant,. CuinquerQ^-umiude^^i^ 
Ke^^ în. ^^^Jiqi^a vthab€îi^J.dean.t,85,JvlQdiaîm prim^ 
dex fuŢ ă cagaofceoîe oporcet id, jguod eft fecuncum naţuram-^vî: doc^ 
^^^* GaLBb* deoffie^imtio, demdeid:, qi*Qdpr^a:naţuî:a4B4j 

HincHippoc^î^$lib,dejd^Gen,<>r.> Medicum Piîiloibphurp «^^4* 
Di>s sqtiakm pr^dicaş ; duabus enim faciik^ribus hiiceX^ 
fkiti^i;^îaral>Mm>pmr^ %fe.Qfteii4k^,fiug^ia^ofim^^ 

Itio quoinfe^icifyder? haufeniAC>nihiI vlterius de .(jpntei». 
Med-comin pîattice partgeqgiţantf jrî.ne.qiia ţa^jl mifere ia tcnebris^^Işmi. 
Phyfct di f,«*»««' vix4i**4j)şr#ftrex^§9ţ:M<^^^^ capitali itî£^i^ ăi. 

Bulia ocen^^^»^> qU<iipb;IRf diqpŞ,.jClJjlla pâeaaift 

Digitized by 


,1 .c r«03îJMi2«r;ffim:^iiinî3^^ i 37 

T^ ■ ^^llOUţ O^CDUS corn, a^^^^ l^*itC. ^, >:& mulnplev 

Jltţ^iţcm yflauam vid^Hceţ.i & nigYamyaţ^ieh^cJunt corpii- 
rişnatur^.^'. Significat qitaDdoqu^ fkcrfţatem^^ qus^ corpori- ' ^^ - 

phi , ad quam vnam fpeâ:athumorescoqucre.j^tiHareu^^ ^.epiifeSîw 
rc,expcllere noxia,omnîque aaiurali cecoBomia^praseffe: 5«ixuuo. 
VjideîîVj5*^|>i4-N^î^^j^>5^>^^^^^ Accipiturde- V ' 

miim non ţftado pro ymuerr^ijipftanria^ qu$ «ex primis cqa^ 
flKtur^elementis j, vt <^cec Gal. ^.,4? 5^^^?^! > ^^ d pro par- 
titfri ftruc^ura, compofidc'rfeque , vtv5. cpid: ccm. d. t. 25. 
;:i bilp^ bfftmn naturăm Cl^inâe m 

&ii^|>idQ?^7^i^^iw? 4^^^?^ natura 'uergehat adtahm ali«eq, '^ ^^^ 

Bon paucg £xtaâ2:.q;dfeiic teiiiş^ar»inis^ccepficncs:^u<i 
Hippocratcm • In prsefenti tam en concexiu certum cft nam» 
yam irf p4^flx^0 iigiîificatu efTc fumcţidam^quatent^ yideli- 
ceL&bftantiştiîtamnemj compp^^^ 

tsd^m ii^işgpentntia,, quibus .ars perf^cie .ifpnftituta exiftic ♦ 
pGeiîlKim ihccrprmtionis^ icu-tra«tiţ:ipnis;jatqut hec eit hu- 

fcem* ;l\im j^ Widhdt ,|/iry»o^2i,^ ^ ^t âb ali)ş yîd^ifce t pji|Kir 

Digitized by 


tâurem coBftimfca^cft p?f clariâîmâ hfc fkuftas. A natufrath^, 

etfî Empyricis-Meifeodicifa; vcUiămtibu^y Cms^iicsnd®- 

ciaatioii^s «xordiuntur Dogrrfătici , fiue aHos iâ . mefxiicâ >di- 

^ fcipîinainfticuer^; fiue iu morborum cognicionem dciaeni- 

re ; iiuc futuca prgdicerc > aut oppottuna aatiibere** pr^eli- 

; diain aiiimo-fit ; tiam qu^madmodum ilUnc e<yppm iricipit 

B.ii£t^.î»i: :radociaatio^i£a in^caâd^m^iîlimdcfiîlit op(^Ă6^;^i'C3et;€^. 

hum^pîru -tum^ck^tîr kajceaam-fent^ntiaâRuîfo-Eph^f^^ 

appei-akcro ^crâtem-fignanter teâanir-in îib^-dc loCm-hoTn* Qu<:»i '*^' 

poreHippocratis kgfclinum habirum fuiflfe . ■ Floruit namq; 
RuffîisEphş Ruffus 5 fummoque honore me<l4ciaaai Romas exercuit fub 
ifîi^k. ^ Traiano^qui circa oduageiîrnmH-a ChriftiD.oiuini Nativi- 

/Vi.. ' taceiinperauk . -> ^- ■ '* - *^ - "- - -• -— -^ 

X^I- Primam îgîtur perforata eft qua parte audîmus: 

etenî'm yacuacîcum circâaares no aliucirn audhnr ^ 

iquam ftrepituoî, & damotctn ;.<^îcqulc|~^iitem per 

ei^^roî^^^^^^ membranam în cerebrum peraeneint^idliquidoiS: 

t4f ^'''^'' clare auditur. Ob id etiâm foiaoăca foium^pepisera- 

Branamcircumcerebrumextenca^eftiî:: ^ ^^ . 

EXpIicaturus^'agnushic Senex humani Gorporis fabrici^ 
^uiiis cognitionem^tSci^fie în medi<:Hm^aficrm$ vt haiK> 
priacipiufermonis in arte medica promtciaiicţiuQuimmiîiĂ 
- X iion tiBiMmM^msy{câmilibtt]pa^ eft f a cogni- 

/ : tio; quaadocp^eav^y^-^ -^etbat^^S^ 

exorditur , velât ai> ijs> qu^ p#imo flobis fe feoâerunrînteir 
ea, qu3 praecipuam .obtineat îociiminhumaua' ftruciura 5 
fîcque- tam^n de-^acrenîis oomibus î tîoncntm 4e gufte > Se 
ta<âu^ qui îgâobîKores ,,mm<M^5 artîficîo ioîift^3^'tfibi> 
n^îfSmtimqu^ £onferunc ad ^oi^rinas eapeflSa^^fe'i-fed 4e 
praeftaitioribîis , îj^ue^ ^norvimo^g^o^mfis^^^ 
Bcio£um con%icimr> fx<>m^q^cogpmÂf&ci^y<^^ 


Digitized by 


hMhmmrf i^i^ 

turn hoclâte profec^ims eft .^ Incipicitâ^ue âl> Auditu» veiut 

afenfu difeiplinae ,*per queai fcientias quafcunique â Pricep* -^-4^'^.;?? 

tpnbxis hiUiririiuş,: ae ep eninv lîc^loqiycur Amt m felit & pUos* 

{enfiL pap.j;. /ri fine ..Şpcw^im^ accUens adpmfmfi^npA^diP^^. 

mim cQyifia.fyfîa^itiu^ veri ^mm^pd^emta efi • Quareân^ 
tiuztaţe ţnuaSommptrQ^Me fmjuy prudentioreş Jimt c^ci^ muîis ^ 
^.furâis. Caîterum^v^ Authorjs mencem liquida aiTequi va- 
î^amusj circa fcnfus^huiuş orgaţiuiţi i|tque obie<^m tantifpsx 
irnmoraa Qp^i:5e;:iarn:/pmium;ei:ir. A*^ris_ namque^ :cum in ^;^^ 
e:cţei:n^m;,;gţqueji>c^r|i^ai corn 

fîtur, vt flexibili hâC firmitate noB concidac ;, fed arrcCta 
femper late pateat, amplum efformans cauum , vt quouis 
tenipore, in fomnajedam , pr;eccîuqiitamcs fonos fiftaţ , 
cplligatj âdmiâ^tq^v in internam aurem ; âb occurfearibiis 
umtn impe4ime;n;is minime frang^tur : cuniqae exanguiş. ^ 
fiîj^ & in ^xţr§m# ,;elatiorique cprporiş parce îocaa^ naţur^e. 
paiţpertaţtem in morţiş faciUime p^i:dpit > itâ vt vit^, n^cifq; ^^ x^^i\,^^ 
^i;i^fagia non.exigii^ ex ipfa colligantur, iuxtâiljud jn coacis . vk? morţii^: 
aam. 2. Jures fngaid^i , ţellucid^ > ^ inuerf^j^ mortifir^ . Huius infi- P«^^^^ • 
f ^'^'^ xnzm fm^m memoria .4ic?ţam napnuit Pliaiuş ^ inquiens . 

iQ|jerF^?^ay4:^Şjvbipyppî;ium2iud^^ Hor. nhlu. 

3^iipftx^p^m% oiEbus excauşfc* ^^^^'infî. 

to.iadcer€brivrqu€baiîmpemhgei;ite> qui quatuorinp^* mapaismc* 
.4 — *n.* j:i^ ^ ^ * - ,. . ţ. mori* cicac 

ţes,ceumtoi:meatHSvytd;ttip^ş.4^ dimdi ^^ ^ 

confueuit ; quorum prijţnus , q^i â capids Jatere primo fe fe ,; 

q^^t y aiidiţorius <^citur., Icmperque patens eft , vţ occur- 
r^nţî ^no quouis tem^ore pf ^5> dlepoi^incrâ 05 pctcp* 
funi /â duritie iîc diCium 3, coriacea ir^tedus cuţe^ excernqqj 
femper acre repletus^j^ adprsetenucai qu^dam vlcjiie nierpi* 
braiiulam extenditur , quse ^ oibicaUri^ cumiic ^ cauoque al- 
.^ /■ ' ^ ' ^ 7 ligata 

Digitized by 


jB^^tâf aâufoj^^mp^iînorem *extenfe> chorHamque esftc- 

fkm4n;fuperficie^haS^ Tty mpamfm nuatupari ^oîi&tcim V 

Membrana b^e>ftiiiByrînga, â dkă t^rcbri mei^rige^ ori- 

- - gînemducanS'jneKmloqueiRtexta, quem a qumtb excipit^ 

ex^t^^^vt atacate <^t€î*ttmî^feifâ^a^ vel io-»' 

âî'^0d«m^ %citate vero admi^^ at]^€^tkfeiians: %c;ff. 

crăffioratque hi:imefitibr-€uafeStV iiebe^ t^ed^dmir ăuHitus?? 
Poft lympanum iecundiîs apparec meatus <3innmm ampîior y 
rotundiis", &abi>iîium tub^rofîtatibus'ioSqi^ codilea/ 
feiî,pefois^iirtc«pati$s , ia quo îsgeiiîcîis^dam reeondkur 
; _ 2 AeîVvel acrea pofâiis^pr^tcfmiîVâ^ 

" ^" no quîdem aeri coaffiHiSi^nîmăJaeâmen pars>*|îm & yi^ 
AftrAuîiim y^^s^ <-:ui veWtprimario-au^endi^ftimm 
^imiti^ft tio fem debet : xryftaliino etemm analoga ^efiS^^^i animator^ 
pariter^ vivieanque, vifionis prima debentur m oculo . Hune ■ 
auditorius neruus â quinto coniungio deduâus, ac per naen*.' 
brana^qua fecunda hsEC cauiras ynctequaq.bbd^iHâa eft,dilaa- 
tus ckcumambit^audiriub ipiritu qîiaq.verius coafpergit ^eo- 
dem paâo y quo optictîs^ciyfi^num inrbecic j^ki^ 
fîuo ÎQectradac . ^Immbbifempî^£ereâ-biHic aereîrv dMt iArî-^ 
^ , . . r fi:c^.'lK^ eft> mdiiîîpabiîemi ciim wdcK^us^eobiepm ; cxî^ 
t:Sî i "^ ftat: nam-cu auditiua? facn|tad$ prsecipuafedgs fit y in fumms^ 
' eaqiriete fonos omnes^vel fonomin %ecies apcius percipere, 
&?ad^commâncm fenfunaibiîltim iudicemid^ per audi-t 

^c : u. jr{ toariui3«rirtte xiefcgas^ vdebi^ 
^^ -o:; terig^atiiraliterquandoq.noîî'îîiodo â digito 
^a r^ i J ' ft-iVâiima^âporibiîi et{^ cerAro gcnîtîsyvel âfc 

A: :" ^ ' nifâisparribuseieuatts'j vi cuiTi^micaîn hemoi^ 

ÂunS m^: î?hcgta ; ac tuiic fibffi , inurniîira, tynnfci^^ 
piQ^uJaiS:^ protitte^uior, aut craiîrorflat^ilentiîs iile fpiritiis extiterit: 
Quod pariter eucnic cuna adia'cemes partes , vt cerebMra 3 
mcmbran3eque<eius,venî£ &iartcn£e aîiqii^ 
riiityaiâc^uîfamt'îî^ bune aerem coarelant, 

qui dum quaeriţ ad naairalem fc redigere farit2i£€iîî>aggkâtui'ii 
iridcque fragoresj fttcpitiifque in auribus fiinilit€i:^îccitar^> 
r-^^'^^ vt 

Digitized by 


Vt fiise apud Hippocratem iabecur lib.2 .de morb.; iacra^. 
tur quinimmoâbijfde^mterdum Taporibus^ & hcbctior ^ •^•^^^*^ 
proinde redditur Auditus, ex quo Hippc^races in aphoriil Aph.5.f€c*3 
mis. AuQriaiiMtumheletantes^capitgraucmîes^ Scimusopi* 
aione hanc de Audicus principatu in ingenito aere a dodiffi- 
mo AadreaLâurentioâreniie impugnari : vemm antiquifli. Lâîir.Hb.ri, 
maeaeft>Hippocraci^ Platonic & Ariftoteli probata^ contra Hippj^pr^l 
quos irivnanimes afferere^liaud lăudabile videtiu: : eo naa- ^^^^^^^-: 
cis, quod,â Viro nimquam fatis laudaco Ludouico Septalio mzo'. 
pri virtute defenditur^ommetario in fe6l i y- Arift.probîa. ^f^^ 
In fecunda iiacinrern^aţiiris parte fagax re.centiorum Ana- '^ 

thomicorum induftria, Carpus videlicet^ &Colunibus , cm .Cârpiismuc 
jllaofTicula, Ve€enbais.amnin6incognita^obfermmt:, ^^^ ^ mloă^cliil 
figura, quam Tefermit, Malleum 3 Incudem> arque Scape- .tmiamve^ 
dcmappdlarunt .^ Hsec fimili articulata, exiftust, malleique coi^S! 
îBanubrioîoiîifring3&feutympano adhsereat^ &jQum ty^n-^^l^ieme: 
pani-chorda cenfentur ad ionormTi diftindionenipercâpien- {.^fâ^fib^sr 
dam conferre : Externus namque aerfonura ddferens adtym^^?^^^^^^^ 
panumalîifus^ illudiîîipejiiti âbiiocmalleus,commouetur> ca. * 
qui incudem.percutiens;^ inxauiaeft^ vt externus fonus di- 1^1^ ^£- 
ftinâ:eientiatur. Veruiîivix intelligia nedum explicări po- in ăuiito e 
tcft , vt nai^ ab olTicuIis ijsiiuiufiBodi pr^ri poffit vfas in 
auditione : Maileusnamquexommocus, îîue iacudem coa- 
fricer , fiue pidfet ^ nouam certe aeris attritionem efficicc^ 
atqueitinouumfonum^alîumâbeoj qui â primo fononte 
produâus eft yetiamfi âb iiîo fecunda h^cmotio dependeatî 
<ex quo fequeretur nos minime audire primumfonuin^ nequc > 
realiter, neque intentionaliter^fedfecundum: quodmagnum 
ptofe^to abfurdu m e^et admi^aere . Hiic accedit^ quod fo- 
nus y fîue foni fpecies , ciim abfque taii ofliculorum miniftc- 
rio in externoacre^craffioriatque impuro, ad anxufsim ex- 
ceptus fit 3 multo faciîius in intern© puro tenuique, vlîo abfq; 
auxilio, recipietur : quapropterfuperfkaonmino cffentilla. 
ofsicijâa;<iu^ tamen Hon iio fada exiftimar^^ 
îingse fulcimentum: cum ecenim membrâaa.HIain orbetn fu* 
fpeufa fit vc incerftitium ^difcriminans ingenitum aerem âb 
cxt^rno, cumquc coni^ruaiis ne diffipeturi nuUiqucfiibieâio 

jF cocattea- 

Digitized by 



coexcenfa adbajreac : cumque non exiguos fonori acrîsicîus 
cxcepturaefret, aiiquoâb intra fulcimento'indigebat, qupd 
haud rigidum omninaefTec acquc inflcxile > ne ipiam myrin* 
gamab extraimpu!iamlacerarec& pertunderet, fed leuiter 
ccdendo reiîftercc; quod perbelîe prociiî dubio pr^eftant cfli- 
cuîa ilia ilmul articulata : quareniis enim cffea funt^ reiiftunt ; 
quaienus vero articulata ^ leuiter ceduiit y tcnuiffimoq* mallei; 
manubrioJo eam attingentes;> minimum occupant, vt perpen- 
denti liquido manifeftum {itt . Reliqui duo meatus per laby* 
rincheos anâ-aâus ad cerebri vlq* bahm dediicuntur-Hoc au- 
diius organu predare defcripric carnib.inquiens. 
Aiidtîm aiiUmindecontingit, ForăminaAurium ad osdurum^ 
fccum lapidifimile psrtingunt . lam^erâ.adîpfimos ejicamtas 
antrofa - Strepitus autem ad durum Şrmatur rolautem coMumn" 
finar fer durum . Fellicuk vero in aure iuxtd osÂiirum tmtds di 
wIuPAranei tela , ^ omnhmpsUiepJarumJtcciJsima , 0uodmiVem 
idyquodficafiimiimefl , maximhrefonat^ multafigriajunt . Citm 
ioiuirţhmmumrefomiit, Tnaxime andimus . Etfunt quidam, qnl 
de namrafcrihentes ^ţrodidenmt , quod cerehxum efttquQdfomm 
edit: hoc autem.fmi nonţotefl : iţjiimmmcerehvjmz humidnm eji^ 
& memhranaypaie tunica cireşi ipj7i??7yhumidaej%if crajfayiîemqne . 
cifcum ttmicam ojja .-NuUumipmrhmndkmr^^^^ 
^^f^^ntia ayaem aiidiţum fac7mt \ (^^ 
cynqueadaudirumfpeaanr>perbeHe pcrfîririxit . At quo« 

quit'f "^ î^^^^^^ditua Anima^vis eit medijs Aurifaus foiioruniper- ■ 
ceptiuâ , de lono , qui proprium eius eft obiecium , pro tex^ 
' tu$ explanaxioxiefuperefl nobis aliquid diflerendum : eiufque 

sonus quid ^^f^î^^^.^^^^^^^^^ 2.dean. â t. 77.&deinceps colligemuş: ' 

^j , ^^' Eft iiquidem ibpus qualiras, qua^ innafcitur corpori inter duo- 
corpora Colida la^uiaqueiB^rccpto , âurn illud atteritur, fr^« t 
giiurque. Corpus verd,quod in tcrcipi ap turn eft;, acterij fran- 
gique y ac proinde fonum tanquam lubiecium excipere, pri* 
mo pr^cipoeque Aer e%minus vero priiicipalicer Aqua etiam 

^^^ omniaqmJiqpKia,jndQceturx.75?, Hincappar^ neceflk. 

focum o^ux ndrequifîcaadfomimproducendum;) duo videlicet corpora 
dura ia^uiaquefefe percmieiitiâ^& mediu m , quod inter jpfa 
iiitercipiacur ^' ao^or^turque ^ Esiqua âc , vc moHia inepta om- 
" ' îiino 


Digitized by 



tilâo fint ad fonum elidendum : nam dum nihil xcfiăunt,m^ 
hil atterunt ^ vnde lâna lan^ allifa ^ non refonat ex L78., quod 
notauit etiam Hippocratcsloco iâm ciţato de carnibus, Dio- 
^enis opinioîiem refellens , affcrentis cţrebrum percuti vo- 
cibus & refonare , indeque auditum fieri . qupd h quando. 
que moîlia fonum producere obieruentur, vt Aer a virga per- 
-cdh$^ nubes in conitru, labia dum fibilum efîîngunt;, id fit, 
quod duri corporis rationem tune temporis Quodammqdo ^^^^^ 
jnduanc, ytque-dicebatPIorinuSj, aernonfonaSynŞJiatumJo^ nead.j.c.^. 
Jtidi corporis adipifcatur ante^uameffiin^ manms qi^oidam 

^u^ifoUum. ferula namque fui motus yelpciPate^ dum^prx^ 
uenit i6li aeris difTuIcum^aer refîftat neceife eft ; ex quo iolidi 
rationem tune habebi t ; labia paritcr in fe comprefla tenfaque 
egredictem per anguftu m tramitem in magna^ccpia Ipiritum, 
vîduraatrerunî: franguntque . Debentpr^tejrea l^nia eiîe io- 
nantia corporaj nam qu^ afpera atque in^equaîia func , inepta 
cenfeptur eo quod aer, qui per attritionemfonoraquaJitace 
imbui dcbet/vnus & contijiuus iit necelfe eft, totufque iîmul 
atterarur text.8 1 . talis autem effe non poteft,niiî inter corpp- 
Xa l^uia pplioTque : nam fi. afpera fint ^ atque in^qualia , in 
exiguis iiiperficiei cauitatibus intere eptus aer difpergitur , difi 
continuatnr , occidtaturque ; vnde ^qualis liaud fieri poteric 
attritio . Velox demiîm debet fieripercuffio 5 nam tiim arte-. 
litur aer> cum percuirionem vnitus , ac non dilacatus recipit : 
oportetproindeexr.79. vtmotUisfexiendsantLcipetpercuflî ^^^^^^^ 
aeris dilapfum , & diflipationem. Soni autcmitâ explicaţi tri* tapiex '£t. 
plex conlîituicur difFercnţiai Philofopho ^.de Jiift- an, cap.9* 
Prima quidem , fui genexis noBien retinens, Ibnus iicit ui,feu ^^^^^ 
iirepicus. Secunda vox.Tertia. iermo &locutio. Spnum ab- ^^^^ixm 
folute, leu ftrepitum;, vocant aliqui quemcunqueâ rebus "^"^ ^""^ 
ii^animatis per collifipnem fit^ modo iamexplicato . Veriim 
ciim & hamine manibusAplcraque infeâa^iş^ aiaphrag^ ^^^^^ 
îiaate>& Pifces Acheloi .& Clitoris fiuminisbranchiaruiia a4:tri. de Arift. 1 11 
tu ftrepicuxn qu o tidie şedere pio certo habe^tur^mendole illo^ ?;/^ /"^^^ 
num quemcumq; pr^ţer vocem ^^ fermonem > ; fiue âb ina-. 
lîimatis , fiue ab animauş fiac . Vqx autenx eft peţculîio vox^ii^t. 

F z inipi- 

Digitized by 


44 mP^OCRATlS LIR h J>E toc. nt HOM: 

kîfpiratî âb Anima aerîsad vocafem arterîam cum imagina- 

ticne aliquid fignificandi ex t. po. quapropter folius aniraan- 

tisea proprie eft , quodlpirat: fique inanimacorum aliqua 

id facere appareat^per fimilitudinem tantum id agunt,vt ribia^ 

'î ^ lyrx , caîteraque huiufcemodi r cumque , vt diximus fîgniă< 

catiuus quidam fonus iîr vox ţ tuffis , &fî fpiritaiibus in orga-. 

nis fiat y vox minime dicenda erit ^ fed ftrepitus : ea enim ex 

Vox <ixiiâ: î* polit* cap* 2. moleJU^ atque ioctmdpfigfjificatio^efi ; qmţropt^ 

**® "^ • afys quoque eocifiit mimalihus pr^ter hominem: Hucujque enim n^ 

turap'ocefjiî in his , vtjmjum hahâont ioctmâi iţ molejiiy ^ ho^ 

inter fe^fignrfîcarefojjtnf. Anima! namque, vt animi pathemata 

naturaiiter oftendat , infpiramm cxpixat aerem r ac dum per 

tracheam,âdfifttdaîinftareffornîatam>egredîtur; in I^^ 

âb epigîottide varie affeâa , atque in palato coUiditur > & vox 

ttmcx*^^ formatur, inqiîc paiati fornicc maxime adaiigetur .-Hinc eft > 

miditatc--» , quod fi sîiquid humoris in fpiritares bas p^ticuîas dîftillet , 

âic^proue^pî^^^^'^^^^^^^^^^^^y voxiîlieo laedamr> cumfonus inficco 

m^ potcâ . fiati fi pxsBter namram exfîccatae foerint & afperitatem comr^ 

xerint, nox paricerla^fîonem nan efifugiat : incorporefiquî^ 

dem exafperato & insequalr, non poteâ ^quaîis fieri coUifio 

vt docetÂrift. Kb; 5. de gen^an. cap. 7. Sermo deniqiîe, fiuc 

s&m<y fiut î'^^^^^iovf^^Ji^s bominis pr^rogaciua eftyad menas concep tus 

locuuo^iiid cxprimendos â fummi opificis liberaîicace ci tfibuta, vtfer» 

monis vincuJo homines in focietate magis cob^rercnt* * eft , 

Ar.iib.4.4c ftcnndnm Anii. vocis per linguamexpiănati^y. Vocdes ioitur Ht'^ 

îii^^*^. ţeraa voce^ gunure, cmjmaTtUslingua&lalri^frofemntur^ 

qtdhis Utterîstmnem'locutionemconfid efi^Hssc 

Ariftotiîes . Erit itaq.locmio vox articulataihoc eft^vari^ con- 

cifa & diffeâa per eonfonantiu-m litteraru cxpreffionem aîotii 

Hngîîf vacalem fpiritam-ad paîatum>aut dcaces aHidentis^mo*» 

tuque îâbiorum fe fe vel comprimentitim> vel dilatantiumycui 

inteîlecius varias adiungit fîgnificationes ad pJaeitum^ vt fuos 

conceptus alijs patefecîat; quodfane folîus hominis eft; quic 

Toiph. îib.3. <3^^<i dicatPorphyrins debmtorum colIoquijs;Pfitcaci enim , 

ttx^b^* ^ aM'^qwevoIucrcs^quibusoblinguamlatiorem teriuioremq. 

humanum imitări fermonem datum eft , materialitcr tantu- 

modo iautantur, cum dcnt fine mcat€ ibnumiex quo fie ilîc^» 

Digitized by 



^ftttacg Dux ^oîucrum , Domim fâcunâor'voîu^tas , î^sywU 

Murnancefolers imitator Pftmcelmgn^^ 
m.^ Uxc primiim memoria prodidit Hippocrates Iib. pluries 
citato de carn.per hsec verba:. Sermonis porro facultas înde 
eQ. Totum corpus Jpirimm intr6trahit;ţlunnmmvero tn caut- 
tatihusftUipftaccmiufatiis autem.qm ţerinanefiras cumt, 
firepitum facit : Caput mim refinat , Ungua vero artimlat cccm^^ 
rensin faucihus > olîurmfqm , iî pelîens ad palatum & denîes, 
chritarmdusfacit. Siautem Hngua femper oecurres non artt^ 
Cularef,non ţoffet homo clare dijferere , fed Jngula ^r^m vocem 
â natura hahermf\ Stgmm hums ejt , Muţi ex natiuitate ăj^zre^ 
re non ţo^unt ,fed z>nam tantum 'vocem fonant 9 etiamfi ^ 
^ritumefflansyfermonem proferre conetur . & qu^ fequuntur^ 
vbi vocis non modo fermonifq; rationem explicac^ied excm- 
plis etiam confirmat . Quibus in vinuerfum itâ pr^fatis.> 
scxtuaîis >am nos reuocat explanatio • 

Prioîum igicur perforata eft qua parte audimus • 

^orporis videGcet natura & cGmpago^Diuînumquc Eumane 

^ Huius 'molis cpificiu^ primiim prarcipuequc "ad proprium 

^ditionis org^numefformandum^ perforata efty feu (ot^ 

m^ & eauernukm hab^t in ea parte ;^ qua audii^^^^ 

Etcnîm vacua drcumeirca Aurcs non alîud înau- 

^ , ■ „ Probat iam quod 

âii^ntquamftrepitum & clamorcm fo^^iminavcl caui. 

tates prsEcipua fint& propria fenfiteriaauditus> eofcilice^ 
^od in ijs ftrepitus perpetue fere audiantur & clamores, 
etiâm fine externo obieâo r quod fignum eft in ijs pr^cipuc 
yigere hune Tcnfum. Peruetus namquefuit opinio, qu^ ab 
A^thorc debift-phiîofophicaAicmaîoniPythagoricoCro' ^«^V 
toniat^adferibitur (hicenim, vt notat Diogenesl-aertius, ciispcraqî 
vtplurimumin medicimtvcrfatur, vidcturqiîe primus de na- ^,,^,tm^[^j 
tursB ratioae fcripfîffc ) nosaudke quod Auresinciis vacua? dc^ natiux 
fimt : vacua namque omniarefoiiare, quotiesii^ipfavoxali- ţ^^^^ ^^^" 
q^aforatur . At vacuum , iiu cauitates, pofiSint quideni 
fonum vel augere , v^i in Icngum protrahere y c6 qu6d,vt do* 
«t Ariftgteks î, de an. t. 781 Cmcmreflmn^ facimtmultos 

Digitized by 



qwmodf '^ foftpnmimnon potente exire^.odmotumej}, 8c Hinpoc: 
a^ant fo- iplelocoiiiperius ckaco de carn.; os cauum refonare per du- 
•""^ rmn feripfit, .& cum plurimiim refonuit, tune nos maximă 
audire : luuaî îîquidem auditum illa fonorum reflexio fonum 
magis impriîîiendo in jvroprio organo : fcd quod in Jiaţ vna 
ibiîorum reflexione auiicus ratio^onfifiat .^ vix iatellio-i po- 
•teft . Arifiotelis erg<i opinionem illam vt fatis prob&em 
vaoniquo. kudauit expîicauitgue 2. dean. t. 81. inquiens .. yacutm 
mum fit au- out^ reHeÂicttuT audiendi ţroprium : videtur mim eif&.-paemm 
fcameaS". ^'^^'^ t. 84. J7rcp?«- hoc.dimnt Antici andire-vâcuf^ fom». 
te , ^Mia auănms hdbentes âetermimtum derem. pro vacud icaq* 
in2di£catum cauemuiis ijs Acrem incelligentes,jiuiic pro- 
• grium audiendiinftnimentumaflerebanc'eogupdijiterâuxn 
4iae.excerno aiiquo obieao, dum fciiicet .aut di'^itQ premi- 
«ur, aut.vaporofo aiiquo rpirituiiluc penetrantefaut arteria- 
rum puîiatioae agitatur , ftrepitiim illico j.fibiiă, aut decur- 
renţium aquarum jaurmuraperfentimus ; quod fî'^num yciq' 
cefaip art. .eft iiiibi vigentis auditus . ex.quo Ariftoteles ăţ^fimmnat 
7x1.)^. *■ ^^^^^^°^>^fin'irsmremJhnperfi;utcorm^^y^^ 

dode expHcat Cefalpinus, quamuis.imp!antatusjlle£r înmo^ 
hlis ţerfefit^-vfmnes ionortmd0Hmes<pemp&ep^ 
ţerţeîuum tamen quendmt mofium haheŢ, (^'Jmumminm fy- 
cit :fed Ji prohiheatur foraş exîre , ^orpore ad meatum oppoftto , 
ţr^cipue fic^ncmumfusrit; finum perpeiuumfacit vt corm , 
vtpjitemercu^fşad corpus M^ 

^udimdi fi fi»et^^m:mdimdi:fi»mjgnet^ eji .autem motuş iile, 
(onnaţuralis effJatio.^H/edamygua non potefifentiriynifiilUdat 
aUcuicorponohieao,extenm..» .'Şttproprys'anfiamim. Ha^r 
e€%inu5.Ve£utiffimaigitur;, Se. forţară verioropi^ 
pxopoxiuur jn prgfenti " textu ;, ^afferfins .cauitates proprium 

clle.auditus mftrumcntum, pro;cauiratibus injiatupi in ijs 

aa-em inteHigens^ nam, quompdocumgiie illexommoue^, 
. ^^'.>^"^^^'^e«xtcrno obicao,ftatim" variarumferumaii. 
. ^^'5oexacatur,%nuţnin.£opotiffin^unî.auditi«am:vimcon. 

tii3en_. Bccene^x varijs j^rţibusJenriţeaum i^^^ 

nentifaus v:«c alia:e,a,pr^t^4I.^m,a^em, & 



Djgitized by 



rî non poteft , nihfufcipiararj faîtem intentionalicer > n â (cn^ 
iîterio tranfmicîi demum pcffit ad fenfum conîmunein . 

Quicquîd autcm per membranani in cerebram 

• • n* -IN o t N j- Ea,qua? extrinfecus 

peruenicid hquido & ciare audirur-p^^ icmbranulam, 

myringam nuncu pătam ad innatum a rem> &c inde per audi- ^ 
torium neruum ad cercbrum , vbi communis ienfus refidec, 
deferuii-cur , ea, inquam > dare ac prouc iiint audiunrur , cum 
iiicernus iile ftrepitus fenfum & imaginationem potius deci- 
piat, dum decurrentium aquarum , vel tpnitu, vel libili ima- 
grnem falso pr^ fe ferunt • 

Obid edam foraiiienroIumpermembranatn_. , 
• \ 1 n Quiafcilicecidcantumli- 

:■ V* ^ quido oc.clare aumcur/ 

quod per myringam ad cercbrum dj^fcrcur ; ideo auditorius 
meatus fbliim eft, ideii, ibium-rranfic, nec latius extendi- 
tur, quâm membranulailla,qu3e nonlonge acerebroexcen- 
fa , feii pbtius in ©rbem fufpenu vc interitidum viiitur,& my« 
ringa,vtpluriesdiximus, appellatur ; hsec enim audicorium 
meatum in medio difcriminac , cranfueriîm obuelaL , & clau- 
diî; ad amufsim» Silenrio camen pri^tcreundum non e|î^ âfe- 
cado Axiris meatu, ad palacu vlq; prope gargareonis radicem 
porum quendam , îtVi canaJiculum obliquc deduci,cuius me- 
minic etiam Arift* i» de hift.cap. n.,qui interno^ expur* 
gandp acri ac recreando in pximis dicatus efl: , per quenTfo- 
îips etiaiîîoliquaex parce ad innatum aerem deferri, ij teftan- Audîno ^tr 
tur > qui hebaicum lînc auditu i ore ad aperco magis audiuc ; ^^ quomo- 
vel iî qui dcaubus cytharam apprehcndcrinc>vcramque obtu- ^T^^^^ 
îanC€sauîem,fonumacutiuşieniIunc* . 

^ In narcs âutcro non eft fbraoicn j veriim moîlîs Ia- 
s:îr4s vdutfpongia > & proptereâper longiorcnidi- ^^^.^^^ , 
fîamiani audi t ^ quâm plfacit • Odor enim ab oJfactu ^^^^^. ^ 

AB auditu ad Olfadum modo explicandum accedit Hip* 
pociatcs^lauumviddicctexierioxem^quia <Sc iî mi^ 


Digitized by 


îîariu vfus. 

în naio ma- 
iefiasî decus 

fiimum ad animi omamenta^omparanda conducat ; ad b^o- 
tiorcm nihilaminus vitşm compliirimi vfus eft ^ vtqui odori^ 
reniprope Diumam^.Diuinifque in rebus non rardexpeti-. 
ador Diu'i- tam > per ccptiuus fit ^ ^uo & facra Animi templa ^ cerebrum 
eipetir^^^^^^ videlicct, tuemur, & aptiora alimenta feligimus, quibusip^ 
facra tuetui fam vicaiîi fuftcntamus ^ vt ample 
pu^liime'^^ ien£ & fenfil. cap^S* Huius ergo fenfiteriummpr^fenti textu 
tique boni- propoîiitur, natcs nempe > feia Nafus ^ in quo non leuia nobis 
ftltS ^^^ ie fe olferunt contemplanda ^ cum neque leuîs fit , aeque viii^ 
cus eius vfus in "Humana oeconomia : quippe qui non oîfaftui 
tâhtumodo, fed fpiriruietiamducendo , vocieffixmand^^ 
expiandoque cerebro â purgamentis varijs fitanatura dica- 
tus : Vnde emtnet in facic , & in ipfacapitis arce âb oculorum 
iHterftido ad iuperius vfqne iabrum protenditur, vc afcendes- 
rem odoramm alitum commodius excipiat> cibospropeos 
diiudicet, infpiratum aerem admidat^ cercbrique mucoribtis^ 
icua^ ^^^^^ pcramplumprsbeat exitum: eique tantiîm maieftatis venu-. 
fagadtas In- fbtifquc fuic â natura tributum, vt ex ipfomct non foîum ma- 
l'^ci-Im!'''" gnacapiantur animi indicîa,.tumRegisindoiis., tiîm fagacio- 
ris prudenţii ^ vt innuit Poeta verbis ijs, Non cuique datum 
KaxtiaL .^j}^}^abere Najhn . Vcrdmhomine^^ quorum propria ea pars 
efî, &fi-c^tcraomniaadamufsimperfe<5bobtinuerint5 hac 
tamen vHleuicer deturpata^ decus ipfumdeturpatum , deho- 
neftacumque arbitrencur . Vnde Virg. 5 . AeneidlTt^mcox mfccî- 
mp.o ^ulnere nares . At Nafî partes, exceriores ^uidcm , vni- 
cuiquefaris perfpicue patent > interiores ver6> pro exaâa pro- 
pofiîi contextus intclligentiarpaulo cxadius funt nobis recen^ 
fendse • Os€thmoides,> ^quod o<âauum inter cranijoflâenu-^ 
meratur, in media frontis bafi fedem obtinet> &^d fiimmanî 
nafi radicem inttîs fixum> prima, iiterioriq; fui parte, cribrî 
inftar, exiguis crebrifquc foraminibiîs peruium-eft, vt p^r eius 
foramiaa cum aer,, turn odoratus alicus ad mâmillares proccC 
fus, atque ad ipfum cerebrum dcducipoffetj atque hinc Etfa« 
moides , hoc eft|, cribrofa pars nuncupatur . Hanc excipit al- 
tera eius pars , quas extrâ caluarias bafîm , in prima narium ca-r 
uieate Tit3^ eft , quse rara cum fit , atque fungofa , -MoU^m laxita* 
iemvdutj^ongiam^ nune cam appeliat Hippocrates, quemad- 


Digitized by 


nomericlajouraîp pîurunum. probauk - GaL 8. -de vIU part. ^^^:^^^ 
cap, 7.,& alrbi.Tema.deBiquc offis iftks pars temiis c& atque ;%îcp^^n6 
folida., orbita^ ^jCuUportimicuiam^m cantho confti- *^^^^>'^^^* 

t<^€snsVSyntpxae5e,rcârin parte Jb^^ 

<&oats^£uappendîCj?S3ex antcri^^ " ^ 

prod^U0t€$>OTâîKmiUare$ diâ^ ,^e - 

|fâpiîHs.:fîmi8irxijî&ţ, ad^quos:^^ W|?oagio{i>,^,^i ; 

cribriformi elaboratus, perueaiens, olfao^^^ 
crgano ^ceiebirari , cumvexHip^ lib* de princ* ţum eK.Qflenî 
fcnceî3m.5 &E£adum„€;ft.:;.^ q^ 

Ariftoţelem^tieîrimjoi aflerem^ fi^ri in^şţtrciBJ^ na^ibu$I;i 
euuîs opinionem a Affici^iîripartuini c|iuipî;:^ticmemirq ag-.] - ^ * 
m' ^- tîficip eii^eUk^ Hippocjratesauc^m^^^ ; 

i^m vnacupt atte.^ţ.er<orfufmUcartil^^^^ c^^ f ; :^- ' ' 

sJmomniă ^c^^quifcu^J^I l^rbşibrf uija<inia& 
macompîe<5îitur>^u3^^n^iîjenc^^t)(^ . . 


obie6kruvîioccă:^:oâar<m'»o4Qr2ţ^ ,: 

«âarumfet . 4jklQhHn.nanjrqu€ naia^ ij j^^Qjt^ip:^^^^ 
ftit iiccitatis iuprâ bîmxiditatenî:^ .qu^^^oiodgrpr^ <-^^^t|â>^^^ ^^ 
ikporimt timuditatisAprâ iîc^PitKf m t y r^amc^îgitur ^ '^^ ' V \ 
Axift.4e feîs.Ă:ieBŞL xap. ^^ft quaUţ3^^cii|id?i o^ţiş^: odor^^^^ 
immutatiua^fubieâasamfumQia cxaiationc, vijextrinfccica- * 
loris elenaţa i corpore mkto- ;, il^n^iio %idâiicciî:as pr^do De ci^^. 
minamrbumido *.Binc cft, inqtaj^lheophra^^ 

sec^sî, ii^f^^-S^^^oncoipdtMn. qucdekiş ^PrseceptfO^^rii^-miiicp^f^^^^^^ *> - 
l>iobi,2! priusdoriîerat iu FPbkmatibi^.>-yfei<)ricntal^M<om^^ M^^d^^ 
plagam eum Sepî:emî^ion^vMeddioAaîiqqe,2M^ o^or^^^^^^^ ^^^. &cur/ 
iilaexurgere aiierit, quâm iniftis : feptenmopalisepim fri^^ Onentaiiî 

' f * jt» ',. 1 ^ 'plaga odo 

Digitized by 


50 mppocRjTMLm.^i:im^zQaim«oM. 

f^%fon^ gîda cAiîwfit, ncque nlraiafîi excGqiierc pot^ humîdit^ettt 
iis ^Hcxi- iamixtis, neque alitum eîeuire, cum hxc opera fîntcalorisj 
dionaiis. qui in orientalibus vigct ; vndc lib. <iefeniVĂ:feniîi. cap. j, 
Erigus fapo. pTOptâT hoc , inquit ^ frigiis % gelaîio ^fapores hshetant^ odora 
odoresddet ^^^^^- cdiânin mim y 'iiţicâ mmeP ^^^^ 
d?^^i?k/;/<^ . Mcridiomlis yero ptagayX^^ 

Arabia de midoiUoiapîdo at<|ueexcb<Sb; careht,*^^^ 

c^ odoîâu efle debetr vnde fîc concludit. Oportet^enimne^muk^wî inejfă 

minus pio- humiâiîaîemfc<m€Oămenimmiâta'n<m^ 

tatâ:-nm enimpet ^apcr . Hibc pariter reddimr xatio opmîoniSt 
illiiis ,*qtîai3¥ -vulga circaimlatâtn ^ vcrkat^m: qoandcquc hai 

odo^te^cd- bere aiîirit iBîdcm Ariftoteks . Aibbtes'niimum reddi odcK 

duntur , in mtâs-, iiî quâs c^lcftis arctîs decubui 

Je^is ^an:ui ^^i^^^^cumque fâ hdlmîf^timyh^c paffioine^ue mim mmriâihm -i^ 

decubuerit . m^e in omnîno ficcis , pi in Jyluaadujkipdfi^ţmmf ^u^ îriM 
JuptrueneriPi odcris fragranţiam fieri Fafltiresajfemnty maximă-*: 
^ie-%>U'Ajpalatns y' 4uf^îi!tm BMawnus 9-^^mrmt^fiorei h 
oimtes^fuerinf . îris erga rofi^ido teirîioife d:cufiâs fbîisaîdorq^ 
pîaîiras alperg^s, 'c^ckmot^sxe<Mk ^ mm^/^ 
:hm$-hmniSfhfemyjîigmj^^ readun*, 

uClt ^> oportePy ihknd^dmi multa vaM^ ^~^-^xiin0t oaîorem ,: qm ^ 
ex sdnfiime: In^Aegyptp dnîemmmmâ^c^mtifloresim 

niis fiioti jît iîc^îcy^humkţitaci d<Mnir^ ^oris caiiiai3% 

i Niîo fiu. iiuedbnăîitiuanîfî^lîârklitateînjt^tedju^^ 

vt in Orieiităli> Meridionălique quodatenus, odoratiora om^' 
nia prouenke ^ mo4o humiditas exhaiifta penitus , atque ex- 
tin<âa non fit : vnde fyluarAim odorifera fertilirate ditiiîimi 
Sabarifeiiciş fuHt Sabsei, ftdick%âbiâî Populi rîip quos ThuS:^Myrxfaa5 
f^'^J^ &Gina^om$iH^ iidcuur> quemadinodum 

ferafyitiarS ecîam &B^lfâm^iB ;« C^Ciuti pr^tc eftodorem nonniii- *' 
€Stan?^^ cum alim, calam vi Vbdofatoe co^pore ekuari; merito nW 
hiiomiBti^Hc^^cli^m 3 aiiofque âb Âriâoî^ 

"- ferences 

Digitized by 


Mint^îligeiîdiîmeft, wmfermaUţcr . Oaorisauţcaxitaeji^ duo pr^ci- 

-i^uds oiores per accii-ens i:anmm<>^0 i^ afîîrmat> odoî?c$ nu* 

^o quoâeiiaindifentihus:^ appet€^âbu%^:|gl€§ Wf^^^^^^, 

ius.yeli0Îuauîs^^^imJiamTO M^ 

prahuxMdum<pecer£Î?riJTOAa^mp?rarâ >. ^^chauftpigue f e- ,^^£îe^^^. 
*^^*^* mim 4^ h^m^iMffimunL c&rehrum- hâh£^-int0^ mm^^ :Vt$r0 

eft^^^îpecie§^orforis>amo3;îaîiî^ / =^ f , 

-vu - "Ga" *brufcîe. 

Digitized by 


- St !^S^^^ 'i# ^po^aaS ^Hîpeir kâbe^ w Aifc^ &Qfe ^aarum 


£s ;n cGuaK bus oborţa- rgumim^m 

"currdum afiqaas ţam^n partesi:(JteHidbccs^.vi^^^ 

V ^^.^ i odoraailîîj^pt^ţemiis^iH^ 

. iisyfkuîc&ia^Sb]^&â¥ae^^^ 

; ; /_; ^tyîn^des^>;&âiblăfi^âdioiir^ 

^^ Sol "fi^s^t^fc^a^îa^^vel fîim^ ^j^ 

mi^^ iîccata^ofetttic^ra fejnt^ytC^ 
^ . iftîiiiiâvidcScethumarec^ 

^^isTau^uto^îî^omacnim *■ 

t^^i^^i te2îâci4e^or€ <iiTOtBi^ouferîi^mî-^ t ţiceat p^ 

zib^^* vidtKcei , aţgu^ Zibetb^ ) hxc xeceiîfej^e ^ AcdeMofcc^qiîH 

fi€mi». demfîlegiturapadScaligemm exeK-2i^ #^^ i>?|£>J^i?l J^ 

pio^eguy GazeLe Jimik animal oMmm^^fih ctiimv^n fm*, 

g^imişefflHmî, ^usejleximm ^:i^40kacîŞm^imrtMsiM^ 

Digitized by 



trahmt, aJîqu(agHtt^ir^tdunţ,.&ficferfi:imt; centefinta' 
tmn p^saâidagendmz fatts # #»%«? • tofusdenzque fin^ 
ms ex9ccatmi%U ftiluerem redaihis, m.fs:fiUicuhsinctjdz- 
t«r; ^M^uTĂnBuroţam . Zibech- vero ,. afiatici .cuiufdaoi 
fdis exeremenmm eft , Taxo perfimUis, cui â cergo fubgcaţ. 
taUbus eeHuiaqusdam, feutoculus, quafiakermapudendu 
lat«at, ia quo , dinu optimis interi m cibisaeuftodc akţur, 
-vc btlis, £iobiliorib«#ie^ camibus, ( quo enim preuoiaora 
vclâltero mehfe, meîleus quidam craffufque co igiturhu- 
tnor,qui cum fuaacredme veiiicaţ^F^r&pârtemiUami&pa* 
riete ,Tei caue« lateribus effricat , ficque locuUim pceuoio 
iamliquorerepletum indicat, qui exigea, eburneoque co- 
cbleareiteaiter âcinde aWiergitur atq> optimu id eft 
vt ipfemet Matriti non femet obierimii ,. duni EmanenuiU- 
mo PriBeipiyFraneifco Cardinali Barbeîiao Vrbani Otcaui 
ter maximi ex Fcatre Nepoţi , Sediique Apoliolics ad 
vtrumque Regem â tatere Legato, omnium ¥irtumm Iau* 
de dii^niirimOjfemuîafcr.-CaîteTum inter odorestongius for* 
taffe §atiati fumus-, quam fioiiri iaftituti ratiopatiebatur .: 

Bl njireş autem noa eff fofaţnerţ ; wut^ molţiş , 

' y ^. r , -. ./ Innaribus^adccrebrumvfque/^it: 

fiqs cerebri vclut addiumeata ijunt , Şc- prpprium pifâaus^ 

ftruţnţntum, hon adeâ vnus aljquis>mplus ac ..continuus^ 

Biga£\fâ><^ auribuş^cpnfpicitur j {;aiue- 

fîM %ongi&i^4?'^^^"^^^WHft inţerruptis for^iiiiubus 

B^i^ro^ Jef .^qu^od ceţ^b 

^^ ftficcickera-aiituna» ,gc<4Qri€ 

fi^Wn Hi&jnfpir^Bdo,,dq^# si X ttî^^^^^^ 

«ţempereţurque ,Et quoaafi câuitasVeiufqueqţimespatres. 

puriqr^sĂfor^ibusiexţiterim, edexa<aiuş odorem percipit ; 

â Bimi^ 6qui46m'4a4p:rftq4ţ^ 

f9q«€ effe oepkpq>ad^C€^?bium 4€i^^ a4itu$-i v,ndc ia 

CQsa^aÎMfesiweţaaaHs.»..: , , ^ . • .: 


Digitized by 


54 HÎPPOCRAŢIS £/?• I. m IOC. IN noM. 

l Bt proptere^ per îoagîorem diftantiâm audir^ quâm 

^ f ^ . Ex enarrata narium conftruclione colligit ad fiaern 

-' : ^^^ * textus Hippacratcs curipfî, â4mo4!i|;n problşmatiş 

Cur cx ttia- fc^^îi^i^^G^ ; cur > videlket , ex maiori dift^jiitiajudiamuş , 

iori diiiâtia quâm olfeciimiS : nam ciim fcnfiîerium |iudiţu$ vni^pumha» 

o^ffi^5 ^^^> concinuum. Se facis aaipkm mfafym admyfiijgani 

vfque ; mj^ringa vcro tenuiffimi (it^hxtmffimisxpăi^^ş di- 

ftis^aporis /fonivllo abfque impedimeriţo ,^d iispîanţa^ 

tum^acrcm ftatim penetrare poiTym > & fi îongi^qqipjribuş i 

parcibusaduenianc debiîes iâm â diftantia> audiuAî^ur tamen, 

cum ikcilis ijs adicus firad px^priwm audims . JAft^pnienruin -^ 

Adde quod aer fonomm Âclator^dum atcc|iţur;> frandturqy e, 

l?Qrt£îi£ yioIentia:reiîîit ; proindeqMe Jmpety a4 di^jpţâoreş 

partes fernir . Contrarium prorius eueniţ ii) pjf^câ^ j c;ţiiu$ 

fenfiieritim > VI diâum efl, pro m^zi^^ %GngiofeîTi Jiabeţ^^ 

eribrifomxem fuhftsuiciam , csaffaiiî j i^Cji ţiiii ilitirmpţis j[iQ^ 

ranainibus^ peruiam, inquibu^od^riiţi alitijs ţar4^ afcţiidm^ 

£cs^ accidoîtaîi^ jcnimeoxum leiiimci k^^ţim^WM^P^ 

turdis Eumidoruax grâuitâs perpeîup jreluâMâ<ift )j:n^gî? t :m 

parte diffipan tur, priiifquaîii admammiilarcSplongo fatis itine* 

re^, deduci poffint : acque itâ diim îonge adhxic âb plfaţSu ^ 

{ku o^2LânşmămmsmQ^hfunt, idiffMergiţur • Bucm^^k^ 

quododpratjisiuxcâxerebrufn locaturiîjît mole makîmum 

in kominidy â cukis fn^iditace reftiggeratur odor y & âb^hu^ 

Homo î«îer «iiditâce diîuăuf :: ^ quo Ariftoteles 2 . de an. t.^6. honai* 

mam haber x^^es^Bamque , & <^îîes^, <^ui â longe 6dorâiîtttîyp:il]yuîîî fou^ 

odoratum, jj^^^^ aj^ iîct ius^erefeiri^Jg orgaba^i^aîis; ţv^fmMmm 

videre eftin:^ibus>i^ ipfb^ 

addui^ > potioifî>rîa(se etiam eft pro foltftione aiteiriui pm? 
Car Jiomo blematîs ^ qiiod âb Ariftoielc j2, 4e anv t.^8> pr-opoiiituj?| cur 
n^i^o^ &i'iaet l^mo:reipi3:^s^qmdfiîn> ^&^^bm^mx^ mmm^ 
cic , ied expirans, aut ienq|îs^^imfig> jă^oi^^ ^ 

iieque coinimis^ nequeilin nafini^M^ms poi^^u^v S<^^ 
czoadiccns fenforium odoratus illud pecuiiare habereia 
"•^"' bominei 

Digitized by 



homîne > & in compluribus etiam Ipiraatibus > vt coopcri- 
mento tedum fît , quod refpirantibus difcoopcrkur dilata tis . 
venis & meatibus /Venim cum nuîlum tale operimentum - 
Anathomiciimieniantiahocorgano^verius dicemus iiecei^ 
{knmi effe infpirationem ad odorandum , vt qua- 
iamadiBammiîlaresproceffus trahaîitiir , ad quos obpecu^ 
liarem & ethmoidis oiîîs conditionem numquam p^r fc pe- 

XIV; E^ î" oculos venuî^ tenues ad vîfum ex cerebro per 
* ambientemmembranamferuntur/H^autem vena- 
la V^fumalunt humore de cerebro purifsîmo j qui 
etiâcain ocuiis apparet^ Eaedcm ven^e etiam ocuium 
exrîngunt vbiiuerint reficcat^E • 

PGftAudkumatqueoîfa^tumVifus nobis fefeconrem- 
plandum pfFeret 5 exterioriim cmnium leBfuum longe 
pr^clarififlîmus, fine quo miferrima proriiis humana vita ^î^^^^f" 
haberetur/HuiusIucidiflimiim organum oculi funt , ipon- 
^ foriioife plane puîchritudiiiîs\ ac poftremus naturse conatus 
in ku'mano opificio: Sunt namq. duo eius fulgentiffima fyde- 
^^ feu luminaria magna, quibus Homo|Gmma circumfpi» 
ckns, rerumqsnaturaş, diflferentias, atq. effectus intelligens^ 
es^miasfibi fcientiats comparatv Maximum op/j^ inquitPîa» 
K^ în Tîmseo , mim gratia Xy'tiiitermUs a Deo donaţi Junt^ ddn- ocuicmm 
Ceps '^^c^cmâumcmfi^ : Kerum enwt oţtimammp vtarhiţn>r > cch ^^^ ^ 
cfdtionemmhiS' oculi attukrunty^^ parandis, 

'" ' ^ ' tur ^ 'numquamdnusntaeffmt ,• p neajiefyâera ', mquefil y ne^ue 
Cvehimfifcip ptmffent . Cognitîoverodid ac "doBis aŞ oculis ort a , 
fecît t^r'dinkmerătione quadam mmfium » mnorum^ue- y amhitm 
metir^m' ytempus c^gmfieremm',vniuerfa^^ 

tremur ; Qm^m-exr^bîis^Fhiiofiphim ade^tifimus , qm hononii ^^^^j^^^^^;^ 
'om^am maita mortalitmgmeratiomd^tum'efl Decrum mmcre > maxima «ă 
mqt^d:ibitur. QuMm^^^ qui&brutis ^^^l"" ^"^ 

communis eft > vc quafi ex alto profpicicmes , noxia euitenc> 
profequantur vtilia y prasitamiorem alteram peculiariter h^ 


Digitized by 


bent mhomine , ytyiiîbilibusHifce immetaz cooximCnmm 
.Opificiş fapientiaS: ■bonitate, in eius amoremfvtpar cft, 
^^i^tatv mÎHcîsvfu'mtamăiflinguunt âmorieAn(^^^ 

hlandt . FrofeBo in ocuHs animus inhaiim^ aîqii& hos dm pfe* 

Ocuîaram ^^^^ > animimiffum videmur auingere . Hxnc varijs Enco- 

cBcomia. mijs tamum namr^ dec-us varij varie veaeranniir , natura 

dculum', animi fpecuîum , faiis fîlios ^ feneftras anim^e ^ ' - 
Qrganum-lucidumV Dminum membrum appeîfentes:, Soâ 
quil tantam pulchrittidinem lâtis raquam-admiretur f <^i<i^ 
pretioiuis vacjuam indiois produ^k Oceanus f Quid^iis. 
ia liSore pretiofius repertum ^Aţpixăat tMtamrr^crvfîlen^ 
tio venerări, &ad propofitîim texmm regredi^ inqîi^ve^ 
nHÎa? prGp0nuatur,<îuse nobiliffimam hanc ^orporis p^cem 
purîffitnQ dedu^ohumore ^ ^Pnt. CenfcnţpQritk>n^^ntri§ 
■ Hippocrace de^ptkk feu vifîuîsiieruis Mc logui; hi^^î^^^ 

Ciim primam fînt aemorum cerebii coiijgiuEa; bili^pn^ciow 
tfis 4 cmht<y altjer in aîterapi ,<^uiur^ inicrkq^ ^ yjânzm 
'^inii vHâ cum animalijbus ipintib^ 

tur r iţa yt perennisj^iritiuim Huxu^ in ijs cxilcceriir^ jfiue^ 
int€Xcipiatur^.conf€|lkn vifio dep^ric,q^ 
gunaiiifeşaB^pi^J]aiit.. Neque^H<^ 
t^ e^iaaii^aru^ş:y^îuţum.nomiîie 
iiii^m 0^<:onpmiaf ^ iios i#:â oftcndemiis^ 
, ; h^A:<>pimQ;.e^ <^^^ib^>;vbi^ademike^fed<aar^^^^ 

milas. quod eftjluţinc^msmui^mimde cerehopercalciSur^.h 

»mjf*<»^-y mysiţfisxi^t ; per hocmtur rehkms', videt. 
Ql^dvmnonfplendiâum e^,wqiieTehicct,ţeTMcrm'uidet-&c ' 

Digitized by 


Wbi de opticis neruls intclligendum cfle xcniffimum eftt 
Ciîmnamque hi meduUa/duplicique tunica conftents me- tBl^^"^ 
dullaris quidem fubftantia , quzmzc€x<:hxo mutuanturj in 
cryftalîinum humorem diiperfa , vt in id> quod proprium efi 
viiiis inftrumentum .> vifiieni fpiritum quaqnc v^rîuseffUn- 
dere poffir^reticulare format inuolucrimi . Tunica: vero, qnas 
â crălTâ & â tenui cerebxi meninge accepcrunt , In oculi ox- 
bem diîatacse, craffa quidem , atque exterior , cherathoidem^ 
^£U corneam ; tenuis auteşiatque interior chorhoidem , £cu 
-Vueam ocuii membranamconftituit: C^se fane dilatatio» & 
^iiembranarum optici nerui ^xpanlio , propagatioque nou 
tiitiexglutinofo, fed puriffimo humore> fieri cre4endum 
eft, cum partes fînt fpermaticie , pelîucidseque ; eumque 
optici non m(i ex^cerebro accipiunt^ tenuiffimam piiroffi- 
tnamqi^eglucinofîilîiushumorisparcemfdîgcmes, vc diî- 
phanas îucidaique effician: tunicas , qu«e â lumine Vifiîibuiq; 
fpeâris permeari-qaeanc. Non inftciamur itâquc in tcxtu 
c lib. de carh. deiumpto opticornm nertîorum mentioncra 
faaberij vbioftenditur cur Gculuspr^ csteris fenfoiijs aptiA 
* iimumfitvifidnisorganum, eo fciîicet, quod diaphanunt 
£t atque pellucidiîni , e puriffima gîutinofî humoris, cu- 
iufmc^iipennaticumeft, parte genitum; fed in propofi- 
z6 contexai xie4>cuîi^ alitiene agi aflefîmus > qux noa nifî 
^medijs venk fieri poccft, perquas cantummodo aîimea- 
turn defertur., cum optici non nifî animdes deferantfpiritus, 
Omitcjmus ,quod impreprie^as venas vocaffct cxilcs , fi de 
epticis loqui^voluiifet: £unt enim bi neruipra: C2t>eris<erebri ^ 
c-oniugijs craffiffimi . Dicendum proptereâillasmincpropo* ^ 
^i tiim venulas , tuni arteriolas^qu^^ in teau^m cerebri mem* 
branam âb internis iugularibus &<arothidibiis diffeminatse , 
ad ipfos dcmum oculos^ ad rhagoidem niminam, feu vuifor* 
mem tunicam , âb ipfamettenui membrana proueniencem^ 
fecuncur.5 in eaqueinnotefcunti ibique.^on modo ipfam 
alune vueam., fed & corneam > & retlcularem, & vnitierfum 
denique oculum prseteradnatam tunicam : nam & hsec cos- 
fpicuas fufcipitve\ias â pericranio*. Sanguisautemper ve- 
i^asrcccpcuSjin.vicreunx-diflUIiUîshuaiorem.j ibi akeracur^ 

Digitized by 


j8 HIPFOCRJTIS US, T.13S toc. lîf HOAL 

prxparamrque in alimentum cryftallino humori , qucm 

crucncari , ac langmnoicncp infîci colore nefas ciFet . De his 

-«ms videndus eitGal. lib. io. de vmparc. capa. dicicer-o 

Hippocr. * ^ o^ 

Etin oculos venula» tenues ad vifum ex cerebro 
- per ambientetn membranam ferunrur . '"^'^^^'na 
cerebrum immediate circupiambitur, piaque meiSTâppeHa! 
tur, ad oculos vlqueprotenditur, dum opticisneruisintc 
norem :unicam commodat, qu^per ocuii orbem diJacaca^ 
vuilormem elîick mcmbranam . Per hanc idque piam vd ţe- 
naein aiemngcm venuls complures , arteriîequc ab jnterms 
uigulanbus, a:que carocidibus onuud», opucum neruum 
perpewo comitaates, adjifum, vd vifxoms ox-anm» fe. 
iimcur . ** 

H^autefnvenul» vifum alunthamore de cerebro 
purifsimo , qui ctiam in ocalis apparer .^^ ?" ^ 
mus ac tenuiffimusi cerebro fanguis adVaeam wfmlt " 
acuş, npn modo m adh^remc Ci cobeam rdudat,cuml^ 
tumq^pd dunffima.<.t, turn quod diaphana pekiSaquc 
eiTe^ebebac, vems penitus deftituta eft; fed in proprfosS 

fangmms porcio^ omni deppfara rubediîe, in ciyfldJiS 
«îciKumexcpqmcur. Hmus alimenu purica. i« ipfis ocX 
rum lmmo«bus^pra:xu«t , qu, in pupHia per corLam rraT 
fparenc i aut in rupu<^«bus eflufj , «^jenti&L coiîfpicium^^^^ 
alimouiquc puHţacem.edam atreftantur : luciditeiraum enim 
Sf ^ mt r ^'^^^^^^"^^"^^ > purxaimoque aJimcnro , nu.. 

E^dem ven^etiainocuîum ext-ngmint vbifucrint. 

OcuîorSvc- refîccatiB. ^^fi«^turquidem,aucquodobftru(aa,«a- 
oa: cur cx- „ turalein commeatuna non amplius admi- 

ficc««r. claaî ; aut x^od in iumma aUmead |««f€uaK , •« dum 


Digitized by 



natura aut vi moîbî > auc vkimi feny in fumma imbecillic^ţc 
cft> vitale ncdar non eo vlque extenditur . Hîiic cabefcunt 
oculi atque excenuantur s cxfîccati humores obdurefcunt, 
denfantur mtmbrana^, omniumq; deperit perfpicuitas :^ ex^ 
quovifioncmminui>velpeniius extin^ui nccefle cft. Non^ 
er^o opticis tantummodo obftru6li$>animaUq; deficiente fpi- ^-^q- a^n 
ruu>acque oculo ill^fo apparente viciatur vifioîfed veiiis'^L.^^^^^^^^ 
etiam cxhccacis , vt iain cxpUcâiiimiiS , idem coucin|ere ctU'^ oh^^x^eth, 

-. ■. n A ^ ^ <|uam oca- 

lenauaicit» . : . lomvc^uiis 


XV. Membran»^ autem tres > qu^ ocuîos cuftodîunt , ocHîomm 
* fuperna qaidem crafsior, media tenuior > tertia te- '^*''^^'^*' 
nuîsj, qua^iiuaioreaî CQnferuat* 

PVlcherrîmîim pra: omnibus eft ocuîoni opificium; quîp* ocuiomm 
pe quiiîvcditiffimacorporis parte j.quavcrsus progredi ^^czipdo. 
animal debebat, omniaq; obucrianriaprofpicrejcorufcant; 
offibus varijs,j&iperciîijs,p^îiebris,cilij%ue vndeqiiaque ob- 
uaîlati , vt zb irrueBtibus quibu&unque mtiores fpîendercnt* 
Hinc, cumceuinfpecu îadtent^âb o<:culendo oculi appel- 
Izxibxvit^ Bîemmy inquit Phto » faluhre palpetramm tepnm, laximao. 
Dl^oculismachinâti 0mtyqui!miiQH^svisillaipiîS^i^^^ 
nmentia tegmînis CQercetury compr^ffaq; interiores moţus perfiin^ 
dit if mulcet > qmhus rdc^atis , iaS^ue emollitis qyiesoritiiT •. Oe- 
terum muItipUcipamumyarkrateîucidiffimum hocorganu 
compofimm eft; fexetenim enumerantur mufculi , qui â 
profundiore ipiuîs orbita? pajrtejâfpbcnoide nimirum prat 
deuiues , in adnatam tunicam inleruatur , & quaque vcr- 
fus xtciă & oblique oculos mouejnt . Sex etiaoi affignaa- 
turmembranarcuftodiendo oculo, obfirmandoque dicacar^. ^^^^^^ 
qitamm prinaa Adnata dicitur^feu comuniftiua, eo quod ocu^ 
lumproximispartibusadncâat , ne violentibusin motibus 
procidât. Ab vîrimis pericranij partibus hascoriundaeft; 
cumquciît opaca npn omnem anteriorem oculi partem cir- 
cumueftiî 5 fed amplum reîinquit meatum in Iride, îtn m va^ 
jricgataiHa, âtqucorbicuiari Imea? vbi oculi album termina^ 

H t tur; 

Digitized by 


gt mp pocRÂTis LiBri. m Loa, m hom. 

. rar; idque vt Viiîbiîibus fpe(ftris , tumîniquc iter ad cryftalfi- 
iiumpâteat : intiis vcrd to um inuoluît ocufum , vc âb ofPiiim 
duriue defendat ; cft^opaca, aîbâ , callofa, pinguis , vcnuli^ 

c^rnîa. atterţoîifque intexca . Huk lubicâ'a eft Coriiea, fic dida > 
quod corncaş famiiias duricie ac perlpicuitatc emule tur. 
Duraquid^mefivteryfhlIino,c^teri£que moHioribus^oculi 
partibus propu^uaculum & âb irrucntibus omnibus ycnris , 
%ore/&ţftu> cmnipfa primo occurrat in pupilla, ynde 
tommcircumaeftitoculum; Eftautempcrfpicua, vsvifibi* 
libus fpeciebas , lumiiîiquc peruia in; A dura meninge me- 
dullamnemi opticei ambiente originem ducit, vcdidumfyir^ 
^terijs venulifquc penitiis deăituta, quoeius perfprcmtas 
purior effct î vnde âb vuea er proxime fubiedb^iîîmentmum 
prokâat humorem. Sequkur terti^tuniea, quas Vuea dici-»^ 
Vfiieâ. £ur> eo quod Vu^ foUicuIo ,k quo pediculus auulfus eft» pcr< 
fimilis figurayCoFore , reiiuitater teaitatetyie esterna fir. 
Tenuiori membransg nerui optici fuamorlginem^hsec ^cep«*^ 
tam refere, vndequaque ocukim'inuoluefîs, prsterquam an-- 
teriori parte, vbi tenuifofamiaepermaexiftit^quodpupiî-^ 
U > kw oculi feneftra appeliacur \- H^cvna inter ©culi tunicas^ 
coloribus diftîngaitur : nam anteriore fuip>arte y quâ quidcm 

. ^ ' : : cîyftalîinamipedat^ fiiica eft & nigricans^qua vero cornean^ 
reipieit>iridem conâituen.^, feir ciroikm Uium, cuius^ laţi- 
rudo âb albo ad pupilîam extencfetur ^ non vnicobr in- omni-- 
bus, fed pro varia cerebri, oculiquc temperie . nune cxB;t. 
nune caîHjlea, nune nigra con^icitur : pofteriori vero fui par^ 
fe Vucâ^ in conuexo fuica nigrau^e eft , i:n coneauo vero pri- 
înum fubalba, mox viridis,.demumcasruîea. Huiu^vtique 
vfus funt, ciim V€nuli&arterk)Iifquc difleminatafir, proximas^ 
partes aîerc;cum iit moHis, cryftallinumâ corn€«^ duritie 
defendcre^colorumque varietâce quafîfpecuîum,-autviri<- 
darium , obicdare . Dii%âtos ipiritus eserulco ^roque co- 
' forc in vnum coîiigit, & externi deaique luminiş fpJendorem 

^^^ «frai^it»Q«arfaAraneadicitnrâbAranearumtebs>qiiarum. 
fimifitudinem fai tenuitate gerit . Proprium efi eryftalliai in, 
voLucrum â piamatre procedcns tenuiflîmum,perfpicuumq;* 

i.cuciiicîis/Quia6taeâR€ti€ulâriSjârcti§^lîmiMtudineita appellatameqî 


Digitized by 



w ntoprie tumca^cft Cbcimdum Galenîi^cum^hU tegat/ed, ^^ 
Sampotius eftmedunaris nerui <^tici fubflanDa inftar cap.. 
S^ nercryftaiUnuav huiivorem dilataca. vt per cum viuhs ^.^^^ 

ipellata eftâvicreohumore, quemciKumquaque ambit . 
SSusmedio intcrftitium cUy figuram refe- 
tms Verum ncmie hsc vera tunica dicendavidetur , fed 

Stur • Aqucum pariter humorem i vitreo fecermt, ne f.m^A 
tonfundaniur . Atque h^ funt vari^ ocuîorum membrana: & 
Wicu'a: , quas curima diffeaione vaJi>poft HippGcratem 
Sathomiclobferuaruac . At cum.harun>.a!iqu:£ neutiquam 
vers fmt tunica;. Araiiea fiquidem tenmlimmeft.vixpct- 
«otibibilis, aeque tomm ambiens Gcukim , fed vnum tan^ 
tummodo cryftaUmum,.eumque/i Galeiio 
de vfu part. c.d.ăbanterioretantum parte. Reticuhris ve- 
x6 vt ex eodem Galeno fuprâ annoîauunus , son elt mcm- 
bra'na, fed quedampotiusncrui optici medullarislubftanns 
dilatatio. Vmcadeniquefitquariappendixrh^pidisjmde. ^^ ^^^_ 
eft QuodHippocrate&nonniri tresagEouerit, iupernam vi- ^,, ,,^,i'„ 
ddicet, hoc eft , adn«am, craffam admodum & pinguem., agnofc^c^ 
«B4S. & Quam carnemappeUat camib. Mţdiam,hoc eit,c<>r- ^emba^a* 
«cSnteauiorcm. Tertiam denique,moIlioremadnuc,tc- 
mjioremquc, Vueamnimirum,^ushiimorcm (cryftaUinum. 
videlicct) coaferuat^noamodd quatenus a corner durme 
jUum tuerar , verum eîiam quia fuis eum eolonbus mirihce 
recreat, fwrkusvnit^ externilumimsfplendoreraobtundit, 

Bc difere^ando aimium Isdat . Harum trium videtur ctiam 
aemim^Iib.dccam. citato, vbiadiiatamtunieamcarnem 

vocateoquod pericrânijproeeflusfît, quodcavnoia capius. 
membrana dicitur , camque caraem pariter appellauit fcup- 
nocrates,¥tvidebimust. I4.1ife- 2.r«â vt admirerAmhor 

rem Libri , qui Medieus hifcribitur , quod cap. 2. huiic tex- 
tura citans, oculum ex Hippoeratis fentetia duas tantummo- ^Ocuicn^ 
dobaberetunicas^eorneam & Vueam,aQeî.uerit. Suncpif- ^^^^^ 
cerea in oculo tres humores , Aqueus nimirum , qui aquam 
puriwie ac pcrfpicuitate refcrt, fuoque lentore ouorum aJbu, 

Digitized by 



mimfîmiliscft;vn<lc ctiamalbugineus appcllatur> quîquc^ 

Aqud^ja- 5" anceriore oculi pacte, vbi pupilla eft , inter cerneam y cry* 

moiis vfu4 . ftalliniim > & Vueam, coUocaturad ipiîus cryftallini tutelam^ 

ne fcilicet â membranarum duritie l^edatur , aut ab externi Iu- . 

mmis fuîgorc : quin ctiam ipfum concinenter humedat, ne â 

cSi^if^ W^?"" «if^uexlîcc^tur. Vueam,pmereâ,atquecomeam 
difteadit, ne concidant & corrugencur . Qndd fi comea rum^ ; 
Sm '^'/s! p^^«^>iSrix \llico egreditwrliqmâus ^ gkitimfits , inquitJirpp.,- 
' atque^hi refrigeratus fuerit yficcus madit ^elut thus tranjpa- 
libfo'der^e^^^* "^""^ totum bis 6b vuJnera effufu mproprijs feocuJis 
Lit ^ '^ vidiiTe teftatur Columbus , 8c fpatio temporis regenitumiicâ* 
Crvibii* ^*^^^^^^^ ^^^^^ cernere ^ger deinccps pocuerit;indequc 
'^ "^"^ coîligit effe excremencum . Aqueum cryftaîliuus excipit^ 
cryftailo , vel glaciei perfpicuicate ac denfiratc perfimilis; 
quouis camen Aiamante illuftrior ac'pretiofîor • Hic pro* 
ptium eft ac verum vifîonis inftrumentum , quo â viiîbilibus 
fpediris alterato , cclebratur vifio, proindeque in oculi cea- 
tro e dire<5io pupill^e reiîdens , principauim inter cseteras par<- 
tes gerit , qua? ei VQicx fubfamulantur. Inre itaque eumvocnli 
ccmmm. Animam ocuîi , interius ipeciîlum appeîlant. Inna- 
Vitrcus. tzt cryftalîmus in tertio tiumore , qui Vitrcus dicitur 6b fiiiî 
vitri iîmilicudinem , quam crafricie & coniîftentia gerit • , 
Huiusprâîcipuummunuseltalimentum cryftalîino prepara, 
re , quem proinde medium e^rcipit : nepbas ctcnim erat niti^ 
diffimum organum cruenco inficihumore, fedpuriffimo, 
acde%ato indigebat, qualis videlicecâvitrco eifubmini- 
Oculi tem- ftracur . Ex hac partium natura oculi totius temperamentum, 
fr.Tu^ coHegit. Ariftoc defenC&fena cap.2. aqueum e&affe^. 
vei igncum rens contra Empedocîem &PIaconem in Timaro^ quiigneii^ 
^ • effe afSrmarunt^eo quod c^kftis ignis particeps iîr : fic oiim 

loqukur • l^is veroillius ^ quinonvrit^dcm .fedilluminando 
fuauîter diem inuebit mmdo,parţidpes oculorumorhesD^sfeurut. 
Quam vcique fencentiam Platonici varijs ar^mcntis robota*, 
re conantur , eo videlicet; quod iracis oculi corufccnr ; iî 
f^jcencur , etiam in tencbris Iplcndent: kcidifiint, zgks „ 
fpintofî^neque vnqnamrigeant. Sed qucmadmodiim ii^c, 
mmmaaî turn vitalium, turn aniaialiumfpirituum, copiam 

Digitized by 


eOMMSitTAKUS mva'RÂTvs. 0% 

în ocuîos infiuentem attcftantur > itâ ftiggidariim pârtiumag* 
crrecrado in oculis ^ varijque humores friggidi & humidi , qui ^ 
liUmqam in 1 js non copiose conlpiciuntiir^ friggid^ atque hu- 
fnidse crafis certifîimum luni argumentum . Ex innaţo xzr 
incB > influentique ; contrarijs videJicet fimiiî admixtis , 
opcimam oriri fimmctriamcenienduin cft^nobiI:fîîma aâ:io- 
nicongmentem , 

XVI. : Ex hîs fuperna & crafsirsîma fi kdatur , & mutî- 
letur , morbos facit . Media vero etiani ipfa periculo- 
{âeft;& vbiruptafuerîtj prominetforâs velutjefsi- 
ca . Tertia auteo) tenuifsima omninopericulofa eft > 
quse humorem ccnferuac . 

MEdicum agit Hippocrates ; proindeque explicata aii- 
cuius parcis natura, mcibos lubinde rcccnfet, quibus 
capars obnoxiaefle confueuit: quamobrem oculus^cum pars 
fit or^'anica y fîmilaribus compluribus contexta, niiUum mcr- 
bi genus eft , quodperpeti ncn pciîîi: , iimilare , organi- 
cum 3 commune. Vnde prudcnter admodumapiid Prifcos 
fadum , quod peculiarcs Medicos his morbis , qui innu- Ocaîona^j 
meri prope funt, dicaucrint; vtteftatur Gal» <5*aph. cern. 3 1. ^uiiliesMe. 
fuborcfcunt fiquidem hi afiedus, non modo in oculoruna ^^^^^^fj^l 
membranis , venim etiam in muiculis , Neruis , humoribus , lunt . 
fpiri£îbuique:Membranarum tamen hic meminit tantumodo> ^^^^^^^ 
quod illaspotiiTimiim morbis infeftari confueuerint : Qua-rocrbi varij 
ţropter fi ea > qua? fuperna eft ^ & craffiffima > quam adnatam fj^^^^^ 
appeilari daximus ^ quoujs modo ofFendauir , fiue âb cxtrâ ir- pamum va- 
xucntibus caufiSj fumo ^ puluere , ventis , tetris exminera"^^'^- 
exâlantibus vaporibus , fplendore item intenfo > violcntoin- 
curfu , aliaue confîmili re s fiue db interior ibus , vr humor ura 
concreftione > fiuxioneque ; in ea iliico iubcrefcunt morbi s 
qui lî vifum penitus non cxtingunr , cum adnata non iit pra:- j^ Adoata 
cipuum vidcndi inftrumentum, faitem miniis commodum l'j^^;^^ 
reddunr : ^am in ea fit quidcm Taraxis > feu o culi pcrturbatio £cchymc£s 
fi âb extrinleco phlogohs ă: rubor excicetur.Fit Ecchymofo, ^ . , 


Digitized by 


Opcaimlâ . 

Chyaiofîs , 

P:cri^ium . 
In corn ea 





gţiine , ob niptam, adapertam, aut exeiâm vcnulamî qm 
pîaae afFccltis in Ypopium degenerat^li idem iânguis deniquc 
in pus vertatur^Omnium tamenfreqiientiffimc Optalmiaeam 
inreftatj iaflammado fcilicet ăim turaorCjtubore > doloreq; 
-exteiiuis biliofiquc fanguiais influxupertcmportim, atquc 
angulorum venas . Immd iî oculi aîbum adeo quandoque io» 
mmefcat, vt oculi nigrum vclut profundus hiatus appareat^ 
tune afFedusfic, qui Grscis dicicur Chymolîs. Hiîc fpeâa^ 
eciatîî Epiphora > fîueîacî^mamm fluxio , quae modo aquca 
"Cft, &friggida, modo acns, nirrofa^ &^rodens , plerumquc 
.adnatam vel corneam mutilaiis ex illuuic extrâ cranium m 
fyncipite coîleâa^ iuxtâ pcricranium diâillance . In^adem 
îiac quandoque membrana flla excreCcit, nemofa & albicans^ 
quam a maiori angulo tam vicrâ incerdiim fe fe extcndcre no-. 
-uimus , vt pupillam contegat, dicicurquc Pterigium . At n*c« 
diam membranam, quse Cornea nuncupacur, periculofîiişadi* 
'huc lâborare contingk,quo proprius id cryftaUinum accedic» 
totumque oculum citcumambic . Iniiac fi Rbexis-, ieu aliqua 
continui folutio adueniac, fiueâbintrinfecis^ fiucâbextrin- 
fecis caufis, tuncprimumalbugineuseiFundimrhumorj mox 
per rimuiam vuea procidit > fitqueProptofîs , xMins varia: aC- 
•fîgaantur fpecies: -nam modo vueaitâ^xcrâ prominet, v; 
MufcsB referat capuc> didcurque tune Chephalo ; modo ia 
âcini Vuse fimiîitudinem excrefcic , &dicicur StaphiIoma,| 
modo augetur adcîaui capitis magnicudinem , &.clauiis nun- 
cupatar . IncrafTatur prsBt^rea cornea , denfaturque turn ia 
fencâute cxficcata > turn exalijsmorboii'Scaufis jindeque 
trontingitCaligOj feu tcnebrofavifîo , pr^pedito niminiq;^ 
tranlim vifibiubusSpeciebus* fuflâuiditur cxtraneo colore ia 
ideritia^ inlîammatione^ figiUatione: ac tune allucinantur 
oculi y dum obîeâa omnia confîmili infecîa coîorc fe fe offe- 
Tunt; alFeâusCrsecis Parorafisdi6ius: Sique poil pblydaînas 
& puftulas , quibus interdum cornea perftringitur^ fordidum 
vîcus fuperueniat , fiet Epicauma , ad quod fequitur Onix ^ 
cicatrix nempe vnguis imagiiiem referens • Ex tertia tandem 
membrana maiora etiamimminentdifcrimina , exvuea-vi-^ 
delicet^ qua^proximioradhucacceditadxryftaliiaum: in jet 

Digitized by 



TiamAcrn m^driafis ftt, boc ei% pupilk dikcatio, eiufdemqite ^y^^ 
- conftriâio ex zdzn&o , diminutoue ptofquam ratiseft albu^ ' 
^inco humori :, a qiio ipia vuea extenfa adieruatur • Augetur 
autem hic humor â fluxionibus , & immfeuitur in oculi atro- 
phia & phthilî ; nec raro a aimia Veiieris induîgenaa] -omnia^ 
que tune maiora apparcnt . Aiqnc hi (unt z&Ctus , quibug 
trcs h? membrana infeftari confueiîeruni: • Cg i^riim aon ram 
br€ui circuîo arâatur-humani oculi cakmitas: maiora namq. 
fuperurnt mala , quibus rdiqu^ etiam partcs z^n raro exagi^ 
tantur.DenIaturccenimalbugineus<iuaiidoquehum<>r,^al' ^^ _^ 

fa iiluc irruente materia , & Ypochifim gignic/eu tcnebrciam ^^^^-^ 
fuffulîonem.Inficitur cryftaîlinus aur vitreus humor r.uc glau- 
co nune fufco colore^indeque omnia estrinfeciis caligine cb- 
urokitâ, coloribufque variegaca apparent . DenfaEurquoque 
cryftaîîinus , crafelcit^ & ad albedinem vetfus £t Glaucoma. Gia^comi. 
Obftruitur opdcus neruus ^ Sl Et Amauroiîs > fiue guttafere* ^^^r^ 
•na. Quin etiam animalis ipfemet fpirims ad viLum delegatus » 
quique copiofos > tenuis , âtqtie schereus efiedebet^ varias 
paticur aUeraciones : modo enim copiofus quidem eft> ied 
craffus ; ac tune obie<aa quxuis , hxxc pro^xima , fiue remota * 
parumdiftinaaperfpicitrmodoluciduseft, fedpaucus^ex ^^^^^ 
quoMyopes fiunt & kfcioiî ^ ptoxima tantiim c^rncates, l^^^^ 
no&uqiic, pîufquam interdiii; modo paucus eft, & ^raiTuş ^ v^ 
infenioeuenits &hebestunc r-eddiair viiîo > propinquiora 
tantumodo^eaque confuseeernens:idqucmeridiana iac^ : 
fiu. 40. exqueNyaaîopesfunc diai, d^ -quibus videndus Hippo. >^'y^«loP^* 
cotes 2. pr^diCt. Deperic dcnique oculorum motus in para^ 
îy fî , deprauatur m ftrabifmo ^ in quo itâ eonueUunmr ^ ac ^i- Strabumai 
ftorquencurocuîi, vt amborum-non idem efle queat intiiicus: "^^^^^ 
idque vel mufculc«:um vkio :» veî neruor^im fec^mdi coniugij^ 
vel ilirus partis eerebri > â qua feciinda hsec ^eruoriimxroniu- 
gatio emergic, ^ontingere iblet . Omiaimus ea , qu^ exter- 
nis in partibus fepius eueniunt, vt maiori in angulo , vbi m- 
terdum exiguus oritur phkgmon .^gilops di^us, ex quo in- ^AegUops < 
caucius curato iîiniofaiequimr fiftula , cui, fi abfumitur ca- 
riîncuk , fuccedit Rhias , fiue profiindus hiatus . Quandoque ^^^^ ^ 
tâdemmet caruneula imrnodi^^ augetur, & fitencanchis. Bnch^iuis 

I Pat 

Digitized by 



vot^std. ^^P^^i^^r & ipfg infeftantur fcabie , earum pracipue extrc» 
»u . mitatem occapaate calido acriquc humore, diciturque P^ 
x«optii- -foptalmia; modo pruritu> feu fîccaquadamUppimdinecx 
-njtrofafliixione, &diciturXeroptaImia. InacrtUBturetiâm 
ara > vc interior earum pars rubra promineat , 6b cicatri* 
ccm , vel fubicâas carnis exuberamiam , vt quanddquc 
Ecuopzon. in Aegilope , qur eft affeaus GrscisEdiropion didus . 
Hozdeoiiis . Erumpk demiirrt in' eius extremitate calidus quidam tiw 
Giando ^^,^^"^"f /^^ abfccffura. defînens , Hordeoîus nuncupatus j 
vei iuprajpfamalter durusemergit, quemgrandinemappel- 
Madariis. lant . Nec ciliaproprijscarenEaiFe<aibus; nammod<>inuer- 
tuntur> & pungunt ocufum i modo- defîuunt ^ fitq^ue Madar, 
hs . Atque hi ilint morbi, quibus prjBcIariflîmum boc mem- 
brura , lecundum varias fui partes mifere obnoxium eft : nec 

defuntalij, iquorumreceKllr, nemoîeftiorfithaîcmalorum. 
llias, iam temperandam duximus . 

XVII, Membrani^cerebriduas funt, altera fliperns craf^ 
Cor , altera tenuis cerebruro attrogens, non amplius 
ea^em permanens poft quam ioerit vulnerata , 


Eocuîorummembranulisadeaî, qu«- cerebriimcir- 


inHîppocr» t€xtuumque connexio attendendainHippocrate, ncjaGa- 
r'ndâ^ct l""f^i^^o««i»ineidâmus initio commnetarij primi de fia. 
xaiiiisoido. Ctuxis,vhi eos infedatur , qui Hippocratem improbant eo 
qudd parii ordinate de rebus egeritj cijm veteres Scriptores y 
qmqUQ ia docendo cxcdiuere , nuJîam exqHiati ordinis 
■ curam habtierimrDiuinusnamque Senex folids doctrina 
intentus , de cateris ad vnum fpechntibus ©rnatam , haud • 
mUitum laborauit . Af cereirumfupnmam corţoris partem cu- 
fiodit, inqniiDtmoc. libellodenat.hum., & feamtatis tu- nujs 
e^fSo! '^^^"^^^^ ccmmijfam haha > intra memlranas ncruofas eohahi^ 
g!urin%foa.* ^^»f • Cum cnim in doSrina Hippocratis , fri<TC'idi & oîuti- 
fr^fg"'!' ^f^ humores exaffati, in membranas extendantur, quem- 
nuioi!aver6 admodum pmgues exufti durantur in ofTa, proptereâ c^re- 
xlC°"' "" ^'■^ » « habecur lib. de carnibus j ^ma minimum pnani. t,^^ 


Digitized by 



ifidim hahi > flurimum /vero ^htinofiţatis > â calido muri 
non potefl , fed temţore tunicam , memhranam ^raffam accc-* 
ţiî \ cir cum membranam 'uero pjpty Quantum calidumjî^^a^ 
uit y 6" im^uihis ţinotiiîtdo erat , De cercbri âure.m membra- i^e ctuhd 
nis difcrepanc Anaihomici quo.admimerum : Reaîdus enim f^^nj^^ 
Coîumbus du'âs agnofcit c^Tas ^ eo quod dura menmx facili «^thomici » 
Bcgocio in duas diuidatur , cum fit duplex . Vcnlxn hsec ra* ^cmm f"^" 
iio hai^d multi facienda eft > quandonuHa cft membrana in 
humano corporc , qu^iuplures , ccn tot in cortkes > .diuidi 
nonpolîir, cum omnes duplicata? jSntadjobur . Diccndum 
proinde^duastantumodoefle membranas xegendo ^ere- 
■ bro :, cuîlodiendoque â natura jnfti tu tas , vt molUamplcxu â^ 

caîuarias duritie illud tutarentur . Harum prima , quse adaper-. ^^^ ^^ 
to cranio ftatim fe Xe vifendam offcxt, .tenuiori .alteri,mem» xnin cercbrî 
branxinbserens^cuiper yenulas^ .arteriolafque anne^iîur, Geicupuo , 
duranuncupaturj^eucraflameninx & mater^, quod craiîiori 
i materia hcizfit ad .cerebrum x^chementioribus in .mocibus- 
iîrmiter.continendum ,♦ E caluarise ,baiî emergit, .cereLrumq; 
vndequaquejnuoluit, reliâiajtanta inter fe & rranium in iu- 
perioripartediftantia^quantaadcerebri dilatatiori.em con* 
ftriCîionemquc fatis erat : Cranio xamen per villos.aJligatur'^ 
quiperfuturamegredientes, pericrapiumxontcxunt . Hxc 
cerebrum inJeuam dexteramgue partem.diuidit , &:.duplica« 
turis quibufdam 5 quse ilonadcerebriikaiîm, fed.addimi- 
dium.tantummodopertingunt, â xerebelio feiiingit : Inter 
quas-duplicaturasiinus.quatuox reperiuntur, qui^ velutyafa 
fanguinem ib internis iugularibus acceptum .continent , Se 
quaqueiiersiis jn ccrebri fubflantiam .ad nutritionem diftri- 
«1^- ^* iutmt * Hoc lignificauit Hippocates lib. de morb. iac. , in- 

quiens • Cerehruni hominis duplex efi y ^quemaÂmhdum etiam alys opat cut 
cmnihus ănimatihus., medium antem ipfizis.diuiditmsmhranate- 7e^/^5^a 
nuis: <^apro^ter,nonfempereandem.capUispanemÂoUryfidpa^^ -otsiiir.6 11- 
tîculatim vtvAmuis yalî^uaTido vero totum . Sed ^ 'Dmst in ipfim ^^^ * ' 
tendunt;ex^nmerfQ.corporemuît^^ tenues ; duaeve}*0£rajfc_y al- 
tera ah hepate , altera alieneze. Altera âb Jiac membrana te- 
nuis eft , Se mollis , quse cerebrum fuauiteratqueimnKdiate 
amplecticur , indequc pia mater nuncupata eft ^ qua: interio* 

Digitized by 



f es cere&ri receffus penetrâiis ^ in^ omnemp eius fubfîant?!^ 
venuîasarteriafque deducit ; cumque his lânguinem;, fpiritus^ 
& caîorem . Explicat demum. membranarum iilarum natu^ 
raîTiijs verbî-s • 

bfanaaoîŞ ^^^ ampîius Qzitm permanens poffquam fuent 

litrfrfănc v * g^i^^^%^i^<i'^rî^^ft • MartiarAisinamiotac. fo* 

i^CIqui. F^^^^^ îocum verf, 44. ^ explicat n©n amplius eaiidetM per.- 
manerey qiiia- ftâtim cormmpitur, denigracur,, & fun^um> 
emiâit: rade Hipp^.lib-. de vuuker. capit, £^i^^ nî^^ in- 
qnlty membrana draim cerehmm efl': ftatimemmaffeperforato^^'^^^^^'^ 
^ exeBc ,. ^de memhramx deîra^o , ipfamâenuăatam memlra,-- 
namptram quam dti^m^y ac ficcam facere oporUt y vt ne p vhi- 
ăd mukum îemţus humîdafit > ccmputrefiat y ac intumoremaî'- 
toUaîur: hîs enw^4îafepMhiSţe:^,^ulumefiipjQimţiitr^en . Ve- 
mm , et£ id nonitaicd eueaiat; haud tsmen mccffmnmcG: 2* 
cum fepe ccmtrarium coiuingat,. fi d<=bita adhibeatur cautio t 
Exquodicendumccnfemus vidneraî^îieâmpartem, & dif^ 
iectam.nonanipliHs eandciîipermaiiere^ hoceftj nou am- 
pUus coaîefcere; queuiadmodum e?capk.-îp.fec.5. FerfcBum 
^ > aut cartilaga , aut nemus ^ aatgen^ termis particula^autţr^^ 
ţîitnmt ,neqtie augeîuY'ymqm caalefat ; quod docuit etiam A* 
cer ) ipfajync^a mncait ^(^ offafuis diJpoUata memlranis. p ^âp^ 
r'anUn^ .. vbiaddit iliud;^/^^;^^^, indicans not^ coaîefcere y yt- 
dicitur, prima iiitenfîone > regenerată nimirumnoiTciogenea; 
fiibftantia; quamiiis fecundariaiacentionej&per fuMantiam 
Spermatic^ ^herqgeneam> quâliseft calîus> aut caro^.vniri paiîit . C^ . 

Dar.escuino vtique de ipermaticis omnibusirbtellî^eridum eil. Ciiius rci 
^^^ vari^ afieruntur caiif^ , feminalis videlicet materia defettus;. 
SăSl^r!" î^^î^^^î^ncisfacuîcads velcelîkio,. vel corruptio;. Seminalkni 
parcium fîccitas ; calorio paupertas y quioperationuamiiiuni 
natur^^um apifex eft, & caufa potiffi^a ;■ Vteri abfentia ;. 
X^ff partis debiikas t qju^ ramen amnia fecilinegotio refelE. 
poffe videatur:nam-redudacfemiî>alis>faagms^in costpore^quo 
^ermadc^ parces Eutriimcur 8c aug^ntur ; immd ex Gal. au- 

Digitized by 


tkc^katetenuiore^ veng & arteria? etiamregenemîîtorrQudd 

fi fatis eft ad nutririone m & augmefâtum , cur vnioni dilcii& fc^'^cal^ 

ipermaîiese partis iâtis effe non poterk ? Nequefacultascor- 

riipta eftjfifbrmaeademadkucremasctr quGdcIarins pa^ 

teţeo qiiia mcauo vîcere quotidie regeneratur caro , qu^ 

arreriolis compluribus veaulifq; propriam figuram habenti- 

bus 5 iniexta eft>quod abfq. dubio opus eft formatricis facul- 

catis . Necjue foia ficcitas fuSîcieîîs caula cft diceada ^ nam> 

ofla ii> pueris eţiam lîcca funt , cum ea qualitas ad offis con- 

flitutioncmnecefîarid requiratur, & tamen Galcui teftimo- 

nio d^mcthe c> 5>CQafcfcere p oflunt: qua e profeâofiifficienîem 

cdamealorem teftantur-Hmus ergo u^npoceinif rauoBem ncn 

modo ex diclis aliqua ez parte peteiadam arbitramux : vt etc* 

nim docet Gal, loco citato de fem. > iieque virtus cam vehe* 

îBens eft > quâm ia ipfo vtero ciîm fcems ge^eratur > neq; ma* 

teria eft adeo copioîi, vt iatis fit ad harum partium regenera» 

tionem; Vcrum infoper addendum cefemus languinis aiBuxu^ 

qui vbique p^^fto eft > & in natura fuppetias illico ad I^fani 

par tem accurrit y feminauun^: partium rcgenerationem^ ynio- 

Betnquc pr^uerJji ;-hic ^mm iacillimţe reficcatur,, deufaiurq;, 

in carnem^ calîiim > atque cicarriceni :: eoque veluc fBagî& 

prasfentarxeoysânaţup;^ ipermaticis regigaendis partibusex 

fcmiiiâUmaî§^:ia occafîo pr^eripitur^ 

XIIL Venx^mcmittanfeantadţ^atîeem per carnes venî^ 

venîctf rlâ^^tia^parte{tipercîlkclaudun£ur3^^& de^ 
fînunt^aii angdosdcuîorumt V^ aureHi â'vertke 
a<î naium jfertur^& ixi virâmqu^^ 

PAte!&(5iaAurkmjNarIum>OxuIorumqnc natura 5 iâm .., . _ 
venas-.illâs exponit ^ qu^^partibus ijfdem aîimcncum riadcv^i^ 
fuppeditant : Oua noftmodum occafîociede c^tens edam ^.^^tenisab 
Vems humanum corpus tamquarn fiumma irngarHibtis , ier- fcripîfcvfquc 
nionem iftituet • pe quarum natura ^ arigine , dC diftribucio- ^^;l^l 


Digitized by 


-jo mppQCRdTiszm^ i 

Bexoiifljicadmodiim,atq;incerteIocutusr£detur,£6fcJlkct,' i 

quod commentaria, quadevenis&i arterijs fe foipturum 
Gi!.coin. j. pollieeturlib. <ie artidiîis , jam vfque â Galeni «tate perie- ^«■'i^' 
S;fime "°^ ' "^^ ^^- ¥^ Jbidem annotat . NuUa etenim eft medici, * I 

l^rH^''' ^^ ^^^ ' ^"^"^ fummus hicSenex diligenter non excoluerit, '■ 

pS?r?diii^T "^^i i'^^'î^ Bafcentem adhuc, &ccunahulis €xceperit. Ana-. 
m^.ex. tKomica vero, qus quidcm ad medicum viiim neceflaria^ 
iuot^ adafteCtus nimirum di^nolcendos, prafagiendos , cu- 
faomn^ randofque , optime iîne dubio caHuit, yt cxplerifque «ius 
lEediciflam moEmncnnsjIjbnsvidelicet de articuL, de 6:z£t , de ofll 
fcftfS "^^''^^^«^^^^ <Jeloc. inhom.,aIijfqueîiuiusgeneris, certo. 
Kippocr. ccmuspacet. Aliquafortafseeum latuere^, qus- ad animi 
potius ornatum , vaîuptatemque ipeâant , quzque dili<yenti 
adiîiodura curiofaque inlpcciionepoft Jierophilum inuefli.. 
gauicpoflericas. Superabundantem fianc , atque fuperfiuam 
vf"!'J;m ^"^^°f"« Patera vocauît Gal. Iib. 2. auath. admin. , illam 
plici ordine vcro vtLem , Cxterum^ie venis triplici ordine Hippocrates 
egicHipp. ,egiffe videtur, pro triplici fcopo,quem.fibianimopropofue- 
rat j : nam m odo lîmplicem diuîitaxat earum liiftoriam de- 
fcribere intcnditj modoteaitudines docere, fecundum quas 
altera alteri conrefpondet, proindeque în i«edendo illas' re- 
fpicere opus eft, &iuxta <as fanguinis miffionem molirî* 
_Hiod6 deniquepcculiares aliguas venas explicareiiudet,qu«' 
păru aIicuipeculiariterinferuiun£alimentum,deferendo, aut 
incommodanc j dum fuperuacaneorumfluxibus iter apsrien- 
tes, moxboruai<aufaparticulaî iUi exiUunt. Veram vtique 
ac fimplicemiiiftoriam.defcribit Jib. de aHmento,germanam '""*^* 
ve» &c.„. J«"««^^î!ginem oftendens ijs verbis. Radicatio -vmanhn 
piexvenaru "JP^JŢ-Radicatio.artenanifn cor.ExhisaieuntmmmiafanPiâs; 

defoibarL'' ^ -^'"^f ,' ^^^^''^ ^ P^ ^^<^ ^^^ • ^Ramoium diuarica. 
abHippocr. 'tionem-delmeauits. epid. fee. 4. Jecsrariayinquiz.per km- 
. .^^..- ^ tosadmagnam'vfqueveruh'am.deorfim fertur, indeaue Aliauid 

: I2L i '^ J"-^ .^'"' *"^f ^ ' idnâeiuguîa nMt rhmcvero partmMcermccm» »■ 

,^X-...-..-. .^> P^?^2W^te»2£m, -qu^am^tUmirfemisţatitorefkxje.adver' 
, .r,, - i?4.>. ?^'^r^ 6^ "i?^^^^rîi«^«fV «^c. ;& off.-nat. y«îa' t^î^-? -„„.7. 
,:....-^y-^^^^:j>erJe^jimtranfHerfim ^hepar, fplenm , renes ad eoxendicem 


Digitized by 


COMMEîftARm 'îlLtSTRAfrS. 71 

cîtci Juram aiijummum pedem , altera autem excorâejuh alas, 

.- ^Icmkulas , iugula > caţut , nafum yfrmţmty iuxtâ âuresMmsros^ 
.âQrJţmyţeBHSiVmtremyp^cuhinim^ifC:, &Jib* de carn^ 
m^6. cauijjlma'oena ţtTx^entrem omnem tranfjtfi; per fipmmtranf' 
uerjîimy & în vîrum^tiermem finditur» & in himUs fnditur ^ 
(^ emlit turn în alias partes 5 turn in crus ^îrumque. Sed ^Juprâ 
in capHtaJcmdit , ^ in temponhis. jinâitur vtrimMc^ if£^ Infi« 
ciaritamen nonpoţeft^qum& circa hariim venarum origi- 
lîem > &: ckcâ diuaricationem interdum h^âimcxit > variufq; 
^ estiterit;quodindeprocuIdubiofaOiumcft^quddrudisad- 
hiîc > & in ipromet cxordio effet fccandi ars : vnde citaro lih. ^^^^^pr^,:^ 
de carn» acorde originem ducere afleruit> inquiens^ Du^ de ve£is â 
Jîint coMcC ^m<^acprdây alţeri nomm eji artma^ alteri 'vena. ^^T^h^^' 
caua 3 m^tâ' qtdm cor Jttum halet, & plus hahet caliâi arteria ^ matuara eft, 
fententiam, vcnoa penimsimţ^robabilemj feciitus deinde part.jib.2, 
eft Ariitoteles , & mordicus tuencur Peripatetici fere omnes:. 5 .de h.i&^, Sc 
»u,i7, Etiib. de ©0- nat. Vm^ per corpus diffiife Jpîritnm , -^fluxu ^ ^'^' • 
acmotumexhilmî^ih^vnawTilt^gerrninanîest atqueh^c vna 
vnde oriaîur » ^ "phi djejinat non Jcio : circula enim falÎQ pTinci-^' 
fiumnm inueniţur,. S^tetimt rami^ ac germina ipfius vndhpen- 
deanţ , ^ qm corporis parte dejinant p iţ qiiod vna his confintit > 
^inq%iluslociscorporis e^tentit fiint yeg(>decl^ 
pocraţcs. Quam vero ambiguitatem magna ex parte eua- 
cuât^m fuifle cenfendum eft di<3o libro > quem veiiis fe fe di- .. 
caturum pollicetur » Venarum vero reCticudines profeqiiitur nZ^z- 
lib* denat. homo^bi quatuor venarum paria â cer^bro deor- ^^^^^^' 
fumadpe^^şvfque defcendentia proponumur îqiiamuisea ^cofenius 
p^^ad#:itîa> nee Hippocratisgermana afleratur a Galeno in ^^^'^^pp^c* 
ciufdem libri commentario ^ & 6. de decret. Hippoc.& Plat^ 
cap.a. vbi Pelopis prsecepţoris opinioiiem refeHit^ exiftiman^ 
tis vaforum omnium originem cerebrumeffe.¥erum ide ha^ 
jiu.ji* jj^^uj. ctiam ofl»naro& alibi, proindequegenuina Hip- 
pocraţis fenteatia dicenda cft>qua non Ytique nouam venaru 
originem docere profitetur , cum âb Hepate omncs emanare 
alias afleruerit ^oimiefqs in vnico trunco coaleicere, led que^ 


Digitized by 


^am defcribk confen&m & r€iSi:itu4mem > quam fupejăoi^es 

. qu^piâm ven^ cam mfcriorxbus quibufdam , pecuîiari qua- 

. dam ratione y habent :, fiue fii>ramm fiue vaforum t quse qux- 

demcogniciopemeccflaria^ft^ atque niîiffitîia in veaarum 

fcctionibus ad morbos turn curandas 3 mm prsecauendos : vt 

Jtice clarius apparet ex loc» cic de nar. hom.vhi lic loquimr * 

Vm^Jrafft£im^J7c fehăbmt. Quatmr paria ipptrum fimt in ^^^^* 

*,CQrforâ; iţ^ntim^Midemâ copite retro per cernisem forinJcQm ' 

-ai^traqus Jpmt parte ad coxenâices ;, ^ in crurappogreditur: 

.ădnde perjurm ^ maileohs firmfecus adpedes perumit:aportet 

-igiîur vm<tfeBiQnes in JoIarihiS dorfii^ c^xendicmndepopliti-' 

. ius facere , ^Js malleolis forinfecus . Alterum^far^ <^c,S\xhâit 

. auceminfine, Ven^igiturjiEiicmeşiupctdfr^diBumfermomm 

facere oportet .' Enitendtm^ ^^''^" 

■ fme â locis faciamus ^vU dohres ficri\ i; fan^is cpUigi f^!et:fc 
enimmiitationmime'njagna derâpmtefiet^^^ccnjuâtudinem re-' 
mcmeUt»i)tnonampJiusineiindmtlocmn:coUigatî^P^^. Quod 
autem nou ea flierit Hippocrads opinie , vt crcdideric qua- 
tuoxiîîa venarumcopiiigiâ id â capite ad pedesdelcne<lcre^ 
Vt akerum âbakero feoriim diftinâo itiHcre feraiur , neque 
vno 5 pn^cipiioq; inftipiteiuxtâhepar vni^nvaXy patet ex li- 
Dt'fcriptio ^™ ^^^ ^" Toc. in bom, vbi defcribcns Hipp/fecundum ve* 
^c^icujiinis narum par ^ 9iC habcc . Aliac du^ vendc d verticc iuxtd aures ah 
^ -i'cnara ţ\^£ ^^^^^y^-colH parte ^trimque ad cauam appellatam venamferun^ 
^"^"^^^ ^^^^ ; ^^^^ atitem fmtnr âuiddm velut mia ; cmftfîit aidem inter 
câ-. . gtuam Q pcUtiT yjuie artenam > j&rtt^qtie per fiptum trănjiier^ 

dijparationes inf^morilus facit, if ad tilias intîts fertMraâmaW 
leşios. H<€^inficundum faciunt hominem cum fnevint feB^j'^ 
Ybi v^ides hune venarunaprocefllim â câpite adpedcs per me-» 
diain cauam deducer-e . Fatenduna ergceftnon nifire<âitu^ 
dinem refpexiffe> quam âb efîedu losga obferuatione di* 
dicerat . Qua? TOque cogmtio tanti facienda eft ^ rt noti ' 
aka forcafee vtilioc de venis hab^ri polîît,taHt3im abeii , vt ' 
pccuUâres ^^^ ^^^fc^ptiofalfa, &âfecaadi imperitia, vt- aliquibus vi- 
veni vbi fumeft, originem duxerit . Peculiares deniiim venas , qua? 
fbKi^r. P^^i 23icui peculiariterinferuium, vplniorbosquan^c^e^' 


Digitized by 



affcrunt, cxa6î:e oftendic turn alibi^ turn in propofîto contcs- 
tu > vbi iuc^ularium venarum diuaricâtioî? es in ieniuum orga- 
na > cercfariq; membranaSsquas fuprâ dcicripferat , proponir» 
Etquamuiscasitâ dcicribat , ac fi â vertice originem duce^ 
rcnt , qucdfecit etiam lib. de oiT* nat, inquiens . în cerslnm, 
^^ ^7. iut^ta commijjuras mult^ îenues vm^e radices egemnt , ir circa to ^ 
turn caput extenfe funt vplmăâ fronîem&îempm . Quaia 
re cxtra apparcntem illarum venarum procefTum videtur fe^ 
cutus; verendumtamen noneft , quin cas veng caiişpropa^ 
crincs elîe cenfueric, dum dicît vcnas tranfîre ad verticcm per 
caraes venientes ad officulum : nam afccndens caug truncus , Caus afcc- 
poftquam per fepmmtraofucrfum fecundumipiGam fuprâ fcr^^^^ 
clauiculasrquas officiili nomine hic defignari cenfendum eft: ^^piom 
diminutiua enim appellatiene ciauiculas ^ turculaS;, inguja eas v^ccrm aj^ 
fempcrappellarîin more fuit) emerferit, in fuperdimos ra- %po^;. 
mos > dexorum videlicet ^ & {imftrum dirimitur, â quibiis dug 
vtrimque propagines fursiim versiis eleuantur , imer nf iugu- 
kres nuacupatş • Externf igitur hse iugulares per ceruicis îa-. 
tera inter carnofam menabranam , & aattm ad vercicem fe- 
nintur> feditâ, vt tam dextera exterior ,quâm finiiira y vbi ad 
feuces deuencrint, induas findantur partes , quarum altera 
ilibauris tadiceintus penetransjifilaringis mufculos^ hyoiw 
dis i & lingug , vnaquf qu€ in fua regione diftribuitur ; altera 
vero facicm versits fub cute perreptans ^ in labia vtraque ^ &c 
pinnas narium furculos emittit > indeque per interiorem oculi 
anguîumjnafiqueradicemsvbi fupcrciliavniuntur, fursiim 
repens , in fronte ramus vterque 5 dexter fcilicet &c finiiier^fi*- 
mul coeunr , ¥enamque frontis efEciunt > qug demum in ver- 
tice abfamitur . Ex qua externarum iugularium delineationc 
facile cuique eft inteiiigere de quibus venis inprr^fenti ccn- 
textuloquaturHippocrates^ dummodo foîum ordinemin- 
iiertamus . At interng iugulares m caluarig baiî intus ad du- 
ram matrem penetrantes , &per eam diffeminat^, in eius fi- 
nus fanguinem , ad lomm îrrigandum cerebrum^, copiose ef« 
fundunt. Id ramen apud Anachomicos diîFuse magis lidere 
fas eft, cumnobis eatantum dicendi , quf ad textum dilu- 
cidandum perneceflTaria videntur^ munus incumbat. 

K AIi« 


Digitized by 



jQ^ AIî^ vero dua? v^nx îuxrâ tempora feruntur în roe- 
dîo temporum & aurium , qu^e premunt oculos ^ & 
femper puîfant : folx enim hse fanguîne non rigantur , 
fcd auerritur ex ipCis fanguis , Quî autem aacrtitur ; 
influenţi occurrir r & qui quidem auertîrur , vclens 
difcedere 5 qui vero fuperxiSE inflQÎtj vol.ens infră pro- 
cedere > hîc impelîuncur ^ ac difîunduntur, ac mutuo 
circumagitantur 3 & puîfum venisexhibeiu. 

T N î^or^ fuit Hîppocrati , c^eterifque v^eruftiiîimisMedicis 

comitic ar* _ _ 

wriâscnam, J^ eodcm ^Xft ^«'f - hoc cft , vciiarum no mine , vafa omnia 
lig^a^cHij! corpus irriganua defigaare , venas fcilket ( fanguifluaş pr^- 
^s Tm?-^ ^^P"^ ^ ^ arterias, uim eciam heruos , vc aurfioritatibus.eom^ 
Medic: . ^ pJuribus probac foefius in oecon * Vnde lib. de nar. olT. pluries 

cicâto , Ven^^^ inquit Hip, per corpus diffiifejpiritum, ^fluxim^ «^ . ^^- 
^ motum exhihmt , ah vna mult^gcrminantes ^c. Ât fpiricus , 
vicales nempc , nan nifi per artetias > fiuxus , feu ftuenţes hu-.; 
morcs, p^er venasv motuiîx ? feumociuamfaculcaîem,, per 
neruos in corpu^s vniuerfiim dcferri , certiffiaium eft * Sic pa- 
riccr & lib. ck.câru. iHt^jlmt cau^-^m^^â corde^ alteri nommeff: ^^^*^' 
arterîa y.ahm vcro vena cana* d'c.vbî venasiîmiliter vocat 
îieruos opticos > qui a cerebri membrana in oculos defeca- 
dunt : quo ctiaîxi paclo Arteriam , ( quam Plinius femitani 
fpiritus dixit) Arabejs ncrumn puUaţHexni Auicennas audacem 
venatn >. Hippocrates demiim micani:em::» ycr puîiântem ap-- 
pellaraaţ, Idipfum apparetin propofîtotexiu, in quoâib 
venarum nomine arteri^ proponuncur^ carotidum propa- 
gines,pertempora,hincinde altera > perrepcantes, mican- 
telque, quas ocuîos premere dixit, eo quod calidas interduni, 
Temporum ^crcfque flluxiones deducanr,ocuIifque morbos panantj qui^ 
Jf^^r^?; busnonaptiusQCcurres, quamharum arteriarum feclione, 

•-«"tur Ovu« fi. *fy * . # , 

ios premere. vitioncuehuxumHKercipiens> VEdocetFernel.lib. 2. medi. 
Carotîsartc ^^^* f^^Pv i8. & HQS infrâ vidcbimustext. 12. &c 16. Iib. 2. 
ria vade di. C^^o^^ ctenim , fîc didta â caro, hoc eft, graui fomno^ quem 
^* inuchic , iiiutercipiatiir y denegacp aditu vitalibus ipnitibus^ 


Digitized by 



quUnîmaîium funt materia . ) cum interna iuguîâri vena fur^ Orotîdi* 
fum afcendens , antequam caluariam ingrediatur, varios tran- ancri^ di! 
fmiait furculos ad proximas partes , laringem , hyoidis mu- ^^^P«^* 
fculos y inferiorem maxiîlam , mentum , labia > mammillares 
proceffus , & vicinos mufculos; ac demum ad mufcuîos tem- 
porales , qui ramuli pulfanres ibi clare confpiciuntur • Calua- 
riam vero ingreflfa per foramcn inter fphenoidem » & os tem-* 
poris fitum ^ ad duram membranam afcendit > effeâoque îi> 
numeris propaginibus mirabili pîcxu , alciuspet^ns, duram 
perforat membranam , & non modo ^d eadem t^empara fe ie 
cxtcndit j^eriim ad ocuîos eclam > euxufque mufculos : atquc 
hinc temperam arteri^ premunt ocuîos , aut quod iuxcâ eos 
fint , aut quod, vt dîximus, per eas non rarocalidas infeftafq. " 
fufcipiunt fluxlones . Has pr^tercâ venas perpctuo puifate 
aiTerit Hippocrates eo quia h^ fote fanguîne non îrrigantur , Tempomm 
fcd quîdam languînîs velut fiuxus & refluxus în ijs contingîr , ^l^^^^ţS^ 
quipuîfationem efficic: Quam vtique aflertionem non de pcmo^uisit 
venishifceindiuidualiterpronunciatam putandumeft; veri- j^^^^ **^^ 
tatinamque maxime refragaretur, cum în quauîs corporis 
perte pulfatio percipîatur , fcd generice, vnum fcilicet hoc ve. 
narum genusfanguinenonirrigari. Dixic nonirrigarî^ tion Arterîcquo- 
quod nulîus in iJs fanguis comineatur: nam, & iî craflb veno- ^^^^^^^^^^^^^ 
foque careat, certum tamen eft tenuem ac fpirituofum incfTe^ jionixrigari- 
qucmadmodum optimis ratîonibus integro libelîo probauic 
Galenus aduerfus Erafiftrateos ; fenfuque ipfopalam eft > iî 
vense illa? pertundantur , fanguinem iîlicoy atque fubfultim 
effluere ; Qoiinîmmo iî ex mutua aduenientis , difcedentifc[ue 
fanguinis circumagîtatîone puîfum oriri inhoc textu afleri- 
tur , cerce fanguinem in ipiîs aliquo pado contîneri fateniium 
eft . At non irrigancur , non expedite aîluuntur, feu non libere 
peripfas permeat fanguis ^ kă vaporofus pîurimaque aerea 
fubftantia intermîxtus ac fra6tus cum fit, âbipfîs vaporibus 
intercipitur, rctroque pellitur exasftuans , indeque in oduc^ 
nîentem alium impingit ^ perpettmmquc procreat puliationis 
®"* ^3* motum. Idem flati/vbi fîc kgitur. Smguinis tron" 
fîtus în capite mama anpiflia coarBantur , reţfeti mhnfimt fnulto 
aht i cîihis aiundanîid ^ condufo dolorem excitat in capite;}^* 

Digitized by 



guîs mîmiţje natură calidus exifiens , vicoaFius ţer angu^m 
■xnam trayifîre cekrrime nonjpotefi , cum multaimţeâimento fmt 
cpa(^la<t ofţilationes: qiiafrop^etiamţu^^ 
pora : Hanc fentcntiam videtur quoquo pa6lo mucuatus Ari- 
ftoteîeslib. 5. de hift. an. cap, 19. Palpitat /mquit intravenos 
fanguis omrâum animalmm , ţulfuquejimul vndrqîie monetur : fo^ 
iufyuemnhm htmorumfţarfzisţertotumcorţus animaliumejis, 
&femţerquamâiîivîtaferuatur,^^^ i^feruet, 

& lib. de refpin cap. 1 5. j» corde femper 'accedentis hmnidi e^ 
alimente per cdiditatem fumefaBiofacit pulfv^m ehuantis primam 
îurdcam cordis , & hocfemperfit continue : Affluit enimfemperhu-* 
midum.ex quofitfanguis natura hc & inî^LEt pulfant ven^. om- 
nes r âfimiil inuicem prcptereâ quodpendent omnes â corde. Moueţ 
autm femper ; quare ^ ilUfemper, ^ inuicem fimul , quofndo 
mpuet . Kefîlitio igitur efifaBa ohuiatio adfriggidi compulfionem \ 
îaîrus arte FulfatîO aiitem hmidi cdefaBiinflatio . Veriim auairuis h^c 
caufa. langumis efterueicenm poffit aliquo paftopulilim auc^ere, 
haud camen poffe eius caufam effe efScientem atque potiffi- 
mam, fatis pacet ex muariato ordine ^ codemque^ quemin 
maioribus minoribufque arterijs eode tempore confpicimus^ 
cum tatnen maiorem prope cor eireruefceiKiam & in maiorx- 
busarterijs effe^rationâbile fît.Sedquis cântam pulius ^^^^^ 
bilicacem vni ebullitiofli^in qua nimiru vaporoia humidis tam 
fatue circumuoîutantur y acceptam xcfa:zt?ArteriarupulfuSy 
Jr^i^ft"' iaq^i^ PlmJncacumine maxime memlrorum euidens . index fe- 
3j. prop^ remorbomm ,mmodtttos cerîoş , Ugepiue meţricas per States fla^ 
£Qcin . iii^ ^ ^^^ţ citatus mt îardus, defcriptusâh HerophiJo medicina K4- 
te miranda arte nimiampropterfiihtilitatem deferto, Ohferuations 
tamencrebriiautlanguidi iHus gulemaculavit^ temperat %c* 
Hinc dilîeft, quod Galenus opinionem hanc enellit, iîiuftri» 
que exemplo eiusimprobabilicatcm patefecic libeJlo, cuiti* 
tulus eft. An fanguis inarterijs contineatur cap. 8. Nam Ci 
quis arteriam magnam quampiam confpicuamqne fecundam 
longitudinem fcindat 3 mox calamum concauum ac pcmium 
in foramen intrudat ; itâut vulncri aptetur , neque fanguis exi- 
îire poffit s tune pulfabic vcique artcria . At fî filo circundata , 
ac iilaqucat^ circa inclufum calamum conftringas 5 etfi fan- 

Digitized by 


guîs âtque fpîritus per calami concauum libert cxcurrcrc 
qiieat, vltrâ laqueum tamen illico non amplius puliam vi» 
debis . Ex quo perfpicuum phiie fic^ non 6b fpirimm in con- 
cauitaubus difcurrentcm, fed obpulfatiîem virtutemintu- . 
nicas tranimifiain ^ anerias â cprdc moueri . 

XX. Vi(us hiimore de cerebro nutritur • Cum au tem 
quîd eiiis de venîs acceperit, fluxîcne turbaţur^j & 
humor îpfenonapparec ; & 6b pcolos moueri ipfi vi- 
derirur 5 aîiquaodo velut auiculariirn îmagines , 
aîiquando velut lentesnîgrae.5 &nihil exaâe iuxtă 
reivcdtatero vidcrepoteft. .... :^ 

VEîiamm occafîone, quibus oculos premî înterdilm > 
^maleque haberi iam dixerat yăocct nune obiter ociilo^ 
rum promptitudinem ad patiendum 5 qnotiefciîn que aliquid 
prsEter naturamâb ijsreceperint : idque Ypochyfîs > icuin- ;.. 

choatse lufFuiionis exemplo . Nos vero fuprâ in commen- 
ţario tcxtus 4&riîpiquarti docuimiis , vt nam vifus ^ im^ ocu- ociiius hu* 
hiş y vifionis iftrumentum , humore nutriatur de ccrebro pil- morepuiii^ 
riflimp > exiugulâriţius vidclicet , quse ramulos per ccrebri uimr / 
mcmbrahas adJpfos extendunr ^ pr^terarterias^ quasâ care- 
ţi dibusexcipiuntt Exijsergo naturaîemcomrheatum pro» 
îd<Sâc . Kt {\ per eafdemivenas aliquid , quodcerebri ^pro|^î^ 
iim lît j vt eius fuperuacanea &.purgamenca acceperir^ âb hac 
ftatim iji^ipne ţurbatur , nou eadem claritate profpiciensj 
neque illapfus hic & cxcrementitius humor , tenuis adhiic &c 
paucus cxiftens ^ confpicitur , fed yitiata camtumodo viiîcne, 
varia prioculîs fpeâ:rafair6 obuexfari videntur. Cum nani- 
que nitidiiîîmi fînt ocuîijomnis^quâuis leuis occal:0:^eos tur- 
bare potis eft: immo in elata corporis^ parte -Idcad , cere- 
broque fubiecSi,omne;fluxionumgenus perpeti polfunt, 
fanguinis, bilisvtriufque, pituitse'> aquo&humoris* vapo- 
rifque, turn ab inferiori -corpore , tum â^^te per neruos.> 
per artcrias, per venas^ per cerebri membranas, ac peripfum 
denique pcricraninm> coaceruaco quaadoquehumore in lyn-» 
- - " ' "~ cipite 

Digitized by 



cipite {uh cute extrâ cîauam : ex quo coc in ijs fieri poflTuiit 

SfxSkaoais morbi j ^uoc tex. idllibri Kuius receniiuimus • Hic tamen 

initimn. quoddam defcribkur symptoma^ quod in vcxx fufFufîonis 

iniuo> dum quid prseternacuram inter pupillam & corneam 

i]îâbiturâcapite;qiiodtenueacdiuuîiuminitio cum fity vi* 

fiua iîîi occurrens facukas> variarum rerum fimulacra offerun-. 

Cur vanaru ^^j. j^ pariter cojaţiiigere foîct;, cum praui humores în ven- 

UcraocuHstricuIo dctanentur, vcl ahqua immmet cnlis^hemorrnagia 

p^tTrSm.! î^empe, vel vomitus ia cardiogmo> varijs fubîacis vaporibus 

raiem offe- ad caput Sc oculos , qui ante cryftaîlinum obuerfantesy îma- 

ranmz. gi^atiuam decipiunt ^ variaque veî animalcula ^ vel alias tenc- 

bricofas imagines rcprasfentant : ob fuffufi enim humorîs 

opacitatem mgra omnia plenimq; vifiintur s abfque eo quo4 - 

ift oculis aliquid adhiîc appareac : Quod ijs potiflimum cori- 

cingit, qui puriffimumbabent cryftaîlinum:, vifîuamquefa* 

cukatcm perfpicajTimamritâ vt minima quasquc cernere ppf. 

-. - iîc, vtdocetGaLi* deloc, a£ capa. Sedquoniâm de fluxio? 

nhV* lubushispîurainfudiaunfiimusih^^^ - 

XXL Allzâux vcn^ în tnedîo aurium> S^aKarum ve* 
narum, qu^feruntur ad aures^ AhV du^ ven^ ex of- 
fis concluiîone în aurcs fbuntur . Qu^^am vem în- 
frâad corpus conuertuntur. I>u^ q^id^^ ^^^^ îuxcâ 
46îKÎinc5<:oliifeEuntur,& uifta verticulâ^ Sc defînunţ 
in renes : h^ zMcmmsm in teftes penetrant . Et 
cum hx afifect^ fuefînt ^ homo languînem yîngit . 
Allx duse vense â verticead humerosferunturs &iâne 
liumerales vocantur . AÎ^ du^ uen^ âuertke îuxtă 
aures aH exrerîope collif arteutrîncjiie ad ^cauam ap- 

PEr^t ajpK>crates-vaî^ 
diuaricatio^s :> ;tum fub4^4j^m ramonim propa^nes , 
quas mfrâ claniculami £ţ emiSunt ; idque eo plane ordine ^ 
jqiiem %y:a c i8. înm^naus^ reţrog:s^do jcil^ in vej^. 

. ticcm 

Digitized by 



tîcem radiccs egerint , & inde quaquc versiJs e^eii& exi- 
ftant j Qucd vt commodius perei pere pofîimus, fuDcI^uium 
ramorum germanum prcceflum recenfere opera? pretium 
erit * Poftquam igitur afcendens caiia ad clauiculas deuenit^in ^^*^P^** 
duos mfignes finditur lamos, quorum alcer ad dexreram^altcj: dauicalS^! 
adiiaifţrani axiilâm defertur^ dicuşţiirquefubclaujj . Exhis 
xamis non îonge â iugyîo , priufquam e thorace exnergant ,. 
qxiiaque tiuticanX: yeu^ , MamiXiaria iiempe>q^^P<^t interna 
fterrii regione deduda^ramulos ad thcracis muîculos ^ & mi* 
mas trâfmictit. TBymica^quâî in thymum,gîand£niagGâ pul- 
iiinaris inftar cause in iugulo ad os fummum peâoris lubftrara 
neâb offisduritrelkdatur, diuâriGauones vere fukiantur y & 
HI inţerrepiences fîiembranas diftrîbuitur . Capiuîaris^qu^ in 
cordis capfulam .; Ceruiculis , qu^ obiirque iuraim per cer-^ 
uiclsiatera iuxta yertcbras ad 'cerebrum.aicendit . Muicula 
denique, quse in mufculos rachy tas ceruicis , & funi mi thora*; 
cis difperdiair • Hisquiaqueemiiîisvenisrami iîli lubdauij. 
cxtrârhoracemfuper dauiculaseleuantur:» & vterque duas 
tune fphagitidcs 3 hoc eft , iuguîares Runcupatas veîiasy inter- 
nam v:îdelicţt;.' & externam productmt . Externa quidem iu*, 
gukris>x|iiaîinb3^is;îiiaior eft^ inlijomiiie minor speriate* 
raoefophagi ad fauces afcendit ^ vbi in duas dirimitur paxw — 

tes^ vtfuprâ-ctianiaic&meft, quarum altera mtuspenetrăs, 
per m^fcuk^s teyngis y hyoidis off^ 1 & 
alc>erayerp exteriori parte i'ubcutemfertur adfaciem> & pr^e- 
ter ramuin illumo qui per interiprem oculi angulum traniiesat: 
cumralia akentîş lateris in fronreyniri afleruimiis^al^runi ra*: 
ma adtempora 3^ alteram adpofteriorernAum tranf. ^ 

i^ictit * lnterna,autenîiugularis per ktera tra^he^e ad dxiram \ 
memngem eleuatur, yarios in iţinere furculos ad proximas 
partes cmi^ens: ac dum ad caput deuenerit^ ipia p<iriter in 
duos finditur ramos ^ quorum maior pars cranij foramen, per 
quodfextum nert^orumpar egreditur, add^rf meningişiî- 
nus afcendit i maior vero caluariam ingreditur per foramen 
apud exitum tertij &: quarti neîjuorumrp^aris conflitutum; & 
priufquam per duram matrcm diftribuatur^ fuiculum emi- 
Ctitad auriş cauitatem per foxam^aiA oflibu^ţemporum.His 

Digitized by 


îo mvvocRATis iLiB. J. ps LOC. m nom: 

îcaexpUcatis facile erit ramos omncs âb Hippocrate hîc prc^ 
pofitos inteUigere : vc 

Alm ă u^e veaae vtrîn^ue fdlîcet vnă , în medîo au rîam 

& alîartim venarum vq«^ fe^«nîur ad aures, &c 
hoc eft j poft aures ; âb exccrno videlicec exeerioris iugulans 
ramo 3 quse ante quam per internum oculi angulum ad froa- 
tem afcendat,. furculum ad aures trâiifmiaere diximiis, & 

premmt aures vel quia iuxta aurcs funr^veî quia per has quan-» 
doqueaurifaus laborarecontingit* 

.A\i^ă\x^vm^3^^?^'^!^^^^^^ eKofsîscon- 

. - hx funt internat fingiilark 

Clufîone îa aures terUtUUr • ^^-^p^ig^j^es â minori ramo 
prodeuntes,qiîe perforamcnin offibus temporum iuxtâ con. 
durioiiem,riue/uturam;ritmn adaurîs camtatemtranfmiete^ 
î^docuimus .priufquamiîid'urammatremdifpergattîr. 
quaedam vero înfrâ ad corpus contiertuntur* 

&a m â iiibcîaiiijs ramis mamarîa^ tîîymîcaa&: capfuîarîs exo-^ 
r mntiîi>quas:infra ad thoracem verti iam fuprâ explicuimus^ 

Qu» qiiidem yen» xuxtâ tendînes colii ferutîtur^&c* 

h^iunt vense <:€ruiciles, qua*âfubclauijsgermîîîantes,ob- 

Hque ad eeruicis latcra iuxta vertebras in cerebrum cxcurrcrc 

diximus . QiiodaucemKs defin^atintenes, &penetr€nt m 

teftes jîîcm beBe couuenit cum anathomicia hiftoria^ qualuce 

■cîarius appar^t nullam â fuperioribiîs parcibtjs v^nam ad infe- 

riora de&rri, nifî media catia • At bie Hippocrares reSitudi* 

nem refpexft -&-confen&m ,<5ui inter ceruiccm & renesin- 

tercedit pcr^&m fpiBami€ui«fpondet qu^dam reCta- ipfaru 

ceruicalium x:ontiniiitas cum trunco caiise ascendente > qui 

cum defcendente iustâ hepar coniuiigitur,€ quo emuîgentes 

vense emergunc, fertmturquc adreiies, & per has ferofus fan- 

guiseodelegatur, vt ckre expofuit Hip.lif>. de oCnat . Ex 

finiftra autem emulgenteipermaricavenain finiftţum teftemi 

excurrit ; quamuis dexteri lateris fpexmatica noa âdextra 


Digitized by 



€muJ^ete>led âb ipfomet trunco defcendencis cauae originem 

. crahac : proindeque iemen in dcxtero refte calidius > fp^riţuo 
-fius, acmaribusgignendis magis aptmngigni ceftiseăidcm 

£iu.iS^L Hipp. tiim iilf). de iuperie(Sar, per jh^c verba . firvhmarcm ^^;'^^;t; 
generare vohierityfnenjihus dejinentihrs 3 aut defeFns mijceâtur , o* rcrur c? qao 
^ ,^i^4?72 ptdîif^me intrudadonk âef^dat^ VU verofiemellamgenc'^ '^^^J^^ ^'^' 
rare volet , cumţlurimi metijQs prodierint mulieri > if â'hni adhuc 
eunt ^ cotai > ac dextrum teftem oUiget » ^uantiim id tolerare pot c- 
rit , c[uod mflici in hrutis epferiuntur . Se,dfi marem gmerare e» 
ţeBat^ftniflcrteftisohliganduserit . turn ia epideniifs . rlirci^ 6:}ipid.icc. 
re inci^ims ^jiqvtidhn dexţer tejiis inttmtefcatp marem ^(îjmiiiâr > "^'^^ ^'*'^"- 
foeminam gen^i^ahit. Quam certe ibcietatem & recîicadinem 
in cnfîbusfortaffe obferuaueritjquas ccmoiode mouere iolct 
natura âfFeCto£apite:nam vcipfemcc memorig prodidiî:}ib.2. ^^^^_ ^^^^ 
de moxh. MuItHm^nn<£ emi^itur -vhi caţiitflurirmimincahie fact/rsuTri 
ritdiquefcifenim in iţfoţitidîăyiiqîiefcens mttem fecedSî ţarîim aâ "^^^^^^.^ 
naresy ţartim ad os 3 panim ad venas 5 ^2^^^ ducunt ad pidmĂtim : 
cum autem ad ţeruenerit y mingit homo , îy patiUir 

Ci^*n- quemadmodumaht>rinceflillîcidio.SciihAcMuh.âixt. Onihis- 
cunquemorUdcerehr^ fant ; torţorţrimum cafut occi4pat^ ^ 
fre^uenter mingit ^ger , d? reliqua velut in vrin^ JiiUicidio perpe- 
titur, Renes namque demandatum humorem per vreteres ad 
veiicam tranimittunt ^ qiii vel qiiantirate , vel qiialirate mo- 
îcftus jfeqiîentiirii^icneabexpuliîuaeijdcur. Cum vero ^f^|^^'^ 
vens ift^ emuîgentes mâlc aiFeCte flierinr > apertse nimirum, de» 
riipi^ , aut cxefse â nimio 5 autbiliofo fanguine , icalculo, vei 
violento ictu ; in reiium cauitatem ianguiaem eifundunc .^ qui 
vna cum fero ad veiîcam deducitur , atque homo demiim 
tune fancruinem mingit. Cruem^ huius miiTtionis mcminit 
2* & 3 . de morb. in pleuritidc doriaJi^ Se lib. ^. ex nimiaple- iib.2.iiu.4o, 
tora fanguinem, per aluum aut vellcam efjfiueie magno eoni- ['^^^'^^.'j^^' 
modo afierit* 

Ali?e GU^ ven^ â vertîce ad humeros feruntur^&w 

Vena humeraîîs , qu^e vulgo cephalica & externa dicitur^eo ' 
quod in morbis capitis speriatur , &:per humeriinii brachijq; 
cxteriora perreptct , inter dekoidem 5 Se peâoralis tendinem 

J^ cxten- 

Digitized by 



extenfa , in Canibus ab externa iuguîari originem duciţ, pro* 
Anatnmi- i^^'^^q^ ^^ ijs â vcrtice videtur proccdere : vnde obiter non le- 
"" k^L^cui' ^ ^^^^'^ ftifpicio Hippocratis guo Anatomicam in hrmis ple- 
ii^^it^ fumqi celebrări confiieuifle . At inhomine âb axiJian dcâu^ 
S!!''^^ ^^^^^* Humeraîis huius memionem parirer 
oflC nac,^ vbi exteriorem iugularem dcfcribens , h^c habct . 
Ipfa mthn crajfa per clatdmlam defcendit fith fiapulas , ^ hac 
parte âh ipfa germinat pe^-neruum fihter fumm^m humen par^ 
îem.Jiuecuticulam, vmahtimeralis appellata: ipfa aut em fanguî-^ 
fina ejî, &fanguineplem, & ^gri curativ fmmpatury aut conuek 
lătur ; âb altera enim parte nerms latus ipfam amhit , âh akera 
cctrtilâgo . vbi etiam^notandum cft externam iuguiarem craC 
fam appellaffe , quaiî akera interiori maior fit ; ciim tamcn id 
yerum reperiacur in brutis,n6 in homine>in quo multo maior 
interior eft , vtpotc cerebrum alirura, quod maxime abundat 
in ipfo homine : ac proinde fufpicionem confirmat in brutis 
fedtionera magna ex parte ab Hippocrate exercitam fuiife» 

Ali^duaevense avertîci^îuxtâaures.&c.r'^^ ^^^^ 

B-enefecun- lunt IligU- 

diya auies . lares exteriores , quarum ramum ad aures peruenire diximus • 
Docet ergo earum progreflum in collo ^ m anteriore videli- 
cet parte vtrimque per iatera csfophagi 3 & infertionein in 
alcendentcmcâuam fubclauiculls. Procedit autem eodem 
inuerfo ordine a fyacipite , vbi ei us extremiares diŞergun- 
tur 3 ad cauam , \xiAt hs iugulares emergunt ^ vţ fuprâ cxpli* 
caţumfiiit . ^ ^ 

XXII. Caua autem vena fînitur quidem veîur guîa , con- 
Mk autem inter gulam & guttur ,fîue arteriam 5 fer- 
turq; per %:u trânfuerium,& per Cor,& inrerfepîu, 
& findîtur ad inguina ^ & adfemora intro , & difpa- 
ratîone;iniemoribds facitj&adtibiasintus fertur 
ad malîeolos^Hs înfoecunduna faciunt hominem cum 
fueriac fed^, & m magnos digiios delînunt . 

^Ergit cxplicaîjdoproceiTum, vel potius reaitudinem, 
cirumvenarimi, quasfecimdum aures eflfe dixir, per 



Digitized by 



cofpom4ongitudinem adpedes viqucSc magnos digito$ ; 
xcă , vt toties repe titum eft > media veisa caua > in qnz cţno 
certiusfcimus venas omnes vniri; itâ tameii,vt quandam fcm- 
per reâitudincm & analogiam inter fe conferuenr, ob quam 
ven^ quxpiam iliperiores cum inferioribus quibufdam pecu- 
liarem ineant fociecatcm > icavtiîquidinipiisredundet> id 
iîbiinuicem facilii me tranfmittant : Qui 6ne modusvenas 
dcfcribendi, vtHippocrati famiîiariflimus fuit ; itâ cseteris 
Mcdicis eft fere i ncognitus, muldfque improbarus; inique ta- venarain 
mcn cum ingecis nt vcilitatis, & apprime in medicina agenda ^^^^ ^ 
lîcceflarius 5 quando fecundam hanc venarum focietaccm UcdS^idrQ 
optimsefiunt crifcsâ natura, quajlegeoperatur; cumqueei fcfiJda/'^" 
vires func , hac feruata redicudine fuos iimper aggreditur 
conacus . Sic Bioni mukum profuit e nare fîniftra fanguinem 
profudiffe in magno îiene ; cum tamennulla directe vena a kdz^W^ 
lienc ad partes fîniftras feratur ; & e contra, vt habetur in coa- ^^^^^^• 
iîum.3, ^J5^ & primo pr^diet > fanguinem viceuerfa fiuere maîum 
cft, vt in liene magno â dextris, & fîmiliter in hypocho/-*dn js: 
Vnde Medicus , qui natura imitator in omnibus effe debec , 
lias calleat reditudines ntceifc eft> vteasinpraxi reiigiosc 
pbferuarefciat, dum fanguinem miţcere, aut caîtera medica 
auxilia ad vfum reuocare opus fueric : Quse pr^cipua c& Pr^- 
ceptoris intentio in his defcribendis venis 3 docere niminim 
curatiuam methodum per venşe fecUonem j cognita partium 
inter fe focietate^ cum non modo infcriorum dextera^ partes 
cum fuperiorum dextris, (cA ipfarum dexterarum iateriores 
cum interioribus , cxteriores cum extcrioribus pecuîiaritet 
nu. i<% confentiant, vtfuprâ t^ iS.docuimuaexHipp. lib. de nat* 
nu. î2. iiomin. &lib. de ofT, nat. vbi eafdem venas, quas hk-exi^î^ 
candas defumpfimus , & cum genitalibus focictatcm ineunt, 
fîc defcriptas reperimus. Alterum ţarţrinciţimn iuxtd attres ha^ 
het per cernicem , ^Jphagitides ăppellantur s hoc efl y itigtdares , 
defertmînrque vtrimcuc ihxtâ Jpinnm intrinfecus ad- lumhosin îe-- 
Jies acfemo ra^^ per popîiîes ex interna parte , deinde per tihias ad 
malleolos intrinfectis ^ in pedes: qîiaprcpterin dohrihns Itmthomm 
& teflium ven^ fc^ionem depoplitionihus ac malleolis facere intrin-- Vi^n^mm 
fecHSoporut, In quo autem confîftathsec venarum focictas, *^^^"^^^^^ 

L z quam T^. ^"^ 

Digitized by 


84' nmocRATis UI. î. m loe. w s6m. 

qiiam ?|/. a^xci, reaimdmemlatinfat^Deîîar.r;arpnfeiîr^ 
- ^«'^^^n'->ieuftamnn:n>reait«dineiat:4ve.;;Si^ 
fcrn.. «-^ ^^.^e^""^"™. longitudinea dumcaş;ît confiderata, ^c voJnit 


^u^.s^aeuni.ndtre8îu^feruntur: fpdveroohii^iueintranfuer^ 
tli.-''^''' '" q«adam meataum direaione. redoque 
rumit: r" *??.'""^,^^^ dimenilone fit , vt it>aior M^d^c 
in^TrC '^^^""'' '^'^ ^^"iq^^^i" pecuJiaTivaforum 

S 1::- "'^™"f ^^^"one, vc mfâ videbimus in Hm. t. 2 j.. 

cuaei.iocxetatisi&usra£io; SccamAnatomicis , vtnarefty 
.t'tlT"'^^^^^^^ rd.n,, mai.rem cercÂdi: 

iir^ndl. ? ^™'^'' ^"5"^^='^ fummus-ille natura opifc^ 
??:;-^-- S!vfc^^':''^^'''?^"^i^fe»e(5ius audaciamconipefcendam: 

eicrienlîf '^- ^ ^'"^^^-^^ ^<^^^ pro medico vfu . 
cx^cnentjatantumm<)ddprobar3s focietacesagnofcere. Oui- 
busitapr^j^batis, textualis cognitioiam fa:is per fe apma 
^ftl/ , '"' ^ Wecaus femitadeorfumquafltum fads 
et ad lugularu m per aures procefTum , & cum inferioribus 

^on4S?"'''"' f *f ^""'^^"^' qu^focietasm eopr^cipuc 
.on.picitur, qudd illis fedis , fteniitas plerumque fuborî'-i ' 

f^^ i :S:rSn; "^"'" ^"^'^ -pncabirurf Po4am eterii 
fcz>pno. i^-^"l~ es,ttim mcernar, tura extcrn»,in cauam fe fe iiiferuerinr. 

Digitized by 



caiîaideotfum protenditiir iuxtâ OEfophagl confinîa^riam âd 
mite & guttuiis îacera locata eft* Fcrtur verd per intcriepium, 
Tiue mtedipiemes mcmbranas ^ per cor :, cui per tricuipides 
uiembranulas âlligatu£,.dum quafi lacerum iaîus ei pr^ber> vt 
iu dexcrum eius iîniviii iztaguinem cfEindat^S: per lepcum trăf- 
uerium , quod perforat ;,minores aiiquas vei^aş femper e ie 
emitcens ;,iuxtaquc hepar cum trimco defcendente vnitur^ & 
:: ad ciîiş iacri immim.excurnt, vbi nonJosge ab inguiniUus 
iiiperamplosdiîosiiuditur ramos> iliaeos Huncupa£os> qui 
inguina v^xsus^&c crura iatro prccedences>in varias diftrib itun- 
tţir&udcattonesperfemora> nbias, malleolum extuemum- 
que pedem 3 turn inieri^s ^.ciam exceniis, etfi internarum tan- 
tummodo hie iiiemineritHippccraies^qu^ in ip.agnos peduni 
digitos definuiit 0p>.qaddh«e tamum cum venispoft aures 
ibcktateaiiGrueni:^.^i:;ckî:ius exprefficlib.xic, dehominis , ac 
de oC riau deqmbus dumtaxat vcnkiam agere inftituerat ^ 
SubdiC deniquehis-fectis (venis fcilicet;»- qnx propcaurcs vcnrspropc 
fun£)infecundosreddi homines . Cuius eiiecius ranonem «^-r^^ *ai|e. 
m<rsx, viderur acEuliffe lib. de Aq^iis Aer. & loe, in Scythartm^ ki- riifi^^qS^ 
floria, qiîorum diriores ex continuo equitandi viu in îKfcya-^^- 
dicos perfepc iacidebant affecâus : ijfque v r mederentur > vc- scyrB^-.oB 
nas hafcc ambas pone aurea copiofa cum iaogiîinis efiuhoiie co^iof^^ 
ţvertundcbant . înde vero peririgerato cere&o, &ibri:aiief^l^^"i 
viiiuerio cuam corpore > akus {ubrepebat fomniis ^ fraClifque ^'^«^^ pat 
viribus y impo^eHCes omnino ad concubitum > Iterileique baniai - 
pxoinde reddebantur.Hinc veîurin aîicuiiis iîagiţij iiîpplicium 
iu âDijs eturari exticifleiK , miîliebri iaduri vcfteV niiler^ ac 
muiiebriter totam cxinde vitam degebant • Quod perpaucis. 
immutaţis > refert etiam Herodotus in Clio . Verum lisec ce- 
rebriytotiufque corporis ex larga fanguinis eSuiionerefrigie* 
ratio non aded propria eft venarum ieJtarum p oft aures> quin 
cseteris etiam venis ^ fronds videîicct, narium, & fortaiTc 
cţiam cubiti aptari poiîit : quapropter alia pro ijscaufapccu- 
liarius quasrenda erit . Eani crgp attulit idem Hippocraces 
mm.^* îib, de gcnit. fie locutus . Qmbufcumqneiuxtk aures vm^fif^^ 
funt y hi coeunî quiim ^ gmituram emitîunî ; x^mun mod:ca?n 
if dchilem ac inficundatn : nam ţlurim^gmitur^ pars â căţlu 
" ' iuxtâ , 

Digitized by 



•iuxtâauresinjpinalem madullam frceedit ; ipfeautemtranpimr 
cicatrice feftione indura, confoUMtus eji* Dixit plurima ^cninitx 
pars ; nam ncqiie roca â capice ; neque totum id, quod iude 
decidimr , per eas delabiair venas , fed maior tâîUtrmmodd 
pars; turn quia per alias etiam capicis venas aliquafcminis por- 
tic â capice ddabicur> mm quiafemenexHippocrarisdQ*»-^ 
mare non âb vao cercbro , fed âb omnibus corporis partibus 
S^^^L P'ocedit, vchabeturlib^demorb. facro, &alibii copiofo nu. r* 
iib.dcgeair. tamcH cumfpiricuuminfiuxu âb co dumtaxat promanare * vt 
de morbis ^^iDucâc Auic Jib.j . icn.2o. cap,^ * Ybi opmionem hanc â Ga* 
num. I. îeno reprobarăm fuifTe aflferit ; quo autcm in loco Hon dicic • 
s.-pr:iî.com. Vcriim non kues adhiic obftant difficultates , ciim hac in 
a^'a^'i^oc! ^^ ^ Ariftoteîem ipfum ,. & Anatomicos omncs contra-^ 
c, 4<?," *^^' rios habeamus * Ariftotcies quidem lib. i. de gen. anim. 
^ ^ cap. r8. opiaionem de femine ab omnibus corporis par- 
Hippocrlrîs ^^^"^ proueniencc compluribus conatur confbdere aro-u* 
dltn-dnlj ^^^^^^^ , itâuc in eamvere AcMIIem egcrit . Actamen nifî 
ab cmuibtis q^i^flio fit de tempore , in quo huiufmodi â partibus omni* 
^'eTe^^ţţ';^ busfegregatiofiti numfciliccrinipfamecconcubitusfuccuC 
fcdinfciici- fatione, vcex corporis tatius voluptate videtur probare Hip» 
terimpugna pecratcs ; an potius pra;cedenti tempore â feminalibus vafis 
huiuanodi fcminis attradtio fiat, quod deinde m coi tus adu 
ciaculatur ^ vt necciTario cenfuit Ariiloteles * Vel quseftio fie 
deabfoluta fcminis pcrfedione; num fcilicet id, quod âb 
o mnibas partibus deciditur, femen formaliter ăc abfolute fit, 
vt ponir Hippocrates^ dum vnamquamque feminis portio. 
nem ideam referrc , & vim procreandi fimile ei particula , d 
qua decifa eft ^ quod potiffimum impugnat Ariftoteles ; auc 
materialirer tanrum modo; feminis videlicet mat-eria, quîein 
feminalibus va£s, & verius , in ipfis tcftibus'poftmodum per- 
ficiatur; vcique non apparet qua alia in re difcrepent magni hi 
Authores ; nam cum Ariftoteles loco citato afferat femen re- 
liduum effe vkimi alimcnti , quod non niii in partibus fin- 
gulis reperirc eft^ non nifîe partibus fingulis feminaîem hanc 
materiam fecerni & ipfe fateatur necelle eft : Quinimmo^ 
fcc. 4. probi. 22. opinionem iUam âperte ampiediitur , dum , 
qu^rcns curquicoacumbunc, refoiui, aclanguere magni 


Digit-ized by 



ex parte foknt? rcfpondec vtrum qu6d fecrcrio âb omnibus 
€ft femcn ? fuper^ft iam', vt Anatomiftis refpondeamus > quî 
coftancer negam huiufmodi yenas â colîi laîeribus per fpinam 
ad pudenda^ & extrem os vfque digitos perreptantes in anato- 
mica infpeClione fuiffc vnquam obf^ruacas^ qua*feminisfc-p 
mita fine : imaginarie proinde locdtam fuille Hippocratem , 
aut fecundum vuîgi fententiam ; cui nihilominus ignofcen- 
dum fit 6b rudem ^ ac fere incognitam tune tempdris fecandi 
artein: quafi voIueritDiuinusSenex venasillasfeiunctimâ 
caua , â capite ad calccm itâ defcrri . O nimiam ftoliditatem , 
quam ne coecus iquidcm ^ ne dum Hippocrates > ingeniorum 
omnium lorige peripicaciffimus , iîdiffimufque , profudifit 1 
■Detcgit ergo fummus hic Author arcanum e naturse penetra- 
lîbuslonga obftruatione ^ experientiaque erucum > focieta- 
tem nenape y qua? inter venas pone aurcs diftribucăs > & eas 
incercedit, qu^ ad pudenda , ^intedorisfemonis, malleo- 
lique partes deferuntur, iîuc ob pcculiarem viîlorum reâi- 
tudincm^ fîue ob aliamviarum dire<3:ionem> vel vaforum, 
congreffum , notum fine dubio natura? , vt ab euencu didicic 
Antiquitas , fi non oculara? adhuc Anatomicorum infpeciio* 
ni • Compluresfîquidem viasipfahabet natura non acciden- 
tariastantum, fed naturaies omnino atque coufuetas 3 quas 
vt \Ealde occukas , non nifi difîîcillime confpiccre £3l$ eft • Per 
has igicur venas genitura fertur, feu potius genitura? materia , 
qusin tertia coCtione â partium temperamento alterata, ă 
ccftibusdeiade> quibus h^cprouincia delegata eft, attrahi- 
•tur , & in perfedum excoquitur femcn ; quseâcerebro , 
( parte nimirum principe, perampla? nioiis, fpermaticasque ^^l^^^l 
naturae ) , copiofîus , maiorique cum fpirituum vbertate deci« ccicbro ma. 
ditiir , vt ex debilitate clarum fit, &exficcatione, qua? ei pr^e- f^l^ 
cipue ex nimio coitu fuperuenit : Quinimmo falaciores vid , 
quique Vencri ftudiolius indulgent, c^ebro fatis diminuto 
reperiri canfueuerunt.Quod fi hţ vense iuxta aures exiftcntes, 
vei comburantur , vel integre fcindiuatur , ita vt via omnino 
intercipiaturs femen parce & infoecundum gigninecefle eH . 
Ar, inquit Andreas Laur,lib.8«anath*qua2ft.4.,inîpeditis iugu- 
laribus cxtcrioribus , curp<îr interiores^xjuaî muito ampliores 


îtur . 

Digitized by 



fuiu, noîi defertHr fcminalis bsec materia? cui ex confiiBîîi 
qu^iîto refponfam vclim^cut magnus iien iion bene expurga- 
tul* per dexceram narem^ad quam adco patentesliabec vns,cn 
ycnxomncs ah va^ principia proueuiaiit ? fortaise per iu- 
^u!ares etiam internasaiiquafemiiialis materia portio in ma- 
|na neceffltace defercur > fed in exigua quantitate , ita vt raro 
ad fbecunduoi, {litEcienlq; fenaen gignendum fatis efle poffit : 
quod profeao non aliuude prouenit, quâm quod hx vi^ non 
adeo con&ciales iunc , vr ven^ poft aures • Magnus Veflaiius 
neruulum quendam iuxcâ aures perreprantem fe obferuaffe 
:riUix>pi. memoria prodidic, quiâfextacerebriconiugioiDnundus> ad 
^ tvfp^. geniuîia vfque defertur, teftes.niminim , nec non feminaUâ 
-^f^^ vala j iiiuinqv in vcnaruiu carum difleâione , conbuftioneq; 
Id^ .Dlerumquedilâcerari credendumeffe^ indcq; gencrationem 
yi tiari : ^Quod an verum fit , ijfdcm Anaiomiitis ftudiofius 
-tserfpideadum relinquimus* 

XXIII ^^ ^^^^ autem vena producitur quasdam în ilm^ 
ftram mamim . î^erturautemfubteriplenemad fî^ 
ftrilaterîs molîitudinem > vnâc fplen propagatur per 
omenîum , & fiaem forcimr ad dioraccm • Prodaci- 
zm autetn iuxiă feprum, & cum humerali commit- 
tiîur fubter cubiti articulam^ atque hacc fplenis gra* 
th fecatur^ 

^ Pknîtidetn hanc venam, ficut ctîamliepaţitidenî,deC:rip 
^^ fit alias Hippocrates > vt i . de morb. Vena» qu^ ^knitis ^^'^^* 
- appelia^ur , tendit â fpkne ad latus , â latere veri adhumermn & 

(mifirm mamm ,Mepatitis/veroaddextera^ţarteseodemmodo. 

^Quoditâque excauâqugdam fetacur vena m fîmftram ma- 

\^ ^^ num; (îuemanusaccipiatuiprototo mcmbrOjquodin brac- 

akis"? ^^^'^' chium ,Cubitum^, &iummam manum diuidicur; fîue pro 

extrema mânu tanuirn y id certiffimum eft.y quoniam fînifter 

^^iS ac- fubciauius ramus > qui afcendentis trunci medietas prope eft, 

cipirar. y^j ^d axiUas peruenity in thoracicam , bafilicam, & cephali- 

.^^ ..camdirimitunquarumbafilica quidem per interiore m;,cepJia^ 

^^^- Jica vcro per esteriorem.bracchij partem defcrcur •_ Bafilica, 


hri^ de Ied 

"^ ; qux 

Digitized by 


qixst in finiftro bracchio vena lienis eft, in profundam,Sc fub- 
cutaneam diuiditurj & profunda in media cubiti fiexura emer* 
<yens , duplici ramo ad manum vfque protenditur > ibiq; fur- 
cul^scomplures digitis omnibus impertitur: fubcutanca ve- 
to fub cute perrcptans > ad cubiti articulationem iixiuos dirx- 
tnicur ramos » quoxuni ^cer cum cephalic^ raipo vnitus > ve- 
nam>quşt.m mcdiam,feu conimmieni dicunt, paric; aîtex 
^ero ramus per intftnumbracchi jlatus defcendit, vâri os emit 
cens furculos ad fubiedas partes . At qiipd eadem basc ve- 
na adfplenem vfque defcratur,qui fubfiniftrilateris molii- 
xudine , hoc eft , in finiftro hy pocondrio fîtus eft > id aBaco- 
mica trutina haud defendi poiîe videtur . New ^uernădmoium 
miecore^mc!^ Rutmş BphejEius de part.hom. cap. 33.2/^ iţ 
inliene fiirsmţverjfis , defurskmquein jtnijîra parte difcmTens 
foUa vena reperîtur . Qtdverh id aj^^mmt^ifnpudentermentiuntur, 
Lien:Vtiqueomnesyquashabet venas,quş complures qui- i^jen yeae- 
fiu*i4. 4em fuat , ex quo venofiis dicicur âb Hipp. iit. 4. de morb. 3 ^t^J!^"*^ 
omnes > înquam,a fplenico rccipit , qui venş portş trutex em 
Venaautem porta>& vena caua, vt omneş norunt^diuerfa^ 
x>mnind funt , nec continug inter fe,nifî aîiquo paâo medijs 
capillaribus > quf velut radkum capiîlamenta per hcpatis. fub* . 
ftantiattn difleminantur . Atqui non id vuit Hippocrates , cui 
fatis cogiiitum erat nuUam venam â îiene ad manum vfque fi* 
niftram excurrere > fed quam toties diximus re^âitudincm , 
' cognicu adeo neceflariam ^nobis proponit , quam non mini^ 
mam inter îguam manum atque lienem interccdere ij fciunt , 
qui in praxi toties experţi funt incredibile auxiiium, quod lic- 
îjofiex phiebotomiaiîniftrgbafilic^perceperunt. Atfiret^ 
titudo iîla in fibarum , vel vaforum dir^cSUonc confiftit> qa^e 
dircâio efle poterii adeo diftiiiiâa inter portam & cauam , p^ ^*" 
quf non nili per capillares confuze vmuntur ? An latiS eit, fîaifiro buc 
â port^g capilare^ 5 qug fplemcg veng conrcfpondent y cum *^^* 
iis vniantur» quş ^ilîrş^partis ven§ caug propa^nes & capi^ 
lamentafunt ? atqu^ fcinc tanxa exoriiur inter easpartcsibcie-' . 
tas, vt finiftra manus iît qiioddam quafi Iknis cmun^orium, 
ad qtiod naturaîker fuperuacanea tranfmietere folet • Ex quo 
fit, fccu4dumVaIiefiu^ibv7,xontrouerC cap*^.vt quar- 

M tanarij 

Digitized by 


po m?wcR^is LTB. î. m toc. muoM. 

Qi^rmnan') taoariî & lietioiî mmm leuamen ex pfelebotomia ia fummîs 
raagnum Ie- manioiis> voa ttniuinaise runt rena? j cranogue fânguini effun- 
'jiârex phicl dc-^nci^^ cuitifmodi: is- eft, qui ex liene redui^dat^ miniis apt^ ,,' 
^^ocomfca in qiiam ex vcnae fectione in bracchioyvbi tamen ven:e (unt craf. 
nibus'le'ca- fiores ,- Natura enim^aHjS eiia£ustioHibtîs>qi!se hane inanuum 
âiiA.ii. ¥iăc- gr^ce<lere folensv kuata ^.: tacilius quod -fupereft excrementi 
ad^ conUietas partes ^, & ipiam^t :cmun^oria tranfaiitters 
nicitur : prseteixjuam quod mmima inde St fpmtutim diffipa^ 
tio jquodinkngis morbis, quaksex Jiene plcrumque fieri 
conlueuero vbi vires &z6i^ funt, qu^rendum potiffimum 
venit, At qmadixerat fplenem cffe ftib finiftri lateris mollitu- 
dine ; {ubdit> propius defignans^iusfedcm, propagări per 
ometitum > hoc eâ: , ^xtendl dilatariqae fiib o^ciico ;> quod 
magîîa fui parte fuprâ ipfum Hene expaa&m eft: fiîi^m autem 
V forticur adrhoracem y quia diaphrâgmati fubtendiîur, quod 
choracis confinkim exiftit . Producitur dcnique toc vena , & 
origiacEi ducit Bon iongca feptotrânftierfo, aliene; videîi^et, *■ ^ 
vbi cms extremitates magna ex partt difpergunrar : hc.Sc îib* ^^* ^^* 
de oiC nar* dtatx> piiires capicis venaa ira deicribir,: quafî in 
Yierticem radices egerijie > mdeq;ue:Qriantur : idqtî^ obratio- 
., ricm c î 3> addu<3âm^ Quomado autem fpkiiicatee mm ia 
cubici articulo cum cepiialica , feu humeraii y conîugatur ad 
vea^communisprocr<acion€m> iam fuprâ fatisedaiîî expli- 
catum eâ. Neautem quis^tincogni eifui& 
ie hancimiftt^ matius cum lieiie iqcktatern ^appohte admoi. 
t^C^o^ dum ibbiHRXÎt , haax: vwam^îenis gratia iecari • Arquinum 
gnirV"faerit ccrto Hinc clici pojiţâb Hippocraas vfque seuo in viu excitifi. 
Hippocran - £g yiaoi icc^ri Y^mhm r qu^ iîîter minimum & -anularem ăi* 
GâK5.dc_^ gituîn,ieupotiuS;,vtGaîcn0iplacaic, inter asuîarem &înc-. 
^^i^ap^T.'* ^^^^ â veDiscubiţi propagata proreptat^quainfaluâtellam 
V * commuiiiţer appelhnt â falutari €ffe<5îu i. quem lienofis in 
' moxbi$yiifque> qui: croind appeiiantur, jt^^ 
LîWi,n*îo. fiîeuîC5nondum âiisliquer.Lnam etiîHippocrare pluries 
dr*âeri?ib! memincrit phîcbotami^ in mmihm^vt lib. i* & 2. de morb*; 
y^^' ^^';^ de fterîlib.& alibi i niWIomiausiîîanum iiinpîieiteriîcpro^^ 
nuni.'-.EiJ îacamprototobraccbio^quodinhumcrum>cubitiim, &cx^ 
o-nkdisvi. îremam mauHm diuiditur > accipiyfiaiftMîmwm câ>yt uoţa». 

i.. -: '^ "^ irit ^ 

Digitized by 


HicGal^: aeTEi part. c. i* 8^3. de anat. admin. cap- 3. atg. .^^^^ 
itâaccepiflfeetiamHippocratcm^ lâds teftari videnmr verM ^ aio ^ccipi. 
a'^ xs. <ju3ehabeiiturloGO citatodefterH.Hz^r^?^/^^^/^î^î?îî^^^^^^ 

;Io per- 

af. acproiride quodcs manuiim veas iecandas pr^.cepit> 
de venis irl cubki flexura iie incelligeadus iit , mâxime veren- 
dum . l>ro hac eî^odanda qu^ftione , deduâa omnia Hii^p-; 
gratis tocha^iiigenterperpeîxdcnda forent ; quod opcrofum ^^ 
ytiqHc ac longum nimis effet* Qukquid.ighur de hoc ht> reâ„ ,,. 
fetiş eft, quodpememsomainoeftiiludpradîdiuni^vccuius ^^^^^g^'"^ 
non modo pluries memiaicGalentis^ vclib, <î. de anat. adm* 
cap. 5. &4ecur. rationeper fa:ng- miCcap. 14. & x^,tcd 
ante ipfem Soranus ephsdiusiniiagogciiâp. %i.ds manibus,^ 
inquic vncm wnam mdâimus ficus âigitum minimum ţroţter 
inflammatimem fţlsmsy juperpoUicem -wena.mindâimnsfropţer 

nuata feric pofterlores fexe omnes , vt C^lius Aurelianus cro- 
nic, lib. 3 .c. 4. Oribaflus Sardian. in medicina compx. i o* 
Acâuarius j.meth.cap.x. Aetius Serm.5.cap*î2.&lermao* 
cap. X 1 .Paul. iEgin.iib.3 . cap.4p. & Iib.e^.-cap. 40. Alexand. 
Trall. lib. 8, cap. 10. in cutationc inflammati lienis ; vbi aflc^ 
ric ccfî miHUs fanguinis ex hac ^enula euacuemr; tamen quan« 
culamcumquc inde tentarăm inanitionem ; pr^cipuum lie"* 
niadfanitacem adiumentum eflc . Neque latuit Arabes pro- 
ficuum hoc auxiUum ; QuiBimmd Auicenna cam bafîlicse 
praetuiitin aîgritudinibus hepatis atqtte fplenis fen. 22. lib. 5. Ht fcs^ 4;^ 
craci. 2. cap. 24. fie ciuidena menaimtllaies .9- aa Aimaiiu 
cap. 7i.alijq.n0a paucîjâc proiiide neque Hippocraci igno- 
~ tam ilire optime cenferi poteft;eo magis, quod Aiet^us 3 ve- ^ 
ftiltiffimus Author , id ipfum de Hippecraceienfiile videtur , 
dumlib. 2. acut. curat. cap. 2. loquens de fanguinis reie<^io-. 
ne vitio licnis , propofitum teftum de ioc, in horn. refpexiiîe 
vifus eft cum inquk j??z a Iknefangtiisfirtunfinipr^ mmus ve- 
nam illam 5 qu^inter minimum anularmmte âigîUtmfita.efî , r^- 
TcinMto : ^uandoqtiidcTn Medic-oriim nonnuUieam ăd lienemvfqtie 
ţsrtincr€ arUtrantur . V^um i} hdc ipfa inier cubiti fvenas 

M 2 infi- 

Digrtized by 


9% mppocRjTisLisit.mim.iifiioAi: 

inferiorîs ţropâgo efi : curîtaque potimeam quis proţe digttos ^ 
quâmm mUticummimţrofcindafy cumhocm locoampliorjtt, 
^ ad efflwcumhahilior? vbi notandum eft tâm Aret^um,quam 
G alenum^ & Auicennam ex aliorum opinione de venala: hu- 
ius fciflîone efle locutos, cum fere femper apponant verba 
illâ Ajfemnt ; Arhitrantur ; Dicunt . quod non aliunde proueni- 
re arbitramur > quam quod euideoti careat ratione rcmcdium 
iftud, videturque penitiis empiricum : vix etenim inteili^ 
poteil , vc nam craiîîores lienis ^motborumque cromcoruiu 
humores, ex venulis ijs fecijius , quam ex cubiro educantUT ;^ 
folaque proinde fulcicur experkntia, qu^tamenfaîlaxaon 
raro eflfc poteil , curxi.difficile fit fcire quid a quo proueniat : 
nam falutaris efFe<aus > quem venube Hlius fciflîonem infequi 
obferuamus , maior fortatfe atque ciiidenjdor ex felia, cubiti 
tune teraporis vena prouenijOret . C^id quod vetiuja iUa incc^ 
anularem & minimum digkum humerariaî propage cfî, vt aA 
^^^Coiumb. ferunt Anatomici ? vc nam iplenicis prodefle poceriţ ? Atqui 
aiiâ'& ' "^^ ^^ vaulu funt in natura , quorum ratio > vt fupra dicium eft > vix 
vnquam reddi poterit . Experientia iam fatis teftâtum habet 
venarum manusaffinicatem cum viicenbus: quandQjiemo 
cft in praxi veriatus , qux ^groraiices intcrdum noft audierit 
aflerentesfeniîbile leuamehrum inipfa ianguimsp^r has ve- 
nulas efîaiîone in vifcerum doloribus pcrcepifle , . Experien- 
tiamrelinquerc eo quod eiusno^lateacratio^ftuiie fapere eft^^ 
Illud fakem infîciari non poterit, in cronicis morbis y vbi vi* 
delice t^x varijs euacuatiombus > morbique diuturnitate vires 
Exper-«n ia ^^^ ^^^^^ funt,&: euâcuatione adhuc indigeimi^percommcK 
rdi qut^r <i^^ effe has tundere venas > ex quibus minimo cum virium 
UreaTrftio! ^^^P^i^^^o «"^^^"^^ioiequitur. Rationem icaque innatursepe^ 
^uireVapcrc ^tralib us iam relinquentes , illud nobis ftacutumht^ dexte- 
^^* ram manum cum hepace ac dexteris partibus > finiftram cun> 

liene atque fîniftris occultam feruare analogiami proindequc 
dextera: venulam inter poliicem ^indicem dexteras capitis 
partes; inter medium ver6digicum& anularem ^ feu inter 
anularem &: minimum > hepar , dum îcmduntur , plurîmum 
iuuare : finiftras autem venas cădem proportione in extremşt 
siBanu fîniftra. 


Digitized by 



XXIV Alia etiam âd dexreram manum ecdem modo â 
caua produciîur* 

£U. 23. 

Sic pariter & primo de morb. protulit * Vena , qu^fplmîtis 
dfpellatur, tjmditafţlmeMlatus , â latere^ero ad bume^ 
rum.&Jmifirmn mamm : Hepatids ^eroaddexteras ţartes ecdem 
modo. Queaxadmoiiim igitur fubdauius iîniftcr ramus ad fi- 
îîiftram axilîam defertur, &,vt dixijxus/ruticatursitâ & dexter 
iubcla«iu5 dcxteram axilJâmverfysdcîatus, eodem ptmtus 
niododiuaricatur^eiifîdcmquecom'enium &focietatem cum 
hepateferuat, quodin dcxtero hypochondio locatum t&i 
' vndc > vt fuprâ iaiitdiximus > non ininus dexterae ftianus phio» 
botomiâ hep^ofis ^ quam 6xn&m fplcnicis prodefle cenica- 
dmîveftf . _ 

XXV. Communîcant autem omnes venae , & confluunt 
inter fe muta6> & alj^ quidem fibi ipfis per fc com- 
mi6luntur^& coincidunt; ali^ vero per venulas â ve- 
nîsextenras- Quse autem cărnesnumunt> ea parte 
inter ie coEifluunt . 

EXpîicatis praecipuarum vemrum int^r fe cofociacionlbus, ^^^"^^^ 9^^^^; 
iamrejiquumcratfocietatumratiqnes explicare: Corn- ie commii. 
murucaurf.quidcin, CQnrefpondentque inuiccm omnes v^- mccat. 
nae,vtquseab vno codemquc principio originemducunr, 
ac vno fere e caudice propagantur.Vnde Ariftoteks pan. 
veBas omnes coBtinuas efle a&ruit j ac omnes proinde con* 
fiuunt inter fe mutuo , dum altera in alteram influcre , con- 
temâofq.tranfmitcer e humores nata cft. A t pra^ter comun^m 
hanc focietatis rationem , qua omnes cum omnibus comuni- 
care ccrtiflxmum cft,tr iplex iam proponitur modus,quo ven^ 
quf piam cum alijs quibufdam peculiariter cofo ciari obfcrua- 
tur^ex quo promptius atq^expeditiuş fupcruacua qu^cunquc 
miituoiibi transfundere pra^c^teriş copfueuerunt; dlix enim 
ipf^pcx & fibi iprxs comnuCtunţur $c coiaciduAt , hoc eft , in 


Digitized by 


5?4 l HIPFOCKAtn LIB. I. m LOC, ÎN HOM. 

eande partem, câdunt j vt cx omnes venf,qug comitacim cx 
determiHata aliqua parte etnergiiDt ; «â afccndeiK & defccn- 
dens ven9 cau« truncus iuxta hepar vniuntur ; fie cgterf om- 
iies,qugbing cx cădem truiicr parte fruricantur: per quas 
cotifefifum dexwrarum paraum cumiîniftris ,-qui in reuullîo- 
nibus prgcipue conrpicicur, magna ex parte oririjfortafse aoa 
incoagruKm e^etaffirraare . A% veroper venuîasâ veais es- 
tealas peculiariter vniuntur, vt Caua & Porta.Jn hepatis pa- 
renc%mate per venularuna capilJamenta ; & thoracica, qux 
•per ramalos quofdam eara ramulis veiîajazygos-coit .. Sic 
^pigaru-icaperretaum epigaftrij mufculum; fursiiin recurres, 
mammarif venulis occurrit ; ex quo mirus inter mammas & 
■vţerum conteafus & xommuniQ prouenit . Alif demum , 
■qug âd eandem nucriendam partcaidefcrimtur, ca etiam ia 
parte quoquo paflo vniuntur, atquc alteram peraiteramibi 
exinaairc fas eft , vc dextrg & finiftrf iugujares , cum interne, 
verr^u to- "^"^ exterBf.-inâcie ,in iyncipite., in cerebrimembranis, & 
eieutes ia conhinilcs alig . Iii peculiaribus autem his focictatibus ccie- 
:la« &cun- ^^^^^ '^^^^ rcaitudinis rationem iuxtâ Hippocratis mentcm 
.dmnHipo, coQfîftere,iureqptimoquisfufpicaripoiret. 

XXVL; ^^ quîcunqae morbus â veflisoriwrjeuîorefta 

' ^ qiaţnquiâneruis/diffluîtenimvnacuinhumore, 

qunn venîs eft , & non quiefciYr & aatura veniV îa 

fîumoreeft.,inearaibus. Nerui autem fîccifunt,& 

yentriculos , fîue cauitates non liabent , & ad offa^ 

coaUftunt5& maxirna ex parte âbofsibusnum'untut 
l^ucriuntur etiam â camibus , &coforem^ ac robur 

-imşcoff^xMC csFnem mediumbabenc.* & humidiores 
-quidem funţ, ac carnofîores quam oflâjiîcciorcs au- 
tem :, ac magis ofsei quâm carnes. Quicanque autem 
morbus ad ipfos peruenerit , roboratur & quiefcit in 
eedem locoj&diflficileeft ipfam educere. 

PArtium humani corporis phiiîologiam defcribcns Hip- 
pocraces,non eariun naturalei tantumtnodo aiFeâiancs, 


Digitized by 


fcd>VtMedicumdeccbat3Îllaseriam > qu^ijspr^ter natu^ 
ramcontingerefoîenî > breiuterinfîniiat, vt plurles di chim. 
fiiic . Abibluta ergo naturali veaarumkiftoria>icii potius, ii- 
Urum confcciationibus jiam vtfehabeamadmorbos exci* 
piendos ^ retinsBdofque cdocet ; idque ex prepria eaium na* 
cura, faC^a comparatiG^ie cum fîemjs ^ q^iakerum funr^^^^ 
rum crenus y quo corpus vniucrfum difleminatur . Ciim. 
itaque venarum Jiatii^ta Goniiftat in hu mido inon certe quace^ Jenară ns- 
nus-parces func fimiîares : ( fic CEim ^.cum yarijs nbris^earum ^^^^^^^^" 
tunica intcxta fit, quse non nifiex îcsia > ductiliq; feminis fiirnsui., 
portioncgignipGCUn:>.friggidum &:fxcum earum tempera- ^^-'^^^• 
mcncum efle necefle eft } fed per accidens > quarenus fcilicet 
partes funt crga^icse > in fiftulse modum excauarse» ad {kngui* 
î>€:m concinendum y coqucndum^difîribL*eaidmTîque>& qii^ 
velutfiumina corpus vniuer&m irrigantia^ calido'femper ian- 
auinc replets fine j.fpir-itibufque tuir^entcs : Vndecx horum 
contacta in humorc iilarum naturaai connftere dicirur , Hin 
mores paritcr in ijs contencli per anîpiam cauitatcm facile vcnamm-i 
fiuere , &a natura, ia-varias eieri partes apţi funt ; proindeq; moibi aci- 
morbi^qux âb huiufmodi pendent humorib usinâabiles fun t^. ^^^ <=^3î^* 
vt t»- j, & 4. lib. huius dictum fuit. Atnerui, fub quorum Keruoruta 
nomine&:Iigamenta;,&tendines, & neruos proprie appcl-^^'^^^^^^^^ 
latos inţclligere debemus ; ciîm exangues fint > & friggidi>du- <^^ . 
plici tunica ymeduUarique fubftantia conipofiri;.nequ€ feniî- 
bilem cauitatem > ( vt CaL corn. i . ia5. epid. docet)fcd po- 
ros , anguftiflimofque meatus habeant ^ quos non nili te* 
nuiflîmiaaimalesfpiritus meare poifunr, contrarie prorsiîs^ 
modo > quam vena? fe habenr; ita vt quemadmodum morbi- 
ficam materiam difŞcilker intra fcrecipiunt y iic ctiam recep- 
tam y 6b pccufiarem fîraâurae conditioncnix non nili difficil- 
îimereddimtsvndcfiabilcs morbi>atquc contumaccsinijs 
procrcantur. Quod autem triplex iitncruorumgeniîs, ex Kcruoru 
ipfomet GaI^ ci>îligitur i • de mot.mufcul. ; primum quidem tf^^^ 
tx olsibus oriunduni . Sccundum ex mufciJis. Tcrtium ye-^ ^^*^^ 
ro e ccrcbro ^ fpinalique nacdulla ^Nerui y qui âb bffibus pro- 
dcunt y vincula > fcu ligament:! appellantur> eo quod oiîa of- 
fihus connc^it > Se per iîncuroiîm omncs ardcuîoş coniun- 

Digitized by 


a^. Sic idem arte • Verulnmintame fulli.'^'''^' 
%iesifed ăâ ipfa cjfa froâum , ligămmtnm funt articulorufn . Hi 
Vtm foii- aucem omni ieniu deftituti funt, ne in motu nimis fatigentur. 
damema^ At Gui e mufculis manant, cendines dicuntur> mufculoruna 
qu'loffa k quaiî caud^ : func etenim fibrarum neruorum , & ligamenti 
Sa^r'^ad ipfi^s mulculi propagines, qua?percarnemexpanfe,invnuin 
iimiîa iniii^ quafi funiculum cocunt, quoamculi omnes ad volunciaus 
S^a^^Sat! imperium ducuntur : ac cum cx neruorum exaâiffimi fen- 
qllccoitrm-f^s ^3^; ligamenti infenfilibus cmnino filamentis conftituan* 
MensTcx! tur, obtufum quendamfenfumlpfîetiam obtinuercTertium 
curreie, am ^^^^ neruorum genus i in quo veri nerui, hoc eft > quos â ce- 
ik 1 ta n^uî rcbro , fpinalique meduUa originem trahere dixxmus , conţi- 
v!c emr^'& îieotur , fcafus , acvolmiâiari^ motus funt inftrumenta , cum 
qîdde'^nuîiaper COS vclut per fiiniculos quofdam animalis vis in cor« 
lo^coliTtut P^^ vniuerfum defcratur > per coturn etiam corpus ipfi pa- 
fedvcimi-' riterexpanfifînt, ijque acerrimum fenfum funt foruri . In- 

totiuscot- qui^ îgi^^î^ * 

porismoic _ . , , . . âb humorc videlfJ 

acS^l QE^cuaquernorbusaveni$onmr^^^.^^^^ji^^^^^ 

V^^â^ in quanticate :, vel in fubilantia alcerato, inque venofî gen^ris 

cap. 7- cauitatibusconcendo. 

. minus conttrmaxjcuratufacilior^naturşe vel 

Le mor eu ^^^dicis auxiîijs faciîius cedens, quam morbus, 

qul â neruis , feu morbifica materia in neruorum poris , te- 

Huibufq; meatibus coarCcata, prouenit . 

.rn * • N t. " o euanefcit, vel în 

Dimoit enim vna cum humori, &c. ^^^j^^ ^^^^^ ^^^^ 

fertut morbus , vnâ^um humore , â quo pendet ; cum non 
poffic ftabilis e:0e ^ vbi eius materia fluxiKs eft per amplas vc- 
n^rum cauitatcs . 

* • t_ no eo quod humoribus 

dis 5 coquendis , diftribucndifq; dicatse fiat s vnde cx horum 

contadu&peraccidens-ipfectiam'humidaî exift^ ' 

-. ' •!. o -pcrquasfcilicec ferpuntjVteasaKtr 

quo padîo participant. Vel potiusquodveîîarumfibris caro 


Digitized by 


iîîtet^eSafît, ideoquc adcarms namranvacccdant, vt con^ ^ 

ftat^rGâl. a. de tempera ,i^^ - - - ^^; - ' - 

r : ^^ ^ P' V^ o nori modo vcpârtessuE 

Neru î au tem liccr ajnţ , tSrC- fîaiikres & %ermatic^ 
verum etiâm quiâ fenlîbiîes alueos & cauitaccs minime ha- 
bear,perqpashiiini3res fcere facilepoffint, vtinveiiis; esc 
4tîa taitreii^ge optici îierHÎ, & pudendorum caui iunt exi- ^ 
mendi: ham iif fbiuz3Sodo^^ ^niîs^nijbîlem obdnuerc car 

Ec adolîaconfiftontf&maKtmaeK parte â^ 

ţ^ . deîi^amentisaîquetendonibuslîScintel- 

POSiHIţr^^^^ 'iigeiîda fUnt ; hi enim , yrdiximas, ad olîi 
i:erminanmr,â<|aibâs'pafitct alimente^ 
Dixit-auiem , maxima ex parte^ quia â venis eciam aliquidre--^ 

ci|>cre cr^i p^r eft.. ' : - .. ^^ ■ ^^ ; : ^ / 

V . .. . Nerui . proprie dicti, 
,Mmtimtm€mm a carnibus . fenOi^motulq; latores, 

â c^rebro ^ ipinaîiq; mcdula oriundi > perf araes diîîcminan- 
* tar, cum caro feiifiista!6iu$vq^i^^i^erip^orpori^^c 
exiftit , prsecipuumfît prgamim ; ^x:qua Sc,ne^^os per cam 
dcductraţiofîabik erat .* vnde ipicmccHîppqcraţes îib. de ar* 
^^ ^ re >, ad tendinum & iigamentox*um diftinăioncm^qux inter 
oiTa contînenmr 3 illos vocac in carne fublimes : quapropter a 
carne fiiccum aliquem excipere iioţi ab re eft ; quamuis duas 
inter tunicas yeuulis etiam ^ arteriQlifquc ditato$ tuiite certii- 
fimumfit* - 

Colorem et robur înter ofsa etcara^m medium 

, ^ - o Parciumhumanicorporis aîi^î albs fun:> afişe -P^fi^iînka* 

fî'^hPnf &C- t ^1* r • in mani cor- 

wauuiHjv^^. rubrş . Iile exangues 5 ipermaacg^ rpbiutf , porisaiicaî- 
fri^<^rde & fiece exiiiut^vcneruoiâ omilia & ofla-He vero ian- ^? f^^^i.* 
guineg & moiks , caîidf bc numxdg . JN eqiie omnes §q uali 
gradu qualicâtibiis hifce participant/ed alie magis,aliş minus: 
Vnde quemadmodum inter ilccas ilcciiruiram eil os , humi- os uccim^ 
-diiTimus adeps inter humidas , fie mcdium quodâmmodo îo- J^f ^^^^f ' 
cumaeruoium genus occupaciicâvcficum offe compare- ^ancs. 

N tur^ 

Digitized by 


Ad^i hw tyjŢ^ Iiumidius fit: > JcadcarniSoGatuaram iccedat ; iî y«Qt tUiţi . 

imct huS- carne y fîccius lUâ fit , oiTegque magisji^tuîg , qnod e^'pgrţi* 

^^ cipatioBe exţr^tiiiţaxi^ vtriulque, hccitatiş vîdelicet, atquc 

humiditads >proucnit : nonfqudi tamen mcnfura i certam 

cnim cft ficcir atem emiaere> ex quo rabur , duririemque fifci 

cpîxip^rarupt • Plapipium docu&Bippoc. j^^ prip. 4|im flu-2. 

cUxIt nerMoageniţai>'cfle ex terreâ»^ut|i)o6, &* frigida o^g^i 

tem , eş:fîc<;?i:a quiderp â c^oxţ, ^4 Pq^ ?,y tfiripis Qffium 

materia, exufta , & ad vkimam jfere iiccicatem reda6ta;immQ 

Ncmomm ^^^^^ ipfofiîiet neruos non leais quo ad hoe reperitur diiFe- 

ăiijaiijsfic- rentia>cumrobuftius & ficciusfitiigameatum,quâm tendo. 

âttnu ^^' Sicciar cendo, quaraneruus motoriuâ} quo minus adhiîc lic- 

cus eft feiiforius neruus , vt cx ofEcij diuer:ficat€ decebat : In 

omnibus taxîieu>vc dictum fuit, ficcitas praeualeti cxqua 


Qaicunque morbus feu morbifica materia ad îpfos 

peruenerit fiue in meduîlarem fiibâanriaiîiddapiâ yikein- 

^maidiSl tunicarum poros, roboreturînfarâa fcilicet fin^iter, ei^. 
ciks,^cur- 4emque loco adliâ^rens , id vt difficile fir ob meatuum 
aîîgulliam eameducere, aut â naţ^ira espelii ; xum ^amen 
nequc exiguus Beruorum caîor illam reibluere , diifipa* 
reque potis fit > nifî aliqua iiîperueniat febris , qu^ iiliim. xn^ 
LafpSt^^ tcndens , contumaces refoluat huiîiores, aut conc oquat s 
morbi quâ- yt ladus infiâ dicctur lîb. j. t. 57. ContumaciiliiXîi icâquc 
îal?iîuim^". funt nemomm morbi; nan icataa>en, vtinijs ialutares ex-i 
creciones , abfceflus , atquc tranfpofidones quandoque â na- 
tura fieri non ppffiac^.etfidifficiiius, quam in morbis venofî 
generis : nam vt in Coacis regiftratum rcperimus, repentinas ^^ ^ 
conuttlfiones foluit aîui profluaium, leu prodeft vrinam fiue- poikml 
IŞlf^^^^^ re copiofam, aibumineam, &a!uumferri,vtluobono cx- '^^'*^* 
* ' percâ eft mulier iila moroîâ in Thafo i qii;e , vrinis ^ menfi^ 
bufque apparcntibus â conuulfione libera ^uafit : Quam can« 
dem veritatem teftatur etiana Piţbioiii$ liiftoria 3 , €:pid.f^c. i • 

«S^* !• 

Digitized by 



XXVII, i^gxîmeautanlmpettintlşfos^d^ 

morbiră^uibus tremor corpus occupaţ. & qai trei; 
mere ipfum faci unt * 

Haâenus neruorutn naturam ; Nune morbo$ , quibus 
atruofum genus maxime obnoxium eft, magna breui* 
tâce profequimr : Ncrai^cenim , cum f arces Cmt iîmilares fi- 
mul atqtît organkaj > vt fuprâ diecam eft 

quegeneris^intempcrieifcilicet^compoiîcionk^ bL?*^^ff* 

continui perpeti nati func: qui pr^erematuraics afiecSîus^cx ^uoquc gc- 
fymptomate, hoc eft, acâionum îstfione^ nomen fortiri ccn- 5ţ" fiiS^' 
fu€U€tunt: inter cos autem pr^dpui artificioseadmodiim 
iub duplici ceupcriplirafi ah Hi ppocrateMs verbis compre- 
hcndufltur . M>riid.quibus3 boc eft > poft qiiOS:( fi vidclicciC 
ipfos interdum curaii comiBgat ) tremorcorţîtsthocufaî , quia 
diim femei adfuerint,ttiiiiquam demdc pcrfcâe cuiahtur, fed 
debilitacîs neruis^^eâam parccintremuîam ferefempcr, 
atque imbeciîlem admodiim relinquunt. Huiufmodi func 
diftenfioncs , ideft ^ conuiilfiones , paraîyfîs , Şc rcfoîutiones» 
prasrcipui & calamitofi nerac^rum -m^&Ms 3 in qMib^^ vo- 
luaâarins mocus , & tangendifenliis pecwiiari&er teduntâixr • 
• . . r. ^ . dum videlîcet ad- 

cunda eft defcrîptîo , qua neniofarum partaim morbos deiipr 
gnat * Huiufmodi autem qua^dam funt neruomm femiob* 
ltrudion€S^,qu3eaditun[i fpiritibus facuîcat^ni animalem de» 
fer^ntibus^nequ^itâim^dîunt^ vtpartes fenfumotuq; om* 
Bino defbîtitas reddant ;^ neque itâ expedicum reîinquunc > vt 
fpirkuum^ir&us atqii^ opuknţia iategre fruancur;led iTi^dio 
qupdam Hîodo fe h^ent > ira vi ex ikttitatc im bccillit^r fur- 
fum raouente, & membri grauitace trahciite deoxfum , quae* 
dam yeluti pv^î^a^vel trcm^Ius quidam motus exoriatar. 


Nerui auiem prcmunt artkulos^exîentiq; font per 
totum corptis • Robulli amcm maxime^ mierii per 
cralfîfsimi fuBt inillis corporis partibus sin quifaus 
pauciffiiiM^ carncsfunt* Ec corpusqtiidem omne ncr- 

N z ui$ 

Digitized by 


font tmuiy fcd flbr^ copfimiies nemis mţcv cla 8i 
carnes tenuiores & fbiidiores. : 


r^tio* f ^ XpUcata ncrtioni natura > marbisq; ijs^quibMS pr^cipue 
JL^i^^^y ofiioî genu& exerceri ibkcj iâm: ecrumdoLiî p^r Viii|ţ 
uerâim corpus; diftribHpoiîem , xmnalijs aulb^iEaiBi^ner^^ 
_ uos ipedântibîiSjîcku^l d^nroribia5 j. qu^fixa^ 
gir • Dixitîîus aut^m fuperiMs ex^tiri^^ 

neruofum genus complecur^^ rendones quidcm ia articuîos . 

irvfcri vc trabere poiliBt ^ ligamentâ ^eid m ijfdem arciculis fy-. 

neurofin cfficere & vnionem rexqtiomrc nuscdicicneruos 

pîemere artÎGuloSynoîi modo qnad^ipfbs attingaat; fed p.ojtius: 

quod 1 js v^riararn cakmi^^:iim iipB taro iint îb caufa : vtiint 

cmm verbo- "*»'ig^o qu©-d premcre:&r. >afjflig.erc iîgnifiiiat . At; 

cum omnes Animălium pârtie nl^^^^tî^ocauit Eraiîftrâciîs ^ ck 

SSkf of" ii€nîo > y ena,& artoria fînr contexte; neruoş( eospr^fercinij, 

nerao> vena q^j ^ cerebroy fpinatique medulla OHuadi itiac ) per corpus 

îtm:"coa:e. ^niuerfum 4iflribuin€€cife. fuit : qua in re tres fuifle iiatî^rset 

^'^' icopo^ doccr CâîenuĂ^^. de \db pairt* cap^ 9^. . '£tmms iqnidem^ 

nemos per jf^J^^nâs fusT^Unt nerm îrihiti ^j^ ţr^ter hac internii mmmm 
puidi^nii- p-artihnsi > ^^e- ăâeb >' iţfius' roentricuU' c'rifcio^ : Jimt erdm 
*^^^* quodammodo eHăm h^c fmfaria ; fic[uidem ţermanuSffipe^^: 
diuâ qukquam > e^^taFludignotîo efi certiQmct . Qrifcmm autem, 
*vmtricuti fenjum haiet aliTnmtiipfi.amman^idefkdmfjşi^ -MUrl 
rDtimt(^rijs fmîumyfic mufiuH ^ ^ui mcaHi'^{>m^0Jfifmţinpr^t 
ţ^mîa 9 acproinde ammaUst immhra moueiC0 iehehmt^^ M^:dWP^ i 
etiam neruitributifunt . Tertius'vem ^"^^ihisalmparţiipis^vt^, 
qucefthi mokjlidin afferrent^ cognafcevmf > ^ ţnţulfarmt. Q^, 
diftrîbutio fumma prouidentia iaflitiaque pcradt^ eft , quan- 
do non ^qualker iecundum candem menfuram particuJk 
quibuique neruos impertita efl: natura , fed vnicuique pro 
digniace & mtiriere cântnm cribuiCj quanţi indigebat^ proin* 
Ncmî vn> ^eqiic tribui erat squiffimum. Partes ^ero, in quibus pauci& 
^o%|aita- Civax fiiGtcariKS, Anus pr^cipue funt, manusvidelieec 8c 
^c^iif^t. crura jin quiUisneruivdidiatque ctdTrfimi conipiciţimiir, 


Digitized by 


Boa*nodâqaoafsikil&nacame,:atqueadipeconteâi,fe- ^ "j 

- ciK«iuffi'fetoîosi\ibafpeaumcadant;;y,emm€mmquodj:a- 
les'â namra effidi fint: Artusenm,'mqmt, Gaî^. de viu pars..: 

cap. 1 1 . «2*^oi T#^^^^^»^''^^^'^" ' ^''^•^'^'^*'^^^ '^"^ 
fl^(mzJî^WMf«^/«^'i2r«î>«î^.At(îuarauisomne corpus n^ ^ 

&- validiffimos obtiriuerint vfaciem , qus oflea tamcn eit , & ^^^ ^^-h 
paucaadinpdum carne contc6ia,âbfque neruis effe nune ft^Hi^^. 
Hippocratesafferic:: non abfque ijs;- profecto, quifenloriis yţiardii- 
inteiuiuht,cuiulraodi fum optici, audicorij, ijque,quibus g^dum. 
odoratus Se guftus perficitur : plurimi enim ex his magni lunt, 
&coiifpicui ifedfineijsunmmodd, quimotumimpertiun. 
tur,quique-adcoteimesfunt, viu part.: 
cd^uod esguus motusfpeaetur infacie, quem â foia carno- 

fas^Ceitmuicuio& membrana^ quaraipfa pecuîiariter habeţ,. 
fieri plarimorumfuit opinie; vndela!:ummufculumeutnţ.îe- ^ 

riquc appelkruntiyerum acuăiis intuenti varios in ea i»utcu- 
losreperiri.certoceKkisagpâfer, prout¥a,rias funţpartes,quffi 
labia,JUEiuiapiBasei,.&inf£ră3r mandibula, quşoronesjprou? j 

pecaliarem lu|)entinDt&,p"eeuliares cţiasa muiculos pbtinue- .^ 

re^V ;^tt:Hnett.qmana:ui, qujâsmufcuUlu ab anteriore cerebri 

parte excipiunt, per varia calus foramina prodeuţjtcs, terţium • 
psa;cipMepar,in teHuîa:ceuftamina>acfilameca diiTectijin car- 

nofam-membrana, & in iam diâos mufeulos iafeţunturi ideo 
iatc£xarne&& c^afubfibraru fpecie:eos p^septare affirinaiiit., 

xsîx . ' Ca^italUturâsii^ekălIa tres j alia qaâtuor. Et 

aures , 5d ternââb anienore> gvi^rta â pofterioFe c a- 

pitiş pariţe . Sic quidetn in capiic , quod quatiior ha- 
bcî^oea^^veFQ quodcres, iuxcâames vtrimqueiunt»; 

&' âb anteriore {>a'rte : pofreriore vero part e futilra; 
iiuiîa ^ft VN^at in^ V quod 

nus*. ' 

m» 17* 

INcipitihîc de offibus^agcre ,.qu^ corpori IbMUtatcsî > re- 
aitudmcai,&fp€cie£ucsbabcreiocmcUb.d£oiîium li^t. 

Digitized by 


rmituSrV, hîbeat^carncs^ curîs omniiun coîlîgatioaciri ac conftruâio 


cxhibc-- ^^^*^ & vense p^r corpus difFulae fpincunî, fluxum> & motunu 
K^mifl^io Oflîum veto docirinaoi Medico ( Ghirurgo ptx&xdm , qui • 
ixcm, , coB. ^ ^ffiduc traâare cogitur^ ) apprime ncceflariam cffe ai^ 
^^diAentio-* feruîc m cpiftolâ ad TheflEilum £îkm- per haec verba * Jd 

^c^lfmtim pfttwnem > ^ ofpum contrUorum refiBionem r dr ţerforâSio^ 
«>îi;gation€ ^ compodtioTiem ^ ât exemptionemf if.rdimmt curăţia^ 

^Qj^.Tt-nem maim induflna ^Utur qms qms noumt qmlîs eji iccus» 
fl^xumĂ^ #^î^.t/^e/? Oi , ^î^oi exeolux^mmeji. Plurainixpc a^gaTOen^, 
motuin. turn knpiit hbro de oîTibus, deaidc. ,deira(âur. &luxatio* 
a^^r ât nibus^db vuîn* capk, ^c^iibi; qua^somnîa fi ia vnum rcdigan- 
dko per nel mx > integra , & vndeqiîaque abioluta euadet rei kuius tracia^ 
ccSâxia. tio, quaein plurcsdifperfa, manca quodammx>doapparet: 
io!iîci ini- etenim adeo exacTie oiîîmn hiftoriam calluit Hippocrates > vt : 
tmdei^icu- {^c dc €G loquâtur Paufanias. Inter ApolHnis donaria ţerueîus 
ja^fitb'ibio ^gîes ijuaedamfmt€X der& hominis , cui , came conjumpta ifila ef^ 
^^^* fmt reliquaiijfa.Aielant Bâlphîci al Bî^ 

Un^oS^hi Incipk veroâ capite^cuiusoffardiquorum omnittmcffen<^^ 
co ib^ietuiD î^am & Hîenfuram docuerat îib- 5. epid. fee ^. Ab bis enim 
€apk!s'oira q^^^ ^ radice quadam fpinxtruncusdeducîmrrâ 
xcii<îuoîuiii iî^ ^ maes , c^teraque artuum offa deinderamificanitir. Offa» : 
""l^tX iaquk Ariftot. alia ah aŞstiem , 6t^mnia imerfcAţta , vmm 
h:d^^v^^c.y. cmîinumtferimtmoâo'oenarumi necefi'olîumos» quodfecrsum 
oSâvnain i^fîimperpmaneat.Vmnimxcx^o fummuspxa^cepcorconfî-t , 
iS^- d€xzxâmxx7i^y<px<^mxoi&L^ 

4^ venaxu-, ijs co^nitîs , cranîj etiam ofladeindecagnofcantur . Suuiras 
diSr^ igkiiî^ { fie ^â^ quod tonftitis rchm fiBtperfini2es^^tiî^ 
s^ur? quid cuie GaL in proem* Jib* de offib* iiint mmquc ferrarilcs^^ 
^^^' fiutn <rouhmCiiones , emînenidjs quibiildam <^i^i€wkm 

vf^r^enT- âltem^im cocîipactar ) non eflifdem fmitgeneris, fed aHaj 
»^^ • quidempJ^ri3£ iîint^ aliae communes^ Propria? ^cjmtur^^ 

qitsecranî] oiTa inter fc eoiţtexmhTaat; Qonţî3^^ 
vcîx futurşE quz oiTaeacfcnaaruperiori maxHl^lpiieî^oidc^ & Eiimoide 
^'fe diikt^nt . Propria Infuper in varasadîiiic ^ &fpuriâs {ub- 
duranaiurx diuiduacur . Voixiknt OiSximîkm^esCG^^ 
kecs nume. ^^^^^ dieiuniâik » 4}iix tres proMt pdmimuiXLa Xc^Mtuliimna^ 

iegcs nume 
raniur . 


Digitized by 


liceţ ia |y»dpi;e^ vU Re^m d^ 

tempOŢ^ ti^akicrfîm ad 2^^ lambdoides in ccci* 

piteâAgr^caiittcra, cuius figuram refert> appellata; Sagit-. 

talis d^miim , qua: re<Şâînteţ has frontem verfus excenditu^ • 

Spuri^ auţemdu;^ iiliu^r vtrimque ynafijprâaurcs , £qmm- s^^ (^ 

moik diŞ:£r> # q^d^TOpitis acţemporum oliâinackm ^^. 


tu;r im^^^y iŞc coâl^aiat . Communes pariter |uţu?? in ţre%; ^^T"^ 
ali^^ dtoyuiitwr^froBtaleni fciliccţ^fphâcnQideanij^ EchmQi- fant,& q^s. 
. deami quas vţ minus iuc neceflariaspraetcriRittimus> cum 
apud Anatomift^ş ^liquidius eas vidare datum fit . Saturarăm suturamm 
^uamulupk^tfi^gn^î^i'âCalcnoIib.^.^ 17* ^^^* 

noiimoddad fuUgi|>oforum excre^^ncc^fum tramfpiratum jj 
cum capiit vdy t c^cmb todinfide^tcorpori, cmnifqu^ 
g€^cm¥ap^r^s>hiiîîîprcique iuriunirepenK:s> exciperena^ 
uuin fit:^ q^ibiis^^ifi exims patcae per iuturaş ^ maJe vdque 
conlukum^flet ^nipimţis taiuti; fcdctiam Wpet ^ascrafe 
meninx mţitk oiT^^igarjetur , quo mk > alia quidem jptro , 
alia auteaj^e^tM cxi^iîej v^qu^ varijs fib^meniis pericranium 
cantex^€:taăd^ raîer et, IFu^iuni pr^t^rei ad cxmi] confer^ 
uatkm£m£<3^teKir> Vt fi quaj^do percuilirm > ryptuxnque 
fi^rie^i&p^r^Ey.mi\^pjH3^l^j)i^ d 

tur ilik & oefl&Jii: , vbi ipflimnie^ iâu<:ium'os coficerpiiqatur • 
Diximm i3juEurMttm^ife^ai^ ^ diiîe^e^ &v{urn> prout 
nacuraliter & yt pluria^iirp pffc cordmmmnt ; Aţ Hippocra- 
tps>. pi^ter eoJ^K^Ja^Cy qiiaidan\ afii?; vari^ta^es, vt quid 
î^umijq^ia? p^a capips%uraiiîai diu^rfitaie moftruofe ad^ 
modum (jtiaixdoqM^ aceidere obifiuaucrar * iatis tamcn di^ 
minute yifeam i^n Jeui3 ftibeat fi^icio de aliqua ţe^ctus muţi- 
lâtioae>cum mn alia3 proponat futuraş io prnxia figura^^ quara 
eas > quas luprâ aure%fpurias ^fle aifir^îa^imus , prseter corc- 
nalcm >^^ & lao^bdoidiem; Ip fecunda vcro eaidem ipunas cum 
Cdb. -coian^H y nulja;â(^la menţioiie de fagittali , quse tamea 
fempera<»k0e^Qniiicuit. Alias cuampi^tcrmitiEic^jCCKfigura- 
mm. 2. ti<mc&, fc^iis quam fe^it îib» de vulii. capit, ex quo Iibro tex- 

^ .. -: ' " nihil 

Digitized by 


Î04 " mfPOCRMiS'^^sl Im 

capita mmi ... ^J - , , . .^ / ^^ v- . ;. •^. .,. : 

iatcr fe co- eodem'mco eonjfjnmt: Veridmqmj^i^s e^ţn^o^^^ 

benr^nea^^e "^^^i^^^^^^^ -yf^j^ ^^^^f'^^^^ Yofnnia offîs ţars emw 

fumrxomni mnspfdiMia) huius(iitUT^ conftfiunt in ccipite velut Utteră p-r^'- 

CO confiâut. cai fingituTy bremorem eram hnemnaÂfrominenmm trajuerjam 

' ' conpitutmn hahet'y /dteram ^erol^^ 

y^^^do^ficrnidfimhn^ Quiveroexjpojte^^ 

âmem aâ front emfemper cQnJiitnta ep . Quis qui's autem ex vtra-* 
qne capHs parte ^ anterîore , ^ pofterîore prominenîiam hahet » 
huk flituri, fiint^mlmr cmflitut^ ^elutlitterâgr^ca H Scpihitur* 
conffflimt antem long^e-^uiâern Imedt ad 'vtramque frominmîiam. 
tranpAerfe; : hreuis auţ&m.ţer medium caputjecundnm hngitudU 
pem- ad ^vtramqm longam Uneam definens . Jt ^ui neutra parte vi* 
imîfrominenrîiâm hahet , ho fiituras hahet x>elut litt^agr^ca X* 
pingiîur . Conjiflui^ autem ha Irm^^ altera-^idem-tpanjuerfii j3Â 
tempora p&rtin^ns , akera -vero fecundufn iongitudinem per mc* 
diurn capiitu Hanc fiiturârum hiftoriam probatik ciiam Gale* 
nus y nacur^queprobabiJiratem 2Ltiuhtlih. de oflCnaCo Szg^ 
siimrartîm de vlu part, cap, 1 7. plurks citata. Hoc idem &ntîtCeHus 
ioms, tiec lib.5. cap. 1. nequeemm cer^useanimnumeruseft , iîctit 
iiuîi\i£U5* ^g^ I10CUS quiiem • RepugnaRttamen rccentiores Anatomi'* 
%,x Calumbiîs > Fallopius^ & Euftachitîs, tanqiiambaîfuti^ 
rarum varktates lecundum variat capitis figuras nuaqiîam. 
%e6teîîcur m naiura , *prout ipfis nunquam vider^ coacingic^ 
quamuis innumeras cataariasinfpexerint: QHodtameaHîp^i 
pocratisfidcm nequaquamredarguic, -qui^ obicmator diîk 
gentiffimm , potuk rara qusedana videre > quse>ciim yddera-: 
ro contingaBr ^ ali)s muîtis obferuare non iiciî^rit , v^I quod 
propoutio \ixc non fit secern^ veritatis jg-vel quod'peculiaris 
coeli iliius condiEio variecacis huiiîscaiifa extiterk. Varietatem 
profe<5lo maiorem iuturis-li^b. î.& z.dehifLan^ 
& de part.cap.j.videlicet quod mar^s pla^es hzhtdmSxtmmy. 
quâtn fbemm^^quibus ynica eftia ^rb5;-marii^^s vero ctes fiw . 
tursE ad ilimmum v^rticemiatriafîgulifp 

" aefcio 

Digitized by 


xM7^- mMMmTM,ms îuysrmMmv : topi 

, , . : .:^ ...;■...,, .'.,^,;.; /. ^:, .. ' Âmsh . &KQB 

^^^- Sanioresatitecapice&atţjuîpîuresi^ samore^ 

/j^„ 2iim:p fCtkxcyeihd^Blaritascorporisa^ k^ t^^ 

&iraticmmp4uâm minus aî^er4ur^mQrhidiores^ Qulproieperjp'^ Si admct 

Qidmdifer^rauUţriuJqm^ zfhiaumn f^^^^^^^ 

^grotanmt^ drffidUmâfmrhis recmudep^tmt . if ^c 4?^d7^ c^ ^^î^ . 
^p^3^i4 Salubriter lîiagis ic^qued^gunc^ <|uibus ^c^ 
ribusinter^f^iBB eft;âitiiri%^u6d vapoces 

rtiiîi ms^ax^m^itee efeu^nji: , &^^gnkurdB capke ,, qu(i ' v 
plures? fiîi^mrsE:^ câ &iHiîS':âifcatianEur 5 a^ difîipentur : 
Qiîas fîob'.rutUE:^ainidefeâam'fednericont^ ionuaic- 
rismorbis parapboricisj-caiaphorkis, cephalaigicis,atque 
catarrhoicis prsbebitur occafio ; Atqui reiiuic concrariuia 
ientit Cclfus cap. i,iib; Svprobaus capitis valţmdinem eo . 
^e commadioreni, qtio futiM:^ iîinţpaiiciores-; Qumimm% 
aiîâ inte^diim iccidât:, ( rarâ^tamcn ; idqu^ fâctriog ^ftuofis 
intoas^^tofla pturimiîm^exficcataj penitus coakfciim) cal« ^ 
iiâ^am fii^idâm fierî-& 2tbf<^€^&^*ris > vt mvho mx^ annata^ . 

^jjj3^ ^. uerat Hipp.lib. de ftruchomovbi aflerit mu^ri-caput foîidă 
fine fucuns;& iUiid quidem humidum; ( per accidcs Humidâ 
videîkeEofa reteiltâs luperfluitattes^ quse pcr^^^ . 

nequaquam pafiiiat ) siUud capui firmiiîuiuim ^^^ â dolore 
tutiiîîmtim'efre voîuic* Vt conrrouerfiam banc compona* 
mus , duo nobis funt prius iupponeKNda , quse ex textu citato alim*man^eâec<^Bigum Prîmum ^juad capur^\ -^ 
quemadmodtim cseterse omnes partes y nou âb intxiniecis ^ ^ 

tantummodolsedicur, vt humoribus,atq. aîituaiîs escremea- 
tis j verum etiam- âb cxtricife<is,^oîe videUcecv Aere, Ventis, . 

n^ 34. violenţîs iiicurfiombus^ yc ample docuit Hippoc, lib,^. de 

morb.i ac iicuc rara textura commoda eilad-euieandos mor- racâi^oS 
bos > qui ab^i^triafecis caufisprouenimit^ libcrum ijsprebeiîs ^ ^^ J^ ^> 

O cgrefiuaii 

Digitized by 


ueaientcs i adcft adkus > facile oicudi poreft ;^ :&e CQmtzdci\fz tcum^ 
sd^eot JqS ^^"^ ^^ ^^^^^^^^ caufîs facillime paticur, hoftibus non dato 
ab exţeina egrc0u ; iţa exţ^rnis Valide refiftiţ^ omni dempto adicu: quod 
ptoixenmct. jjq^vdo docuit Gal. I. de tuend. val. & de opt. corp. coftit* 
D€opt.corp. Dmjiora y'mqmt ^ciXirpQtaĂ caufitintemis ţaîi p*ompi:e , r^ 
"^^ ^^^^ ri(^^ facîMus k caujue^ vero &ppoaendum 

cftin euacuatione qtialibec.vnacum exqrcmcmisaîiquid fe\n- 
per vtiîis materig diffipari , vn^epars imbecilliof p 
reddi neceîTe eft: Quapropter ii:^ fuliginum^per futciras exclu- 
iîone , vbi potiffimura rariores illa* funt > plarimos ctiam fpU 
ritus euanefcere putandum eft , proindeque caput/debilius 
f^[f^/^"^ reddi. QuibuspohtisdicenduiîxexternascauiâsCelfiim re- 
Hipp. circa fpexifle, quibus, quo folidiuscaputcft> magifqiîe compa*. 
fuittias . ckum y eo validius abfque dubio refifiic, tuni dencgato om- 
ni aditu , turn j^aturali roborc , iob ^iriruiyB copiaî» > qui in 
hoc minime 4yfîp^^î:^î^ = atque.hinc.dixit caputhuiufmodi 
effe rpbuftiffimum . Verum cimx dcficientibus iuturis «lorbi- 
ficse internss: neccifario procreentur caufa? in capite > reremis 
nimiruni fujginibus : excrinlcc^? vero caufae e^onua, ,qu^. 
plures luturas ofendere poffijnc ^ de neceiîitatie iioA âat ^ led 
poifimt adelTe & zb^St j ide.Q JFJippocratis: dii^um, & veriu^ 
etfe 5 & fepius verificări pronuncis^irni^ş ; m ^mmÂim c<j?. 
gamur homiaum . capita ftuftrâ ferraciş petâinaum compagi^ 
bus fuiffe conftruda f 

XXXI. Inter fupercilia os defccodît ^ ac traafît ^ & mandi- 
bularum claiifuf a in medio menio * & fispernc sd 


capiţîs con. /^ Aput tota ea pars eft ^ quse coHo vt columnf Jmpdfîta ^J 
^'£iSo°.. V^ vclut ţoms opificij culmen fup^^reminet, ditîiditi^rqMe. 
in cranium & iâciem . Egit fuperius de offibus cranij dum 
futurarura hiftoriam explicuir> quarun) minifterio huiu/medi 
olTa difcriminantun acorpn^i namquq os frontiş defîgnatup, 
âJamdoidcos accipitis;afaggiptali Q&,diiobj:egmatişî j i 
fqMammolîs dcnique offa t%m^Q%\mi 9^f fe p^^pria^fî^ 


Digitized by 


^^ ^onnumerarc vifus fit ^ dâ<Hîatriuiîi :imma^m «xpkîis^ 
^ cum tamen^poftîxma hasc duo (ipfeen<3*d^nei^ 

ti Câluarîae tanquâm ba/îs fubtenditur ^ immd inter onmia 
^iim cranij , turn %eriori« maxifla: ofiâr vclut cuaeus icfig^- 
tur, & palatr ^s nunciipatur; & Ethmoîdcs , feu fpongoidc$^ 
quod itttcr fupercilia iii bafi frontis refides, cribriformi, fpoa^ 
jgiofaquc fubftantia peruium M t^^- ^ 5- iii>- ^^"^ expiicaii- 
mus , nares ,' & ocularum iuxta internam iatu3 orixitans 
CGnftituit)fîm potitis^omraunia;- itâv^t inter faciciofla a^que 
bene connumeraripaffirit -.. Pergitniînc igitur agendo de 6- ^*^v<>^ 
ciei oflîbus , quse duplid-maxilla-y- fuper-iori'-fcîHcetyinferio- 
rique; proprie ibmprehenduntur t-inter ea tamen ethraoides 
. connumerat ,- quod inter fupercilia ad nafi radiices locatum , 
deorsum dclcendir^ţ^ctinîque fuperiori maxilla terminamr . 
Venim tain compVeffo fermone, atque adco Ienicer hasc om- 
riiâattingiriî'rt indicare potiuşVquâm dcicribere vid^^atur, 
bonarum artium fcmina iaciens , qu$ aîijs fortafse libriş ex-^ 
colere;fibianiînopropofuerat. Maxillarum alteram fupcrio-^^l^««a 
renT^nfcrîoremalteram eflc cr^tio. 

^ betimmbbHîsîeft> vtnotauîtîlippoc. iib.;deardc.> excepc© Ar.îii>,5^ 
tamen I^fâco,&Cocodri^IIo>ytteft^^^ ^g-y-eiufd* 

an. cap. i r. ^ & alibi . H<ec adincidcndos > mandendofiq[ue |^^^* 
cibos mobilîsâ natura effiâaeft. Gomponituriîlâexpluri-iâ-. 
buîJ officulls i quorum numerus xontrotierticur inter Anato- 
îtucos > quipîura y vel paucipra ^cohftîtuunt yprout ^arias ad^ 
iâcentium oîîîumportiuncuîas inter ea connumerant^ Vnde- 
cim tamen vere funt ,,ytroque «x latere quinquc , & vîium in 
medidîocatum. Primo externus oculi anguîus, ac magna or^ 
bit^eparsconftitnitur. Secundumofficuîumefllacrymalein f 
angiîlo iîîterno > cui câtumcula ineft , qu3e ftillantem de cerc- 
bro humorem gîandulse iiiftâr excîpit> expritnitque in nares 
per foramen , quod in eas pcruium^habet . Tcrtrthti omnium 
maximum cft,omnia dentium alueoîa iuo elaterecompîe-: 
âens, orbitaîî^5 malum , magnamque palati portionem con- 
ftitiicnsi 8c finuofumyalde eftj quapropter^vt dixit Hippoc* 

O z iib* 

Digitized by 


ie ns cnî. Quai^ţujî^ j^ cxîx^mp pal^ţiiedem pccupai^ <juâ videlicet na* 
xes ad palamaxiiiB^4>,i^rui^^.; Quiâtum denique ad nafum pe- 
oiliaritcr pertinec . Şi&addi poteft; vndeciîium|<3upd vomer 

plici tancMm oiTe .coAftruciae efl;j^.^ja^âg^riu$ in t^fi ^y. ,flHQ4 
mentum dic^kyr ^. iŞ^iipIici fucuta , feu ,ha^^ 
tur> qua? depeSitiĂ^i4uljus>^i|afyGj^k^ 
rius vera.ycîu^^jq^uc.eofum dupîk^îţi;:haUetap^ feu 

proceiTum ;, qt^orum lofigiar & acutior temporalis^mufclili 
tendca^em excipiţ ^aker v^ro , qwi hreuiar eft j-ac rofiindusj^ 
cauicatioffis p€troh>feupociuşiug,alis^b,^4i^orio meam 
iîiartkulatuv > cums îujc^tiaiiem ia, ori« hiam JQepernoa fine^ 
magao diferimineaccidere afîcrkurinC9ads.»î^'ţ^^i^,^.op^" ^^'^' 

' '^ -^ -^^^^^ ^<^//4^4^^^njî^K^^??^. & .^î^ 

ixi^arr^îne! ^^^Hî hiiîoriam ţcţuîk hi^^vcrbîs.. 31^3^^^ 

Excludithâ ma^lUcor^liiMţ acMnmiUyCum alterocapite fiiţerius Jît^alferL 
msox^^ i^f^^^ • if^,^xţrm^ i^iji^^ g^^ p^rtes ita p hdbenî.^ vî: altera. 
Qh kngitudineptnon facile ac^ejfîim admittat ; altera pero- cornm 
^> ^ S^PK^ i^g^le QS^xceâii . Simuî auţem ^^ asmtarw^ hArum] 
tpctrcnfjatu nermjlundoneş exi^mt^exi^ţiibm mufhtlfdepmdm^^ 
^ ţernforales > a£ manducatorţ^/tppellantur. Frppî^jeâ auiem ap*' 
pellantur^^ proptereA 'înoumtur 3 eo ^md lîim dependent : nam^ in. 
cdendop ^ in h^uendo^ ifinreli^oorisvjk^'fiiperna quidem 
maxilla quiefdî j ep mim capiti cmmxa y Q non codrtimlata 5 in^ 
^ ferna autem maxilla,moue^iir : codrticulata enim ejîdjupema ma^ 
xilU j ^ â capiuy'xâx Galciiuţzi cdi».2tfup3:4 ewhdem librum 
pardcula4* ,.^ 


Digitized by 


xxxit ., Ve«kuîâali)^ura5dijpaudorahabent,<^î^â^ aiî^^ 
dora hăbentj^hîs duod€ui§mîî to Horum alialur- f^^ 
siim^dcaimtîalîadebrsumadfedemtend^ • 

PRoximacapkifpinafefeofFert, totius offium compagi-- ^^^^^"^ 
tns bafîs&Mdaî3^ 
ilim<ii^ r imtimz m onmBus > ^u^ojfilus conpant.Jpinâ e^y^ ^^^ ^ 
î^quir i^îfti"?^^^^ cod^mtata ex/oertehris } âcapite ad coxas [''^^'^[^ 
§orii^i^^^^^^ exc:auata> magnam cere-: ; ; 

Bnpr%âginem conţine t^ 
cerehrlemulâin j^cuius vicem 

ilerMs origiiiem prgftat , qui partibus omnibus â capite ftn- 
farii''& ffîotuminiperduîitut. Sacrsehuius meduîlş P^^^E^ p^^X 
griacSu^ eft ip&ipîna, qu32 &âdeiu$fecuritâtem^ & vtani-^ buscoDâiii- 
m^cumante^tumretrâm '^^^'* 

mîc^bus cbnftriiC^a/qne vertebrg, feiî Şondili^nuncupan' 
tur y qui ad varias mm coftarum > turn inter ie articuîationes 
& robur 3. vmjş ^pophy fibus atque eminenţi js obîiquiSjtrâl- 
ucrik&c zcniiSy â lateribus.:, & in pofteriori parte fuerunt ob- 
lullaţi : De qua fpina nune agere intendit Hippocjatcs , cuius Deofilnât* 
^^•^* xi&imrmm^^ <^^ nat.:, & de ^-;^^, 

artţţţi^^aniuiş fpina fit rota ea pffiumcompagOx^q na^. , 

piţi a4^ facrum deducitun^ vţ ex Ariâoteîe fiiprâ aflertum ^^^^fj^^^ 
c|t ^ i^xgîicuitq: Hippocrates ipfemet lib* de ofl. fac.; eam iii uke^aorsu, 
cerujcf m;^iu^^ > & îumbos , vt commumter âb^ ^^^^ 

cma^us^^Aîaa^micis -cîiuidi iolet > per hf c verba t Verticula. cerake fcp- 

taf.âuotoihi.^^^^ iuxţâ latenim. mollituSnem ^iy^i^^nlmi^ 

''^»,^3{miî1y^i'if^H^<^'^^ . ; bisquinquc 

'^WâJ9'^lF^ ^- ^^^^^^^^^ ^^ lunibQ i ^^tn^ue ; Attanien , vt numerâmr. 

npţ^i;GâLţc>m^ Hip- ^^f^ 

ppcr^i pro (cafolumm vertebţarutn compofitione^.qug ah Hippo/ 
i<>tip^ ;&lumbis adiacet 5 quod ipfiim hic paritcr feeifîe cenr ^^^ ^ 
fcîxijm eft* dum vcrtebras duodeuidnţi efle afîeruit. Jii- fuuc > qux 

-v'iv-^'---' '''--' --^*-^- -. ■- .....^, ^•-- ^ -^ ■ -eitin dorfa 

qUitv^rgO,^..^.- , . ^ •; '- ...^.-— : : . ^ - &ialumbis 

¥ertîcuîâ aKj^ui^IO paiaciora liabent, ^r£: 
jciîs tpţa cx virtcbris quatuor & viginti fţcundiîm naturg ie- 


Digitized by 


işo, mPfOCB^l^,MB.iţ,sm. LOC. m SOM. 

l gesplerumque confimatur : poţcft ţatnen hîc numenis prg - 
ternaturaUter variari , & plures eâbjV*! pauciores : fu^ enim 
quxyndeciffiîfuntquitrefdecimvertebrasin dorfohaSent, 
penes quas coiîamm etiam numerum variari contingit . 

^Qa» pauciores hăbent , his duodeuigîniî fun^^ 

Hkprocul dubio duodecim dorno&.qujnqueîumbQruit 
vertebras enumerat, Giperaddito iofuper ofle |acfo,quoâ im> 
ÎS^ţ: S^*™^«^'=<^^*'napP^l^auitfcc.4. Hb. 2. epid. relida fcilicec 
ţeiiauit os ceruicc . At cur addiderit . Qui ţaucioresHabenti nandum mz- 
lacmm. hi v^de conftat,cum nuUumfit dubium, quin aliqui hispau, 
ciores habcant,vndecim videlicet in dorfo , vt docet Gal. lib. 
de cfir. cap. 7. immo ; cap. 8. rarius fupereffc, quam dedie 
afleruic j nifî dicamus , vt raro euenit naţuralcm numerum va- 
riari , ita nunquam HippocraticontigifTe pauciorcş quâm de- 
cern & odofecundiim dorfum âclumboşinhiimanofcelc- 
to obferaarc, 

Horum alia fursum ad capăt , alia deorsum ad fe- 

nenna$ UI as , quibus ipma in poâica parte 
vertcbrară vere coiiftituirur : Etenim , vt âiănm cft , Vertebrarum vna* ^ 
f^^lsf quarquc plurifaus €xtuberatproceffibtis,obliquis, tranfiierfis, ^ 
& acutis . dbliquos bkos habet âb vtroq; laterc > quofum ^ 
duo furiiim , duo deorfum verguntad fuam cum ca:teris artî- 
cuîationem ; Vnuin in vtroquc latcre tranfuer&m ad varias 
mufcuiorum inferaooes > arţicuîatione% 
tus vniciîs poftica in parte eminet, Ipinam prc^meWnftmies: 
Qm acuţi proceflus â fecundocemids v%adde?^ 
potius vnd€ciHîum,velduodecimum dorirŞbndyluin, quafî 
hamati dcorfiim adfcdcm vcigunt: quemadmb&miipfa vn- 
dccimo , vel duodeeimo ^cepto , qui inneutram vergitpar^ 
tem y reîiqui omnes inferiorcs fursiim tendunt , vt late do- 
cet GaLIib.citato de offib^cap.S^pinam eleganter defcripfît 
Plato in Tim^oSţh^aMcinit,offei!L4uafi tomofadia , ^erehr^ 
cirmmfepjit • Huic m^as^ rdi^uit meatns ^ p. drca cenagis 

cari inesfuhMditMvt âca^teţermmi ţmendmt ^Sicvtiqut 


Digitized by 



qHcdmp.m^^^ptmtiâfmtusflexim gratia . 
xxxîii Coftâe feptem a pofteriori corporis parte ad vcrtî- ^"""^ 
cula coaneâunturjao teriore parte in pectore inter fe 

TRu^eus Kumamicdte ; vel patius , t&orax , cx dorlali 
ifim, coflis ^atque^ erno cohflimitun £git fliperius de 
ipina; ifc <:dftis,atque fternoeum nune agere par erat. Cofte 
autem â dorfi fpondylis iuxtâ tranfuerfarum apophyfeon ra- 
dices 5 velut râmi â trunco hinc inde emanantes , duodecim 
abatere vtroque fruâicantur • Harum fuperiores feptem ad coâxduo^ 
medium vlqu^peBorişexporre<^£e>&cum^^^^ fppndy. f^^^^^^' 
lis,&cumvfternicarcilaginea parte adnobilianiv^^^^ laterc mt^ 

.tutelam articulantur : ac promde , perfcCl^ cum finr, verse & ^^^^"^ 
lecitimae nuncupari mcrencur , quas tancummodo hic confî- 
derans Hippocrates , feptem tantiim coftas enumerauit. Pau- ^^/*f^ 
î6fecusAriftoteIes>quicoftasvtrmqueoâ:onasefreafremit> cz^%T^ 
Harr^s de gente Turdulorum , ( qui Populi Hifpaniam B*e- 
ticam incolunt) , quorum homincs feptenis co&is creări fe^ 
ruat ^ ELuUius ido^ei Authoris teftimonio conftare . Arifiote- 
Jem^cuţus eft Plinius nat. hift. lib. i). cap. 3 7. Coftas homi- 
ni odonas tantum 1 Suibus denas > Cornigeris tredecim > fer- 
pentibus triginţaaffignans. Sed vtrique eo decepti funt^quod 
oâ:aua cofta fatis vkrâ produda , ipfa pariter cum fterno coi- 
rc videâtur : quinimmo defadio quandoque coit . Csererum ^^^^^ ^ 
iafetiorc^ qma^e 3 inchoatse tantummodov, vt itâ dicam > in'ccfta^ium 
alij{queWcuior€şi,>articuIata£ quidem cumipondilis iuxta ^^^f 
fpifmia i. fed paulatim deinde in cartilagincum quid dciinut j 
inţerk^wminventrefpatium exoiTereiinquentes^ad natu- ^ . ^ 
ralium vifcemm extenfîonem in cibo &poru: Quapropter hg ^J^^^ f^' 
inipcrfcdse cum fint , fpuriae atque illcgitimae inincupantur . ^* 
Hoc totum his verbis expreffit Hipp. Iib. de off. nat . CoJ^^ 
itixta difcrimînaîiones "vertimlorum neruo annex^funîa ceruice ' 
i^pl^acblm^QS intnnfcms : âb antericre cmtem ţaxu iuxts ţe-- 
ămlMam ^mM&n Jkvmmn parţ^m k%bmtâs ^^ccu ţr^cun- 


num. 3* 

Digitized by 


Bis ănimâlilus Mtmfne ohton<e . Bactnm ţimem^ 

molem hcmo haht . Q^^ verLţarie wfl^ nonjmmy ekmus ohlU. 

quus 9 hreuis y^ latus ad jht^â yerticula. nemo atmexus efi. - - 

XXXIV Clauîcuî^ atîiculos habent alios în media 'pe<Sto- 
ciauicuiaiu x\s îuxtâ guttur> atquc liîc ccartîctîîat^ fiint .; aîios 
vero ad humeros reclinatos ad .fcapulas, quas hume- 
rîs femper adha?f eiinŞcapul^ f ero ad m 
chij 5 fiue rocius nimisl ârticujântur^inc^ 
in ipfbm os , quod in membre eff . Iiixcâ os autenri^ 
appendîces du^ prodeunt ^ altera întrinfecus^ altera 
fbrinlecus yXjuaî ad icapiiîas ofsiadriafcentes ^ infra 
: articulaţie font* <^e vero in cubiti flexurafiîht^ 
iniră quidem radio coarticiiîataî {mitymxtk os natu- 
ra cauimi exifterisîfuprâ aurem radium pauIuMm^m ■ 
cubiti gibbum : & tune tum os ^ tiim ladîus în ideftf 
commiiE^articulixmmcnbitig iuxta 

vînam vero appendices prodeunţ tenues yalde qua- 
taor \ du^ fursum ^ duas xleorilim^* Ec ad cubiti gib-^ 
bum qiiidem dn^e appendices confiftentes^ fap^â ^x 
ofîe h^reîit i bas cum oâfe coh^rentes V iuictâ oflîs^ 
artîculum m cubiti gibbum coarticuiantur • Qur ve- 
ro infra lît^fuot>&întiisrecIiriat^y fa^ vtr^quC-* 

committuntur ad radium > €x lopernis â ^m^ 
; fi^rocedentem j & intîis ad memb^^ 
&radiumappelktumciaciuntha^fîbiîpfî$ irausia^ ; 
cubitocomiî)if& . lalrâauteniad manum os artir 
ctilum hâbeţ* Appendices vero hac parte tenera 
e^iftentesjduse quidem noncxeunt in artîculum^ • 
Superiia autem & Inferi:]^ cum olîe coardiculantur . 
adniarium* ; T / 

Sceologiam: profcquitur Hippocrates, & â trunco ^' 
-artuum QflâexpIicanaa.acc€dit,ioti«s manusfcrkm,' 


Digitized by 


cxtremamqueManumHippocrati fubdiuidifoler : Incipk 
"^ -^ tamcn â CIauîculi% vţpote thoraci coiBmunibus,înaiiibu% . 
Nam duo b^e officula a fumşia ftemi pane hinc inde ad hu-i 
merum vfque flexuofa protenduntur ; extuberancia quidem 
propc ftemiim > vc vafîbus Mc pr^tereimubus locum cedât^ 
deprefl^ aucem iuxţâ humcrum ad robur : ex quo s gxxc^ li&* 
tejrse figuram i:eferunţ ^ & iuguîâ > quafi exigua iuga appcUaiw 
tur *. Dicunoir pf^tereâ âb Hippocrate cîauicul^e^, mm quia 
tbc^acenx claudunc^ ţiim quia humerum cum fcapulis firmâî^ ciauîcuiae 
acfarc^inftarfulciuat,neadpc^us excurrant: quapropter <^^^^^^^ 
fiirckula: nomen etdam obtiiiuere . Articulancur turn in fum* 
ma ftemi par ce prc^pe guţcuc j» turn cum fcs^ulis in fuprema 
bui^cro , vbi fciîicet,hjumei^U5 reclinamr ad icapulaS;, vt cum 
caîumgîenoide calitate iâi^^cecabuloarcicuktur: Hume- Hunteri de» 
i^u&namque^ feu bl^chi|îm*^t dilucide defcribiturîib. de icr^puG- 

îîu-4- ai£nat.,ine«rmimfoî:â§jfeSc exteriori parte obliquura , non 
reâum eft ai acetabuîum. îiy:^tur autem ilia diarchrofco^^ 
&u ardciilâtioms fpecie > qHam arrbrodiam nuncupanc : exi- 
guum cmm ^ depreffum.^e clauiculjae caput in baud profun-' 
damfierni. cauitatem iMferiiur >. motumquc j. etfî exiguum , 
CGnfpioumt tamen edunt ^ vc :^ni Hippocraţes docuit 

m4* fib. de oif. m^* inquien^ . CJmimJ^rctundjefiintadmiUvioys^ 
partem ; ad ţcBus ^miem hrmşs ma:^ habentes ], adjummum 've^ 
m humerum frcmmtmeş : cui fimile haberur etiam lib. de 
5 Eodemprorfu&moda&fcapuIsEquidcommunefunttho» omopht^a 
r^tci manibufquc; cum & clauiculis ilio acromio ^ & braccbijs Gi^^is sca-^ 
gtenoidecauirateinarticukatu?: Namduohsecoi&crilatera i^^p^S^ 
Sini:* &ingeatia> forisgibba^ inmsexeauaca^ fuperioribus aBarbarîs. 
coftis a cergo, pro earum mummme, luperpoiita , quse m vai- dcfciiptio. 
de excenuacis ^arum more prominent • In harum ccruice ca- 
uita^ infculpta cftglenoides dicia> in quam humcri caput in. 
feritur , membraaofo ligameiito vndequaquep;ia£cin<âum3 â 
gleaoidis ore oriundo ; :cx quo ofli huic fempei incunibere 
ăicuntor : d^ hac tamcn re idem Hippocrateş coniblendus * 

au.4, -tftlibt de qC mu iMicka^Q • Omoplatum ktitudini forti- 

P tudmem 

Digitized by 


ii4^ HiFFocsuris lAs* i. m^^^m 

atque pru. CX (JUD VirgîKiib^ I X* 

g^^^ n^c fktus , lamhumerosJîiHeBaque cdla 

Veflsfiiper > fMuiqt^ mpemorpelk Leoms .. ^ lihf. 
' Ofiâniitlatof himeros . t^c, 

- Offi âutcm^quod adfcapuIăVrecimari, tjkfenîqueiiiarti- c 
culari iam. dixioîus , bf acefeio videlicc t y fiu€ hun^ero ^ offium 
omnium maximo , crure excepta Se tibia , u Galeno cre4i- 
mus cap. 2 5 offib.,mlnferiore fui patte dîia? ixîfum 
phyfcs, &appendice5; noniU^quidemy quarmufculiscar- 
pmii & digitos mouentibtis origiaeiB prasbem , fed qu2& 
trochieas eflformant , arque infrâ iacubiti fl^xura cum vina & 
radio artîculaiitur, quaîduoăiat ofiSfc fecundam m^uspar- 

Ci.i>iui3^. teiiî, quar cub^iciîs appeliatur, conftituentia;f ociîe mzmsy&c 
{ocilcmimxs appelîant Barbari . Radius^etenkn atqiie Vina, 
qu32 cubicus etianrdkiiblet^-braccbij cracfeleis inarticulâîa> 
arciculum in cubiti ftexura efSciunt r ciiiu-s znimiitiovÂsx^ 
tîonem d^fcrlpfît Hipp^ lib, ckfiaâ^inquiem. ^QarSnifQrmis ^^^^ 
ejthrdcch^pars m cubiti fid^^ hac fi^ra rnmtmfyoffîhmiuhiti 
^hracch'ij reBiîuâinemfadty^elutimumz^numeff^^^^ ^.. - 

VInademqueyfeucubitus&.jfeciîemaiîisy4^ţ^tu^ P 

appendices^ diias quicfen^ in fuperiori parie > quas roftra :, feu 
coronas appelkuit GalenUs > quse br^chij cauitatibus immit- 
tuntur; duas vero in parte ir^fima, qu^ idea diciimur intus 
feciinats, &quodcomiîVîn:unturadradium:, qaia^ cum vi- 
na & radius ea fînt racione conftruda , vt in vtraque extremi- 
ca:îe fîmuîcoaîcfeam, dchifcâiHaucemif^ medio ; VI^^^ 
dem in fuperiore fiîi' parte humerumvcrfbscraffior cum lît , 
radijtenmorem eKr^mitatemexcipit; iîcute contra^ in. e^ 
tremicace înfmori , vbi ceiHîior eft > in radi> crafiSorcm partem 
ifîfinuatur> itautcu^îB ipfoco^fcat, vniamrque :. Vnde duo 
h^c oiTa quaiî vnum funt > miro arcificio ad manus & cubid 
robur > acqtieflextiras varias efiormatum •. lufeîiores er<yo]i$ 
ipfius vlnae appendices muica carcilaginemuokta?, ac proinde 
tenerx exiftentes y non exeunt in articalum ^ hac eft , nonar- 
ticulanmr cum infima îîianu;:, feubracchialiy.îquia aoacâ 
vfque exccxîduntur , ayiftyloide ^odam proceflu , .atquc 

* mc» t 

Digitized by 



^incdia copiofi ckrula^e mtcri 

potius vniumur, &<omittantur afli, quodad extremam ma. 

enim eft> qm bracchialis cauitatibus foas cubcrofitatcs irnnu^^ 
cens > octremse^tBântis articulum conllimit* 

C^teruîîi ©anus artlcuîos raultos Babene : Qu^- 
cumque emmoiîkiflter & commmmur , omaia ar; 
tîcdo5 faciunt .Digitî ardcdos h#ent muîtos,vnui. 
quiTquetres , vnmn ad vnguein in me^o vnguis, & 
nodJfe promînentîâeialteruminîpfa nodofaprcmi. 
neatia , qaa ţ^rte etîam cîigitos confleaiunt: tertmm 
qua parte cîigiţiis a .mana^^^^^ 

SVperioî^m- arttîîn> qirem 'braccWum vuîgo nuncupan 
fcimus, inhumerum, cubitum, extremamque manum 
diuidi cx vetuftiiriiiiis Medicis diaum fuk t Prioribus itaquc 
iatn exaclis partibus ., turnam modo cxequkur , fumm^ ma- 
luis ftruâuraou^fercnsLqjuam in ttesixidem partes, Carpum, 
Metacarpuiiv & Digitps âb Anathomicis diuidi de more eft. 
OrganiKuiusgrarftantia quatitafitV dilerre admodumvlac^ Mâfîuum<£i. 
qiiedociiir Gad: î:MeViupart;/miiltoquepriusArift. 4. de ^nitasat^ti. 
part:vcaf^;ip.vaqtiocomplurap3^ dubio mutuatus^eft:. dciiripcia . 
Huk tmtum ir&mt Anaxagoras , vt aiferu^rit Jiominem om. 
nium> quot quofŞirant >|>ru<knţiirîaTum dTe, quoniam 
vnus omniiimmanus obcinct ş etfi âb codeai Ariftot. atqu£ 
G^eno iuxe opiîîîo reprobetur : dantu^ fîquidem o 
îiaiura pxQ fecult^tumexigcntiăj^n econtra/facuîtas pro Mani^sfru- 
organorum aptituclne: Quaplopter.h^ quddprii- ^^^}^^ţ 

d^xitiffimus'&turus erat ; pkir/buiqne -nm pacis turn beîli ^^ ^ 
artibus inftituendus , compluribus itidem indigcbzt înftru^ 
mentis; manusproindc ei tribuc^ fuerc , rationis ac fapien- 
m miiiiflrse ; organum videlicetante omt>€ organum, quo 
vno caetera quaec^nqne inftniirienta parantur , quitus lua? 
imdkati fatis fuperque deinde fuccurrits eo paâc, quo Anima 
primo âborcuicientijs ommbus^ aiubufqucdciliîuta, vna 
ratioac habitibus varijs poftmodmTi induuuratqucexom^ 

P 2 cur • 

Digitized by 


mt» C«cmm <5U0mani pi^c^ui^'^rganîifBus viiis fotura 
erat remm ap^prehoiiîo , magaitudine m 
xime dHarepaadum^ nan vnico^ if^exibUiquc oĂe conftrui 
dcbebât ^ fod compluribiis porarticulationetn inter fe xom- 
padis > vt modo pUirimum ^rtejadL, n^odo in ard^mum 
coarâari pro rerum exigQntia valerct ; qucmadmodum in di-* 
gîtfe â Mctacarpo tzBqazm xamî^â tmiîco prdraanaiitibus 
€^re mniis conîpicitur ,acliquid6 intona oi^ramr* ¥miiî^- 
quemque autcm ^itum ores hab^re a^ţicidos afleriţur * ad^ 
jMamim.» numărata nimirum inter hos {vrimaf oîUcis arcicuIadonc,quaî 
ofiafic arti. tâineR HOH <um Metacârpo , vt reUquorumdigitorum, fed 
cu Cârpo eft> ac proinde digitorum officula quiadccim erut, 
prsBtcr fciameidea articulis iatericâa ; xjuenqLadmodum Me- 
ucarpi quatuor , Carpi autcm odo : vndc libro de oflium *""^ ^* 
natura > totius infima? mîuiiis o& vigintifepxemib Hippoera- 
£e eaameraatur • 

XXXVL At veto în ccxendicibus ârtîculî duo fant 5 quse 
aceţabuîa âppeîlantiir y &femora in hosin artiaka- 
ţa iunt / Ipxrâ femora autem appendkcs duse pra^ 
teodantur^ altera int^ ^ altera foris^ i& în ârtîculum 
mutra pro^dîtjiîeqixeâb alteraparte^ fed adosad 
femur inieruntur • Femur autcm fupNerne^v^i in^ 
âcetabulum ingruit y bifîdumefthmuicemodi bki* 
|)katc . Ia ea quidem paite ^quaeifîtro înclkata e% 
miummîtate rotundumeftac l^euc^quae etiâm îix^ 
acctabuîum îngreditur • Altera autem bîcîpitatîs 
pairs exterior magis foras prominet > & înferius ap- 
paret ad.nates 5 & coxeadix appell^ur . 

INfa:ioriamii<Ais proponiturartus, ambuîationîs înftr^ 
mentum, quo inter t^rrcfbia ani mantia folus homo bipes 
Pcsmcmrc, cofctiutur : pio anterioribus naruque pedibus raamis, vtpot^ 
iicroumpe-animaHttni&pientiflîmoconuenientiorcs, dbtaefunt» lic ia 


Digitized by 



Biam Pedem : Ac qucraaâmodum in manus hiftoria re- 
cenfcnda âb Omaplatis Authox incepit , quibus bracchk 
velut^bafibus implanclata vifuntur ; ita paritcr in Pede 
deîbriberido â duobus ijs ofllbus «xorditur, qux facri oi; 
fis tranfuerfis pro£cifibus vtrinaque adnexa , & immota , 
poftremain dor&fiintj amplana cauitatcm pro infimo ven- 
ire conâituentia , <3:ttrWBM5U€ aitkuJauoni potiiîmum in- 
XcmiBnr . Etigjiamias, vmmque veura vidsatur, buJIo pe 
culiâri ooajine iB%iituin ; vnumquodque tam^n Uncjs , 
^itcxic^&pe tbariSaginibmin tres partes dimfum eit ; q^- co^teiidix 
fum fijperior & laik» pars iîiuiîi o& conftitujt j inferior feu iuiua. 
atqae aateri@r cosssdicetn , feu ilchium ; quae autem inde o^pub* 
adhik adanîfiri©raprot€ndimr, ospubis efiormat. Ifchio, 
feu C0xefidki *îa:iq. ampla cauitas infcslpta €fl,quam artroa , 
• feu articulum modo appellat Hippocrates , Acccabuhm, vei 
Cotyla commtmicer dida, cuifemoris caput vaîido incer- 
ceă&azc ligamenco committitur atque inarticulatur , Fe- 
mur autcin ier€3 ac vere maximum inter orania huraana oC icmas. 
{ky in fuperiore fui parte infrâ ccruicemauo habetaddit*. 
m«iaa-& appeadices, quarum aheracxrerna & maior eâ, aî- 
tsta. wr-6 Jacerna -aiquc minor; neutraqtie ad vUam deuemt 
aKiculaaonem,neqae:^ sdtera parte, boc eft, aequeex^a 
parte, quaipfîfcmori vnitinttir: adnata: cnimfiintfemori , 
BoncoartiaOat» , a»fcukmmu}U€«xormi atc^ infertiom 
dicatx tantumaiodo filat:» quo yarijs CBurum laotibus ioler- 
i«un^atq.bJBC-»?««»^»>Gr2ci§,latinisrotatoresappelIaiK Troci,«tv 
tur.Abhis^Wgiilongaceruis, cui^caput pr^maotium & [«'^^ 
ieuead iatra recbnacuan, impofîtum eit, quod in acetabulum &c«norto^ 
inferitur adcaxiarticulâtionem. In iiiperiori hac parte biceps tatoi . 
fernarapparet:: etenim prşxer magnum ilkd caput , de quo 
iam dixitnus, externa appcndix, maiox^rotator diSa, haad ^^^^^^ 
loHoe inde exur<^it , quascum adnates ie ie cttcrat yf^To^ , „od'o «rtf. 
etiidicitur.Exh'octextu coiUgi poteft primo A/>â ».,hoc eft, cui«u>n«^_ 
articidum apudHippocraiemdici non modo naturalemiilam tabuîum^ . 
^flkmiyataîdm ,&compagem,fiucconi«n<aionem, qua; ^„"tac^al 
effiscapMC, acetabulum, &vincdiimcompîectKur, prout buiom^ 

Digitized by 



^Tîkulum ^chmt; Ted qtîâdoque itâ yocm acetabulum dum^ ^ 

4:âxat; exquodixicincoxcndicibusckios^freartîculoss quan- 

doqiie A^cro os tantummodojquod alteri committitiir , vnde 

^rticuîos prompta excidere^vcl reponi pluries dixit ar- 

lichium.fcu <ul. ,^ defeeiur. , iJGca^qiie Gaî. lib. de offik, & coîiî. 2. 

^'rrrifeft ^^' '^^* dc fra<3ur. CoSigituritidem fecundoifchium,feu 

isiu"l,^cu- <oxendicem , quamuis prc^rie dkâcurdc ofieilîo, cuius finui 

iljferi^'^'' îiiferitur femoris caput ; nune attamen tramfem adfîgnifi- 

iemou$ ca- candum^magnam ilîam femoris externam apophyfim, quam 

ISppocrtl ^^^^^^^ ic iVefferr-e , maioremque rocatorcm appclJari dixi. 

«ica piura uvds : iîOiE intcrdum & camofas^x vtroquelaterepoft kim^ 

^ ^f* bos eminentias ; & coxs turn articuiadonem , cum ofla, quae 

in ipra~articuîatione:commitcuntur , & interkâum teres vâli- 

*durcq; Ugamentum eodcm^hoc nomine dei5gnari, fatis liqui* 

xio probat FoeiiusiafiiâOeconomia^ 


M genu vero os Femoris rafiterWceps eîl.Bîcîpî- 
tio auteiTi huic ostibia appellafa^ velur in cardine 
adaptarum eft . Suprâ adapratum aurem mola y fîue 
patelb mcuwihk.quţ humidirarem â carne in ardeU'< 
lum cspafîiini.dcfcendereproiiibet^ 

ÎNicriorem femoris partem niînc defcribit, quod â medî^ 
deorfum craflefcens , prope genu biceps euadit, in duo in- 
^enuarti- g^^tiafatis<apita<iefînens-, quae âtotidem tibi^-cauicatibus 
cuiatia. in genu cxcipiuntur ; luxtâ ea autem capita â ^ergo magnus 
i^aidam , ac profundus ineft finiis, in quem procefîus inter 
duas tibi^ cauitates extuberans^ inferitur; validum emittens 
%am en turn ^ â quo tota hxc ftrues roboratur , ftabiliturque • 
Propterea ea diarthrofeos ipccicsxofctuiţurjqu^ oinolimon 
â gingii mo ; hoc eft , cardine nuncupata-eft. Cardinum ţnim 
inflar difao hsc offa , femur & tibia , oim vtraque & cau^tates 
hăbcat,& proctfTus, mumo quodam ampkxuexci^îunt, 
atquetxcipiuLtur. Articulacioni huic fcutiforme^uoddam 
os mobilit^ ncumbit>quodâ figura V quam lefert^ moîa^ 
^otuk , fcuium^ &patelia vulgariter appeUamr . Cumque âb 


Digitized by 



interiori pattc , vbi lubrica chartilagine inuolutum eft , varias ^^^^^^ 
habeat turn caueraulas^ turn exiguas tuberofitates ; his omni- gena imjpo 
bus femori tibiseque itâ aptatur, vt excipiat , excipiaturque âb ^^^^ 
iliis. Huius offis eam âi%aat yfum Hippocrates , vtqua/i 
opcrculuni quoddam' fubjtdam articuladonem > cx fefatis 
Iaxam> tueatur^ie > dum expaîidkiîr in fiexionibus ;, hiimidi- 
tates vari^s ă circumadraccncibus carneis parribus fufcipiat . 
Aliiun tamen affignanc recennores Anatomici , vr gena arti- 
ci^hiicynt m tegere t ne exirâ îuxaretur ; quod de îacili accidc- 
repoteran* Vârijs interim tumligaiiiemis.tummuiculorum 
tendinibus fubicCtis parcibus adnexum eft^. 

îuxtâtibiam aiîtera appendices âux procedunr> xxxviu. 
qu^ infcîîîe ad melieoios pedis finiunr jfuperne ad 
genu : non autem perucniunt ad ardcaîam . Ad pe- 
demveroxibia iuKtâ maileolos arriculumnabct^& 
aiium iafrâ malkoîcs. 

QVx inter femur ^ extremiimq^ pedem interiacet regie, jibi^ a&. 
tibia nimcupatur . Ka^c cubito refpondetjCuobus *^-^P^^* 
. tm^ fiquidem oiîibus coftru<ita eft > cohar rentibus qui* 
dem fimul iuxtâ extremitatesjin medio autem â ie dîfiunctiss 
?t latius docuit idem Kippocrazes lib*de oiT. nat-, & de fradt. ^ cSxlzu 

. . f ^ , . . . ^ nu. I. 

Maiusatque interius exhis, tibia; minus autem exceriuique. De fead. 
Sura> vel fibula & perona Grsecis didta eft, Vnius tamen, veluc ^^^"^ 
pouoris , tibise videlicet , hoc textu memînit Author: hanc 
eteniiîi vnam fumma fui parte femori in genu coarticulari di- 
ximus , ima ^ero cum talo , quod eft primum aftragaîi os • 
De ijs prgtercâ tibias appeadicibus mentionem habet,quaî ad 
articulationem nequaquam deueniunt ; fed harum inferior eft 
produ6tior capitis^ pars> qu^ Tali articuîum pr^e tergreiTa, ciq; 
âb interiori lacere adpofita, internum maîlcolum coftituit eo 
paClo , quo cxtcrnum âb appendice ipiîus fibul^e cdftituicur. 
Superior autem appcndix in hoc textu commemorata^ancror- 
sum eft non prociil atibiae ceruice , mufculorum, qui ubiam 
€xtcodmtt,ifl&ruoJ^ia admitteus : Veriim qua: nam fie ar- 


Digitized by 


ricuîatio , quam hoc os infîâ mâîkoloshabereâflferiti^/ inge- 
nue faceor ^ m>n dum alîeqtw mihi dawm eft « 

XXX1X> Et în pedibus artkuîîmDlcî, quemadmodum & 
Qaot ofTa, ^ manibus > fant . Quot enim ofsa , tot fant articuli* 
totanicuii! & în digitispedum codem numere fant, ac pari mo- 
do habent. 

TedEsma- II yf* Agna iatcr pedem mamimqueintercedîtfimjlitudoi 

cuf^paagna l\/| ^f^^^ paricer maxime inter fe conueniunt : nam vtraq; 

4o . iunc quodammodd apprehendendi mitrumeaca , manus qm^ 

dem nmplicicer tale eft ; pcs vero quatcnus hoininis , quem 

fohm ex amnihm âmimdihm>mc{mt Firmiaaus^cwm Densfiatuif- 

î-adant. fir- fet facere coeleflam , c^era vniuerfa terrena , hu7ic ad cocli con- 

^Ifiaîp'ei templationefn rigiâum erexit , hipede?mlue conflituit yfdlicet vt ea- " 

cip. % ^yyj^ jps^aret , vnde illi orig^ ep ; illa vero depreffît âd terram :vt 

quiă nulla bis tmmmditatis expeBatio efl , tot o mpoH in humum 

pcsapordic proieEi.1. , vsntri pahuloq. feruirent . Fes inquam apprehen^ 

dciidKnarii ^endi inftrumentum nou fimplicirer eft , fed quatenus homi- 

S^o4aet nis, cuios figura ereda exiftit^ftationem &progre{&m ki 

quaîxbecloci dificrcntiâfifmâreitumniqu^ reddere det^b^t^ 

Vîidcioco cuilibec debak poffe circumplkari, atqt^ mniti^ 

&:quamcumque călcaţi corporis figuram compreheiadsrea 

^ amplceiiquc ; compluribus iccirco opushabukartkulis>quo 

multiferiam extendi , ficai , araariq; poiîet, vtgreffile am- 

maljcatione mfignkuKvdecebam:, C^digiturin naami eft 

Carpas,teu bracchiale^in pede Tarfus eftsQuod in mânu Mc- 

rltî^m'^a- tacarpus & Poftbracchiaie, kipedc.MetatariumfeuPcdiiiâUt 

retio, P!anîa:Digitî demum &ip'fi pedimaes inytrifiq,e^uats.n€- 

qu€ duo hirc inftrumenta alker inrerfe diâeruHî^ifi quatenus 

& coru vfus, ad quem ftruclura dirigi debcbat^nonklem om* 

0ui6 eft, vt iam imiuimus. Similia igitur ixxnt ia ftmCiuxa qua^ 

tentis vcrumq.apprchenfiuum eft iaftrumeîmu DiifeîiHULYero 

quatenus iliud optime appreh^ndcre^hoc autem tmo pţogredi 

debebat : proindeque in iUo kMigiores fuiit digiti^neq-omncs 

vna ferie locati> ied poîkx aBjs e dit^cîo oppafiruâ.eft> vt v;^ 

Hda ^ yndequa^ue £en polfet ap^^heafia5^iaiiac.i^a:^ âC 


Digitized by 


eiiim:expc<iiebaîr oigaino^non fimfîmm ^^mhcnRiib > fed t 

procrreffionis ietiam & firmitudmis inftmmeoţc^ vc accuratâ - 

diicrceque docuit Galjib. ^. de viu part. per, multa capita^ , 

Multiergoeriam in p^dibus iiincartiaiîi^ totvidelicet^ quot :^^^^ 

ofîa . C^a^ yci^ue^aiiertioy 'vf veriiSma ea ia pcdc? pane v^iiii. 

nimif um.totiadnexa.arciGiîîati^ey4^^ 

ncouaquam abfolute prolata Yerificari pa&î: ^ vx mxntiâm ^ 

tot erunt arricuîi in humano corpore 5 quot func ofla^ iî aate- 

cedens cuni iubfeqiaentc perpetud coBneâim^^ 

v^ro non habeat cum quo fubfcquenţe conneâ:atur?2^ proia- 

de fiiperlic neceflfe cft^articulorumque iiumerum vnitatcialtc ; 

-offa feniper excedent; inter dup namqsYnataiiruniodd 

ccdit articulatiol At dubitarecotingit nUm eade numero fine ^^ ^^ 

D^aiiuii affa ac; pedu^vt in pr|s.^tiî:extu;baberi yidetur^aîlerişq; immTadeS 

Cdi^Hb,S^c. Jtânquieas <^j?5&44.^0'?^ Jm^^ ^"^^^S 

^2 Jiii^r^jf sy^n^Dîffiriifetîe pamipfemet ffip.jqur Uh, de^cC • 
riat,m manibusyigrndiepteiBofla>inpedibiis vigindqu^^ 
eife afîirmatiit.RiCcentioreSiycrd Aiiaconiiftas a,ccurat4 iideii- 
l^erque ia mami quidem yigintifeprem 0iîîcuIa;Q6cG nimiru 
ijâ Cary0>^amord0:Mecbacarpo>quindecimin fâigicis often- 
dunt : mp^de; v:ei^ noţi plum qaani vigkitife; in J a^ 
iicet {eptenXî quoi^ni^iTiajnnominataiimCj in Mec^tarioP^^^ 
quinquc,inI>îgitisveraquatuordecini* Polks:^tennîi;sioav - 
{ăiis.quanî daa ofîampeife babet; nani eiuâprimuHi, immo- 
Me c0m:omnin© fe^ iniDer-mediataria'clîarecen&tur;^^ 
qpaniiecimuâân manu.^ Aiv iăa^more fiiit priicis Authanbus \ 
i aiariî officulis^ rnalieo] a. etiam iiâterdd rn annu m erare > quaii * 
in vnoquoqe pede duo maileoJa ab vnico oflexanliiiuantur; : 
vnde ofia o6io ipiiinet carfo alTignarunt^ vxfeciî GaL lib. 2,. 
de frac,t,8.& Ruff.Ephef.;notatq;RioI^xoni.inGai. Iib. de 
oir.cap-24* ?:Ex quo & Hippocracem idipfum voIuilTcexiâi-^ • 
mandum^eft, duai^quaîemoiîîuninumerummambus* pe^ 
.dibuiqueafllgnauitXibcIloaute:TideHat.oir.;vbiyigintiqua" . 
tuor effe pedis ofia afleruit^ tria illa in carfo ofîîcula^ quse i\nl- 
Io extant nomine infignita j veluc ignobiliora , minufque ne* 

Q^ cefladâ . 

Digitized by 


ccfîariâî, pr^i^rijt v Dîgitis veropcdum părem offium liunie- 
râmtribuitacdigitîsmanuum , quiaprîm immobikpoU 
licisodicuium 5^ quod Me^tatarfb aiij^âffignânt ^ jplîus polikîs 
proprium&cit. PauFd alitcr GaL 3. de viu par, cap. 8. Ante- 
rhns partes pedis /mqixity ad amuffim perjtmiles comvrehenfi-^ 
r^s piex ^qualibus illis numero o(Jihusfa£i<e^nt:^num mim , quod 
ahl^um fitevăt magno di^ta,y ipfiţîmtăa^ojmm yfedt *vtţar. 


C ArtîcuU infuper niuîtî în corpore paruî fum ^ non 
iîmîuterommbus, fed ^Uj diis . Hi aatern^ qnl fcripri 
hic (nat y omnibus fimiJirer habcnt . Alise etiam ve- 
noe alîis funt , fed rton îiiemorabîfc 

ANacomica? hiftoria? finem impofitur«s Hippocrates, 
ne qnidyidcrctut'mfcms omiiWc , cmn qnxd^m mi* 
mis necefîariâ fiibâciierit / jvt q^^ 

natrarionum , fuMit:non^ pauccKs tadiiîix^rmm^ard y ac 

proinde ofla, tum veniihs-exigai momenti in hum^inaftruc 
rcperiri, qii^e nan eadem in oaînil>us> Ad^ia iii aUjs mird» 
Natura va- incerdum deprehenduncur : Natura crenim, quamuis in fuis 
^SSio^ operibus ftatâshabeat iegeşy ai^ue ordinis^ferc immutabiîii 
ticuiiş ^uâ- procedat ; ludic tamen guan4oque>inijs.pra:fertim, qu^ noiî;' 
Ş*i^^P^âr* apBrime ad vitam necdfaria funt, vV^ietaî^mque iubit aon. 
tim>qax mi- exigeam, i"qimiimqueid^o prou^niatj iîue efficieatc* 
ri^fiiat ad liue iniateriali. PrsECipuâ t?m€n.y jTt. qua? ni compendiario 
viram* hoc tta^âatu narrantur , vaide raro aliter^ quam hicdefcdpta 
ixtnty repeririconîingit>Quaai efcuiâri^^nemadduxkjeiiam 
Gaienuş in fine libri de oflSbus. At qui monftruofas hafcei^- 
rietatesaudireexoptatr Realdum Goîumbum adeat lib, 10* 
de ijs, quas raro in Anatoaie repcriunmr; v^ut etiam lacobi 
Siluij, ncc non Pîateri'obCeruaca : pluriesenimin Gorde» 
in Pulmonibus , in Anmjs , 6^ in Cerebro , ( yt mirasnunc; 
vi*^^^^Q^"* tăceam venarum diuaricatcioneş ) officulaxeperta âini: ,.y£- 
ub? de o£ aîij ţeftantur Author^ş . : , 

cap. 34* 


Digitizedby Google 

XLI. Uac^ : 

lubrici inter feiproş /Xabor autera,& dolor fit vbr^ t^^^^ 
caraetumidicas fluxerit vitiofa . Rrwuai enimarti- ^^^^ 
ii^us'ftabiliiur ; i)on enitn iubrica eft huaiî<iitas,q^j ^aom. . 
decaraeiaâaxitviJdndfcVJEJiiuitâ&valdefpârla , & 
excarn^BoairrJgata , fempa: refîccatur , & vt multt 
€xtftehs,&africuioi|>faranoncaptcnte,^fflBir»& ^ 

k aabilita eleuattieruosi qaft»us articrf^is coUigaturj 
jm^fqueinconnexoş a:c:difîolutps #ui & propcerea 
aaudiiiuat->£ium:|tf}craa£isfît^ , cum minus. 


I lartîiralw, { ea nimiram:ar£iculationi&fpeci€s,qu2 1*. jj^^^g,^^ ^ 
jlJxior eft ^id^apoţiffiiimm excx)gima fukâ natura , vt £^^^-« 
oiîiuinjftirues^uaque ye^şiis flcxiUs e&t , aptaquead omnem j^^^^ j* 
moiusyarie_taEgm-exifteieti.MacăomBia.m^ *^'''"- 

tbbbm: aagese >. metUiiJiîue exf^ditum reddere .^ ta ^raat« 
¥oiu&o(E?cap9tMţeri}is ciiiimtUai^^ur^ ficm^^ 
tb,ncSamtur.rytquepxoi»pj3^afinia -• 

aut£cciţas«iijaUjaî;€X.a{ît<iiJ» agitadone iiiijs aiigeatUE,indegj 
€meî<^ât 4olor,>auc ,. x.iaMo CKficcaîo , facile dimmpatur^ 
inucu°quidaQî, hoceft, albuş humor, leiKus,&gIu£inofus - 
şiixiajlacio«iiiU«:.a0iifu§£fequi.Cubiade âiap«uacaaco,quod - 

fupcfcft,M«sc<>mpagiŞ^ai"Be»ţPi. îenoiiaţur , coiile^ 
y*t« -venubs AVOTuique, qui ai^ofla-producii^ liganieatum 
font artkuioru^xfeftriai diMat; & quandoqu^, vciiabecuC ^^ ^^ 
nu.t8. Jib-dearECi magoo îegroruai niifore egre4itur. Qj/ciĂona^^ viupî^.cA 

tureeknus. Qivo.ufque jigicur purus exftiterit bumor h:c, oeqj 
â nawâitâacu quaUme y 'aut quanmate dccelTetit , vaient &: 
ârticuii, »o«Eatqj*e«pai5«>i exiftuat . Ac ii propria arucu.o-, 
îumimbeciilicsteiaujcorjsbuiuice niaiimn congcntijr, vei ab. 

Q^- 2 habicu 

Digitized by 


u^ru^ ^'^"".^°'P?'f > ^^f'^P^^^evitiofihamorisfiuxioedcoBcr, 
tasâpud a- uHisIabor, varii eftfianif?M-iJ'o^,^ u- ' "^r^^^^cis^ lz~ 

terdu^pr^dolor., a.caBiilurap«> „<£a^g SiS; 
- -«oHeproueme«^.n,:qua:arîk^^^ 

pr3.rcrquamquod khorofys cum.ilt.nfluens hic hunfor^non 
eiim nsbetlenrorcm,, quirubrjcicarem addit artic^alis . Vin. 

AJ^^, itajt a cauxtate poftxnodum fea¥arWufed&£-r 

vnc.e rtipp.5. aph.59. Q^hufiunque â ccxerJiam dolor^mtm- 

Am-sulora Z'Z'^^VT^'^^ ^^ncrsusînddit, ys mucores infunî^ 

humidime ^^c£a eitnjftoriaiîi hî>. de Aer.&Ioe. r-eeiftrata^ d'e Afiorira 

^^- &Scych:cagente. qu.o^entalea.plagi*SitSS 

j=^.iia&. Pf^-^«"!neolunt>.terrâmaffiduisîmbnbusimguam,ftaoîîa». 


boraixmr. P^f^«"":)HeqHe arcumlntefidere,.fleq«e teîum toîcmers 

va,ent, Mi vfeoaibusec.m^ii,rfbusarcic{.los prins c^uberan^ 

cuiis tobm ""'"*' ^fq^i^ccQdonibusVim mijdeH&ij.^doIo:rem €xciu« 
-^i.r, ^^^^™^^g."e;fymhax-hekuaicantifeWadici magia ,.vcl:mkusl 
proutm^or vel minor &cm aifeâio ;. .<^|d ^-câpiofior 
adnucte fluiio^^^itâuter-excipiefidar ncuti^aaai^ fatis iitar. 
ticuh camtas , dittundittîr , ae- ckcumfitas omaes oecupai 
partcsmtumaremeieuar.s: aeiiifiâbalioiafiuemeb 
lUDindeciiîâtur, tenmoribusparribusâcalorercibktis, cxa- 

SS" ^^\^"« f :u<^uns humore vei faiTguineo, v^.hmL, aul 
mdancolico; plcmmquetameapitukafo^erudooae, ei aii» 

Digitized by 



Ikartkuîisvetiiâatecraflefcit, &glutinofîor rcdditurfîc ^^ vţ 
ia duriciei^ cpnţuma^iffimam ohcaUeli 

XLI I In vcntrem porro ea > quse comeduntur zchîhnnmt 
procedunt. Ex ventre aucem fibr^ în vefîcam :. ^ua^j 
ţarte&unwi^cnfţercoiat -, CKttntxhnt^ ^ ^ 

DEnataralibuspartibaspauciflîma quaedam Hic attingk 
Hippocratessidqye fatis imperfcâe, itau^iure mutilams 
cenleri poffic hic textus : quem tamen facile rcftitucrc poteri- 
mus ex libelio de corpor. refece j necnon de ofT. nac. > vtiaîi- 
menti, âcquc excremtntorum eius dui^lus acci3rate> abfolu» 
tşqufdefaibuamrA' i^ ^ 

FR I M 1,1,1 BRÎ F IN X S. 

_; ■;^ ^ «4 



Digitized by 




LiberSecunduC . - 




Texms L 

Tîttxion«s *ir^f^^?££ L VXIO NES autcm & perfrîgcrats 

cornou^iB. ^^^ 1^ valde carne 3 & pcrcalefacta nunt , ac 

1^ |-i S^fuperiîiflamniata . riuxiones proprer 

^ ^ frigus Bmt corn caro în capke & ve- 

carne 5 & ad ang^iftias pcroenientej adftrkraque^ 
atquc excîudeate^ humidkâţem expriniunti& iîmul 
carnes ip£3e contra exprimant ad angaftias pcrue- 
îiientes^ &capilli{ursam^ierectî fiant^vcpotefîmul 
vndequaqueforcitercompreffi* Qukquid igîtur inde 
exprefsum fueric ^ id ipfum quocunque condgerit^ 
fiuir^Fkit aatem etiam proptercaliiitarem^ cum 
carnes rarefactsetranfîtus pra^buerinr , & humor ca- 
îefactusrenuior redditus fit ' Omiiisenim humor ca- 
îefactus tenuior Ht^ &omne cedens Auit maxime 
vero vbi valdcfiierit iaflammatumjpropîerhanc fîuit 


Digitized by 



ctvLkm. CarnesT valde pkn» fact» capere non pot 
funtj fluit humor, qui capi non potuitiFluitautem 
quoeunque comigcrit.Vbi autem femei fluid» hctx 
fuerim fiuxionesjdifîluunt ad locun}>qu6 tandem co- 
tigerit,doncc tranfitus fluxioniş comprcfsi fuerint 

prppcergracUitatieBi • 

ţ~%Ixiiîn» in prcHimio ad Ităotim librum de ho« j^jţ,^ ^j ,^ 
4 J mine effe quoddam velut meaicina: Compendium , ^^^'^^^^^ 
pbyfiolpgiam eon modo compkciens quo ad eam partem , medionV;' 
in qu» d^humani corporis ftruâura peragitur ; verura etiam compendia. 
patbologiaro , TOorborum complurium nacuram, cauras,atq; 
iymptoraaMpat<sfaci.ens. Enarratis itaquein i.Hb.panicu- 
lisjqyibuŞ.bypaapum.corpuscoagmentttumeftîneciionea» ■ 
mm vniojie fymp«hia, naturaliq; ad varios morboSidifpoii- 
ţioîie i iam in iţcundo hoc ca,' quae prster naturam funt, es- 
pîiţSfC aogrcditpr , a fiuxionc iniciuro diicens > hoc eft,â Mi- _ 
crocefmî tempeftatibus : fluxionibus etenim partcs inuicem ^^fţ^^"^ 
kdiconwiftariq; fspenuMiero confueueruiu ob cam , quam t^^ e: 
primo JibjQ 4ccui|nus fpci€tatem inter fe, atque vnionem . S'»^'^' 
Qi». quid«-W vott latiffipe accepta , «fi quilibet humorum 
âb diiairi aUaro ppţem decubitus intelligi ţo&v, bic tamen 
pro €0 ţanturornodoaccipienda cft» qiii â capite immodice 
repkţo in ftibi^O^ <;oncitatur parte^ş , prout iutura oratio li- 
qui4arafaciet.:.Nequeib bacprasKr rationcm exorditur ; . . 
/V ^smhţahma'mmqnţ ii:pbrium pcnetrabdi m,ado5.e labefa- -^.^^ ^^^^^^ 
'(aâţ«>,<}U^ &bi»f^pt , partes , imiiţmerisprope moibis ob- |^^«°f 
iioxk iC-d4weWf . Wx fiquidem fiuxio quoddam repleti capi- increitentă 
ife fyjţipchojpa 3 â quo ,picut varia cil Jabentis humoris con- ^Jf^'^^ 
diţioip.quaUiate & natura; varius itidem locus , qui occupa- 
tW > iî»il9 fere eft humani ţorpoiis xgritudo , qua? aut origi- ^. ^^ _^ 
rvcm , aut incrementum ducere non queat : quşpropter epfr/d'oT! 
eapwt bunianorum jmcibeivm ladicem efle aflcrimr , ;f«^f^^s« 
Bteniw hooio pi-« cf tciis animantibus huic maxime obnc- Koir.o cur 
xmsgft, lym perieob amplum cercbrum, fubiamc locatum, ^^;^^ 
fcggidum prahWPudumque, nccnoiiob orbicuIar€m,quariî icav^iceob- 

Digitized by 


tcii^fr."'" ^abetcaluaria^guramex amplo inangofium, acpBoindc-tta- 
'^l'v^ W^anî -aptiffiîîîam; ;;tum.per accidens, ăh.^fcrzimvmm 
cum.'uzu *tque in vi(Slu errata. Caîharrinamme nommy-vtref^îtPlsr 
Kâ°llli.3. ^' '^T"""^ ^' ^fiulapic, acfilf ^ms ; 'om^ue cti^ luxu 
derepubi. homimhus mnoîtdt . Quiniromo magmiJliMedicinx proc£- 
«ifn."X fBsputabanthomines natura, autincontlneniia morboios,vi. 
Snt4°'m4' "^"^r "^'^"^ '^^ Jp^s,ncque alijs coaterre;Vn£Îe neq;i:irca.Hio$ 
rofino'fcnt ^^^'^" medica artem<:enfuerunt,neq;efle curandos,etfîMida 
waţi- ^^^"^ '°'^"P'^.^"°i^es-^*i«''^?^^?«î?>» exîJUmaxB e^,vt eius vcr- 
.fcorum me- "^^ y^^^ihommesMedicis eoereyr.cnad -vulnera fananda ămntaxat, 
^Sk ''"'"'hi^^&rnnâosHntefftperie ams , & p-ro annitempore aliter 
taatu-. <^ai ^'ti>^-^ diter incidentes ; fid phnmum aâ deflillationes ■> it ffP. 
Ubo"!^?''' ^'^^ interiom tumefcentis impdum , oh moîtitiem atqm J^diam, 
aut ,quem damnauimus, Imeutn . Qmhus effeăufnefl yvt ^homi- 
MmŢ^"ic; *""' ^'*^««^'» i^p^r aqua flatume emlerantium mmisoţple- 
lacunarul^ fc , coegmnt pentos Aefcukp^.fticceffires-morhos ^mfdam no- 
flal". el«' *'", "î'"''"^ ieCHliationcs^ & iriflaiiones appallare. kt qnomzm 
bc^nc. ita fert mtcmperantis huius astii eon<iitio , fre^uemiffimi 
kîius aâeifas caufas opera pretium erit pauMiftudiofms in- 
calfcS^- "^^'S^re , qu£ & in parte mitteute, & in ea , qu« reci- 
te mandan- pit,atque deraum in vijs , perquas fîuxio de<iucitur , re- 
«:S!t P=""",^"'''- ^«umquealis^principesfont , âli^ concomitan- 
tes , au£ deniqiie conditiones neceflârio requifîix , qu» ca- 
nien omnes ad efficientemŢotiffimum reuocantur . Superua. 
BJuxionis ţ^"^"! ^"^. q"i^ Jbct in cercbro humor-fluxionis materia exi- 
mat«ia,> fiueibi-expraua 'partisei-usmiiritionc<:©ngeftus obna. 
curalem vei adlcititiâm difcraiîam ; fîue ăliiinde dcle-^atus j 
â ventriculo nimirdm -vel imbecilliori., vela crapula vexatOs 
aiijique'exsftiiantibiK'vifeeribus , dura fublativapores acere- 
Hîp.^apii.5. bri fciggiditaîe concrefcunt, queraadmodum &Aercrafrus 
caligiuoftjs , & venti auftrales , caput , ( prsfertim iî prsca- 
Kdum lit) , excrem«ntis augere confueuenint: Atque h^c 
poftmodum aut propria grauitate defeendunt, ed quâd â ca- 
lore niraio eliquata fot, vixque laxaca^ vel loculis omnibus 
cxpleiis , miliara nancifcuntur fedem , vbi firmcntur ; aut 
deorlum âbalio deturbantur; nonmodo, inquam, âb cx- 
. pulcrxce faculcate , quâlitate velquantitate -laceifita -, fed yi 


Digitized by 


pi:>tiffimum condenfâ^n^ fagoris-, cxprimentiîîţue * Ex cjuo ^^ ^^^^^ 
trcs in pr^feari texm ftatuuntur efHcientes ftuxionis cau& , nis caafsia 
quaeiniranfmicceftce parte operancur ^ frigus > edor> nimia P!^^^^^^ 
c^piţis vepîetio: caeter^e autem excipientxum, aut defercmiuiB fiku£,caior, 
partium in fequentibus contesctibus, aut taiiguntur y ayt enar- ^^^^^^^ • 
rantur; Vnde fie loqiiitur . 

FluXîcnCS twnt# jjiaque caulain demandance parce con* 
ckantur / . - 

Perfrigcrata valde carne, & percalefada & luper- 

. -. Non vera inflammatione , vbi fciiicet in<- 

mtlammata . (^^^^ mporofitatibus^^ calido humore , tUr 
mor^q. cum doîoribus & renitenda excita^co , nU înde egredi 
poccft , nifi in pus alteratum ; Sed , vt vertit Eocfius, &per tu- 
mefaiia carne , nimiumque repleta, itâut coatendum bu- 
morem derinere Bequeat , ac proinde effluat neceffe eft : ver- 
bum enim (pxByiĂUivGf^iiom modo inflamniari> fcd quocunquc 
humcMTC turgere , ac tumidus eflfe fignificat , vt optime anno* 
tauitidem Foefân Occoapmiafubdidione şM>a^ 

JFluxîones proptcr fiigus fiunt cum caro m capîte. 

Nou ea dumtaxat y qu2e vere & proprie caro eft > vt mufculo- ca^i '^g^ 
rum 5 hsec enim perpauca reperitur in capite 9 ne animaîibus ^^ ^^r^^ c6. 
funâ:ionibus impedimento fit t ex quo Plato m Timaîo ^cac* 
tegmm cd eerehn tutelam non camihus ţonderofimi y feâ lene e0J - 
'votuît 9 quodadfngoris » cahrijuemtemţeriem repellendamjtiffi^ 
cerety S'jen^acîWîmminimHmpedireţ^v^ docuitGal*!» 
prog. part. 7. fila temf ora ex'vmHerfi căpite mufadcs hahent, 
quos nommmî i temporihm crotophytas : reliqmmi vero eaput om* 
niprorjus ^ame vucat i Scd mollis qusclibet& carnofa par- 
ticularum fubftancia-căput componentium, vt cutis > mem« 
branarum omnium > & cerebri 5 fub catnis nomine latius ac^ 
cepto comprehenditiir; tâlis namquc facile patitur ab aoiuis 
qualitacibus , fâcileque replecur • 
^ , fub quibus arterias pariter atq,neruo$ fubintelligas 
Ct V«iaî- ^^ gjjijjj confucuiti vt probauimus text» 49. lib. !• 

R Ten& 

Digitized by 


i caiiC Xlier>;ţc • ţ^ ftigo^e (ienfataî : nam hf , came vi fri- 
goris iâa , eoaâaque iu fe ac proindc ^elut fpongk m^^^ 
vndeqitaque comprefla^contendum excliuiente humorem j 
ipfas etiam fimul compriniunxur , atquc itâ humidicatcm cx' 
primunt, feu cxtra emittunt & fumknt.. In bac zmcm coi> 
d€aîfatione,curismeatibu$adftnâ:i% capilli itidem eriguamr, 
rigemque inflexiî^.: quocî E flcâanmr > dolbrem exhibent . 
Expremis tandem humor . 

^ ^ . • rt * Quâfcilicet maior fecilitas 

Quocunq,coiitigentfluit.^i,^^^^., dbviammla. 
xitatcm 8c îeSitu<Biiem,tiec no partis,qu2e receptura eft,tum 
deciiucm fitum^ mm imbeciHitatetxt ^ lîuc hsec â natura exti- 
tetit, vt in cute^ adembimona^yi^aşi^ii^uinc & alis>quaî emun- 
âoria nuncupantun iîue â niorbp contrai fpr^ferdrn fi ca-^ 
lor ad/ît> 8c doloi .Sileutio kuîd prsetereundumcâj opinio- 
nem hanc defrigore fupenîiuraaeaexprimente > iam pridem 
^f^M«?Ll* impugnatam fuîife iloanne^I-angiamfms epiftoJis, quem 
cap. de cal dcindc fecutus cft Ludouicus Mercacus in praxi ^ vbi 2^^ 
tairho . ixicelleâum capcre nequirc >^ qui poflîe cerebrmn ^ viuentc. 
Num âuxio. animali, futjftinere tantâm frigiditatem , quantam par eft , vt 
nes conci- p^j^^g pj-^ congelationc condenfat^, intra cranium expeliant» 
goie • quaproptcr ccniet tngus non niii per acaaens coinmşiiere 
catharrum > quacenus icilicet obferatis poris , cogit adai^eţqi 
cerebri calorem , qui pituicofas deinde materias coUiquat» li« 
xatqucinterioresvias, Vcnimhi fai&innituntur hypotheâ, 
dumikpponuntcercbrum congelai ogortere, qudintus 
primantur humiditates; cum iat^ fitifriggidiori acre car* 
nofes c^itis partcs.;, vtcfiâ:umefixvenaspariter>&arterias^ 
• in eiaerna potiflîmum fuperficie paulatim denfari : proinde<p 

corum fententia abicienda eft in ea parte , in qua Hippqcra- 
temimmeritooppagnant. Ne quid tamen verităţi detraha- 
tur , ampleâen^m m altera parte exiftimamus y vbi calorem 
in eo catti per accidens augeri exponunt> atque itâ diâinguen- 
dum effe . Primo quidemfri^di aeris appuliu extimas par- 
ces rigere , dcnfarique > vt diximus; ac fiquid tenuioris băio-' 
fa^que hunuditatis > autichorofaî & ^ueae ibi repcriatur > nc- 
. ccffe 

Digitized by 


num. 4* 

cefe eft întrp trudi;quod tmm deorfum mox dekbi par em . 
Oaufisi^terim exiftcBtibt^ pom>proha>itaquciWigmum ex- 
pkâtione, oJioretn poftmoihim ctiam intendi , atque âb obli* 
dcnte contrario frigoreTBiri , itâque mpmkiMi poflfc , kaud^ 
inficiamur : & fi pituitofa crafTaquc ibi adfînt cxcrementa ," 
eoUiquari etiam , intemafque laxari viasâtendum eft. Qirod 
fifrioiisadcodcmumintendatiH^, yt cerebri calorcm non ob« 
fid€miîH>dd, fedeumcarciam incipiat, ita vcin<:erefari pe* 
neţralibtimm proprias exferat^r^ ; mnc excrement^ omnia. 
& craffiora, & incrciora ad motum rcddir^onabile dicimus, 
ac foporoias porius , apopicdicafque tune imiehcrc^e<aio. 
lics: Atquehinceft, vtinfrat, 4. darius hafaebitur, quodâ 
fiigore bilioik ftuxiones, â calore pituicofas magis conciian- 
mr. Adiuerfakaqueinteiifianiâgrâdu in agente, aâicnis 
diiiuifâaiute, paffiquedifpoi^^^^ etiam cugiperfc, 

mm per accidcns prodmcumur effeâiis , vt te ^iai^uoii^il 

clamm fie» 

, . ' ,.,. altera effidens flii.^ 

Flmt autem propter cahditatem. ^^^., ^^,^r^ ^^ ^^^^^ 

c^ tranfmi«:enţe , qy a? carnes rarefaciendo > fiuxioni peram* 
plas fternitvîas^fundcndoautem^ atqueattemiaîîdojiîuxi- 
fe^ reddit huftHW^s • 

Omnîs enîraliumor caltfadus tcnmqrit . ^^^ 

diutius Bon agat circa eandem materiam : tuncenim prima 
quideiîi attenuat & coliiquat 1 rnox tenuior^ rcfoluendo 
partesincraffati acdemun>cxficcat, Huicvidcmus, qui prius 
attehuatî ad fauces pc^fqae defluxerant ; ibi paulo detenri , 
craffosdem^m excreari, Id docuic Hipp. lib.^ principijs 

'O^ifmţore etiam deficcaf . 

, . Id proprie ceditexAîiil.4* meteor. AriAot,4. 

Omoecedens fluir^^^^^j^^^^ tangentijoaim pne- ^^^* 
bet, fuoqire interimie ronmet tcrmino , vekic c^rablan- lib.t.d^^c. 
dior, otnneqiie, quod molleeft ^ Qaa quidem fign^catio^ r^is?"^^'* 
ne hil>-qii6d liquidum fit ^ molie aut ccdeas votări potent^ 
aqua Bamq.v'fic^m^^ mn £olum mHo cir* Sicf^ 

Digitized by 


xja mpBQCKjO^isiJs. mm mCrJii noM 

cimticribetur proprio termino^iediieque fi 
ia îuperficies , vtferatâr iîtprofondiim ^ ied dxfftigier pQîŢiMS ^ 
hms . Haud igicuf vcrum erit, omne ced^ns flucrc, fi :id> quod 
cedit>liqiiidumnoneft* Aa.HippQcrates nune id yocâcce- 
dens > quod proprio termino interminabile eft , facile alienq , 
quod ell: huînidum in aâ:u fecimdo ? id enim tangenţi jtâ ce- 
dit3 yt eius termina iiguraîqjueiempecfe.fe aptet> ac circumn 
fluat >nullamq;,propriamierueţfignraiii ; qiiod procuI:dubi<> 
fiuxiîe eft ? Onmis igitur eakfaetus humor tenuior fit > qui 
poilmodum cedeado fluic. 

Maxime autem vbi valde fluir îaflammatuirL^ l 

1. A -^ r HincirefeHituTiNicoIau^ Ro'« 

aflerens fluxionem excitări â moderato calore > eo qijtod âb 
intenlb incraffetur humor : IncraiTat etenim vbi diutiits c^o- 
ris adio circa eandem materiam perfeuerauerit, modo iam 
iiiperius explicatoyiieque vnquam incraffat, nifi prius fuderit «. 
Incalelcit autcm caput â fole, â cibis, â îaboribus turn animi, 
tumcorporis,ă firigore, âcalore febrili^ vt ipfeme tdocuic nu. 2l» 
îib. 2. de morb. . 

qilibusiaca- ^^^^^^^^ v« v*w ^j,^l.^ *«vt«. wvv fp^j^^^^^^ fluxionis^ 
Sfcat. vtfupra dicîumfuit; itâ videlicet adauâohumore, vtâvafis 

nonvltrâCâpipolÎ2t> acproindefluit quocunque contigerit 

faciliores dări vias iuxta caufas allăcas * 

Vbiauteiemcl fluida fkâaefuerîntfîuxbnesVjxjelat^ 

tenuari fuerint hiimorcs, ac, facile viam nadijin aliquam par- 
tem concitati fint > non fîftuntur ha: fliuxiones , donecvi^, 
venarum potiflîmum duiitus atqxoniîigia, adftri<â5e & coar-» 
flatse fueriat > atque itâ graciles , feu tenues reddicas : nam 
quemadmodii â calore & humiditate Iaxantur,& amplf fiunt, 
ita â ftipticâ fîccitate conftringuntur * Hinc eft,,quod interci* 
pietibus vtimur in his cafibus,qug terrea fuiit^friggida & ficca: 
Hseclîquidem repeil€ndo,exficcandoqueomnem ăbfumuat 
humiditatem> atque ita dcnfaadovias graciles reddunr- 
-. . " \'^ " ^^ Cum 

Digitized by 


CQMMEJiîTMJtlS IIjySTKA^trS l ^ţ$ 

II. Cumăutemcorpusiueritrcfîccatnm5& aiîoquî 
corpus ipfbm fibi ipiî comunîcans iît^etiam camfic- 
cu eft diducîc5& concîpît> & daclt vbicunq; tatidem 
humor obtigerit • Ducere autem ipram non diăiciîe 
eft, vtpote corpore vacuo ^ & non înturneicettte pvx 
gracHitate:AIiquaado autem infernal partes ficcae 
iuntvfiip^rn^ ver6humida£:magis aiKem ^^^ 
vafa humida funt; Vense enîm piures fuprâ ruDtjquam 
infi:â>& carnes in capîte minori humiditate opus 
habent . Ducic îcaque fîcca corporis pars hutnimta- 
tem ex capke , & fîmul tranfîcus magis ducenti pa- 
tent ^quam eî 5 quae ducitur ; nam ipfi tranficus ^vt- 
potc fîcci exiftentes, eam fîbi lucrifacîunt > &fîmui 
humoresâ natura deorsiim procederS iblent>fi vel 
modica quâ^dam neceffitas conringat • 

PErgit Hippocrates varios flusionum caufas rccenferei 
cumque eaş fuperius in parte tranfmittenteenarraucriti 
nune eafde in €a>cju^ recipit^feu termino ad quem,confiderat: eauf«m© • 
Verum c«m pjures caufşe huiufcemodi efle queanc > vt caîor ^ ^^^lî^ ^'r^- 
dolor, iîccitas , figura concaua ex amplo in anguftum ccar<âa- parte reci- 
ta/pongiformiş &c,hxiC fîccitatis antummodo meniinic 
m* lop c^teris vero alibi mencionem habuit : calorisquidem i. de csior quo- 
morb. P^/f»o 4 caîore adfe îrahitţiîuitamex toto corpore r ^ ^^ ^^^ ^^" 
^mlexc^ţcicapit vero caîefâuîumex corpore* C^odnonnifi 
pjer accidens fieri cenfendum eft } quatenus fciacec calor fui 
iubic(âi hi|j^idiţates abfumendo ^ refoluendoque y vacuum ia 
pprpfitatihus inducit , ad quod pr^cauendum , proxim lores 
primiîm, deindequi longius abfunt , humorcs accurrunt^ 
maiori &pc cpnftuxu , quam opus effet : acque itâ calor iden^ 
. li partem repererit copiofo fcatentcm humore , illum eiiquat, 
iWionique in nranfmittente parce occafionem prsebeciatiî 
iQ parte infederit modicas: humidicatis i hanc reloluendo^ rare- 
facicndoque poros, vacuum procreat, & traCiionis caufa in 
parce cxcipiente cxH^c» Poloris vero, vtfluxionem aduocan- 


Digitized by 


'.^mmm----:- tţ4 HIFFOCRATIS UB, I, DM mcm MQM. 

- tm^îMmmtt aph^jjv feci. 4. Simte morhmt qmdJoImrit ^ 
i^cnmhis incumhit. VndcGâ!. 2. de djEfeb. cap. 2. lUud 

inutilis materia redundat^ magnaţortio ad eas definit ţartes y qu^e 

^ehemmtius incaluerint; nonparum iticmt adţartes dolmtcs folent 

d^uere.Kmxs rationcm rcculkidem GaJ.commenc, aph.55. 

Doior quo- feft* 5 . H^c mm, jnquit , âu^am e(iratî& commimisin mihm 

modo tra- - i j, i- -t • ^ /* •_?/».. r 

ij^t ^ xmlenteraitqmd excemit natura , 'oteopmgms &jpirîtus tmpetu 

ferantur ; qtiihus dmhus inflrumentis natura vtens, ea, qu^^ in- 
fep.ant , ţermm expellit. Hac raţiune igitur ^ dolentihus ţartihus 
inflmimationes adueniuntynaţura excemere^atque expelkre caujam 
dolonsţroperante: vt vero hocfaciatyfmgtdm ^Jpiritu locum im" 
plsnte.Sc li. 1 3 5 .i?m4 e^e natura f ocult atemy^&nt^ 
^t^ămexcretoriamdicimus . Bafiiomtmeretumfimg2thr,C70ntri{ie 
diquidfinfit ; Vmm 'vero quiddam ejî ex ys , qu^e cam ccntrijîant, 
iţfa , qu^dokrem excitat , caufa , qn^ecunque ea fit. Banc intur 
eycere dum prQţeraty ţhlegfmncm interdum in particula cmcitat . 
cum enimprimisfiiisconatihusnihil proficit, vehementius aggrefi 
fa y quod infcfat , expeîlere , fanguinis y^ alypiid Jpiritus e» 
juperpofitis partihus in affliBam fimuî exprimit , Atque hinc fit^ 
quod ex dolore particula y proportione in cam confîuemis- hmnoris % 
in tumm-em attoltitw . Memmit au tem figiir*e ad &afeeRdum 
apc^> qu^fnadmcKÎttm eiîam & fpangiformîs Hb. ^ vet; 
^^ ^^ medic* his^ veibîs . Qu^partes caua > ^ ex amplitudine in arihtm 
fimt câoBa y htţ trahere âdfefe > allicereque humiditatem exreliqm 
mrpcre ma:mnepoffmt;huiufinckiifiintCdput , Veficay Vterus ^c. 
Scţmîain&z.Spm^formespartesd^m^^^^^^ txehit Hen, pulmo, 
fmmmay^viiddmQt a maxime fiterinty & didh^i^mnfy ^hunty^um 
raquefimf > atque augefcimt hufHâre accedesm j moâ^e pkhno • 
<îaod idem Jib. de glaai \m\xs dacuit; imbecal^enim &m ^ j,^^ 
hiiîufiiK>dîpartesy &6braritâtemadrecipieadt«n^aptiffimş* 
' $îcchaj vt ^î<^iî^35 demiimquamufshumidiatti contraria^ ac proindc 
SThS. ^^P^f^^^P<>ri^s,quamhumiditatesattrahere,per - 

tem. aît^ahit tamen per accidens , dum partes > vbi pluiqaâm natu* 

, r^is ratio poftulat, esficcatse ^ kimor^ zMicmni, vtad timi^ 
ralcm le fe temperiem redîgaacltâ & yterus plus mmio exfic* 
camsy adhepar comiermsr^ vtdtB^ hun^&«e-fttiai#f ,^ e* 


Digitized by 


eoMMmrAKiis luvsTRjfm. 





îib.i . de morb.mul. , & aluus exinamta trahit â reliquo corpo* 
re & capite himiidiiatem ex lib. a. de dm. Inqmt igkur * 

/ C om autem corpus ftieritrciîccatum.^^^ 

&i parte ^ qusepras labarc, auteuaeuatioBe nimia aridior 

Et alioquî corpus libi ipfî communîcaDS fit . &c* 

cum totum corpus fit fibi comraunicans (tocum cmm cot^ 
fpirabik & tranlpirabilccft^quaque veisiis cumculo$yatquc 
mcatus habcns, vc lib. r . 1. 1 . cxplicuimus^ fi accidac , vt pars 
ciusquaîpiam ficca prstternaturaliter euadat,quacun<jue ia 
parte contingat tune humorem rcperiri, inde dedHdthoc€&^ 
feparatdiuiditqîapartîbusijshumentibus^ & concipit idcH y 
' mc & congrcgat : efl: fiquidem propria eorum loeudo > qui 
de aquaîduâibus agunt > vt vidcre eft apud Frontinum > qui Aqui cosux 
dicuntaquas concipi, vbicx pluribusexiguifq; riuuiishinc P^^*^^^^* 
inde emanantibus colligicur ^ & congregaiurinalicuius mo- 
menti copia , vcinde poftmodiim per aqueduâus ad dcfi- 
gnatum locum duci pofîîc . Eadem ergo ratione pars exficca- 
ta a parte qualibet hiimente humiditatem primo deduci t, fe* 
paratas concipit > & quafi paruis cx riuul^ hinc inde congre- 
ga^ > vnitquc ; exinde demum ducit ad (cy atque allicit vt hu* 
meâetur * Quod vtique facili ncgotio pra^ftare poteft, cum 
vacuafit, & humoribus exhaufta; ex quoneque facile, neque 
tam cito expîetur atque intumefcit > ita vt nuUus aduenienti 
humori locus reliquusfit>vtaccidit inpartibuscopiofohu* 
rooreturgeruibus ; namquevtdicebatlib- de gland,, nonim* 
morari ac monera ţoteft ici * quodinfiuit , nm hahens vU fidem 
firma Schxc u i. camcs ^dd} fUtue faU^ , cum caţere nm 
poffmt^jbdthumoryqjdcaj^nmptt^^^ contigcrih^c^ 

Aliquando aurem Mtmxpmesâccx fiint, &c. 

Acciditintcdum infernas partcs p3^«E^rnaturaIicer exficcari,- 
fiipemas vei^ humidasefle; immohae^naturalitcrhiinudio» 
xcs exiftwnt , aîimcatitia videlicet humidioatc : cuius ratio cfli 
quia plures vena: fuprâ funt âb hepate> atque â diaphr^mace,; 


Digitized by 


ilmfu^a^ q^âm infrâ : pîurcs mquam , non maiores : nam rt &nfu ipîo 
quaminfra manifeftum eft > latiffiraa eâ ea cauae vena? pars^gua? infrâ ie- 
fecUcTx^S cur, minus lata quas inter pr^cordiaftperiustendit: plurcs 
«"^* tamen numero funt in fuperioribus partibus , vt facillinie ap- 
parebit contempîanti eas taîitun:iqix>dd , quse in caput, & ce^ 
rebrim^mbranas difperguncur m'agilq; inijsabundant hu^ 
mores ^ cum inibi nobilimmse ^ calidifiîmseq; non m^odo fint . 
partes , vt Cor & Puîmo > fcd ex naturali eciam figura ad tra^ 
hcndum apcifîîm^> vt caput ; Atque itâ fieri ajquiffîmuni 
craty cura âcaîore magpa fiat humorum refolutio, & in fupe-' 
rioribus partibus vitdium fîta fit, animaliumqî fpirituum of- 
ficina, qnx corpori vniuerib fuppeditare debeţ, vt annotauic 
Galen. iib.i <î*de vfii part. cap* 14, . j 

S. . •^ . ciiîufbîodi vt plutim uni 

€€iu£. fubflsntiam , cordifque proximiutem facilîîme exficcatur 3^ 
humiditâtem ducit â capite ^ vel âb alia quauis parte • vbihu*? 
mor abuudarct coniingerit • 

Tmfitusmagis ducenti patent. &c. if^^ ^°j-^^ 

doqueadapertas hâbet; traâus attamen humor > âbipiîsj, per 
quas tranfit , partibus, quandoque cbibitur, atque cxfîccatur 
priufquam ad partem principalius trahenţemdeucaire poffit î 
vt pulmo câlcfadus atque exareicens, trahit quidem â capite; 
fîuentes tamen kumores ip ipfis faucibus & laringc intcrdum 

- difperguntur priufquam ad pulmones dcucniunt> vel quod hse 
etiam partes bumons ind^^ fînt , vel alia quacunque ex cau-* 
fa. Quiinis verbis videtur re^ondiffe tacita^ cuidam obieâio* 
ni , cur vxdeiicet pluries accidat , vt exficcatis diquibus parti- 
bus , neceflarium nihilo minus humorcm ad ie non attrahant > 
fedalxunde,cxteriasvidelicet, iuuarinecefle habeant : tra^ 
himr fiquid^m femper cxficcatae partes; Verum tradtus humor 
iniphsnon rarovijs diffipatur priufquam ad trahentem par-« 
Km deueniat,ac proindcâb alij5 mederi neceflfe fii: & fi humo- 
res fiîperioribus in partibus r^dundantes , kul quacunque de 
■ caufadeorfura, ob naturalem grauium propentionem^ deicea- 

dant^ atque exiguaomniao indigeant trâd;ione . 


Digitized by 


. COMMEiJtÂKIlS IllVSmMrS^ i^j 

lll. îluxioncs ^e Capite fepteni funt, in nares, m au- cap^ re?- 
res ,in ocuîos , atquehas ex capite fluxionesobocu- ^^'^'' 
ios confpkuie exiftunt . 

IAm fuperius didu fuit fub fluxic«iis nominc latius accep- 
locîuemcumq; materia decubitum â quauis adquamli- 
betparcemintelligipoffe; hic tamen pro ea acdpi,quaî â 
eapke ad aiiâs ei fobieâas partes delabitur . Quod patet per- 1 
fpieue cx pr^fenti cextu, vbi poft fuperius enarraamfraxioîns 
nararăm ia vtroq; termino, iam vias, per quas coUeaus m 
capite humor delabi plerumq; foleti explicare aggredicur . ^ 
Has vero feptcm eiTe dicit, quarum tres vocac confpicuas eo 
quod,ad extracumtei)idaat,riue externis in partibus mor- 
bosprocrecnt,fiue per eas innoxie foras dilabatur concita- 
tus humor, tub ocuUs effe dixeris . H? iunt Nares, Aures, & 
(«^ Oculi , quas vias nacuraies appellauLt lib. de_gîand.,uon quod 
ad hoc fint primo â natura inftituts , cum leofibus potius di- 
cat2 fKiC(^idnamque de «unei tantiira foramine in palato ve- 
re pronunciari poieft, quod pituitoizglaaduis ia felia fphz- 

noidis fubie<âum , pituitofa excrementa , qua? âbinfundibu- 
1© , & tertio cerebri finu affidue rccipit , în p^atum 4iftillac , 
vtper os exceraâtar; fed quod excrementuin, dum adco exu- 
bcrat, vt per palatum fatis expurgări nonpoffit, per hasreciam 

vias femiîiariter, & quandoque innoxie, cerebrum expietur . 
Quatuorcetera: hicnon cnumerantur, vt fit in gîand^ 
*""** vbi hacfentencia rcgiftrata reperitur , vel quod liber hic, etix 
vere Hippocraticus,non fie tamenadamuflim vndequaquc 
expolitus î vel quod fonaffe aliqua defint : quod eo probabi- 
lii^ videtur , quod inferius has omnes iluxiones vfque ad fep- p^ qa»s 
tem finguîatim recoUigit, ac morbos ,quies iUaf «^ vna- v|^^^exp«r.^ 
quaque emergere ibleni , diftincle enarrat . Prater hasigicur 
confoicuas vias , aîios latencesiiabet cerebrum duCtus , per 
quos'j dum nirais applctum ell , fe fe exonerat , per amplos. 
nimirum palati meatus in tracheam , & in efoph^um & per 
venas in fpinalcm medullam &ini"anguinem, vt patet citato 
lib.dc gland, Dicuntur autem hs ojcculca;,ed quia aim ad in- 

Digitized by 



13 8 mFPoauxis us. îl m toc. m nom. 

nîs fer aftMtr , internos, ac proindc lâtcfttcs > excitant morbos, 
vtixifrâ vidcbiaiusi^ At gloriatur Ferneîius ]jb. 5. paţhol 
cap* 4. ^iiod âliam viam omnium frequcntilfimam , Veteri* 
buique;gnotam,prinîus rcpererît;eacjue cft inter pericra^ 
ni um & cutcm ad partcs omnes externas in oculos , in maxil- 
las > in dentcs > in ceruicem >in fcapulas^ in bracchia, in late- 
ra,indorfum, & lumbos ,in coxcRdiceii2,incrura> & ia 
omncs d enique articulosjeamque tuni omnisar£britidis>mm 
externi cuiu% fere doloris caul^m cfle aflerit . Attamen via 
h XC eft coiledi tantummodo extrâ cranium humoris > eamq; 
haud ignotam Hippoerati fuifle ^ non femei infrâ videbimus ; 
Hic lamen agi de fupeiuacanci^ ijs , tju^ intra cranium in ce* 
rebri fubftantia plcrumque coUiguntur, qua perenarratos 
âb Hîppocratc du^svtpiurimiimeuacuari confueuerunt: 
Nilî dicere velimus fub fpinali medalia ncruofum omne «^e- 
xmSi Se membranas ipfas comprehendiflc Hippocratem; 
qucmădmodum fub nominc fanguinis 3 non modo venas Se 
artcrias , quas fanguinis naturalia conceptacula {unt^kd fan- 
guineas omnes partes, cuiufinodi eft ipia caro 5 inteliexit , vt 
liquido ex infrâ diccndis apparebit * 

PojSquam au tem în îhoracem fluxer it pra? frigore^ 
1 1 1 1 * hilis fit ♦ Magis autcm in thoracem pr^ frigore fluic, 
proptereâ quod faciiis eft fluxJo adguttur, vtpote 
non ccnreaum, Pî^ frfgore vere â bile înfeftati , 
proptereâ lafsitudîne affliguntur ^ quia carnes , cum 
bilem hahuerinr^ non quiefcunt^fed concutmntur^ & 
concuf&laborantjac delaffantur 3 vtpote veîut în 
itinerefaciendo concufîse.Erfuppurati fiuntcumin 
thoracem fluxert» itemque rabidi . 

AFfectiones explicare aggreditur, qu arab vnaquaque cx 
enarrâtis fluxionibus , varijs in partibus excitări con- 
iueueiunt; initiumq; ducit â thorace tanqam 6b late na vifce-: 
ra eximio , ad que diftillationes vt plurimum,magna nobiliu 
partiufCordis videiicet,pulmonuq3Jincommod6concirâtun 
nă,vt innuit CcHl lîb.4.,diftillat humor ex capitc interdum in 



chosaccm • 

Digitized by 


nares» quod kue €^mmâu în 6uiC€5>quod peius «ft ^ totcniu 
etiam in puhnones, quo4 pe^mum cft: Vţ ycro propoiitum 
texcum dlare percipcre valeami^ > . qu^eilam nobi^ diiucidan- 
da prius probandaque fuut,quf tanquam certa hic fupponun* 
tur. Primoquidcmafrigorc , ctCi cuiufque humoris fiuxio^ 
ckri poiTxEj biiioiâmtamcnfrequen^iuş* quam pkuitofeni^ 4%oi#bi 
concimi: qu£madmodum,e contra, âcaloremagiscommo- ^^^^^^ 
ucripituitojram; Afrigorc inquam> nonquatcnus frijgidam concitâmr^ 
cerebro difcrafiam iaducendo , pimitofis procreandis ^crc- fj^j^ţ^^, 
mcntis occafîoncm prsebere poteft;fed quatenus conftrin- ^ft^Sccur. 
gendo cxprimendoqiie, morbofos cercbri apparatus deor* 
fum decarbare aptum c& . Quodinde fatis pat^i: > quodfrigus 
innatafui viftigidarn craffamque picuitam craiîîoxem 9 gin^ 
«inoiîoreiB , HK>tuique magis inertem riedait ; ae proiode x\ifi 
ccauon^ aquofâmquc intcrdumnancifeamr > ytx. i, îib*,huiu$ 
amietamm fiiit, vix vnquam extrâ ccmbxBm eam pwp#îleţ* 
Sk yicevcrfa, calor eam 4:oUiquans atque attemi^jjş , facil| 
fluxilem rcddit ; bilk>iâm vero maiteriam attej:iuaiis , & poros 
vndeqiiaqueadaperiens, diffipat^Bincc.larc fequitur .fecun^ 
dum; quemadmodumfcilicecibambkfltis icalore ^orporis gg^^^^ 
feabitiim vndequaque rarc&cknte atque .euocantc, iîuxion^es ^xt^ fiigus 
^ilius^ €xtra>^d podos mmixmnMmt€Sy c^cer^u^ ^^^ 
«xtimas parî^s concitanuu:; fie pr^ firigoxc ^eudem CQV^pmb^ moiict* 
bitum dcn6nce,exprim^ntcq. intus ad caitmm, &ciflim.e hu^ 
tncHT-asper gutcur ad thoracem , ytpotexapiti.c4ir€iftaiMbk- 
.â^cipitari. Etquamuisab .epiglotdd€>(quf ex Hipp.4^ 
au.^2. aemorb.yV€luthed€rgfoUiimpdmpnismul^iacumbit)g^ toS^^. 
ttiriscauits^.conî^gatur ad cibos ,ar^eendos.& potus; .diâmr tux,4'Qţoî|-^ 
tîMotninusnoncontcci^im^^oquiapcrfiftuiaîU }^^'''^' 

femper vacuiiupcreft y pefquod & potus portio ^ &c deâillaii- 
tcsîiumor^sfenfimdelabipoflbnt,, vcdocmcidon HipJib. ^ ^^^^.^.^ 
decorde:<:^mimin63ytnoj;ant Anatomici^ Epigloxds>qu^s coadci^tio. 
laryngisopercdumvocantjfe^perhiai, vtâeri,.iiumiiifqi 
vaporibus adirum , exkumquepr.^beat ; ncqueymquam^e^ 
primitur , iiu€rcîudicurque,mfi aliriijcati pondere deprimatur: 
ac proîod^ per laîyngis latea ad bi^nchia puimonum iaflue& 
li humori femper patet aditus * Atque bine manifeiium fk 

S Z quo 

Digitized by 


«4^ mFWOCRAtis Lis* î I. m %oc. m hom. 

quo fenâi eadetîî epyglottîs cxat(9a 4icaa:ur âb Hippocme K* 

beîio de ccxdc : eft nâmque cxaCh, non quod exaâe claiidat, 

ied quodesacie, omnîqiîe numero abfoluts effida fie pro 

pams> cuiinfcruiredebebât, exigenţii; arcet fiquidem cibos, 

pienumque posum ^ qui aeris ite r i titercipere poiTet : hiimidi* 

tat€S autem per trachese latera delabi finit ad pulmones iugiier 

humeciaKdo^y ne rara eoruiu fubftaniia db affiduo motu, 

BUs fmpll pc^^iî^i<î^e cordis ferubre Bimmmc^fic€2^rctm • Tertium căr 

citer proîata qudd bilis fîmţ>IkiterproîatadiipIicker fiimitur ab Hippocra» 

Sifi^f^^ro ^^3 pirimoqtiidem pro cafido ficeoque humore > fiuc natura- 

^^^^^?^ Hi fiue pra?ter.natHam : ac iuxd hune fignificâcum quod â 

căpiţe ad thoracem , palaionumque fubftantiam delabirur 

ciente feigof e, etfi pituitofum fit ( pittiitofa ctenim plerumq; 

funt cerebri purgamcnta i vnde âb Hippocr. lib. de princip» 

glutîiiofi & friggidi metropolis nuncupatur) fit tamen bilis, 

eo quod ita in pulmonum caiiitatibus coarâatum ^ incalefci^ 

putriduoî fit y acremque fibi adfcifcit qualitatem ; ex quobt- 

îem emulatur : Vnde primo etiam de morb. fttfuţpivaîîif» 

inqukjjtpitmta â caţite aâţulmonem dijiillet : ^ ţrimum â^pMmi 

*vîflurmium latenter d^uit ^ tttjjîmqite tenuemexhileiy ^J^ţum 

fauloamanusfilitoifc, vbiciaram fit in doctrina Hippocratiş 

y piciiitam â câpitis arc€ âdptdmontini te^bras ddaram.j ife 

candefcere , vftioîiequc acredineni jconcipere , atqueamaro- 

Ham©res p- rem^ bilifque emulam vi acque lapore rcddi'. Quod pr^ofeiio 

^?^^|^ non itâ arduum videri debet ; nam quemadmodum namr^îeSs 

nerari pol-- comiatique Kumores^ uon nifî in naturali oâîcina ^ hoc eft j> 

iuni. hepate eîaborantur ^ ita & eos , qui prâe ter naturae kges iiunt> 

vbicunque corporis prasternaturalis yigeat caufa -^ aptaque ad, 

fit materia , procreări pofle eft afferendum . Si<: in vcnţriculo^ 

A<5ua'qao. ^^^ ^^^^^ gruginofas varias porraceafque bile^ ex cibi , huEno- 

ţnodobiic- rumque corruptione gigni conipicimus ; & aqua:»qua^ picuita? 

^^*^' inftar & humidapariter , & firiggida eft^-fi biliofum in ventri- 

culumexcipiatur, &ipfa etiam bilefcit> vtannotauit Hip^j, 

acut. Bilefcit j inquam^noa quodferuentis ventriculi calorem 

fuafirigiditate per antipariftifim ingeminet ; aut bili admixta^ 

iilius molem adaugeat, dum diluit;»vt Interpretes eo loci com« 

mimfcuntur^ diuerfum fenfuiu ăb Hippocrate cxcorquentes^ 

' . - ' cum 




Digitized by 


tfi tamen^x fe diIueMeloijiiatar ; Sed biteickea quad â prse* 
t^raaturalibitiofas caccchiarise caîore>d« in ventricule immo- 
r âtutjputrefdtyVt ibi expomt Galen* adfcitoque fîbi amarore^ 
eorrupt^ bUiperfîmilis euadit;qu€madmodu & extrâ vemri- 
culumvbicunq. &quâuisdeoufa€ademaquaputrefca^^ , 
viridis , & ainâra eicinnata propenfîone redditur^ vt doâe ^x- 
au. 29, plicat 3^ratipB€înqiîe: adducirMartianusr annot. in lib. deae^ 
aq. & Ipc^fcct&m piitrcfcens fanguis ia flauam atramquis 
bilem'tranfinutâttit : & bilis ia cerebro , vt nomnulIifcnfîuBtj 
vbi in phrsenitide , coirfumptis tenuioribus, feruidioribufque 
partibus , inquid cinerulentum rcdaâa eft , velwtvinum ^^«^^^^^^ 
eiianidiim aaturaîique caîore deftitutum , frigefcit>atque> vf bp ctcden 
ha dîcam , pibiitcfcitîesquoad mmulmolbs^ ddii-anrîum J?^^te£ci; . 
moms , fopor em* ii%fequi plerumqîie co3afpieinm$ j etfi id ab 
cxfoluEo inmctx€\^c> ; ve! a pimkofo M ntmquam. deficiente 
kiimotej quidenmm colliquefcit, interdiim prGiiemtepo& 
fe arbitremur . Amaram bilemâb afiumpto aceto pariter pk 
mi. 29* niîcefcere aiTeruitHipp. j.acut^eo videlicet, quod friggidior^ 
arc diîucior reddatur ^ Acdpitur fecundo biiis âb Hippocrate 
pro bilio&qu^dam pţilaioniam cacodîimia , vtliquidum nec 
inferiustw I & &^^ iibfbEmusiieciiindi^arq; in boc fîgnifica^ 
nuncxie ac^pi<;ndâm, fatis:patet cx iymptomacîbus^ quse re-* 
cenfeniair i l âum flaiionenxâb iniţia viijue biliofâm esocitilfe 
oftendtin t . Poft quâm ergo in thoracem quid fiuxerit ciente 
fi-ic^ore , ^ biîiofum vt pkrimum id eft > ac proinde morbum 
procreat >quibi!isnonuneiniîgnitur,.Atid> quodâ&igore 
conHno^eâiry âd^koracem fepe fepitis delabitur, quiafcigo* 
ris-eftir^sverfusexprimere; quodqueiHCik expreff^ 
fkilepcr c^acbeam deicendit > cum itcr fempcr adapertum 
reperiât ; Qui veto prse frigore biliofiis bafce patiaatur Buxio* 
nes > laffiiudinibus etiam > ( vlcerofis videKcei ) obnoxi) fimt. ^^^J^f ^f^ 
Vix ctenim fieri poteft â frigore expreffio , quod ia ambience Hmp. iib.^, 
aere fufa ic6tatum > corporis habitum vndequaque demac atq^ ^^ ^'^^' 
cbnftringit , quin tcnuiorcs aliqiii bilioiîque ichores per car- Lâînmdo vi. 
nes defcendant;auta venisincarnisfibrarumfpâtîacxprimâii* Uoâ^^lxiv 
tur > qui > vt primo leues quofdam rigores excitant ,. dum per ce conchara 
fcnfîentespatticulasfenintur; hcpoâmodumincaîeicentes> ^''''"^^ ' 


Dîgitized by 


14% - MiPFmKJTisnB.ii.mmc.m^ 

ma:emiu:quirunt qu^katcm; acnpii*^ cariKS calc^ 

feciefido labe&6taac* fed dummpr4icam, illanim partium 
excretrkem excitant ; vnde concuţiuntur , & permdc ac in 
CeîriisHb.4- itinerc delaffantur. Sic CdfusfympcomatareceiîfcBş, qua? 
&S2^!^ ex capitis fiuxione ad thoracem exdmntur^Jaffitudinum mc^ 
*^^*^ mimc, qiias foîXâffe €x ncmomm mzm principio nimis in 

aq>reffionc illa humedatp prouenire interdum poffcfaten^ 
^m eft . Patc^ iam cm podusân fluxionc.cauiâta i jftigorc h^e 
oriantur laffiaidines, qmm m ea, quse fit â calore : frigus enim 
ÎHÎîoiâs vtplurimum concitat fluxiones , vt didum Mt > den^ 
iâadoque corporis habitum,biJioiâm cacocfaimiam ia carni- 
bus rctinet 5 vbi calor e contra mcatus omnes diJaunSj cxtra 
edam euocat^ & in alitum refoltiît . Cerebri dwiuin excre- 
mentaad pdmjonnmdxoraciftiue catîimt^mdetea, qu?cpn* 
dafa inoîdcere^ac bîkm emulări diximus^ fi copiofa a^teio? 
âîim &nty ita ut neqacantperanacatharfîm iati$ expurgări, i 
conc^to caior« in pus veîtuntur , atque empyema cjccitatur^ 
kixca aph.jSXecj* Diftillatioaes in ventrem îupocioîFem fup* 
puramtur intra vi^ti dies 1 qui tamcn niiî rixâ fittifque expur* 
geturintra tempusconftirutumapîî* ij.fecj. quadragiata 
^delicet diebus> pidmoncs, quiiiibiîantia xariiiinc  moUes, 
exedere atqueiirkerarc indpit > cx quotabes pro^eatair > vm 
ucEfî corporis extesauatio exigua cum febre , ex pulmoiţum 
TJcareproaeaiens • X^H^m vcique opinionem deSiiîpyematc 
â copio£i pituita abfquc yUa precedente inflaaraiatione atque 
^mpyem^u Ticere>fâa;a>4xgiikauitHipp/3ib.i* demorb*;<ju?m^ ^^* 

£cd^ţ^t^ Itus inxommento conoair dfeer înterpreiari,ied tt:55 . ^^ 
ex AoxionU demiii>ri, &t!s -maniieâeiConuinckur.; vbiccgitur/ateri cflTe 
pScedci^ tamquam peculiare fupjerioris ventris >ioc di^ thomcis^ pi- 
inflâm^tio- tuitam in pus vertereab% eo, quod coHigatur in tubercule , 
^^' 6b intenfum , quem indudit , calorem ;; fecus quam in vejfj» 
treierfcriori^v^bi db ca2orispaapertatem>& amplas vias nil pcM 
ceft&ppurari, niiî in turnare priuscoUedumacqxoa^ 
coqucîidâ fi^- Qu^mnu^ emm .conco^td^op-ortet » inquiti5* epid, cimcfeiSî Sec- ». 
ciaufa «Ce ^J^^^^jj^^szV^praster qiiam quodapearos vcîbi^idi^umj^^^^ 10, 

^ ^^* Hap.iib» degland. iaquiei:^.;Sip^rp4£?^/i^m 

Digitized by 


tOMMEmAKnS ILlfSfRAtrs. Î4J 

ţuîiTîones pîtuîta 9 at^e ea]ipfa pus jkrid quâd pulmmes exe^ 
dity ^non facile ^groti fiperjHtes mănmt, Hanc iententkm 
amplexati funt non ignobiks Medici, Trallianus > Pauîiis, 
aîi}que,vc videre eft apud Mcrcurialem aph. jS^fecj. 
vbi eam mordicus deteftdit . 

V, Cumvcro înmedulîamfluxto condngeritîtâbcs m^îiam 
occuîta , atque incoBfpicua oboritur • pmaica> 

ALtera ex fluxionibus ijs , quas fuperius occultas iiiincUf 
pauit,e6 quod morbos pariaat , qui fub ocuîorum 
aipcdum nequaquam veniunt>fitper venas,vel eciampcr 
mcmbranas,ad fpinâlcHi meduUamv Qua* autem fine hx 
jiu.20- vena: ^docuit iib. de oC nac. inquieuş/ • Yma cauaiuxtâ Jp- 
nam ţer d<yrjmt:'9 acitipihm , ac gHîturpr^ţmdiiur > if mtd^ 
tas venalis Jpnali medj^dU tranfnittit^ cui tanquam haâera 
plurimîs capUIamentis adh<£reî y îf impUcatur . vbi pro capilîa- 
mentis inccUigeads; abfquc dijbio luat intercoftalium vena* 
rum excremitatcs ^quse â vena Azigdş promanantes, ad fpinî 
in dorfo terminiântutî quemadmoaunî per colii iatera a iugu-, 
laribusaonpauc^edamvenulşe ad ceruicis vertebras tranP 
miituQtur > & vt demuni babe tur lib. de genit, tendunt in Jpi^ ^ .^^ ^^^ 
naîemmedMlLsmaho7nnic<nporem^. At quanta? dignataţis iît duiisdlgat. 
baec pars, qu3e meduUa miniis proprie nuncupatur ,inde fatis ^** 
conftat, quod fit quxdam cerebri cum Uiis niembraniş pr^^^ 
duâ:io>qu^ intra vercebrasIatitanSi & officulis vndequaq; 
obuallaca> velui; argenteus funiculu$ ad coccjrgem yfque pro^ 
tenditur, cerebri vicem gerens , yarias neruorum propagines 
hînc indc k fe emictens , quibus cotuiţi corpus acnpl^iâitu r, 
fenfum Se motum , ceu per tot radios > ei infiuens . Habet 
proindecumcorporcvniuerfofympathiam, itâvtcum ipfa spinaiisme 
totum corpus Isedatur^fiuc vt iiaftrumţatalis pars , iîue vt fi- ^^|^ţ.^^^J. 
milaris laboret: non modoenim bac obftruCta^ meatuq; ani- pere fynipa. 
malibus fpiritibus denegato, paralyucag oiiuntur a^gritudi- '^^^^^* 
nes, fenfu depcrdito & mocu ; ied ipfa etiam infua temperic Tabes e fpi. 
pr2eternâturaliteraiFe<5la> coturn corpus laefionemicntit, ac fa'c^*^'^'^*" 
pawktim concibcfcit^ fiue quod omnia transferat adfuam do£^\ 



Digitized by 


<X44 H2Pff>Gil^TIf IIR HOM. 

.gentiiiţatem j> quo rnoâo ex^ iciiicnirs c« i o Jib. iV > fiw f 0- 

tius quod ci amquâm Eotiiis c<H:poris carins ,â aiiuslate- 

ribuscoftamm compagoliuj3ciâniiiîicpaftruitcorpus>omni^ 

turn yiţalia , mm aaturalia vifcera adiaercnt > ac proindc quă- 

cumfpina:! cumq;eiuslabem faciîlime contrahunt^omnifqstuîn yitalis.tu 

^^l^fci- naturalis^tum animalis oeconomia cum hac labefaâatur j feu 

manaoeco* deniquc qupd ipfâ 'MpiiiaU medulk m Bon 

^?r^*^ poteftquinfenfuş&mptusaMqviapacao iiîreliq^ corpore 

î^4antur 5 ad quorum lafîonem & nucritiuam Isdi neceffc 

-eft, eo quod parces nou xqm bene alim^nti indigeatiam pKsr- 

dpientes, miaus valide crahunt â venis ; quinimmo non nihil 

imbecillioribus yfdcm partibus ad motum redditis; cx nimia 

quiete imiatus torpelcit.calor > qui am^n ab aiaimali fpiritu 

tune temporis minus csdyip , 4aeque etigimrv nequefcmemr; 

& influens nequa^am attrahitur : exquibusxaufis membra 

omnia â fpinaîi medulJâ male fe habente procul dubio conta^ 

befcunt/lpiaverdfaciUimilaîditur» diffipaturq; oh moM^Sc 

spinuiis m^- laxam , quam habet fubftantiam; ftuxianibufque aon ra^â 

imXmi iîifeftatur,non modoobplurima vafayqu^adipfamtermi- 

<aa ar. ^^^^ .^^^^ diximus ; venim cciamqma capiti continua , ac 

perpcndiculariter fubieâa eftivndc per membranas etiam ce-ţ 

tebri fuperuacanea excipere apta; ex quo varij in ipjâ exckaa^ 

. tur afectus pro kfîuentismaterici^&loci varietate >qui aflu- 

xioneoccupamr^ Nammodo nexusv^rtebraruinlaxat,& 

făfwîlhx putrefacitillapfusbumor; quapropterluxationes coatingut^ 

varijl & inde giboiitates^aphoniac,anginofeq; affe^tiones ^ vt patet 

€x 2 • epid/£ec. 2. , & 4. deloc» afF. cap. 5 . Modo â craffo ad- 

modumbumore obftruuntur meatusyanimalibufq; fpirici^ 

bus via intercipitur , ex quQ.partium paralyfes ;niodd t-enuis 

ac morbofa fjuxio ipfam Iubit medullare&bftantiam > eamq; 

diiiîpat , at^jiie î^foluit , itâque non vnius generis tâbe$ pro- 

crcancur . Tabis nomine noncMh hk intelligamus cotporis 

Tabes a fpi- extenuationem , quse cumlenta febre coDiun6ia> âb infanabi-^ 

ia%î.^^" " hbus pulinonum ^ceribus originem ducît> ac proprie pbthoc 

nuncupacur/de qua in fuperiori egit -concexcu 3 fed cum eo 

nomine quofcunque , & â quauis caufa , corporis marcores 

7> Aph.coiiu Hip.vocarefokat,vt annotat G^l. i .epid.rec.2.par. 1 3 •& aii- 

^^* ' bi; 

Digitized by 



bî : nune cum potilTinium proponit ^ quî arefcentcm fpiua- 
lem meduîlam vt prsecipiiam caufam agnofcit^ proindeque 
dorfalis tabes aîibi âb Hippocrate nuncupata cft . cuius piu- 
res ditFerentias pro caufarum diucrlirate > a quibus meduîla Ţabisdo»- 
^xhauritur^, vanjs locis regiitratas repenmiis : nam modo diâ^ienu^. 
a copiofo fanguine y quem multiplices yenas in eam euomuni^ 
iiatiuus obruitur meduilx caior , Scdeperit mitritio. mo- 
do ijfdcm venulisâ craflo & glutiaofo humore obămăis 
debitum deiaegatur alimentum > vnăc medulîa atrophia exa^ 
^u.1.. î'^^<^^^^ vcvider^ imenâftl^<a;vbivterque calus rccen- 
^ 14.' fetuf , modo â nimia Veneris indulgentia, vel affidua feminis nor^istâ-^ 
effunoae in gonorrh^a, inquaalimenmm folidis parabm> 'oesobremi^ 
fobripitur 5 ipiarumque fabftancia exficcatur ; ipfa podffimiiiîn ^cl^l''^'^' 
medcîHa vnâ cum cerebro exhauritur ; non quod femen a: 
foîo cerebro ^fpinaliq. medalia procedat^ .vt videmr innuiiTei genit.& 4. de morb.iniuo^cu aJibi dixeric femen decidi 
ab xsmni humidovc vidîmusjib, Xvt/2 2. ^^^^^ 
do âb ipfis deducacur, mm propeer analogiam, quam habent 
cum femine;tum quia humid^ &: îax^ cum {înCjtraâioni mi- 
nima refiftunt:imm6,cum in corporis extremitate fedemob- 
tinuerintjpîurefq^in ipfîs vtns^ terminenîuî^ tefteş d um nimîs; 
exhaufti trahunt â venis, atxj^b^ maioresa minoribuSjVtlu^u- 
lenter explicuit Gal. Bb. x , de femxap. lă.yin exxremitatibus, 
demumÂftitur traâio;,bf q» partes omnium nxaxime exinani- 
tae obbumidsLm fubflantiam & diffipabilemjnon habent poft- 
inodum vnde reiîciantur» Exarefcuatitaquein nimio coitu 
plus nimium , vt nocauit^tiam Axiftoteles , & cmn ijs vniuer-^ îib.^.d^ 
fum corpus linfim marcefcit >M pater ex hift.Satyri illius^gQ- f iţ^".^;ţ;; 
aoxrhsea laborantis lib.^.epid. icc."^. t. 44.; S: lib.2* de morb. bic. i,z: &; 
vbi agitur de ţabe dorfali :, qua? recenter Sponfos , Veneriquc '^V 
nimium addiâps quaiidoque infeftat. Lsditur jpoilremum 
medulia^bsec â pitiiitoia , vel bilioia fiuxionc : â pimitoia qui- 
dem cenui,natiuumquecaIorcm nimio madore exdnguen- 
te f â biliota vem^ăcri & exfkcante> quaeip&n diffoiuit, 
& ad nihiiiim fereredigitv Quaiîi fluxioncmi non modo per 
venas y fed- per membranas etiam , m^duikremque iiibftan- 
tiam cerebxa condnuam deduci pofle cenfeHdum eft . Ac de 
^- : - T iiîa. 

Digitized by 


î4<f itiTFocKATis im tu m loc. m hom. 

iăaloquiturmprsfenti testu, quemadmodum locuţus etkm 
cfl lib. de glaiid.; vbi non immerito tabem , qus â ipina? ex- ^.^^i^^ 
Tabe^ dor- hauftu prouenit, occuîtam vocat : nam etfi aliqua adnexa ha- 
caiu/iiî:^cfi- b^^*%^^> qu;£ â: redundantem incerebro materiam ^ & 
ta . poftîcarum pardum la^fioncm indi caar, vt capitis do lor , cer- 

uicis>Iumboruin, mufculorumque ibiadiacentium, vţ ha- 
betur Iib.dc int. a&ci*; non funt câmeii tabis propria %ua , xiu-î-^ 
qiiemadm oduin tuiîis , & purulenta fputamina in tabe ex vice - 
repulmonum : fed paulatim diuturno tempore^orpora at- 
tenuari conipiciuntur > vila abique cuidenti caufa, proindeque 
rari creduntur â Medicis hi caiiis > fortaffe quia non animad- 
uercuncur ; fcd iî quid tale contingerit , ftadm occulus 
naturalium pardum obîirudiiones fufpicamur ; cum tamea 
fpinalis medulîx exarefcentia symptomatis huius caufa licpo* 
tiiîiina^ de qiia vide Sene3:tunalib*z,part. 2. fuse praxis cap.25 . 

yj^ Cum autem retro ad vertebras, & in carnes dcflu- 
Hydrops cx xerît hydmps fir •- 

CApids fluxio occuîta atgue incoipicua > qu^ pofticas im- 
pedtpartcs j iî , non per ipin^ medituiliuni fera^ur ^ fed 
podus per adiacentcs vertebris carnes & muiculos ^ dum aded 
exigua non fit , vt protinus â natura euinci > ac diffipari poffit ; 
vel fi aliquanco copiofior , a validiori expultrice in imbecil-* 
liorem aîiquatn partem deponatur; tune a carnibu$ imbibiţa 
hydropemdemumparit . Quod vt namfiat> iam modojace 
expUcabitur : calus enim hk incognitus fere videtur noilra 
hac setaie, eoquod pariim fit Medicis obferuatus. 

VIL ^^ ^^^^ ^^ ^^^ cognofcere <Jatur • Skc^ cnita^: 
anteriores partes funt ^caput videîicet ^ & nares 5 & 
oculis amplius hcbetudo accedit^ fiuntque cum vira- 
re pallidi 5 ieemque reliquum corpus •, & nihil expui t 
liQmOy etiamfî mulcum fiuat^ Fîuxus cnim per medîam 
camera retro fluensy & âb.anteriorcauerfaSj ante- 
riores panesilccas fkcit ; poftericrem vero carnenut 



Digitized by 



îm<'at & magis eamyqua» intus eftad venii^, qaara 
aux foris ad nafum, proptereâ quod corpus fons ' 
roasis folîdum , quămintus, & anguftiorcs meatus , 
&foraminahabet: Quarefane cum tenma fint fora- 
mina ,coftringuntur , ipfaque fibi ipfis raedentur , & 
auxus nulius hac tranfire poteftJntus veto foramma 
arapliora funt, & intermedia tenuiora habent : fluxus 
vero^vtpoteâb altioribusprocedens, &tenuîaim. 
pedimenta contra rehabens , influit , & carnes humi- 
ditatereplet. Sed& humiditas â cibis m idem pro- 
cedens , corrumpitur : Corrupta autem ipla pvx am- 
roixtione , & Cmui cum ipfa ea , qu^ â capite dcfluit , 
corpus nutriunt. Carnes vero multo humore nutrita, 
& morbofo augeTcentes, hydrope plen» fimt . 

TRia hic cscquitur HippocratesîPrimo figna proposit, 
quibus conieaari poiTimus cerebri purgamenta ad po- 
fterior« atque internas itcr fufcepiiTe partcs . Secundo rauo- 
nem rcddit cur nam fluxiones ad interiora fecUius, quam ad 
exccrioraferantur. Tertio explicat modum,quo€x peltica ^^ ^^ 
hac ccrcbri diftilîationc hydrops procreatur.Quo ad primum ca^ to 
Si-naidoftendentia/pra:ter€a, quasiiuper mter. 
aftecrecenfuimus, ^qusequa vere pathognonomica dicipof. 
funt , pofticarum nimirum partium dolor, hic magis amft- 
ciofaproponunmr, anteriommcâpitispamumficcitas, na- 
riumvidelicet,oculorum,&om . Sed cur addit. 0«./o^^^ 

pallore, cum hx partes a fluente materia faaud infeftenmr? ^J^^'^ 
Lquiain^ocafufpiritus-fereomnes rum animaJes , mm vi. cc^^^,«bc-_ 
ta'es vnâ cum naciuo calore, adcontrarias partes cum tiu- ^.^^ p^^- 
^aoneimpetumfaciunt, vndeoculiipirkibus ,magiiaexpar- «.«.h«, 
Kdeftituti,hcbefeunt-, &adiacentes partes ^quafv&igeant 
, iam,virefecntipallorefufFunduntur?Casterumlib.2.dcmoib. 
« repericur , patientes boni effe coloris aflermt , fîue qioa 

Digitized by 


148 mpFocKÂTis UB. mm WC IM hom: 

b^par in £>imorbb minime afficktiir , vnd^îaudabilem po^ • 
t^rit gignere fanguinem j fmc quod â tenuiori pituita poţeft 
quidemfanguis quoquQpaâadilui, non tamcn ©mnino vi- 
ujâus cius color occukari : pr^efertim quod partes illx aste- 
riores 3 naorbofa fluxione liberg fupponantur . Qiîoties i^itur 
caput â precedenţi grauitate pauîatira iubleuarî obfouamus , 
ac nihil interim perpatentes mt2ims cerni coipicimusy nece& 
faria tune confecu tione fufpieandam eft fordes iHas ad inter- 
nasnobiîiorefque fcrri partes : Vix enim vnquam^tanta ei; 
ie poreft excrementitia materia , vt fimul ac femei omnes 
ppris fit inuadere partes ac vndequaque propagări . Qus qui- 
dem ânimadueriîo fummg exiftit vtilitatis riSn tântum in pro- 
pofito cafu, dumpr^cognito pericuîo priufquam expoâicis 
partibus perenniter I^fis tethaîia emergant mala , faîataribus 
Ammduet- ^^^^^^P^^^^^cre pra^fîdijs j verdm etiâ dum ad diqnandum 
lîo iaDacijs inggmum in cercbro humorem ^ varios focus y ; ftillicidia 
praefertim e medicatis aquis, Duccias appellant, quandoque 
adhibcpaus j fi aîiquot poft dics , £bx fcilicet > aut odo âb ap., 
pîicito hoc pr^fidio , nibil aut per os , aut pernares ^ aut pex 
oculos^ autper yrinam & ficefllim euacuari obibruemijs^ , 
tune prsftantiffimorum Virorum obieruatio monet euefti- 

gio eiTe defiilendum: fignum^namque eft vei bumorem illum 
neudquam pofîe diquari ; vel fi eliquaţur ^ ibidem tamen re-^ 
manens^ vel propagări ^ & difFuadi, vel putrefcere, vnde ma^ 
iora minatur mala; vel quod denique occultasac nobiliores 
adoritur partes , maximo procul dubio ipibrum laborantium 
cxcidiot V 
cuf S^ . Qy^ ^^ .fecunda FluxioJiarcmagîs atq; f^cilius carncm ir^.^ 
pcîimer«as, rigat^ qu^ intus eft adventrem;, hoceft^ quseimmediatein»* 
S^P^* ^^^^^^ ^^^'^^ corporis cauitatcs , quamea, qus foris eft ad 
tcs. nares, &: m fuperlîcie . Eiusreiratioeft, quod corpiis foris 

iblidiusfîtacdenfius, &quod anguftiores habelt nieatus, 

ouam intus : Idque optimo natur^e inftituto > vt externa vi* 

delicet garţes , cuiuimodi eutis eft , & carnofa membrana , â 

quifausţoturn corpus vndequaque circumtegitur, quamms 

€m,coTd^^^^mioiMmnibus peruias^ fint ad infenfibilem falioinum 

^er.tio . ţranipirationem, lUdorifque exciufîonem ; C^uinimi^ de^ 

' bUis 

Digitized by 


bili$> îgnobflifqtie curn iît ipfa cutîs, cftqtiafî'vtike rfi corpc^ 
ris emunCtoriiîm, ad quod ncn r^roiutiernaiuro partiuni pmv 
gameata â \:aiida expukrice deponuntur ; vnde 5;^<lor ; <iicc- 
^^' bat Hippocratcs j^.zc\\uOnîntbtt$mcrUsefl ccmmtinis: actamciî 
angufti, acfcrei«fenfibiks funtharutîipafd«m meatus, ne 
fpiritus nimiiim diffipentur > fcd conferuetur iimatus calor^ 
atquc: âb extrinfcco fit tutusambiente. Cum ergo turn ex 
naturaî inftitutoj ţujB ex ccnt;inuo frjggidi acris^^^ m/^h- . - 

îîoriîtatque folidior externa corporişiuperficics; bine fit , f^pius^ pc^ 
quodnon aîque faeile iJJac elabi poffint humores, ideoque i^^^^niaspar 
dieufltur iibi mcaeri, hcceit, praeieruare le hac meatuum vrims^qaarn 
anguftia, qirominus âb huiufmodi humorum incurficBibus f^lc^^^S' 
infe%ntur I ynde morbps per internas fe vrina cencux- 

& feceifu, quam per externa yfudc>re> alijfijxutis inquinameii- 
tis , uidieari obfcruamus , Seciis accidit pcnitioribus in par- ^ 
tibas> qua: r^riores ob intertium calprem affidue cuadunt,; 
cumque mcatus fatis.araplps habeant , tenuiora pariter erunt 
horimi mcâtuumjnterititia^ vtvidere licet in ipongiofis cun- 
^tis corporibiis , ac defcendens proinde humor â tenuioribus 
hiice interftitijs non x^moţdmr > atque inde carnium poroiî- 

tates morbofa iUuie iaciJIiînerreplentiir . ^ 

Hxnc.4enique fit Hy drops iile x qy i Anafarcaiiicitur;>totîus âuxio^^ 
carnofi Kabitusa^e^o: attractys etentm alimentitius humor |^^^^^^^ 
cum hoc morbofo ia porofis partibus^niicetur , ferofus, cru- 
dus ^ atque âlendo inutilis redditur , nam in paxtis fubftantia 
non traiifmutatur:.: vftde fie inelaboratus ibi remanens^ â de- 
prauata haci C^îtia ^roâione in partibus , totus e^ 
Uîs intumoţcm ^^^ndam cedonato&m excrefcit ,prsemen- 
dsdjgiti ;yeft%iaAru^s . Ab anafijxa vero uciiiscft tranfi- AbÂR^rca 
tusadAfckcmj&Vmformem hydropemillum, feu etiam ^«^ii^ft'^ra 
îympamtcm ^laquo aqua vel ipintus in pcritonsei capacitate fciîe>&iym- 
coUe^yş, totum abdomen in portentofum tumorem eleuat, 2^^^^^ * 
?t habeţur apb. 7. fee. 7- , ehquaca vidciicet â calof e vitiofa 
carnium colluuic > Se ad mefenterium atque periconatum po* 
ftremo dilatat prefer tim dum poftcriorcs partes , dorii pr^e- 
dpueiaciumborummufculijferofaiila pituitofaqi materia Xamborimi 
occupantur , ob mirum confcnfum , qui inter lumbos ac me- ^efcmî'c^^o 


Digitized by 


Hydro|>îs fî- 


du. dicitfolâ 
Afcitim vou 
cari hydro. 
pocratcs ., 



fentcrimn ihrarcoiit, cum hoc fuarn <kcat originem a ncruîs 
&Ii^mentisijsvquibus lumborum vertebra intcrfc conne- 
auinur^vtnoatHippoc. 5. cpiifec* 4. part* <5. , vnde lum- 
bis Ixfis refrigeratifque, mefentcrium, eique omncs adia- 
centes partfes^ refrigerări rationabile eft, atqae ita omnem na- 
turalem ceconomiam labefaâari. Hincincoac.prxnot. & 
j^. aph. 1 1 . Lumborum doIor,fi mcdkamentis non foluatur, 
inhydropemiîccum definit , Atque h^ccertia eratpars 
propoiîti tcxtusjin quo nonnuUa veniunt adnotanda. Prima 
Hippocratem non eodem femper iîgnifîcatu yfum fuiflc bac 
voce T(?f64> namnon raro quemcumque aquofum humorc^ 
ferofitatemquefub eaintellexit^ vt clare patet turn hic yerbis 
i\syCameshydrope plen^JuntymmlibAe nat. pucr.,vbi hydro- 
pemappeUatferofimtemillîttBjquae in fetus cgreflU per vte* 
rum e&nditur ; Turn deniqu€ 4. de morb. , vbi inter humo- 
res, qui naturalitcr in corpoîe detinentur, ferofitatem rccen- 
fct, quam hydropem pariter appeilauit . Prastereâcum apud 
recentiores Medicos hydropis triplexcommuniterftatuatur 
differentiajfumpta diuifionc â materia, & â parte a&fiai 
namaliumdicuntiicriincarnoibtotius corporis habitu,yt 
iam dî^um eft, dîciturq; Anafarca^vel Hypofarca, vel Leu- 
cophîegmatia;Alium in abdominis Câuitate, vbiperiton^um 
velut vcer aqua repletur , & appellatur Afcitis. Alium deniq; 
cum in eadem cauitate, cum aqua? exiguo, plurimum recon- 
diturflatuîencifpiritusjindeq; tympani inftarrefonati dici- 
turque Tympanitis:has omnesdifferentiascpmmuni hydro* 
pis nomine appellaffe cenfendum eft , contra ac ftatuit Mar- 
tianus , vir acriingeniopraeditus, vtfuisinHyppocrateni an- 
notationibus turn hic .turn 4. acut, , vbi mordkus defendit » 
foiam Afcicim hydropis nomine ab Hippociate infigniri:qua 
fortafse opinionem mutuatus eft âb Andrea Gefafpino lib.y* 
fuse praxis cap. 23. Redarguitur enim manifefte tnm cx hoc 
textUs vbiluce ciarius Anafarcam, carnofi generisaffe^um, 
defcribit , quem texţu proxime esplicato appeîlauerât hydro- 
pem ; turn lib. acut. , vbi eundcm hune morbum/atis appo^ nu*^» 
fite âtque expedite in duas dirîmit natuţas j&mpta diuifionc 
ă parte affeâa , quarum aliam dicit effe hypofarcidcm; aliana 


Digitized by 



âutem fieri cum infladonibus : nam "m abdommc Gm£zt 

zCckkyfm^xyvn^nms^ in vtraq; imumcicit totumcpig^ 

ftrium ; in vcraque mm aqua reperitur, turn ifîmus ; ntqu^ -" 

aUter dax hse hydropum ipecies difterunt inter fe > quâm fc- 

cundum magîs & minus: quandoquidem in afcite pîurimum 

eft aquse^ & pariun flatulenciipirirusuj in ^mpanite cum mul- 

to Şirku , perpauca ţeperimr aqua : -Quod non^aliunde pro- cm aqua & 

ueniţ, quâm quodAfciticorum aqua iecundumaliqu^îxiui ^'^p^^^'^w^ ^n 

partem â calore îmfiamm iubiade vertitur^vt noimiic Ai^r.^^ S^« ^- 

xollig. i;âp. 21. flămlentus vero in tjrmpanicefpiriîus infoii- ^''^'''^ 

fatur, ac veluti ncbulofus euadic, atque ita vnâ cum flatu 

quafi ncbulofus humor coaceruatur,vcdocuitAet» lib. io. 

cap* 20. Mimm ergo non eft , fi ytramque fpeciem fub vna 

cpmprelienderit , pro more omnia non neccflaria ■reijciens. 

K eque dicendum ciî de anafarca fub nomine leucophlegma- 

tis, hoc eftjpituirg âlb^ femper egiflre;Bam pituita alba efrpo^ 

tius pituicoia qMşdam cachexia,ieu malus corporis habitus^in 

quo copiofapitmia^ţum incrâ vafa, turn per camis fpiramenta pituiu alba 

& poroiîtates^colieâa eft>acproinde pallidus, laxus^& fubtu- *i^^ ^* 

midus2^âi^>futur^leucophîegmatisrudimentu,iuxcâ^^^^ ^'^^* 

dempxiiidpiu hypofkcidios , â qua carn^ in ieix>iâm humi- 
dimem liqu^cm ipfiq; crudi Jiumores ad feri natura propius 
accedut,omneq; mufculosi gcnuş pkrimu tumet.De qua pi* 
tuitoia c^hexia locutus eft Hippocrates quotiefcunque â pi^ 
îuita aIba.hydopem fieri affirmauit,vtaph. 70. fe<a. 7, cita^ 
to>l^ d^al&âu & aiibi : ex qua inccllectionc lochafere om* 

niaâMartianaeatHippocrate in contrarium addutta, fatis 
cnodataremâîirenti.- ; ^ 

Anrtotandiim fecimdo cx hoc texcu eft Hydropem quan- Hydrops£<î. 
doque£cdiiulJatcmis, nequeprimarid, ncquc fecundări© , Ut^^S 
maleaftecio iecinore, contrâid, quoddecr€uitGaIcnus5. A^^^«P*te. 
de Ioc.a£cap.«J»& 6. de locaf. cap. i . & alib i : idque non taix. ^..icf^cnar. 
turn de anafarca intclligendumeft, frufirata nimirum tertia "p-'^' ' 
coCtione in kabitu corporis, y t in oexcu apertis verbis affirma- 
tur i vcrum ctiam de afcite , qua: â1> ipfo ptouenit anafarca , 
dum piîiutofa iila coUuuics , flaccidaquc caro , vi calons cU- 


Digitized by 


pliata > per lumbos in peritanşum delabitur: cx quo Hipp* 
N^s* ^1^^ a itieoâc. pr^nodonibus , & ia ftogTi.HyiYoţes inciţiunt fieri- 

ce darius libro I* de morb* mul. hydropemiilsefb omnino nu- §7- 
iiepate interdum oriri aflferimr cx folo !kae , dum quis ma- 
^imelîtiens , feu febre j^ feui quouis auâo calore , muîtam 
incrur^tataquam^qu?^ rBi protiBUs âutper vomitum , a^^^ 
fudQrem>.aucperyriaatn ei}ciatur; trahiturâîiene^^ 
rus natura cft, & ad peritonaîum ipfam denîquc traiifmirtic . 
Ratumigitureâhoc dogma indoClrinaHippocratis, mira- 
rique licee Pecrum Salium , Virum alioqui apprime doiăum^ 
i JnoStur" qui dum Galcno nimiumaddi âus , ne latum quide raguem 
^ eius dogmatibusxiifcedece aiidet, Hî^mcraî^m expUcanSs 
ae^ffbjeft ,. m ^u$ memi^m mimk.quandoque: aflcquamr : 
iîamlibi2r,:demorb;c4. quemdam af&âum^^^^^ 
qttoxereferi rpioîita actcnuata excrâ craniiisi; emifia ad carnes 
conuemmt: vnde capitis cucem > reliqutimque corpus attolii , 
^ atquecraflfefcere neceiTe cfti eumq-morbum effe fatecur , qui 
iiihocjtextudefcribitur3 & quem ipfemec Hippocrares hy- ^ 
' ^iropem vocar>e0 quodinipfo turnee corpus qwmadmodum 

in anafarca ^ C^a^ udir tandem iaud eife verumiiydropem ,. 
quiahydropisgeaeratiQ â kcore ; iiic autem morbus â cere- 
brali pendet ifluxioae ; eamqueopiniQBem mordiciis tuetur 
etiam lib. de aâett part. cap. ^* acque itâ Hippocratem nou. 
ek mente Hippocratis^ fedpenes Galeşi dogmata interpretări 
conatur ; cum tamen Enarratorisprsecipuum munusfit Au- 
dîoris mentem aperire , atq. ex ipfiufinet prjncipijstanifeăo* : 
âo interpretări. A$ qui plurajuiioeargun^nmmmd^ 
petit , adeat Sennercum , Virum nunquaaafacis-iaudamm^ 
' qt;jş{HQnei. dehydropeâicite,Ybiatt!âioEka^^ 
ac compiurium Hydropicorum hift(s>rijs oflendii^hydropem 
hepate omninoill^efo non raro procreări. Videndus:eftetiam 
, IoaniaesSchenckiusobieru.ined*iib.3*4e^dope.. :^ 

VIIL Siamem modîcus flujoisiu^n 
cox^d:;c artîculorutn diuturnam affeâk>nem f^cic^ vbi:flaer& 
fi« . ceiîabiti nam y t modicus , & vnckquaque ab omni* 


Digitized by 


bus fortîoribus depuifâ$,âd arrkuîos reiUglum fecît ^ 
fiunî prxtereâ articolorutîVyac coxendicam ^ctio^ ^ 
nes â taîlbus morbis fenatis 3. cum morbum quideni 
cfficiens fânatur 5 in carne vero quid relictum fuerit 5 - 
cui non fie exitus ^neque rursus inîro > neque fbras > 
ied ad cutem egreîlam ^^ cuberculum vnque fecerît i 
fagk ausem ia id , quod cedk ,artic4îloş videUcet^ & 
aut arîkuîoriim, aut coxendicum afFecciones mdudt* 

SAtis îiquet îb Jiiimani cotporis eeconomia ita regînaen > 

adminiftrari > vt potcntiarum partium morbifici appara- 
tus^qtiantumvigentis narurae conatibus fieri poteft^ adim- 
becilliores^pscpetud tranfmittantur, vc ampîe habeiur 2.epid. ^utcsinm. 
^ g fee. î . c. 1 2 . & iiba I . de morb. muî. ^if^r^ enimţars , kiquir^ ^^ *^^^' 

rit y ^ continue non ptmnt . idqu€ nuUatenus Isfa ^quitate , 
cum paries omnes c6 confpirare debeant , vt indiuiduum , 
quoad poteft^ conferuetur; ac proinde qu^ magis conte- 
runt ad viram, prse c^teris immimes feruari par cft . Quamuif 
jtritur vnaquf que pro vkibus fe fe tueatur^per expulfîuam po- 
îentism arcendoquicquid eft nosiums in mutua tamen aîter- 
catione necefle eftimbeeilUoresdemum fucf umbere^ vtque 
âb infefta oppreffse materia iangueaat . Id ipfum accidit ia 
propofitacapitisad pofteriores partes fliixione, cuiusmor- 
bofos affeaus hic profequiiur Author ^ ex eaarticulos dupli- Arde* 
Cicerincerduminfeftari aiftrens; primo vbifluxus modicus f^^^ . 
fuerit, itaut validei -parte qualibet expellatur, doncc in ifchio, ficxioniba^* 
aut compluribus articuîis i^ recipiat^ibiquc diuturnani excicec 
afFe^âioaem , repletis arcicuîorunicauitatibus morbosl mate- 
îia , â quâ ligaiTicnta , & cum ipfis nerui, tendones , membra- 
nseque diitenduntux , vei mteniaqiiaîiiate alcerancur, vel acri^ 
monia irricantur; idq; poftquam ftuere proinde âb 
illa irruemis humoris iînmcUtione; fe ic colîegerit natura ^ 
virefq. reiumpferit, it^ vt contra morbu iam infurgcre vaîeat ^ 
inqiimbecilliores arciculoş mprbificum humorem deponere • ^ ., 
Secundo fiuntarthriUC^il^Yciîichiâdic^a&âionesi^ ^ : 

V td^m 

Digitized by 


1 54 mFrocRAnsLiB. i r. m ioc. mnoM. 

^*^^ ' falihuf morUs tn^iktcz fciîiceti alij^JŞinalis mcdulte affeâio- 
^j^M^ '^ nibus^uaferintjfaiâtsl ia flujfiofîe^refolutis humoribus,reftau- 
:^>^.^/^'raîâq; natuta ia babitu corporis > vbitatmenaliquidraorbofat 
.^ ^-^'♦^'^*^ materiei reli<5iumfuerir>cuineq. intiîs pâteat exims, neq.foras 
'*^ .^^^f*^*- adcutem, adquarnlipemcniret,-vtique tuberculumexâta< 
retî conflukiccirco a<i partem, quse facile cedk,receptiorîiqtîe 
Artîcuîora ^P^^ exiftity atticulos nempe, ^uomm iati0ra Jpatiay iuqmt Gal- 
îiîtaiaiis op Coiiî. in aph» j i . fec.4. , prompte fi habent ad Juperftmtates fiiy 
^Siadhtu fiîpiendasy îbiqueautarchricidem occupacis pluribusarticulis , 


moribus.; aut coxcndîGenî > rcpktăifehij cauitatCj excitat . Diaturnas^ 
tic^oulT autemfuntba?'aftt(Stiones- etfî â modico fluxii pendeant, noiî 
€^T*^'^ modo 6b rationes tex.^ . lib\ i . âddudas ; eo icilicec , quod 
morbi ^ qui llccion in patte refident^ cuiufinodi profedo 
funtarticuli, fitmantut 5 &contumacesfiant ; quod repetit 
Hip. afFefl.^vbidixitpodâgram efiemorbum diutiir- ^^*^** 
mflîniUîi3,&qui^gcecediCjquianitorbus quantoiii ccnUiori- 
biis fuerit venuliSj & m parte, qua corpus plurimum indiget iii 
{bis motionibus, & iiî neruis & offibus muîtis ac denlîs $ tantd 
{ane dur'abilior eft , & qifi âîgerrimedepellipoffii . Turn quia^ 
etfi modica eftlia^e ^ixxxOi eft tamcH friggida vt plarîmum^ 
&infriggidoexangifiqueJo€orecipitur : vndcnoQiiifi tem*^ 
paris diuturnitate concoqui ac diffipari apta eft . Adde qCio^^. 
cum â cetebri fluxione pcndcat ^ pereiiiiis fkpenumero eft^ 
humoris hiiiiis generatio > ob aliquam mittemjs partis difcrâ- 
fiara i Ac demum fciciim eft theoreina illad Praeceptoris îib. ^^'^^* 
de riât. hum.regifirâtum * Quicunque morU â vaHdi^ma part$ 

articuîărem morbum eddem lib.deaffeîî. breuemdi:^itefl^**«'3^« 

& acutum ; id de eo incelligendum eft^quiâ biîiofapendct 

fiuxidne^VE ibi patet ; talis eiîimalioruin tefpcâu breUior e& 

cdnfueuic . G^teriim notus eft aphorifmus 49. kchâ* Quîcm< 

^nepodăgrici morUfiunt, hi^fidata inflammatione > in 40* duhus 

jâfb^Tm nftituuntur . Qui terminus nori eft acutoriim exquifite, fcd ex 

^^^^d ^^ decidentiâ, vt explicat ibi GalenuSj& in comm* i* prog.t.25. 

mx^ ^ ^^ Atquehincfâtispatetquâmrationabiiiterfeiaâec FerneJ*5» 

gSdamt^ pathoL cap,4. quod primus catharri Viam per caincs perfcru- 

friffiocatîur tatus fit ^ Vt imiuimus textu 3* huius Ubri * Silenâo imerim 


Digitized by 


%m& ^mtcxcunhim^^HifJ^Qg;mcm yfum fuifîe hac yoc^ . . 
Kl^jjLATAp jqnzm CommJ^ş intj^rpreţaţur, Mtkulonxtn 4iu^ |,^^ ^^ 
turnam affcâionem , fccutuş Erotianum in Onomaftico^ ^^^ ^. 
.Oalenus yero in cxplan. linguarum JJippocratiş ;, transfert, ^^tâŢ 
BxfluxuâiuîuTf^ affeBipnes vel inonmilus arţictdiş , velţr^dţuk 
drcan^tehras 0mrum , MartianMS ,auţ.em vuU ^ffc ^articulo- 
rumjdiatuxnps doloreş,non admpdujn rehementes^ qupruni 
materia a pra^dominip pkiuţofa eft . Sed jqukquid ficjcertuna 
^ hanc arriculobrum,aff€i6tianeîii noiiji^Ji jiiRejfam ^fle ib 
Arţhritidc ^ jqiiandoquidem .i^dcjttioi:Jb.T,bi.mprbos .e>mm,c-^ 
*"'^* rans , qui.ex lui natura jiiinim„e texbales funt , s:^t^ios^ 
nuatuor eAumerat ,arRculoru Affejâipncs /pejcie inter fe diftin-- 
^ăas Xs'J'^«eTa^Toi^^>/>Hr>/?x-,/^t',«t/>9/i^^^^^^ tamen differre, ^^^ 

ita vtyera Arţhritisinceriores pccjupet iirâciilorjLim >:aui£;ates^ şuimo/sac 
eedjrnata.Wtem iiant , jcuin iluxio .exi;erna ma^isp^tijt , ita yp 
parcemin îumprem magisjcleuet , ,&jnjnu$ doleat, ;eo pror- 
£ns .mc^o , /juojipcmc^. pra^ipl. , afler^ns ^ircâ ^rticulos 
***** ^^* doloresiîeri &.mmotes.non po.dagrico inpdo, & .G^. 5^aplu 
.com.3 o.> id inpueris quandoque aceidere afferjiii: . 

.•. SI porrĂ jbtiHnumnt nares 5 &^imîtapIenjefiîfc-.coga3ftq^ 
irinc 5 atjque .ea compacta* oportet pituitam cciupa-"'^^'' 
ctam&congeJatamatcemiar.cautfonpdentis, autme^ 
dicamento^ & non auettere • Sucnim fluxus auc rfuş 
rşlio procedat , omnino mâîorem in^orbujn facier ^ 

I cerebri thcumainnarcsper.os xribro&m irruat> jqu^ 
î prima.via.efti confpiciuis , vi plurioxum ytiqueiGl)Aiiis 
cm ipfîus j^grotantis^cu liber iftac pateat,exitus .excrcxni^nuti^e 
jnat,eriiE;ex^uo.Hipp.Iib,.de gland. Si admresfwdpfia^ amh f^^^^^ 
**^'^* duntur.nares, ^nihil aliud graure aecediP, nam vi^ îpfanm ^mz^U dc^ţcncaio^ 
funt , iîfM aMxilimpffunt. Atcaiîien.lî infigni aliqua vigeat ^*- 
.qualitatc> vei quantUateplurimum excedat, ipiaj>iM:it^r jpo^* 
. JbQrum.caufa exiftet : ii .etenim ^alidus jnimium fit, acriiiiQnia^ 
sm»?x* querprxdius.defluens.humor > vt lib,4evet» med. Mb^cur-, 
internas narium membanas pîerumque exjLirit > .crodendoquc 
iimplex procreat yIcusj cuiioi conj;ruo:ftatim occurras auxi^ 


Digitized by 



Iio,putret atqac ozsena exckamr^ cui prauo ex fanguine capiH* 
mcSfilt/ culapoftmodum fupercrcfcens, Sarcoma, ve! Polypus fuc^ 
?oî/pu$. cedere deraumconfucuit. Siautefriggiduscraîfîtie^&quan- 
ticate excedat , itaut cribrofum os pcruadere non poffic -^ tune 
muco opplentut narcs, atqi^ intumefcunc , ododbus incerci-. 
pituryia, piitrefcicdemum pituita> qti^ intolerabiîem pa- 
rit foetorem: oportet itaque tune tcmporis compadtam atee- 
uuare pituitaiu, co^ere , ac fluxilem reddere cum fomentis 
cxîrâ adhibitis j veî cariaceo vtre aqaa|calidiffitna repleco , & 
circa frontcm alîigâto ^ vz doctiit morb. ^ vel fpongijs mat^ 
congmo deco<fto expletis ex chamsmelo , meliloto, fiirfuri- 
busj hordeo, cajten&jue huiuicernodi; cuai medicameatis ijs^ 
qusepernaresattradiay errhinatiuncupantur> ex aqua videîi'* 
cec Betoiiicţjvel fâiuias, in qua fi:sftulum agarici ebuUierit; vel 
parata ex aceto > aqaa , Se ori^no , vt ipfcmet propofuit in iî* 
miiicâfueodeniIib.2.demorb. Dicic autem cong^latam noxx ^^%p 
^ quodâ frigare vt glacies obdurata fit';, vita enim luperitite 
4ctforc!mm ^^^^^ poteft feigus in amoiantium natura vfque adeo intendi ^ 
^^^ ^^' ^^ ^^ Gperctur; ied quod concreta aliquatenus , atquc incrat 
' *** fataiit : quod plane aon minus â calo re y quam â frigore pr^s- 

fori poteft, vcdociiitHipp. lib.2. dedia^t. nam cum iuxtâ g^^^^^ 
Ariitotelem 4.meteor. funi.2. cap,2. , eoncrefcere quoddam 
/iccefcere fir; id profedo & â calore humidiorcs tenuiprefquc 
par^cs vel abfumeate , vel fecum educente ; vel â frigore ca£ 
^nonî ^*^^^^P^Î^^^^^>P^^^g^P^*:^^i^* Monetpr^terea ne auerta^ 
«meaciâ . mus reueilendo, vel deriuando excrementitiuni hune ad narcs 
^uentem bumorem, non modo quia quomagis natura verc^it 

■ ^erconferentiaiocha>e6iemperefl:ducenduni;ver^nietiam 
quod quafcunqne alias fufceperit vias morbofa h^c fluxid 3 
maiorem femper excitabit morbum^ob partes longe nobilio^ 
res , quas oecupabit : Quaproptcr nifi ingcns aliquis morbus 
ibi in naribus procreatus fit , neque ad ipfummet paîatuna 
deriuare lăudabile erit: patet namque indc ad thoraceni itcr 
atquead pulmones, quâ verfus îeui quauis occafione fluxum 
deinde corriuari facile cffet . 

X^ - Cumvcroinaure5fluxeri£^prîmumdoîqrcmcK^ 


Digitized by 


î>et; Tiolenterenim procedit: dolorem autem exhn Au^s^sior 
hn donec is fiftulam redacrus fueric, Vbi autem fiue^ ai^ixiosc- 
re confueuv rit , non amplius dolorcm facit . 

^^■^ Vas ante propofiuit fluxiones , fÎBguIas reaflumît > prj* 

1,_^ cipuum aliquem, frequentioremq; morbum enarrans^ 

uqem ex ilîaru vnaquaq; paculiaritcr excitări obfe:rua£um eft ^ 

vt exemplp clarius infînuet , doccatqnc vt rheumata iila exi- 

tioia humaaofint gineri * Inter conipicuas erg^ 

îam enumexatur „qn^e excurrk ad aures^ interi ores videHcct j 

in offe petrofo latitantes ^ quarum anfraâiis ad cercbrum vfqj Aanui» a^ 

percingunt , ac proinde & proximitatis iure > & commuiîlca» ^f^!;^^"^ 

done vaforum ci pîurimum confociales: quapropter harum temo(ndz', 

a&ciiones nunQuaincontemnend.£e funt, fedfignaquslibet^ ^^l^-^Tf. 

&coaleniientisceî:ebri> &prsehantis natura? ^ primo vique &iiiî* 

dieftudioseanimaduertenda : falîax fiquidem hiclocuşeft^ 

medicoqiie inopinanci fspenuîîieroimponi£.I§î^î^rfiîa>ii> ^uiiiim 


emt Celius> lib.t?. cap. 7. ahauanfo mmus pencuhim e{i , ^^-^s?» fei pencmo-- 
tnocmu : namvjtta ocuiorum întră tfjdsnocent ; Atmtimtnpam' ocuioxiLn. 
matimes r dokrefytie int^diim ^îicnn m âemmîiam vtortcmquc 
pr^ec^i!tnf;^ipi<> mops inter iniţia Jiiccî^rr£ndp:in y[m maiori ţe-- 
pkidolccusjit , AA aures igitur cum per tenuiffimas venuias & 
arteriolas fiuxcritfuperuacaueus humor, membraaulas audi* 
torio meatui circumtenfaî , aut ei , qus? ofîâ intus in imo mea- 
tucircumambit, aut exiguo malîei muicuîo infîgitur , diftea- 
dit ; ac cum cxaâiffimi fit fenfus 6b neruulum, qucm â quinto Ammm d^ 
cerebri coniuglo excipit ^ intenClTimum excitat doîorem; mi- lor^^^î^as, 
norem profesio , minorique difcrimine;^ ii pituitoia fit nuxio^ 
^4^ V£ affe6t. non raro fiexi didicimus > qua? anguftiffi-. 
maspartes, venulasvidelicec, atque membranuîas ^ vel fia» 
tiilento fpiritu , vel propria mole diftendens > veî laîla aliqua , 
crodcntiquc facultate exulcerans> dolorcm inuehit abiqne eo, 
quod muîtum indc ceiebrum patiatur s ex quofit vt lenes^ 
quorum temperamencum frigg.dum efl^humoreique fi'iggidi, ^b a^num 
quiinijs plerumque coaceruantur , minus periculcseabfaap. i:i*=rbisfcn€s 
îummorbis infeftari coniiieuer|nt . At fi humor caîidusfu^. osc'mfcibu. 
litjVtfanguineus^ vclbiliofus, tune vnâcumphiegmoncfc- ^^^^^ 
^, ' brera 

Digitized by 


î5^ BippocKMi$im.TLmioc.mnoM. 

trem acjceiîdit> m^ximuniquc 4educit in difcrimcjtîîOb cere- 

fcri proximiîatemj quodin .coniejîfu;B tacillime ducitur;naim 

yeljeius ipirims intense calefaciendo^ atque infl.ammando 

iexâgitat^âiffipatquc; vel propagate xommujiic^tcquje phleg- 

^crcbmm-» w^^^^-^^^^^ lliMandam' yitiat; yelingenci dolpre euocajcis 

^Homoâo ^miequaque humoribus^ yitiofa m^t^eria rcplet . Huc acce* 

a^dat^ S^zcntz fcbris , affiduarque ^igilise , quse .omhia iieliriuiB 

pr^^nînanjcur 5 iuxtâaphoxifmum 3 . progn. , & in ^.oaci^ ani« 

Coltft!^^l iBaduej£onibi4S regiftmum Auris doîoramtmf:umfeirecm* 

■tinuaacfim 9 horrmdm ^fl: perimlnm enim efl deliratU" 

t^i^ rf^*K ^j(p h<mmim > /te ţenţurmn : qujmiam i^ţur fallaoc hic b- 

tioiî» j:usePycito mmtem aMih^re ponumi^Ptnihus alys fignis â fri- 

fnaÂie^^fermnf jiuUm iuniores hominesA f^timadie,.^adbuc 

citita exhocimorh>y ţmes ^u^ra Joy^e tardiîis:mfniţfiires9 fy 

ieliria minus ^jîs amJkmt y^ hac de câuf^m^ 

tur ^ Verimt hU .quijdem atatihus redĂiu^ ^^'^^ <^^^i^^ 

flurmos .midvMt . Ât^erx>iunwr£St ţriufymm Juppur^îur au-^ 

ristfereunt; nam fi pis alhwn^fflnxeritj^ aurc^es ^ejiitme* 

nem fiiţerţUt^nmafiinm effe.^fi fane^/diud qupdâam honum 

fignumîpfi accidat.. JSc 6. cpidlXec, .6. Fer aures, ex Aunbus 

ţlentmiim tertip dieimoriunturl* >lorbofa igirur mai-eria iîbniînî' 

quandoqueinpus mutata, memboiumierodit, & per anfra- 

iFhiofiim .aurisiB^ajcum forâs .egreditur, fcdaţu^que .dolor^ 

HQumioimdni citx> opportiunisauxilijs.exficcando opituleris, 

ibrdidum eiiaditylcuS;, ac .finuo&mctiîqueinîongumpro- 

Hiaulasuii ^ţrabatur tctnpus , obcallefceiîs demum , in fiftulam ceder^ 

quse cft M&m > oblongus , & jcalloiiis finus ali^uatenus ia» 


^^. , . *• yiexpcllentisânobiîioripâr- 

tatSBiîutcrise ;: non poteftetenim abfq; vioientia in ar^iisi- 
Fiuxîoâd .0ias aurium vcmilas iioxius iumor jnttudi .. Seciîsquâoi 

aurcs cur , . ^* 

vioientafit. accidit in naribus >xuius meatus Jatiores ■atgu^patemesiunt» 
Doi -d -A4 hac autism ?vtiiâtdQlor,qui.trilliSveft, moleilaq;iieniatio 

tem^diiToJiienribiJSjdebetmutatioiîenconfe^r^^ ficviolen- 
terad prsetecnaturâlemiiatuîaij vt xiocuit Cîal, i 2.meth*c,7*^ 

Digitized by 




& îonge prius Plato in Tiiti^o^ & in Pfeileboi violentia naq; ^ 
fubitaq; mutatio, adeo naturaî contraria eft^ vt quaiBuis alte- 
tatîo ad naturaîem fiat ftatum , dolorifica tamen eft^vc ij fatiî 
ekperiuntur, quorum pcrgelid^ manas derepente caleiîant ; 
cumtămen,fi fenfim fiat calefaâio iJla, iuciinda fit. Scd de 

Doîorem autem exhîbet - Muens fciKcct humor, do- 

ftec in^ftofam redactus fuerît#locu$ videlieetiluxicne in- 
fcftâtus. Irruens namqiie humor > pattes> quibus infartus „ 
cft> primo diftcndit} deindeinpusimmutatus^quaque verfus vîcus muc 
corroditi fînuofumq; efîîngit vlcusîacdumvnitacem difiol- |f^o/o^i 
uit> rempet doîorem excitat ^ quem proinde dicit Gaîen. i . euam- fea^ 
de fympt* cauCc^p.îXuumhabere eflcingeneratione: fa<9:a ^ 
etenim continuiiolutione > obduratifq; caui vlceris latcribus, 
ceflat omnind doîor ; vtq; alias pronunciamtHippocrates^ 
dtmt ahefafcit if cdrrumpitur natura ydokres fufit , quod ktiiis 
explicat Gal.lib. de inreqiîali imemp.cap*3 .Neque dicas Cy- 
disfiliumj auris dolore rheumatoio, fiitulofoq; âpueritia af- 
fiduc infeflatum fuiflfe, vt habetar 7. epid* , nam Ci A^yrr^ua ; 
idefl^dolor profymptomate ibi accipiatur > impropria ni- 
mis reddetur oratio : dolor enim inepte dicir^r fiftulofus,. 
Pro morbo itaque, atque ipfa iegritudine ^ ibi accipienda ca ^^ţ^ F? 
di(Sîio eft> qu^mâdmodum pluries Hippocraiem confue- risnon t^ 
mffc annotauit Gaîcnus in exegelî , pîutibufq^ prob^uitFoe* ^^*=^Bit»i^ ^^ 
iîus in Oecon.Ex quo habetur îoco pr^eallegato SEgium illum '^^ 
abfqj dolore pleruraqi extitiffei quia catenus quandoq; do^ 
kbat ^ quatenu$ acris fluxio audă intcrdum^ nouas adoiieba» 
tur partes, quas lancinans^ dolore excitabat; fiflulofum tamen 
vîcus Câllofumiam rtdditum>indolens omnino erat.Qua in re 
Ucet Natura? prouidenciam admirări , quas cum corpori vni- 
uerfo fenfum ca<Sus> impertita fucrit , vt voluptate ac dolore cm fcnfiu 
quaeconferuaciua funt,âutdcftru6tiua dijudicaret^vtillafc- tz.^i^p^ 
€[uerctur> h^cautem quoad pofTet, euiarec j lecma partis JoxpusfS: 
corruptioîi^>feufolutione continui îctfipardcyla illapcxi- f^^ ^î^P" 
me tune fe hafaet>acfruftrâiamadmonetur de imminenti ^ ^* 
difcdmine|(€i&t dolor jquafî ad tempus fcnfum adimat, 


Digitized by 


ne aaimal iam cmdeli fymptomate timc tcmf oris fruxlra 
criîcietar. - 

XL Eî vero , quera doîor afflîgît ^ medkameîitiitn_^ 
. ^^j^, natuta calidum ^tepidum faâum 5 & n^etopo diîa- 
^"^^eciif' taaî3Înfundendumeft5& retro ciicu^bita medica^ 
afHgenda ^ fi finiftra auris doluerit ad dexrram \ fio-j 
dexira j ad fiaiferam: oofî aiitem fcarificaado pe: tun- 
dere oportet 5 kd vt trahat foiam fiaenda eft • Si ve- 
ro per hoc dolor non fedctur jfrigefacientîa a natura 
infatîdanturî ^ & medicamenmm potaadum prasbea- 
tur , quod feceffam deorsiim faciat )^ &^^ 
noo : quandoquidjM voîBîtus ocn ăuxiîiatur> & de-^ 
^ c^rero friggidis Ytendum eft^ & femper non ianan- 
tem variare oportet modam ; & fîqiiidem peius red- 
diderit malum^adcontrarium teconuerte; ft vero ad 
fanîtatem tendar, omnino nihil afe hîsjquas adhi- 
bentnr > auferrc oportet jneque quîcquam alîad ad- 
dere aut apponere . Si v^ro iam in iiftuîam redaâius 
4ierîtj& multa piirujentafaaîcs fluxerit^quae gra- 
ueoiensfîtjiîciacere oportet . Spongîam ficcantft»^ 
quopiam ficeo medicacnento imbiie 5 & in aurcm.* 
quam penitiisfme indcy & ia nares purgatorium mc- 
dicamentum micte ^ quo ea* qu^ prius in aures flue*^ 
bzat Vin nares^rantur > & non Id y quod i|jorbofuai 
efl^incaputrursusrecedaf. ' "^ ,^. 

HJppocrates î artic^bonu aliouando mcdicametum 
t& dixit^etiam nulKi adiiibere medkamentu ad aures : 
Vnde Liuius anfam fortafsc dicendi defumpfîc Meduosplusin- 
terdum ^uiet-e^qt^dmmmenâo atque agendoprofeciffe. fruftrâ itaq; 
tam diligens ad^iures -modo inftkura vidcim curaţi o. At bre^ 
uihunc €xitfîem\is aodum , dicemes Hippocratem ibi Ioc«*- 
tii'm c âc dt frict-di auie cxtemaj hoc eft,auricula ; â cuius mor*» 



Digitized by 




mi* te. 

mu 1$^ 

bis> cum longius d cerebro diiîita fit, vix vîlum knmmct difi. Aimcaia 
crimen> cum tamen aîiaex paite deîigationes quaicumque fLvUii'^^ 
âegreferat,itaut eciamfana, fideligationepreiTaht, doloret ^''^'^^J^f^> 
puUatioflc , & febre afficiatur : ap proinde ii fradîa exciteric , â 
cacaplafmatibusgiâuatar, & â deligatione quacunqiie maîc 
habet, atqueiccirco ipfam quaramiaimum contingerccoa- 
dtîcit • Secus accidit in interna ai|re^ cuius a?gritudin^s 3c hor* 
renda? funt> vtauper dixirmis , & medicamenta fine vila deli« 
gatione retinet : Quapropter fi phîegmone decineacur , doîo« 
rem quamprimum delinire Sudendum eft, fluxioque retael* 
îenda , & deriuanda , ne morbus nimiiîm > extrema cum ce- 
lebri ciade, aiigeatur; fedula aditibita cautionene ta6tu , aat 
vialiquaafflidaparticida irritetur. Quod prseceptum om- 
nium potîffimum effe in aurium curatione monuic <j al. 3 . ca^ 
tatop. c. de doi. aur. ab innflamm, oborco : Vnât in Parmi. 
nifci filio 5.epid.profuitauricuIarem dyfterem nonadhibuiil 
fc, eo forcaffe^ quod vna cum furditace » dolorofa aUqua ade- 
rai affeâio, ac proinde otenchypae , feuaurifoiorij iUiusipe- 
ciii comcatius^ turn violenta inip6ti6 , feueiaculatio ^ dolea- 
tem paitem tedere poruiflet . Perpukhra itaque iam propo. 
nittir otaigise curatio , apertis fanp verbis exar^ta , cx qiia non 
leuia curatiu^e methodus praîcepta haurire fas erit , cum non 
patica nobis fe fc offerant circa ipfam contemplanda . Et Pri- m^^u^ 
moquidemHippocratisingenuifas, virtusprofeâomagno- «^-gcmucas, 
rum ingeniorii prc^ria^aliâS in Viro hoc âCelfo -diferds verbis ccic îîb. s. 
celebrata t haud etenim erubefcit libere fateri non femper ei j «P- 4- 
quamuisDiuinumpeneingenium obtinuerit^ de morbi na- 
tura cc^mpertumefle î latent fiquidem quandoqiiemorbiin 
penitiffimis partibus, ita vc niilkim neque exigaum de fe indi- 
ciumprsebeant, vt eorum natura certo explorări poifit . Arti- 
ficiofaquapropter mnc coniectura vtendum elt, vt docuit 
etiam lib. de arte ; fepe enim qudt mdomm con^eEîîmt effugiunt ^ 
mentisoculis ohtinentur ^ fiperantur : atque vbi omnia func 
adeo incerta , prseter caîteras raticfcinationes , licet inliiper Ie- 
uiota qufdam experiri praefidia , vtcx medicamentorum e£ g^o^^*^*^*? 
feciu , morbi Idea tandem deprehendatur & caufa . Quod medicamai 
argitmeAtumficâb euencu dcfurnptum, quod ciarius pro- ^^^^^ 

X poniiiur 

Digitized by 



potiiturmfi:âc28.Iib. 5* &certiffimumefty & Hippocratî 

noa raro in more pofitum ; vţ conftac ex 2. aph. 1 7. nec noa 

lib* a.demorb. Aleuiori^iîquideniaiixiîiofilcuiorreddatut ^^* ^^' 

morbus , demonftrataiam via eft , quod ita eft curandus : at 

fi peius habeat , vc iiiquit loco iam citata, contraria facienda 

^* ^ * funt * feciis quidera , quara pra^cepic z . apb. 5 2 , dum cerciffi* 

niis conieâuris morbi diagnofis nititur>^iufque infallibilis 

exţat certicudo • Facienti (PmnictfeQunâmn r^tionem ,JinonJecun^ 

dum r^ionemjuccedant > inqn'itsnon oportet tranpre ad alina m^ 

CtlîMi.^* nmtihmys i qu^emjajuntâpinciţiotj^peenimy vtdocecCel- 

«5?* J* fus , pertinacia iuumtis morhum vincit ^ Id itaque obferuat 

HippocrateSj dum interna aurisIaborat> cuius obliquus an^ 

guftufquc meatus ad cerebram vfque percingens > cum in pe* 

trolî offis anfra<ăibus alie occultetur , occuîto plerumquc la* 

borat morbo; ita vt vixaliud, quam intollerabilem fere cru- 

ciatum perpeiîdendum exponac*CaIida itaque fomenta hic in* 

cipit primo e^perirs, quoniam cum nuUa de febre babeatur 

mentio , morbufque a eerebro pendeat , in quo friggrdi ple- 

rumque coîliguntur humores , iure fufpicari poterat morbi 

M^topîum materiam ffiggidam eiTe & craiîam ^ proindeque câîefacienti* 

quITnl™- busindigere acque attenuantibus^ quale eft Metopium vn- 

^ioiliiir. I- guentum > Bc âLi&.nm,i tefte Djofcoride ^ ob Galbani mixtio-* 

^^^' ' nem ^ lignum enim , in quo Galbanum naliiţur^ Metopiuni 

vocant, Suntqui fcribunt Metopum ţ mendofe tamen , vt 

feiitit Mercuiialis: Quinioimo quoties Netopon apud Hippo« 

cratem fcriptum reperitur ,' vt fepiffime in îibris mulicbribus , 

Metapium reftituendnm vuit Gorr^us in fuis definit . ^ xxtc 

non Foefius in Oeconomia* Huius vcro vnguenti compoiîtio 

habetut fton modo apud Diofcoridem loco cit.jverum etiam 

Aetius te- apud Aetium > Aegin^tâm, & Nicoîaum Myrepfîum* Meto- 

Jgin-'fSisI P^^ pi^ite^ vtîtur Hip, j .epid* nu.2^. in filio Parmenifci furdi- 

de?e medic, tace laborante, vbi videndus Vallefîus : qua etiam voce inter- 

^Ntcoi- kc. ^^^^ dulcium Amygdalarum oleum fignificatum eft. Vngue- 

tunihoccalefacitvtiquevehementer>adurit, atqueextrahit; 

alijs proinde admixtum calidis , bumidifque fomentis , pitui-» 

tam attenuare ,atquedifcutere quam optima poterit* 

femm ^ 



Digitized by 



fertîmdoIorinfefîat^Hippocmtemftatimad localia dcuenire ^J^^^Jal 
remcidiajVC {ymptoma aliquateiius fedcojr attempcraa parte, ^^^ p^* 
& difcufla pauîifper conmnăz materia: vt aduertit etiamMer- Loc^îiamc- 
curiali^iib.^. de vitijs arţic. cap» i^ Neque interim pr^stermk- aic^.enta^ 
tit, iîopus iît^ aatecedcntemreui^Ilere, acderiuarc * Quîe Lhiii^jril^ 
methodus & grata ^Egrotantibus eft , & ratiojii confencanea, ^^^* 
mm certum Jit a doloribus potentifliBîe concitan fluxioBcs : 
hegueib ea.abhorrec Galenus,niiî in peculiari cafu , vhi vide- 
licet infignis zddt totius corporis vd ple.nitudo , vei cacochi- 
îţiia: tune enim ^b vmuerfali exinanitione exordicndum eft^ 
vt expreffis verbis docuit 5. de compoC med. iec- loc. cap, !• 
inquiens * Etenim 'ven^fiBione vtimur , ^pirgaţione » 6* clyfi^* 
ribtis^inedia vhitotttm corpus aţfaruit aut multituâinshuinQ^ 
TumTefertumy Ant eorîmidemmcdma'pitianîm : fi'vero nmtrum 
horum adjtt ^fiatim ad^curaticnem per bcalia remedia dmmimtis ^ 
Quid clarius ?Hiac Medicorum eorum efl: argueiidaîeli^io, 
apud quos placulum eft , etfi kuis adiît jaffeâio , aliqxiid.aife- 
B.Xfzxiicn\x applicare, nifi vniuerfalioribus prins admini- 
ftratis , maxima se^otantium molejlia s qui cico & iocxinde 
curaţi exoptant , quafî fit vniuerfaliter accipicndum > quoda 
Caleno in peculiari cafu fbtutum eft^ cum tamen maior ab% j^]^^ 
dubio attraâioiiat â dolore^ fymptomate infeftiiîimo, k quo hii . 
fpiritus atquc humores plurimiim a^itanuir, quâm â medi^ 
camcnti caiiditate > qu^ panîm plerumque , aut nihil medio- 
critatem exceditj ac diim longinquibribus hoftibus ocoirrcn- 
xcs , eos , qui iam oppu^nanc , prscterjnitimus ; pars debilior 
.redditur^, &moxbus maxime ttabilitur, Quinimmofihafîc 
methodum paffim regiftratâ reperimus apud Hippocxatem , 
Hippocraticos omnes , AfcIepiadeofqueAuthores, vt paiet 
Icgentilibrosde morbis , de inter. afFed. &alibiyn arccxîdo 
dolore pîcuritico , alijique huiufmodi j quot fecuiis credimus 
apud prasclariffimos JWedicos 'hune vfum inualuifle? Quoc 
aîgro5 Vanităţi itâ reftîcutos ? C^uodii obferjuaflLenralocalX'* 
bus.medicameatis ante vjiiueriales euacuadones adminiftra- 
tîs ^ .doibres plerumque exacerbări , num adeo inepţi credcn- 
di font, vtnefcjiîent erroremhunccorrigere ? At dicetfor* 
JEaffe ahquis^ viEseîntemperantianoaaded apud ipfos vigcbat> 

X a ac 

Digitized by 



acproindenon n'iB, valde raro corpora nimium repkca iM 
rcperiebantur: feciis quam accidic in noftris regionibus > vbi 
propter exceffum in viăn vix aliquem reperias , qui pletoria > 
omnis Iu- aut cacochimia non laboret . Ouaiî noD oninis luxus €x Afia 
fckc deittS & Graseia hiîc effluxerit • Nonne Gtxcos vitiorum omnium 
G^'ci * o- g^^^^^^^^^ vocauiţ Plinius , quos proinde cxlcalia vniuerfa 
lumomniu pcUendos ccnfuit Cato? NoH ne omiîi morborum gencri ob- 
n^mî^i]. ^oxijerant, quotquot vna vi6tus intemperaiitia producere 
aac-hi&c.4, coîifueuit, adauâis fuprâmodum excremencls ? Defuntfor- 
tafle eorumhiftorise inepideniijs, qui ex quouis intemperan- 
ţii genere in maximas ajgritudincs inciderunt ? Quoties vi- 
dimus Empiricos quofdam , vel petulantes muîierculas vna 
vei altera pyxide y qua linimenta aliqua ad peculiares naor- 
bos prasparata fecum deferunt ijfque nuUa pr^paratione 
vtentes, non fine rationaliumMedicorum ignominia &no- 
minis,& gratisB non parum apud vulgus fibi comparafle > 
Quodfî femper fruftrarentur euentu, vel morbos vtpluri-. 
mum exacerbarent > non seque bene cum ijs ageretur . Con- 
cludamus îgitur nihil perpetuum efle in Medicina > fed omnia 
^nfbbris ad ^aticnis normam effe reducenda > nonnegîeâaexperieii* 
piiiiics regi- tia • Eâ autcm , qua? in magnorum Authorum voîuminibus, 
humur^iî pJ^ries regiftraca reperiuntur , vc vetuftatis monumenta vene* 
mînusmio randa eife , neque vnquam ipernenda > etfi antiqua caliginc 
parentînull inuoIuta> minus rationabiliaquandoque nobis appareant ^ vt 
^uam tame qu^e ex Ingenijs plufquam humana fapientia praeditis emana- 

Notandum tettio ^ cum Auris in capitis latere îocata iît , 
pcrexiguam illi effe eotrarietatem ex ante & retromam fi quis * 
poftiplâm laborantem cucurbitulâs appîicaret> h^cpotius 
dicendâ eflet deriuatio > ob nimiam proximitatem > quâni 
reuulfio . Si ergo reuellendum fit , vel trahemus c furfum 
deorfum , & fie fpatulis & ceraici applicand^ erunt > vt corn- 
muniter fit , feruata partis reditudme ; vel imitacione Hippo. 
crads, edextro infiniftrum, atque ita per hanc nori modo 
contrarietatem , optimam moliemuircuulfionem , fed pro* 
ximius euacuabitur caput, cuius nimia repletio iamfuppo- 
lutur morbi fons perennisatque oxigo.Caeterum cucurbitula? 

Digitized by 


dolcntibus Auribus vel Gapitifemper pr^efentancum pr^fti- 
terc auxilium ; vnde 6. epid. {^c. 6. parc 2^. AdAurisdok^ SifeaSSl 
rem cucurhitulam affigito . & lib. de iudicat. initio . Capit cir- ^'^f^ ^j^^- 
cum circa doknti , quiamqus ex Jhpemis hcis doluerit , cucurhp- U^c^ !at 
tulamaffige. ^mdhum. 

Notandum quarto vbi morbus â friggida caufa pendet ^ Se 
laborans pars {xi^diâz ex fui natiira eft > Hippocratcm non ad- îq %gî<^o 
mi ccere fanguinis euacuaaonem: quapropccr cucurbitulas mc ^^^^ ^^ 
appiicat iîne fcarificatione,contenâus reuuliîbne tantum,qug t>^ ^^^f^' 
fit trahendo. Quod ialutare prseccptum puto âb ipfa experien- ncndus .'^ ' 
tia didiciffe in cafu AîicarnaflTeniis illius , annorum quinqua. 
nu.54. ginta quinque y.epid., cui cum Caput & Aurisper hyemem 
vehementer doîeret, fecia fiiit vena, â qua refrigeratum eft ca- 
puc 3 mente motus eft, non iuppurauit , mortuus efl • 

Notandum quinto mareriam aurcs infcftantem commode 

deriuaripernafesjvcdocuii ctiam âph.5o. fcc»4. Qmbu's in Moibifîca.» 

fehrilus Aures olfurduerunt his fangtds e narilus effufîis . morhum aurmm ma- 
>. . ^^ . V • î_\ • ^ • T-r- tcria pcrna- 

joto^.Mentoigiturhicvnturnaiipurgîjs Hippocratcs ; nam r^sdcrman- 

ficuc reuulfîonis proprium eft crahere in redum^ fie deriuatio- ^ • 
nisin obliquum. 

Notandum <5, Hîppocratem jpoftquam periculum fecit de 
morbifîci humoris natura ^ eumque caJidum cffe coniecit, 
vndeadrefrigerâdacurationemconuertit^vomitumprohibe- mtfbhaIrS 
re tanquam minime proficuum; prsecipere vero alui dcieâio- qii^a<io<^cm 
au.3. nem^ contra ac docet Iib. de affed:. ; vbi auris doîerem a pi- q^^âo ă^ 
tuitâ curans^ hanc vomitorio euacuat • Cuius varietatis ratio- *^^ • 
nem affert Martiânusannotâtion. in eundem Lbrum : nara_ 
eum peccat materia calida^ quaein parcibus infcrionbus, in 
hepate videlicet , vifceribuique > fedcm obcinec , jSc corpus 
biliofum eft > haud conuenit vomitus , per quem humor ifte 
pertenuis ac leuis,facillime afcendit, partemquc afFeCtam ver- 
siîs concitatur : perinferiora ergo turius euacuabicur . Ac fi 
picuitofus humor morbi caufa exdteric , qui in capice,vc in na* 
turali fede prşcipue viget, vomicus tune pr^ferendus eft, 
â quo prompcius fuperiores euacuantur parces , Neque ti- 
j»cndum eft ob vomicus violentiam de capicis repletione; 
materia iîquidcm crafta cum fie , li cius porcio anfrâ exiftac , 


Digitized by 



kauâ facile ad fupcriora elcuabitur . Sed de hac re alias :^ 
Notandum feptimo atque poftremd Hippocratem in auri- 
culari afreCtu friggido putato , ctfî medicamenrum virtute 
valdccâlidumadhibeac, cuiufmodi eft methopium cralbana 
claboratum, pra^cipere nihiJominus tepidum applicari > e<> 
.^uod auris > cum nil aliud iit > quam flexuofain pecrofîs olîî* 
bus cauitâs mcmbranuEs ficcdVimis^ circumuelara , ac proinde 
Aurîs nuM ^^anguisferc, atque excamis^^ nuDum fuffert medicamentos 
fuffertmcdi tum txccffum ift achiali calidit'ateaucfriggiduacc . Quod mo- 
SfeSl i>*^i*^^î:iam Gaicnus 3. de med. locaL cap. i. & clariusadhiîc 
cur. Auicen. Iib*3. £4. tr. i. câp.5. Aâuaîisnamquefirîggiditasex 

aph.i8. feâ.5. imbeciîlcm cxanguium calorem extingmc; ni- 
mia autem 5 acquc achialis calidicas earum dejftruit tempera* 
mcnmm , iicciffim^que partes p^ene adurk * 

XI L C^terumvbîînoculosfluxîoprocefrerîtjoculîin- 
fiammantur & tument. Sic autem afFedum hominem 
medkamento îiqui<îo ^ aut ficco inrperfîiî curate 
oportet . Sî vero Âarim inflammati facrînt , nihiJ om- 
mno illineifcd aut fortiffime quam infime vriro , aut 
aîioquopiam aluum fubducenre medlcamcnto attc* 
nuaîo 5 vitandone vomîtum facias* Si vero yelutla^ 
pilii fubter currerînt^ medicamentam illînes > quod 
plurimam lacfy mam ducete poteft ^ & reliquum com- 
pus hum€aabis>ac tumîdum facies^ quo oculi humi- 
dîores iiant ^ ac colluantur ^ vr Iacrymâmadftriâam> 
ac compaâam decurrere facias . Gum autem în ocu- 
I0S pauîarimftuxcrit ^ & prurîrum fecer it; fîc affecium 
aiolli medicamente iJIineSj quod fiecare poteft^ fi- 
malq.modicamlacrymam ducere^ & ad^ares medi- 
camenîum adhibebiSj aut fingulis diebu^aut alternîs 
eode vtens. Sit autem tale medica menfum^quodnoa 
pîus quamacetabukmper naresdeducatj îdquepai^ 
iatim- Qnod vcro oculisadliibetur^ refîccet^ vtquod 


Digitized by 



eculorum pharmacura reficcarit^ ac obftruxerît^îdip- 
fum ad nares feratur • 

TErejâ e confpicuis fluxio cft , quse fertur ad oculos , quî , 
etfî innumeris obnoxij fint morbis , vt vidimus text. ip. 
lib. I * > plerumquc tamen phlegmone tentari folent membra- 
nx i Jlius y qua? cerneai adnafcitur > diciturque coniun6ttua, eo 
quod oculum cum fua orbita conncăzt : qu^ vtique affe<ftio 
Gr^cis âfîtonomaftice Opthalmia^hoc eft, oculi morbiis nun- opthaîmie 
cupata cft> I-atinis vero lippitudo . Huius affedus cauiâ poteft cmado. 
quilibctefTe humor >vtSanguis, Bilisvtraque , & Pituka; 
quiomnesetfihumidifînta6tu'; potcntia tamenex ijs non- 
nulii, bilis fcilicet turn fiaua, turn nigra , & falfa pituita , non 
mediocrcm pra? fe ferunt ficcitatem &c acredinem^fi aquilonia 
prasfertim, ficcaque Acrisconftitutioprasextiteric, â qua, vt 
docuît Hippoerates libro de aqu. aer. & Ioc,./ quod li^ 
*^'^^^ quidiffimurn & aquofiflîmum in bile eft , confumitur : âtn- A^%®'* 
iiliimum vero , & acernmum relmquitur. Quod idem ac- cnmom^m 
cidit iuxtâ eandem rationem , Se in Iknguine . Abfumitur htltl^Si' 
icaquc humortim ferofitas ab aquilonia Aeris conilicurione, 
vel etiam â proprio temperameuto , fi ad calidius & ficcius 
accedat ; augctur autem â pluuiofa atque aufîrina, velab 
humidiori corporis difcrafia . Hinc triplex opthalms^ dif- 
ferentia reperitur apud Hippocratem . Prima quidemhumi- o^htaiiB^ 
da, exquaplurimusferofus humor fub lacrymarum ideaef- "fe^ima^* 
funditur , cuius meminit x .' epid. ică. 2. tex. 6. Altera autem ^^"^^ ^Pi 
ficcâ , in qua nihil per oculos effluit , fed in angulis, feu in pal^ 
pebiis concretus apparec feroius humor, cuius mentio faabe- 
tur 3» aph. 12, & 16. Tertia denique opkhalmig fpecies pri- 
marum duarum particeps eft , vt qu^e inter humidam > & ari* 
. dam media cxiftit . Aliquid enim illacrymatur in ipfa , fed 
mprdacitatem acredinemquc adnexam habcnt ha lacryma* 
Hasomnes ergo differentias hîc curare docet Hippoerates ^ 

Vbi ia oculos fîuxIoprocerserit,&c. ^^' '''^'?^^^ 

^ ' cct, quasape- 

ricxamoperfiromeiu&temporaiaipfos deducnntur. Tune 

' * 1:' 

^ primo 

Digitized by 


primo in exiguas vcoulas, poftmodum in a4natx fubiîantiam 
eftuh faumores , ruborcm,& tumorenj , vna cum calore & 
dolore excitant . Ergo fi inflammacio hac paulacim procef- 
fent,ita vtlentus raotusfignam fit, neque multumexube- 
»n«s macenaî, neque plurimura irritancis , ad Jocaîia ftatim 
deuemendufuerit^collynaque âb ipfomet initio appiicanda, 
fiuehum.da,rme acea, primo quidem qux facultate habeant 
vala conltringendi ne prompta recipiant, & quod in via eft, 

repcDancatquefic occurredu.n ne vicerius procedat aiFeaioî 
mox ctiam ad refoluentia deueniendum , modo id opus fit . 

Atriftatiminflammatifaeriat,&c. ^.^^^n^erţiini- 
- _ , • uumcummcre- 

mento & Itatu quodammodo coniundatur; Quod fit vbi 
multa redundat excrementia materia, qusi]]ic6& confer, 
timmoculos ruit; tune localibus medicamentis omnibus 
cnpitur opportunitas : neque enim repellentia coniiemunc, 
cura nullum-adfit vacuum , qu6 verfus repeUatur, praindeq- 

matenam magis inculcarenc, & cralTiorem , contumaciore(?' 
redderent; neque refoluentia, qua: perpaucum diffoluerel 
attrahere aute multum poflrenc,dum materia adhuc acritatur • 
magnum igitur tuncejitremedium nujlum adhiberl remel 
dium , {eă adintercipientia, reueiientiaquc oim^ta curatio- 
nem dirigere . QuApropter 

Auc foitiTsimo quam infime vrito , aut alio quo- 

piam ducente medicamenro attcnuato. f°^^«»»5 
... . . " . Mcrcunaiis 

labemlatereputatmijs verbis „ W^«,;,^r«SV« /^.^J 
l£tTCO . vnte quam mfime fortiffimo: ( etfî in omnibus 
codicibus ita fcripta reperiâtur_;eâ fcilicet qudd prsccep- 
tumcontineantdifcriminis pleaumrnam periculofa admo- 
dum vitio eft in oculis : ac proindc ita vuk cfTe reftituenda 

llMcitrkîuî *i_^ţ^^^y »^rce râ /^yeS'r>).purgatoperinfemafor. 

«iaxgaimr tiitimo:Quodtamen, (pace tanti Viri dic^um fit ), neque 
•;il^£* f^n^ll^"'''"' r^^^"""» cenfendumeft. Eftquidlm 

'^iTj't "'^'"P^"™^^"Pi^proponeretur, vtliquido patetlegen- 
'iZ^^'^i^''^'^''^'^'^'^^^^ tumHippomti.lm cĂri. 

Digitized by 



V£tlo hi^ 

VttuftioribtisMedicis familiaris fuit profunda vftio in ofuio ^„^^^ 
rummorbiSjgisadHuxioneminterdpkndam Haorbl 

*^-^^ poribus, ^t hic infoîus. H;^2?^^ vmasvifum fremmte^ Bmrerre ^SîŞ^ 
^or^e^ , c^i£ -videUcei femper pulfinty&intâf<ăiirsm irt^o^ ^^^^"^ 

^^"* raconfifitmt , atque hai lib. 2. 4e morb. vrendas docuit 
donec puîfare defiiiant -. Vnde Ariftot. problem* 5. feâ* 51. 
quaereiis^urcse^iânatiaicate Ronfiantcaiui?Refponder. An^ 
^mldf&faflaî: 4)cul(^ ImmoT fMius (^nfî^em ^ w^ y qui 
e^ circa t>cuks ; if p&pterek m ieflumnihus ăâ ocuks ^ fv^[ 
nas y ^<e funî circă tmiţora , im^imt» x:ondenfantes hm<^ . 
rum pTOS 5 ^: ahraâunt caput di^ecanfes cutim » ^pi£ :eji in: 
y>jf3 ? Turn in ipfis ocuîorii palpebris^vi videre eft in libelio de 
vifu ^vbi modum id peragen di edocet ^ adminiftrari conlue* 
uit^Qu^âm âxt€riamîn'cxiiftioî>em in viiim reuocalTe Fallopiu 
«U.Î. rrarm Gifnerus . ka Celfus iibu 6. cap. 6. de, iuif uiioiie vet- 
ba/afieBS , ia temporibus ycxm adurerc confaîit, & Paulus 
irb: S. cap- J. , poâquam docuit ^enarum iaeifioriem in cem- 
poribus, vbi oapitisdoior, Scacris caiidaquefiuîdo^oaiîoS; 
infeflat>fubdk'. Suntqui cauther^s mucronais yafa^ahfauem^ 
ciponeadmukam frofunMmem 4ij^r4r^Jiireigii:ur dum mor- 
bus aded'propere motietur 6b materia^ exuber^tiam , y c cb . 
omnimoda oculi extindione timeudum fit> ad intempientia 
îcuelleAtiaque ftatim confogit^ aixeriafque intemporibus* . 
quâ fciîicet fluxio pr^icrgrcdi vt plurimum confucuit ^ q^oi. 
ex ipiarum tumore^ liuore ,aîaiorique pulfatioae conijci 
potHîîmum poteft^akc exuric^vt artcria itâ integre cxufta^adi^ 
tus omBiîio iîîtercludamr.Sedd.e hac r^ pkura hab£tur inferius ^ 
hb.j .^40» CiE ter-um caţhaitico tocu corpus euacuaodo att^-» : ^ 
nuaţ,&âbipfo cerebro x-tutHht.Aluus «îf?«^xf2î/t3îifii;înquiî2, 
de diaet- ex reli^tio corţore; i; capite humiditate inpipsa trdiit^ 
nitniu^didâ cxîficm.Exi^cuzt<x au4£ câpitc Vifus Se Auditus de? 
ţ\xr^mx:Vaăt6.zţ]^Upţimîsm^dmţrofimdoc^^ ^^^ ^ 

^ • r - in vomimniaiiruajrcr lib. de iu- 

Vkanao ne vomicum lacias . pj^^^^^^^.^^^^^ va,^^^ 

poribus , humoribuique^qui in oculos d^indeiexprimuncur? , 
dehi^midaoytuh^misu^, >.. ..^i . . :^ > 


Digitized by 



SWeroYelutIapilli rubtercurrerînt. ^"^ '^'*'" *^^^' 

., * gnaţ lippicudi- 

sem,. aridam nemp^jin qua nulk effutidunmr lâcryra* , fed 

.is"S*^ ««^«â^ atque contjreta in pculis infident,ac ot>kduGt;pun- 

««ura & gendoquearenuIas,feulapil]oserauIantur . Qyodfiţ, vcţ 

carauo. disumus , vbi colericus fanguis, fiue ob fîccam,& aquiion^-. 

rcni> qaaprscefsic, aeris conftiţucioneni ; fim 6b calidiorcl 

cerebri difcraiîam,ftrQ tt^agn^ «x- parte deititu ms,x>tt txicnxu 

pencranei venulas arteriaf^uc i^ţ adoatam tunicam deuenfric,! 

j^que quodfupercft ferofitatis â eoncepco calore inagis ex- ' 

CeJ.RhoJi>. p""™ ' penitus exarefcit , coitque jn lemaş^J^e exigua ii,. 

întiq. icef ^* > "<^<=a duraq; graoa^qu^ Rhodigino.teftc'^ramja vocâwr. 

Medicamencuin illines, quod plurîmam facrymam 

' ' "Uroidicate diiîbltiaiKur .iac^fwa «2Z7»Jiip- 

^re04,mquit vinin£ne,ea/^«f4iî figca igicur lippitudi- 
ne numeaamibusagcndum eft,qH2Ro modoconcretamla- 
crymam , vE diaum ftiit i emoUire , ac^ifToluere poffit , flii- 
xibilemque reddere, vt mortifica iode mşteria euacuetui:; 
cmufmodi eflent îonvs AJocioues ex caJcntlaqua, veJ ex de- 
coctioneMaJuarum, Violarum, Fainigr^ci, ^ fimilium , ex 
quo Hipp:oe.dehumid. vCuycalidamJismumit^oJmiujJupr «u-ir. 
ptratimithus , lacrymis nterdacihus ^Jjcd} omrdhuş , ^e. Sed co- 
turn corpus humedandum, ac nutriendum eft fri<>^ido , & 
hussedante vidu; VBde dulcis aqu« balneaperopportuna 
- efl^t , cum vniuerfum corpus, QommMqnt in co humprcs 
ad&citatem vcrgere » vbiârida vige£lippitudo,puţ4n.4u'fit. 

Cum autem in ocqlps paulatim floxerir , &c , - - 
HarctemaeftiippitudiBisfpecies, quţ inter humidam , ari- 
- , damquc medium effe obtiaet, cum videJicet humores ncque 
©mnino funt â ferofitate deftituti , itâ vc exhâui[l« penitus 
fincjacry m2 ; ali^iiid tamen ab aquiîonari tempeftatey vel â 
calidâcerebridifcrafia paffi iiiiu, itâ vc ficciţaţem aliquam vel 

acr€djn«raiGontraxepiDt,jquodmai}ifeitHm fit ex pruritu, que 
excitat horum fluxio . Pţofluuut itaque ia koc aâe.otu J^cry- 

Digitized by 


m^t fcd parce ob hutnoriim er^ffitiem ^ & mord aces : ane- 
dia ergo ineunda cft cuandi ratioa ^pplicamdumque medica- 
menmm > quod non ad<ediiumeâet> fed iîcciţaâ$ particcps 
iic , n femei & iîniiil exiijberan^ quoquo pâ<îto exîiai|ri^ ik.; 
runi^ yt quod reîiquum: eft iacilius concpqixami: ; craflam 
vcro > &ihmcoa<^m lacrymam djtoat > flimjique, ^tioi^m; ' 

humorum deriuatio exoculis adnares^vel reuiiliîoadfau- ^ "^ - 
jau. j7. ce$ : Ynde 7. epi A, Qu^^mfluximesjmomUs tţm^s if âîuttmâ^p ^ 

iortmi fltmones fi dmXQzduQ^ ;> ^ ^ 

conumit: proxima enim inter Te fuht iiîe p3:rtes> oninefque âB 
anteriori carebroexcremeiicadi^iujac.^^ maioribus autem iacrjm«aî> 
ociiÎQrum angulis metauis kcitat^^oiruncula xpogerţus^ per ^^Uzâm^ 
quem, dum ierofit^ in oculis aimi^ ^exuberat , facâîlime ^^^^^^^^ 
nai^raiii:cr egrcditur ^, yţ patcţ ija flentibus 3 q^ 
naribus plerumqiie diftiiîaaî t.uîicergo vtimi::eri:hino pîiiri^ 
biis:iieb«s , quod paulajcim notiplus qmm ^etabuliim ^ău^ ^.^.^ y^ 
cât;^i^abacjîienfii»^qtt^^ncias dim^ir^ morfeisoca- 

tnediccrem^uacuaţi<:^cm^ue<>pprterenosa4aîonens. 1-c- m/i icuia^ 
uiaproinde fintinhocaffe<au jiâfipurgia, & apophlegma- ^'^^^^ 
tilmata^yrâbociJis^proxiîiaifiilue parubu^ . _ 

Bi<yne euacuenty xseteî^s autem bua^resi, qiii in totp cero* - 

broilabdaîitur^ne conmioueant^ acmaioî^mex;c^ ^ _^ 

ocalbs Amoiiem r^ui a'prffenci JBorb 
reddid 1 6cilifîegotiaquodcunquc.0oxiumrecipiuii^^ 

' Quod vcfo ocuîisadhibcîur exficcet ^ ^^* c^ îi^ 

pur<^îjs oculare adhiberi medicaanentum > quod Xm^i^x iîc^ 
can^ vim habeat, vt ficvniinia ierofitate exhauflaj^uod 
te^quum ^ft > faciliuscoquanur , &:^<:raflfe£:at > ne adeo prom- 
' pt^ per affeâam^^pajrtiem , oculos nimirum ,eîmcuetur . , 
Q^M^uid^ igiţuîţ^ailks ita lecbâicum eft , ac proiade â col- 
lyrio obftruâum , boc cft;, obferamm , pr^pcdxtumque 
ne facHe per eculos exeat , errhinis deducatur ad nares, per 
: : ^ Y z quas 

Digitized by 



172 MippQCRjxjsm. îi.j>£.wc.m hom: 

quas polimodum^ianoxie' expurgări poterit . Quantai«^5ttîr 
cauuone vtatur Hippocraces in raedendojvt morborumrmc- 
dicamentprumque vires diligentcr expendac; occafîonem. 
De Via ţf*? ^^'**P°'^"^ 0PP«>"yn«ates qiianti feciat , vnufquifque per! ^iopropofitaopchalmi^curarioneperfpicerepoteft. CoU 
ink^ditisad ÎP^* £«mhumid*cxaquis&fuccis, turn ficca &<-Gnfperfi- 
fiaeajiib.1. "» cx metallicis , aromatibufque Hippocrati confueta , ii qujs 
^ni..rS videre oipit, legat ii> calce libri de viciu acut. Se lib.aTde 

&eftmeat morb, IBUJ. .. ; 

ceEb. î.dc . 

STorb* mul* _ 

XIII. Medicamenta caputpurgantiay quzquldemîorZ 
folS'^^ tiafunr, â totocapiteducant ; quaî verodebilia, âb 
Lr^Su^ ?*^"^^»^^^ncâyîcinisnafa pa^^^^ 

ro ab ocuis « „ . ■ ' ' " ■ - - -;:^,., 

proximifo. /\ -ivrepta occahoiieâbferrhinls, quîBiam inododixit i» 
^<^T .t\ oculorum afFe6iiombus efTc adhibenda,^qug leuia fînt, 
.: neque plus , quam acetabulum educant ; idque paulatim & 
fefiiter ; vniuerfalem obiter nane interijcit doarinam de me- 
«icaisentiscapwpurgantibus, qu^procul dubio nafipurgia 
fuatpţineipaliter> •viqus^ralocapitc, proximifque p^^^ 
v^ biis bumores, qui circa cerebrum , ciafque mcmnaesjeKcns-, 

iunt, per colatoriura iramediate educant; minus prjncipaiitex 
^^^^ mailicatoria, qug apophlegmatilmaca â piilegm^e^fub 
Sfafiicate. cuius idea euacuant quicquid educunt, appeîlaatur: hţc enim 
& â*veltti. ^^^^o propria funtcapiris, cumetiam â^ventriculo non 
cHiouahst. nihil expurgare foleant: vaa fiquidem tunica eft, eademquCy 
<^x initeriprem ventriculum atque pafatuai circumueâit î 
îion poteft proiî>de^,^odmanditur medicameatum, capiii 
iameiita venarura, meatufque in palato fua caîidicate aperire, 
&internatrahere cerebripirrgamenta, quin trahat pariterâ 
ventriculo. Horumergo alia fortia cum fînt, vel quod fum- 
inovigeantcalore, &acrediae, velquod eiedîiua trahant- 
aiiaverd debilia: iiîaquidemâtotoeducmucapite, a^^itant 
înultum,aclafam partem versus, oculos iiimiftiiii,cooc!tant; " 
îixc autemproxmiioresfolumraoddemundaiitpartes: oua- 
proptertutiora ia oculorum affe^bus fepatantur, "'■ 

' - " ■ Si 

Digitized by 



2^^i" • Sl au tem â carne & offe > muco inter os & carriem rteio ^ 

terna cspitis 

fubfîftcnte > fluxus ad oculos fiat ^ ex1îo<>mamfeftum 
fit 5 quod înde prcfiuit . Cutîs incapîtecompreflace- ^"^^ • 
dit > & vicera în capîte enafcuntur, vt oculi lacryman- 
tur,& paîpebrse non exulcerantur>nec mordax eft fiu- 
xus>nec vifumliebetat 5 fed homo îpfe acutius mătti 
fluxus enîm non eft falfus > vrpote non de cerebro * 


LAeduntur oGuIi non modo âb interna capîtîs cacochy* 
mia > vt fuperius explicatum eft ; vcrum edam âb exter- 
na t nam^fuperuacaneacxcrementa & intra caluam incerebri 
îatebrîs, ciufque fubftantia coaceruancur > fiue congeftione 
ob kfam crafim , â qua naturales vitiantur fecultatcs , ita vt 
alimcntum haud bene conficiant ; fiue infernarum partium 
cuaporatione ; Et extră cranium , inter ipfum videlicec, & 
cutem ^ feu mufculofarn membranam ^ quam hic carnem sp- 
pcllar > eo quod in capite carnea peculiariter {it , quaeque cm- E^cremcnta 
tifubftratuf : Ibicnimcuiufcumque humorum generiscoi- î-'^ ^^ks^ 
îuuies non raro coIligitHr vel ab intemis cerebri partibus per â^uSo. 
caluarisefucuras, aut venarumofcula, qu^ plurimae ibi âb ta^^^acrius. 
externisiugularibus deduâ^ terminantur> adueniens i aut 
jbidem â l^fa facultate , aut vitiato âUmento , aut praua fuli- 
ginurnexpiratione ob capitis craffam den&mque cutem ge^ 
nka > â quamorbi non pauci poftmodum procreantur^ vt late 
explicat Eernelius lib.<5. pathol.cap. iS. Ab hac igitur externa 
capitis caeochymia epiphora incerdum > feu illacrymatio fuc- 
crcfcereconfueuits cuiusproinde iîgnahxcproponuntur , vt 
âb interna eamdign<?fcerevaîeamus, Cucisnamque capitis 
in propofitiocafu, â latentibus fub ie excrementis cramor 
rcddita , ii prematur > in fe coada cedit, velHgium velut c^ra 
ictincns > eo quod humores infpiramentis atque poroiâtati» 
bus, & fubipfaftabulantes, neque bene apponuntur, nequc 
affimilantur^ fedinutilesibi remanentes, a comprefTa parte 
difcedunt j ac fubterfugiunt , vnde locus cauus remanet, cum 




vţ74 MIFmCRumSîZIB,^ lUm I^GC^JN HOM. 
nequeat eueftigio ad priorem locum recurrere ob crafTiciem 
ct^îth vi & katofcm,quem plcirumque adaextimliabet. ftiiia^autem 
cera. congeftioniscraffiorpars^qugfluxiomineptior exilik,ex aio- 
ra âliquatenys incalefcens , aJiquam contrahit acredinem ^ 
cute erodenti vi vîcera deinde in capite excicancur: Parş vcro 
. tenuior a Icui quauiş occalîone , fîue calorîs , fiue frigoris , e 
fiia^fedc turbatur , & deorîum inter cutem , ttanium v & 
pericranîum praster îabens , fub lacrymarum %ccie in ocuîi$ 
iimotelcit > 4Ia .abfque palpebrarum exulceratione , cum 
. ex ^^"^^^^^^^^^'^^^or, ncqucvllamâ ţnpi^caliditatem con* 
fpica^cioîe?' ^^^erit>exquaacredinemfîbi adiciuerit: Neque vifum he< 
I^S"! ^^^^^> ^""^ baud tenax & vifcidus fit, icauc poffit>quemadmo^ 
* diim in ^bugine , telam oculis praetendere ,fcdpocius homa 
|îc ^^usracutimyideîi mm quiaaqiieah^flus^ 
quodammodo abfer^t, m^ifque reddit periî>iciuiB : vndc 
Plinius nu. hiă. hb, 1 1. cap^j^. tmuîmhus , inquiţ , multij^; 
memhranis oculos noima compofidti cdhfii contra frigora calo^ 
refquein extremoîwdds yquasjuUnde pur^^ 
fălim. 8c Lzămtms Firmian.dc Dd opificcap. x o. Oculonm 
acies; ideft imsmhrana illa ţerlucsns , ^uamficcari ^ oharefcert 
non oportet, mjihumoreajjtdw t^rfapun niteat^ olfilefiit, ScAxl^ 
■ toiîoohtai. ^"^^^^^^ Pfobtp. fec-jx. Qua^rens curaliquipoftS^aî^ 
miâWutior miaaaacutiusyidcnt? Kt(^oni^tan^âp^mmculipimp^ 
dim'Sf <^^f^^:f^^^^^oemm exterior dmjtţasghfL^ 
Czpevifui cfymantiaut^folîdtMr: proptereăifmordmconferty vtC^e; 
confert . dtmim -veromimicum , -ut Origamm . Mitic idem Ariftotclcs 
AJexandmm MacedoBcm inftimens^ pr^cepitad viiîon^m 
^lodo coBikuaadam , irt oculos limpidaaquafepa ablueret : lado 
ficatsprir«- fiquidem ex gdida aquaoculos abftergit> cîaros nitidofque 

uctdbiis . bus prgiertim^vbi pociiîîmum calidi fpiritus & humorcs abun- 
dant: aqueicnim iuntoculi a proprio tempcramento, vnde 
afimiliconfeniantur: ignei verd funt ob complures-afflii^tes - 
fpîrims vqui attemperatione indigent : faine Paulus âd oculos 
acaligine prgferuandos, gelidaaqua dmfubmer&$ apartos 
decinen precipit . Acutius mm etiam vident in kzc illactyma^ -- 
uone^grotaiucs,quddc€rcbrum,fQpauacanea materia^^^^ 


Digitized by 



cutcm &extimas partcs detrufa^adeo expiatum rcmanct^vt jbî* 
ţidifltmos fpiritus ad oculum tranfmitrar, vnde perfe<ăior ce- 
lebrâtur vifioscontrâ id,quod accidit âum âb internis partibus 
- pituita per vcBas dcfertur ad oculos : mm , vt inquit lib* 2. de 
morb. initio , Ccecutiunt cum aâ venas in oculisperuemritptuita: 
aqubfior enimjîtvifus 9 ^ turbulentior , fy jpimdor in ocuîis nonjt" 
militer JpImdiMaefi. Rationem deniqtie fubdit , cur faîfit & 
nitrofa noh fit h^c fluxio j vidciicet quia noa de cerebro ^, . , 
procedit^ac penitionbus cws parnbuS;» vhi coiicIuuis> & coar- cuJcs niu cx 
Ctatushumorplurimum^ncaîefcic, indeque crafîicres pan:es ^^^ff^^^^ 
aduruntur 5 qu*e casteris aquofionbus ccmmjxrîs, ialledinem bus^ccdat, 
pariunt: prseterquam ^ quod co loci non bene diffiantur hu- ^^^^cds^^cl 
mores> proindeque putredinem fâcillime concrahunrj iaî fique eS* 

îia.ii. eviadunt : vnde Hippocrates hh. âclm^r.z&ci.cfim capa ţi* 
mita imţleîum ^egroîarit , if color accefferit y pituita in Ciripite ccm* 
putrefcit , *vt qu^ moueri non potef vt decedat . Fopea cum crajprfk^ 
^^efuerint t &ţ^tr£faB'^ y ăcfi^perexplet^venuUyfinxioinpMl" 
monemfa y c^ ţulmo vhi Jufceperity flaţim agrotăt, 'oî qui â pituita 

îia.45. mordetur i qu^ falfâ eByacputriâa. &c lib.2. de morb. cerehri^m 

concakfcensfaljuffnpfamhjiworem • Secusquamacc^it cercbmmin 

in externis partibusy vbi, etfi crafla admodum ficcapitis curi^ cakfceBs r^i 
neque adeo întenlus concjpuur calorjneq. ab impedita vena- more ecua. 
latione cam fiicilepucrefcunt humores . lure igicurexcremens^ ^^ 
ţitia hsec materia mucofa potius erit & audă, cuiufinodi cfle 
confueuiî; oiîîum y membranarumque excremcntum . , ' 

XV. Hune fîctoreoportet.Medkamentocaput pur- 
ganduni eft^Bpnibrci ^:& corpus an^^ 
bis &^e4icâinennsii^â corpus jfubducentib^ mv^a^nkcu 

nec attenuato corpore flux tts r^fîccetur > aut medica* crfnio^J^ 
mento in nares indito emoueamr. Verum ad ipios ^^"^^ 
oculos nullum pharmacum adhîbendum eft • Si vero 
necjue fie fanus fîat y caput fecare dpnec ad os pcrue- 
neris oportet 5 non fuperficialibus ncque tranfuerfîs y 
apt obliquis fixuris încuffîs vfque quo os ipfum per- 
tmgQm : frcquentcr autem fecare oportet^ vt compa- 


Digitized by 


dus faumor citius proaeîtc :per vlcera efiîuens , & & 
tnul vt frequentcs fe^iones exieniionemcarnis ad os 
fâciant.Sic mederi oportec iî huie modo res fuccedat. 
Si vero hiBcnoQ commoda fuerit , & fîuxus non elui- 
tur, vt clutus aciwecernere fâciat, femperab incura- 
benteocuii magiş fpkndefcentcs fiuut , &acuuis vi- 
iushoEDinisexdnguitur*:. , 

flîSef T ■^ciy'»^f''î'î'cffluxum ab externa capîdscacocîiymiaiam 
iernae»pitis i.^ cutarc edocct; cumquc morbus ârepîetionepcndeat,ab 
«rochymk eitacuatione iure exordicur, quxrens capur, & vniuerfum cor^ 
pus ternii vidy , purganti medicamento , alijfqueparciculari- 
uput'i"?'" ^'^s euac'iationibus âepkre,at^ueat£eîîuare, qud fluentis ma- 
non fiSîjfos. "^c^î^^ fons exhauriatur : Caput tâmen medicamento non forti 

SiSo"^ ^""^Ş*"^""^ »'°"-^> «c a vaHdioris cathartici vi exagitaca ma- 
tena,vehementius in oculosirruat: Qaa tamenin re Hollcrius 
iih.i. de iat^. morb. in fcholio ad Ophthalmia fîc 
^ucas eft JNojmum e recentiorihus Hippocratis authoritate moţi, 
forttores pirgatzcnes mnproiant, quodfic commatus humor âefluat 

. ^ocuîim-^aŞcontra.VidîconttmacesOphtalmiasnoţotuîff'ecura 
msvehementimhusmedicamentis. Sedomtiaprohimmsquantu 
iaîe ^quoMtate tempeiranda. . Gciriis interim nallum oharmacu 

yuIta4hiberi,.noH<5tj<^d Nil profit ocuKs,vt<Gmmuniter ada.' 

If /«ţurî guod par<Emia â Germaais origmem traxifTe nairac^ 3c. FaBopius , apud quos Nil fignifîcat fpoditim, feu thutia , qu^ 

Smţhi: «^"^JP^'^^efe muameşti confaeuit. i^amnirenim yc 

inc, - verdjimum fateri oporteat in -loc^ibus tuMccmodi adhz 

OcuE W ^^-«^dis plurimacautieneopuseffe, obodjonimiîaturam:, 

patiuatur- â ^«-«9 vtdocct Gal.hb.4. mcdicâm. ioc^. cap.2., melJmtm 

io^^.bus..c n.ll^nen.,^^hec ^l^a^^r, aptitudinea J^:^^ 

corpmsaa^nalfa e^, ţroftcr^finjhs fi^iHtatem ^ fiibfta«tU 

Mtem : quapropter verendiim efî ne plus nocumenti\ 

ocuiorunx. 5,"^™ op« > fepefspîus afferamns : praterqaamquod idein 

ficacuvtpiu „r«^:,r c^- 4- aflcnt ocularium pharmacorunr«.- promiffiones magnas dTe , at «fie&im aIiq«ando nulluo» ,' 


Digitized by 


îaiîqyândo valde exiguum : Cum his tamen nuUâtenus infî-f 
cimdumc&^ii debite appiicencur, proficuaadmodumnoîj 
raro cxp^riri : vbi propriumfciîicct aliqucm ^ffccuim oculi 
contraxerînt . V^rum in caiii propoiîto per accidem tanuim- 
modo laborare videîitur,ob replct^ra capuc ^ cuius morbiiicâ 
teateria innoxie fer€ per ipfcs ocular lacryffîaodo e& 
pToinâcqnc ad capicis faaationcm Se ipfos pariter hcnc ik hZ'* 
biruros rationi confcntaacum eft, Quod fi ptarmacanon fii£- 
ficiat>ad ferm m deueniri pr^ccipit iuxtk aphorifmî prgcepcum^ 

nonfMat;ea ignis fanat y Qu^ ignisnon fanate incurahUia Jîmt * ^^^^7* 
Cutis igituradds vfqueincidendâin capi^eft cxiguis infli» 
^syidnufctilis^qua: &crcbrafiiK:/& profunda, adcramum 
pertigentia , vc impadl-us liumor penitioribus ki pardbiis 
4elitefccns , attenuatus& attrkus , per plure^ poftmodum 
^îas cfiîucrc qucat Mncmbrana autem ilîa mufciiîofa,<jua: ob 
fiibiectosiatitantesliumorcs non nihilâ^::ra|uo diiiungicre* 
.dendum eft t ita vt iîli non sequaliteradhsereat, fediînum 
cuodamînodo ferttetjVbi aîij h^morcs itermn-colli^i faciJIime 
poffent , frequencîbnbus hifc-e vuînufculis ad cranium yfijuc 
impacăis ^ cranio quaiî coiifigatur, vtita dicam , omnifque 
Houo morboauferamrocca^ . Cxtsxum noii fint obîiqua* 
aut trKi(uer{a> ied potius in reâum > vt viilnisrum labu mai- 
cein ai^lidta pcrmanercpoflmiCj^tque ita ck^^ Şi - 

^go exbac eurandi mctbodq res^fclicicer &«x v^to ilîccedâţt . 
ci in^ftexKkîm eftj atq; fie mederi pcrgendum ad perfejâani 
vfqueciirationein. Narat ThcodprusZuinger.Ma^îui^^ c^fimcmis 

falium curationem hanc iriflidîis vukufcuîîs ad vâim fcîiciter ^^,^^^^ 
reuocaffe in Carolo vnico Phiîippi Catholici Rcgis Filio , cui c^coci^JS^ 
^^quodamcafucaptitvalde intumucrat. At fi &h^c minus î^^^^ 
commoda fenfiamiis, ac nihil fere opituîentur ; ita vc lacryma- tm* 
îum fluxio nequ^ ab inte^nis 5 neque aî> exteniiscuaciiăntibus 
^iiamr ^^^ eitj. eximat^ur & ceffet i & ablatus^, yifionis orga^ 
num.piimm atqucabfterfum, cejrebrum veraab iUviuie oimii 
cxipiatum relinquens, acuce cernere faciar, iuxta pro'bîema bo- 
, num fecij I . fuprâ citatum ; cunc a perenni iiac contumaciquc 
fîuxione ocwlus obkdi incipit ; ab incumbcnci ctenim , hoc 

Z cil. 

Digitized by 


cft ,âb humorc inipfos oculospcccnniter dccurrenţey ,^k;% 

defcentes fiuat , videndique acuta acies vel hebetatur ., vel ex- 

«pŢendorin tinguitur; Augetur qiiideminoculisnitorinpropofitocafut 

ocuiis coeci- jjj nyQ imminec czcmsy non ex crytallini, aqnei , âlbugineiq; 

tatcm porte* - " . . . -^ . * ^ Z.\^„^ 

dens . bumoris puntâce ^ non ex cumearum omnium > (cornea: prse^ 
â'e^ndoiTcl fcrdîB,vbi pupiîlam attingit)tenfîone & politurainon cx con* 
de* nati lumims fulgore fpirkuumque .vbertate: fed quod a peren* 

ni ferofî & aquei humoris ^uxu'natiuus calor iam incipiţ in 
ocuiis excingui : acque hinc non modo membrana? , denfîo- 
rcs duriorefque reddit^, extemum lumen ma^xe^i^n* 
tcs, fplendidiores quockmmodo apparent 5 venim etiam 
jpfaemet lacrymse^quibus oculi perpccuo mad^nt^frigefcentes, 
glaciei inftar fplendidius qiiid intuendbiJS reprf fentant . Ocu« 
los autcm,fcu cutem ad fnggidi humoris contaâu durefcerc 5 
dociut Hipp.lib. de humid. viu. Ad membranar:iim yero den^^ 
Smicm duridemquc caJigarc,acutamque.aciem extingui^ceftis 
cft Arift.oţ.probL9.& Î4.fe6l.5 1 . Vifiuis tiaaique fîmulacris,.. 
qu?c â vifîbili obiedo aflîdul clcuantur , vel ixuUus tune , vel 
diificilis patet aditus ad cryftallinutn humorem i pra^terquam 
quod fuSulîo ex contumacî adeo illaciymaticne plerumquc 
fubcrefcere confueuic. 

XVL ^^ ^^ vl^vim y îa hqmoresî purum cruentus alîqujs 
humor mgredîatur> fauic viAis înttâ oculum qdn roK 
tundus efle apparetîproptcreâ quodin qiîocumq;îneft 
crucntusteînior,idipium ncm appareat*Huic iraqjde- 
fidt vt vifus rotundus ăppareat/& ante oculos^^ 
^ inQueriipfîvidentur,&mhîlrcveravîde 

Vîfum prcmcnţes exurere oportet^quae vîdelîcet îcm^ 
per pulfant^ inter aurem & tempera confîftuat*&vbî 
has obîurauerisjoculis pharmaca^quae humedant, ad^ 
bîbe^&Iactymam qaamplurîmâ proîecia>qu6id,quad 
în ocuiis compaâum eft^&raorbum 6cît , elimtur ^ 

NItidiffimum profeâo eft oculus j incapotiflîmum par- 
te > <yxz inttr cryftaUinuai corncamque poiîta cfl: i quâ- 



Digitized by LjOOQ IC | 

cjue pupilii cxcuntibus radi jsy j[pc£lrifquevifîlibus alumine 
aiuftratis^aduenicntibus^ iteraperit t puriffimoitidcm num- 
tur alimento > vt alias ex Mippocratc docuimus^ . Iure ergo â ' ocuins ia. 
craffo quolibet , quod perfpicuitati impedimento fit , hoc ^^^^t^^ 
lucis fpicndendumque coiorum receptacuium îsedicur : Mqi ^''ff^^' 
vbi in vifum,fcu pocius, vifionis inftrumentum , crafliis aîiquis *** 
vel vapor, vel humor, fiue cruentus iît, fiuc bilioi^ , fiue 
^ituîtof^, autmelancolicus, per cipticos neruos, aut pet 
«j^mbr^as, membranarumque venulas, & arcerias^cfcea* 
dcrity ^ connatos, puriifimoiquc humores, aqueum , vd vi- 
trcum^nec nmn membranas ante cryftailinum pofîtas, obfede* 
ritV tune fi extranea hsec materia peruia aîiquo-paâo fit, ita tc 
innato lumini vna cum fpiritibus irradionci, vifîlibusque fi- rifibilia o- 
mulacbrîsaditumpenitusnoninterdudat, exmaeo tantum ^^^^g^^^^^ 
infîcitcolore,proquecolorcinms^xiftente, colorata etiam a^pa^am:. 
apparent vifibiiia obieda . Atqui fi coaaa iueriţ, atqueopaca> 
( nam hîc crucntum aut pro craffa quaîibct materia^ poiitum 
cft s aut cruentus humor , non quatenus ruborc fufFufîdiaa^> 
fed quatenus craffus , radijfque impenetrabilis efcpr^tcmatu- 
lalesparitaffeâus, quiinpracfentitexturecenfcntur) ^^îţci^ Suffidbîws 
tam forte pupiUam occupat^ & int^ram inuehitcasciiatcm^; ^^<» • 
vel pupilii paitemi& tune rantum de ^aturadi iUimtotundi- 
«te demitur, quantum eritpars âcoado humore vd vaporc 
cbtencbrata; quempoftremttm caftim tantumodohicpoijit 
Hippocrates, duni ita affcdispupiîte figuram deprauaiam ap- 
părere afferit . Deprauata praeterca eft vifib, dum qusedîun ijs ^pcftravark 
videntur prse oculis obuerfari> vtpili , mufele , aUaqueiitiius X^|^ 
generisj&nihilre veravident: fub varijs namque imagiiiil^us -ooiHsâuax. 
hsec fe fe offerunt, pro diuerfi tate formai concreţi vapori^ vd 
humoris, inter cryftallinutn comeamque exiftentis : atquc m^ 
ftâbiles fiint donec in veram ypochy fim firmcnîMr;qu^vtiquc 
afFcâio Medicis ima^nes & phancaftnaia appeUatur . Caste* 
îum morbo hoclaborantes curat interceptaprimumfiuxioiic, ocidonmu» 
combuftis, accicatrice obfcxatisarîerijs ijs >^u«intempori. v^^c^ 
fcuspulĂnt , per quas vifum prenii Ixdique plerumquc con- ^.xiOii^ws, 
tingit, <le.quavftioiie plura diximusfuprâ text, 12.:, eamque ^^^* 
laudauit Auiceix.Ub*3 ;*cap. 33. modumqueid pera^ 

Digitized by 



gendi defcribî c • Pernelîas in coisfîlijs efftcadffmofrh mquîi,âc 

Optima fit ^^^^^ff^^^^^fi^J^^^^^P^'^^^ 

zeauifîo ab <i^md eji inTădic^ auris , ^ in conmxione maxilUponemfamm cm^ 

dullalcS *^*^^^^^^ ^^'^ rmMsefl'ueH^ iugulms intra fnhims inoţii- 

Ă cur. COS nemos vtrimqm excurrens y eofyue ccmtaturcâ ocnks vfqiie \ 

In idi^itur emgmint emplajimm zm^is magnitudine apponendum 

efi^».quc^^mfletex^quis.p:s^rtihtffiipnismgri, ^fakseommimis 

ţritirvdaBidexfemină £/napi ^ emtkrndihmSc. 

^uSonis municaadhibecaippocmesv qushume6taado^^rarefeeiţm 

dcque vim habent diffaluendi , attcAuandiqi^ eoîi?ipa,^ii vab 

oculi friggidicate Kumoris ^ yt.v.eiiaalitiim deinde ^^eat , vei 

m lacrymas folucus eiâacuccur. Praiâabit igitur primo- ocuîuiîi 

, M:xlmmmAtco€io^\nolmimyAm^2iU^^ 

re^deillde coUyrijs agere^quaî feîlibas varijs^ VI Cap^^se & Pe 
\: : ^ ^^^^s^i^ccisRyt^, Chdidon^, Fceaiculi vnac^m^:e^ 

Mim daboranaii:^ vt qupd fom uuMbxmMi ^cxUoUyxia 
4emum abftergiatiii: , Quas vtique cautio plurimi facienda eft^, 
ne^fi ^criQribu^ tanţui^mado a^miisatenuipri diiToliita^parte,. 
quod cr^ius eft, cerreii^na aîagisrcddatur^ ac pene iiidi^ 

::r\':. .:. ' lubăc.. [ ■ ^ ' _ ■ ^.^... ■ . ' Z. ' ' 

XViL , 1 li verq ociiJus mmm^h monîSus medkâment^^ 

m^alSÎ^ ftamcoeat, & cicatrîx renuis fiat v Sî autem adhuc 
^•'*''*^'^ ^H^oribusplenus fueric ylacrf mare oculo conducit. 

Otitei $antummodo> ixon exinfiituto, Hippocri^tes a^it 
in hoc opere de niorbis^quatenus videlicet deixQminis 
natura lociKuruS;! Medictpartes eraatpraecipuDs quofdâmor^ 
bD^exj>Iicâre> quibus componentei particiil^ obnoxi^iin^i 
vttam es n^urali> qiiam ex pr^ternaturali conftitutiofîe Hlară 
natura Medico phiJofopho eognita effet. Quamais exgo innu^ 
meri pene iînt morbi, quibus oculos tentari pluxies ixău t&; 

perpaucos lamen attingic , ex ilmilaribus fcilicet vnă ophthâl- 
miam ; Ex iiifbmmcntaUbus , imagines , qu^ ypochyfra^^ 
ceduntî atque, v: in vnoquoque genere exempîificaretur.coîi* 
umil ioîutxQmm iam in medium adducit^ de oculi ruptura 
' > vcrba 

Digitiz^d by 



vefbârfecîensihienitoaâfoum în^ fiipcrqiîefo- 

do âb interais câuiîs > vt ai> acri pure.; vndfe Hippocr. 4. epid. ^cmbmxi^ 
Suţfurdtionihus oadi h munţentiamagna 'ulcera jhmţy if feBa l^l^ ^*'' 
frofundâ.'Vtroque Tncâointuitusem^^ Id fepiuscon- 

tinc^it ex obortis puftulis, vtyarioîiS;,.mtrMorbiIlis,^^MGdo 
ablxcî^^cfeV'^okmibufipîe^iacimîo^f^ ;/ 

euelîtiblis ^ct^iiea tepriniis expofita:eft^ 
ta ^ vd aîbugmeas effimditur humccj vt JegkerJih.ifc p 
ac tiHK: trjrftaîikiiisib cxterno luminebaud bene^cfcBditur : ' 
cumque ab eo humore membrana optime exteniacoîoferua- 
tetur 5 concidit poftmodum , conftrmgiturque piipilîa ^ arquc 
hkclceditur yifîo : vel vuea percorae^ rimulamexcidit jUâ 
vt nune Miiic^ eaput > nune vu^ acinum repr^ientet, quas af^ . ' 
fe^aioBesMyoycephaloji, & Sjap]:>y:Ioînâ Grf ci mmcuparum / 
Narrat ^aieirJib. î,d$ ^p^au£c,i,de Paero^is^o m 
paîa<ompiia6tus3bum<>re flujdijJbugîrxeus^pupi^ cm ocpiii/ 

aita^eft>coinca:xugQfioiapparRit:& tamerif fiii^fanattis eft ^""^^^-f^ 
np fine magiia admixatipae.At pIuriiTii hi caîiîs yideantiir apud ^tmtuva^ 
ScheşkiujlAiâs ctg<\5^rbi^qu^ ^i^ualiter Adikii^etia {unt & ^ 
molUa^ti(^e4cM3îşkmor^ espema, 


tis> adbibetiŞîf!p^â^şi,.»QWna^^^'^î^iteB^ - -^ - 

proinpte id.ft^temSconiiMant al^^ , venim eîiam ytdiiifc ' 

fe parţes quam ar^ffime.vniairfţir , vţ vulfîeris vcftigium> feu 
€icaa:ix,qpaepermanfura neceffarioeft, & albugo dicifoîct, 
Quâm te^uMSmaXwperfiit; > b^c n^mque cum lua deafitate acie 
arccaEdumeir^iQHe pupilii cil ; quoeţitt€nuior> c6 mirms 
impedidait)BâQ:v Haa^m^tbodum^t^ G^en» 4. de ^ ^ v 

comp.:OT£<iiocâî^ cap,:5*3euiîiqu^iecuti iuntPaulJiKg^ ot^o 
cap. 22**&Aetx*jyibv7, cap. 33.Gale|ii%cfuiit ve Tke^S'v^ 

qti^ ţes* croponem tunica corniformis fiunt > 'vt etîâm epc 'vmfirmi <^urci:tax. 
qiiiâ.ţrmmt > fnmfijhm efl , quod turn oh fi ipfiţ, tum ol pro* 
laţjknem repdlmtUm, iţ/^pringmttlusţharnmcis opus hdhmî* 
Conandum efiautem, vtcxipjfseligammiqu^ nulîam^pitudin^n 
facimî 9 ^c. Jalia fuuţ Rofe, Hypociftis , Gal|â omphaciqs> 
^■: . modij 



inp4i,ajiţ;4B fttio adiiringente 4eco<aa,ayţ in aqua |lft%uro , 
.PhnragtnJSvPoIygonijSpogiaq; wîe deco<3um m;ipcre , oc 
lifqucapplicare. Subdit; quodripofth^coijjRiafupcruaca- 
neusaliqmsadhucfuperfic humor, laciymas tune effujîdere 
profîcuum erit : nam vclut dum ocuU naturaliter fe fc habent, 
lacrymis ab eoruhumpribusnimiiim profluenlibus>illos con- 

a^'^. ^^>m^ «jcienuarijiecdfe eft;ex;quoCdf.Iib.5.«p,d« curat. 

In extenuat ociu, > CQQtinuos iîeţus oculos immÎDuere teftasum tfiliquit i 

SS°" f * ^^'^ praternaturali humefcum humiditate,pîurimum ijş 
ul^T"' ^y'"^ conducic, omnique arte id prîcftandum eft; Vndg 

^codu^w". '^**p2fn vifui commodam afleruit Hippocr. lib. 3. de diîet. , 

CapeocuUs f ^'^\^* P^**^^'^' ^^<^' 3 1- • ţrofmtmterdunty mquit,4«rf»ior- 
9iSi4ue' , ' ~^'>''*«»^^«^»^>wC^e. Laciyma; etcnini,quae oculi 
i'^mis" î I - °'^:^"'''^' < ""^ parergon,a£que obiterid , TeidUuci- 
breais di- ^^^^g«M,JiuBcdiâ:uinfît,)tripiiciexhumQre,aliâsatquc 
^Sh«u ^^^'^'i «oJ^ueuenmt ^aurvidciiccc ex'huxnidime ia 
•cuii fiidor oculorum gkndalis adftruata y<}aod|rfcruaique, Se ex Natu- 
SiSufor- ^3î»n"itutafitv.(-promda namquc Natura lucidiffimi organi 
"g^uI P'^."*"*^'^"'^**^^^"3^na oculorum angulisglandulas ap- 
ocui'isapp* P°"*^»<l««^*^"in «dgu2 quadam/încporoffiipongifor- 
^'huSidi "*^»*'^f^ orî>J<:"tees carunculf iferofitatcsecerebro/cn- 
oSe^^ fi'n*^epEoleaân(t,OcuI^qjpauIatimaffimduM tînnaditt, 
'ghame. fcricicate in îpfe<onfeniandainj tumedam,«e percnni moţa 
agitaţi, Şiridbus prf fertitn aflidoc copioseque eo affliKncibiis^ 
nimium exficcareHtur.)Aut formâtur laciynngiproprijs oca- 
lorum humoribus , vt diuturno in fletu,vbicf teris alijs omoi- 
bus humiditatibus db perpcaio cnaanâteslaciymasexhauftts^ 
acipiî demura in laciymas colliqucfcuntî ac de bis locutus 
îS^cims *^ ^*^* locofuperiuscitatoi naittnoiimoda^coeulianim, 
pariuat. â! minuunt , led penitiis etiam «xtin^ant . Aut 4caique. ex vi- 
«»*• tiofis Cerebrireduiîdantijs , feroiîiq; humiditadbus, qnx in 

oculos pr^ternaturalirer delabuntur ; vt in cpiphora , Uppitu, 
dine , alijfque oculorum morbis . Exeuţiuntur autem, cien- 
turq; lacryms, autab cxtrinfeciscauiîs, vel expulfîuam ocu- 
lorum facultatem irritahiibus , vt Fu mo , Cjpis , alijfq; acrio- 
nbus, de quibus-videndus AriE fea.2o. probLia„vd com- 
moueoubus, expnmentîbufque, vc âcelericmfu.fngore,. 



■Digitized by 



âaui!onârîaîc&ftiturioiic>vt coîligitur ex eode Arîft probi* ii* î^*!^«^ 
fe<ft. 5.>&ex mH1pp.aphor.17* lect. j.^Autcienturabin- "ksocctttia 
trinfecis , vt funt morbij Quorum aîij ad Ammam^aîij ad cor- ^"^* 
pu$ipe<âant. Ad Aiiimâm quidcm 4>e6iant pathemata, quse pathcmata 
Animi dicuntur a^gritudines eo qu6d>etfi in ijs Cor prascipue ^^ ^i^âtur 
aiŞciatur;ad eos ^amen motps Phantaftica fculmaginatrixmdi^^^' 
fâcultâs vna cu AeftimaHua aut Ratiocinatrîce neceflario con- 
currit><juamm altera obieâum apprehendat-jfiue prsefensil- 
lud fir, fîue praîterîeum , fiue futurum ; altera vero bonum,auc 
malum illud effe dijudicet : înde etenim Cor > eiufq; 6mu- 
lantcsfpiritu^ varie atque varie deinde agitâtuT;, afficiuntiîrq; . 
iuaxatur enim quandoq; Cor, atque vna cum ipfo prsecordia, Pathenuta 
totiimq; laxatur corpus , dilataturque ; atque hînc aliqui prse ^ ^* ^^^- 
gaudioiacrymantur, vliro promananabusIacrymişoDaper- tiam» 
tos gkndularum poros jfangmnepraefertîm fpirituq; ad exti* 
ma vndequaq; effufo ; vnde quandoq; & interitumbitttttdît 
fi^am fpiritu^prx gaudiyexceffu accidiffe perhiberur : quod ^ 
liecitiaî accedatrifus,lacrymaîis humor magis indecommo- exgaudio 
tus , effiuît^ Quandoque autem conftringitur Cor^ipfaque f^xâitu vc 
jir^M^,, ^vjtîn dolore & moeflitia > atque vna cum ipfo mu- vtcxckctk. 
fcţdi ooan^4aiâ^>jqua? ei masdme confociaca eft, conftri^ *^^^^* 
guntur j.2B:qu£iic cx madentibus oculorum glanduKs humidi- 
tatem e^prjmunt , cainterdum vbertate>in humidioribus pxg- 
fertîm ,* quales Sint Mulierum , Puerorumque , vt oculi eP- 
fundcndo fatîs rion fint , fed in narium cauitates per meacumi 
iii maiori angulo exiftenrem prolabantur. Atque hse vere prcK; 
ptîeq^fiMiţlacrynaa^>^d<dentisAmmnttdices, â cuius lacera^'^^J^I^ 
tioneitaappeliatas aliqui voluere*^Dehisfacundementi€3i-:aiumi indi- 
tesj appofîte tamenjlocunturjdumlâcrymasfaucij Cordis ^^eji^r. 
cruorem,ieuVaporemeiufdemexa!ftuantis inCerebricaui- i^crymaiâ 
tatibus concretum , deruatumqj m oculos 5 ieu Ijquelcenus 
Gordisiliqupreta, fiue Animi labotands agit^q; fudorem 
appjdllantî nam languores animifemper attcfentun Quicquid : 
aucem fit , certe adeopretiofus eft hic hmnor, vt non nifi Vni r 
Deo digne efiiindatiit . Has pariter lacrymas voluntarias ap- voiuatari^ 
pellauit Hippoc. aphor. 52. led^^. eo quod Animus fletui^^^^^ 
huicHb^ntfirquodammodd affentiatar,cum inde leuamen lu- 
; fcipiat 

Digitized by 


î84 mFFeCBiJ^::I^B,-nt ^ ^^%f^ HOM. 
x^ciyţaiţ {cigiaţ^fîkt^^ffiBatiiij; fuli^j^ib^ş ijs,<3^ibvţş ge^fe^s C 

. . * . . , ... . Arhitrw tuo 

Impkre lacrymis .pfietus ^rumnaş.leuaţ . 
5cbuid,4.<kn:ift :: b f . 

Lactymxa Adcorpus ^eâîantes morbid qullacjymascommaucft 
qi;ibiis mor ^ţ. pj-Qprij funtoculorum , yc pptalmia , epiphora. Si extrc- 
an . ^^ rctendricis faculcatis imbeciîlitas^vt in iam morituriş ; aut 
funcx:erebri , vtmdaacolicaaftedio^ cuiufmodiHlamHera-' 
cliti Ephefij extitHfe , qui perpetiiis cooficiebatur lacry mis * 
exiftimaadum «ft ; aut feroia eiiis cacochimia . Ac <ie poftrc- 
«ushifceîacţymis mpropofitucontexm iatcîligenium effc 
proceruflîmahabcmr,qiiaî & improprie funt lacrynif ,& in* 
juoluntarig , nulla animi eleSione j exorâq; ea&prolicere profi- 
- ^uuqa^eft, yrCercbrumcxpietjurjOaiUv£ro:BMUam^ 

XVÎIL Ac vero cum în thoracem Rvtxacit^Sc BîUs faerit^ex; 
hocmam&Ram fir. l>olor lateris molikudînern occu- 
pat>&ciaukalamdur<i€mpartîs^&febrisad€ft & 
Imgua fîiperne palKda fit, &excrcarc0inpa<5b;Hu- 
îus mo Al perîcuîum leptîma^ aut nona cSeloftat. Alîa 
Bîlîs • Cum ztr^olmrzdplu^^ 
feduţia prî^^^ 
' «keft^Ulaveroî^^ : . ' 

LOms Hc ccmpîura magnonimVlroromdiutorfîtîsgc*^ 
nia . Nam ^uid longius a communi recenfîum Medico- 
rum-cenfeafuexcogiîari poteft> quâm, ctim ktus vtruînq;do- 
laeritjPeripa^uoioniaiai eiFc ; că alcenim tanmnamoddi-Pku* 
rkidcm:^ pronuîvciaxe? cum cermfîifitytriiniq;cxhis morbid 
& in vtroq; latere v& im altcro tantnm pofîe procreări > coquc 
damtaxacdifferre-5 qu©d alter £t Puimonum inŞammatio; 
aîcer vero Pleurse -membraiix : bac tamea diferenţia .>*.quad; 


Digitized by 


Petîpneumonia iipefepîus y trumq; latus ajîcere, raro vrmxjx 
mmum ; Pkuritis yerdi contra , dih^xjmx latus yc plurimum ^ 
^trumque xariffime fokat : Cuius quidcm yari^tatls incau^ 
fa eft Pulmonum raritas atque vnio , cx quo haboK, ^£ ery-, ^ ^ 
fipeiatOides pMegmonfaeHiinii in ip£s propagări poffic , iicH$ duaiîcirur , 
quâmaccidit îii Picura denii orisiiiMami^. yidel>atUT ^«l |Jfoaue^l:£ 
,iisec periodusinterieciaj vel faltem quide^? niîgariiim iencen-: ie aâciriir i 
îiapjTiaeterjatioaeinpxolatpm ; itâ vc hoc vnum dogma, ^bf^^^^f^ 
HippocratlsdoârinapcQiiusdiileBtiens> librum hune , veluc- 
fpurium juiQimeque Hippocraticum , apud plexofqu.e dam- , 
riamm reddideriţ.* At aoniiefuii: e contră;, quodiiuaiana in ;^^^r^,^^^ 
incertitudine plerumquefît,>quiranium£dei huicxontactui^iutas. 
adhibuerir, vt csteris omnibus pofthabkislccis ^ vbi de PJeu- 
ritide & Peripne^imonia Hippocrates alicer locutuseft , ia- 
-€am.deuenetirfeQtentiam, Meuritidem non nifî puimonuin 
vitio excitări , quod frequencitcadauerum diiieâioiie inijs, . 
qui â iasuiffimo hoc affeCtu perempti funt , ditî ie .oblexuaiTe ^ 
xeftacuseft. Veruni omni luce clarius apparet in ientcncia .Hlppoca:^ 
iiippocratis pkuritldem etiam in iacere , nulîatenus aiFedtis j^^S^^*^ 
puImonibus^pofTe procreări, ^itotiefcnnque/eilicetperc^^^ 
Jcfaâ:is humoribus, ac proinde eliquatîs ac fiuxibiîieribus 
xedditis , iîue â nimîo yini potentioxis hauftu , quod intenlo j^Umi^ 
xalore attenuat primo > Se eliquat , rnoxiiaturalem excinguit 9^<^flcîodo 
calorem , ex quo poft ipfîim frigus iequitur j&xigor^ ytznnO'^ "^ ^î«fi^ui* 
tâuic etiamAriftoteles fee. 3 •pmbl. I», iîue â nimic Jabore, 
velocioriq; motiî,ytdoj:uicCelf.lib^4. cap. 5. fialiquapoft^ 
modum acccdat caufa, qua^ hmnores inrro pxopellcre vsăeat, 
x^t vehemens frigus > V enti aquiîonares , fepicncrionalis xe- 
gîo , quemadmodum docuitHipp. 4. aph. 5. & iib. de aq* 

*^^'^* aer. & ioc. Hsc etenim extimas partespx^ frigore conden- 
fant, iatus pr^EiCrdm, quod carne paucioricoopercumeft,; 
exterifqueveniorumiBcurilonibus magisexpofixum ; vndc 
eliquacos intexnaytpotexaiidiora , iiîagiiq; xima-^ 
bilia , exprimunie -.; ibiq;in pleura ineinbrana > quar deniior : 
eftjobfirmati,phlegmonempariunc, Id coturn difercis yex- : 

gm^ ^^^ bis docuir Hipp- lib* i • de morb. inquiens . Cimtţotionss acer^ ; 
îiat<^9 ^fortesva!dhorri£imt^^^caleJcitmfimcorfu^ 

Digitized by 


fneHatur a tîtîo : maximi autefnptuîta fy UUs percalefiit ^ hu^ 
fncBaUiT y ^ his coimnotis if humeHath conţinut ^t rigorinuadaP 
elnum i ftue folmum . Btcum L^mTtatura came nudum fit ţr^ 
cmntbm corporispanihus s &nonfiî^uiâiniţfOi moi renitatur 
prdter ventricuU caidtatetH , maxime ngorcm per citit . Bt cum fi-* 
mmff ăcfefngeratumfumt, tmn am y ^^e ejiinlatere ytum 
ven^ contrahmtur f ac conuelhmîur: & ^îi^aînfninifptcams^ 
inefliilis ^ ţituit^ > auî in ^omis > (pi^ in ipfa carne fimt , iifm^ 
gna ixparţe , aut toîum fecemitur, intngue comţelUtur ad calî^ 
ditatem, carneextriafecus condenfatay atqmidadlatusaff^itur^ 
^ dolorem vehemenîem exhihet , hpercalefcit^ iţ per CaUditatem, 
" ■ îrahit ad fe iţfum d -vieinis vmisM camihm ţittdţam ac Ulem^ , 
atciue hocfane modo fit Fkuritis. Sicuti ihidc de Pxr^ueumonia 
Valde aîiter quam hic locntus eft , fie haben^ . Teripneufnonia 
fit cum CofHffKTta^ caiefa^apituitaac lile^ pulvzo pr^tcaliditate 
traxeritinfeipfiimdevicinishcisadeayqu^iamfimtinipjo. ^ 
. percalefcitqmÂmtotumc6rpm9& dolorem exhiht^mi^ 

dorfi y ^cojîis y & hmneris ^acjpin^ : mminmi ah his infeipfim 

attrahens ţlutimam humiditatem > ^fi^perexiccantur h^ partes^. 

.^ ntmiim calefcunt : pafiquam maemattraxmtinfe ipfumy ^ 

turn Ulisy turn pituiUafedetn in ţuîmone occiîpatdt yţutrefciry ac 

Cur* Komâî fuppurântur ^c.Qnoă fi hic Romse in Vhmlmomm câdaue- 

^rmi^aX ribus Pulmancs fere femper malc aftedi reperiimtur ^ id vel tx 

ttcribuspuî- peculiâri quadam Cîrli huiusrheamâtum feraciffimi ^ condk 

Smque^If- tione contingit j ita vt propter bas cerebraîesiîuxiones cafus 

fc^î rcpc- ^ Hippocrate hîc recenficus fepiffime accidat; Vel id fit, 

Haasm . ^^^ pkutttica affectio , raro y nifi pofl prindpium , in augu^ 

mento videliceţ> aut ftam^ iEgrotantes peri mat; vndemor- 

bum â pleura ad contiguos pulmones probabile eft boc medio 

temporis propagări ♦ Quid igitur dicemus ? Cenfeo equi» 

demfapientiffimumSenemDiuinoprope ingesi) aeumine> 

affiduaque fymptomacum obferuatione adeo omniâ human^ 

Hi cmîs n:a:iir;E arcanafuiffe afTecutum^vtqui varia eiusmotitîmenta 

cBcomima . ftadiose euoiuerit , fatcatur necefle eft, nil penitus etim laţuiC 

fe.A«reujn hoc buman^ ^piemia? flumen ncquitquara tenui 

fub alueo comprebendere labores . Preflus vtique fermonc 

el^re auccHJ iHcomprehc»fibăis ; compluircs fiquidem agno* 


Digitized by 


.noaien ci> 

jcucquc la- 
teris Ăoioii 
ion ap 

«itmorborum idea$ adeoâ .conwjaura Medicorum ootione 

fincminiâM<iittS, ^qua animilance deind^contempieris, 
uauitetiamin3««aUiioloje, cuiusyariaîTp^^^^^ 
ri&at^irepcBunmonruis „u>nu«ventis,PlcuBtidis»oc«n ^^ 
Ion âî>l6urînnembrana, auemadmodum GaleBi^ , ied „^ 
L ş^MVfo.,ioc.cft , â tee , deducens ,: promd^^e «. .^^^^^ 
non vnam1?le»rsinflamm«icnem,fed guemuis ^^'^^^^f^' ^- ^ 
lorem, modo febrem , di€cilemque anhditum adiunamu ^ ^^^ 
i^eat , fub boc plewitidiş nomm« <osip'^eheridit ; qua^^ui- 
lemjio^modoi adi^mium iniarereiiurnocum.coikctio. 
ne-iaBitur , ycnotauitftuscxlib. i, demoxb.,y«tum_*nain 

ytiAfiXDUc&ur: .cer€bxaIki»amque.caco,cbyaiia , dum 
tewîs &^aofafit^ica vtpoffit w. puimpnum yique^rctm^ 
tates penetrare ;fiunfuper.copiofa,vtptilmonum alaspiu- 
riiuui^i^ere vaieat,^n.ekuisapuimoa^uş wowBtv^sm- x.t«vr.â 

Itefoiratioiie yiolentiâ quadam latcrixurgidus Puimo dhdx- gi^.&. 

.caloxewimperciwrî atqueexuAanribus ab.affeâaparce^ii- m^,^ 
jmditatibiis quibutdam , dd«i» laţermon rar<xagglut^atur., ^|«-^ 
vbi adaudo £iiu,pluriaiumpariterja;iaanem adauget. t^em 
omemăwralem afeauro, ij v»-ar*}qu«îaîusoccupet, ^x h- 
^udioe quadam Peripneun.«»iâxommuniter auacupaa 

pkruaiqueinfcftari ob radott-ei» fuperius ex Puloionum ran- 
îate aUaamifiycrA âlt€Xutn.taaouBt»odoiab eadeoi fimiiim- 

tivuloiienteixtiamprolata î fiue tumPenpneu^wma iia^c, 

folEcui erimm.qivemadmodam rvequefuit îj^f P<>^J^^ ' ^^^ 

Digitized by 


i8f Hippocjum £iF. n,m wcJmiHOM 

nîmmopîuries forcafle aecidere, etiî minime animadueK5& 
tur. lIlcrdetiămBon improbabalicer dicere|Jofîemus', Hip, 
pocraris mentemfoiiTe, cum amSopufmonam latera; dolue-l 
«nt, Fer^neumoniam fîmpJidternuncupari rcum v^ero alte- 
răfântibnpujHonartipars;. turxdiciPcripneumoniam cum 
addito,hoc eft, fatefaîcmivffius nimiram laferis PeripneumcK 
îuam . Hancamemraorbi fpeciewBocioco pectiliariteî re, 
cenfer yqimde tnorbia â capitis- rheumate protienienti&us 
fcîspracipaeagebatur. HorQmitaque aiFeâuumfi<^na iam 
aîtentepercurraiHUs,- Vî diagnofis inds fecilius.coiitmgat. . 

Boîor lateris molii iudloem occupât , & claui* 

cuîam eî»rdera Darils ^^ P"Îi»oîî«J» nempe ,. vocale 

. .... ^ * inftrOincQtum ,' fpiraHdoque ia 

pnmisdicatam, qui tdtani feri thoraciscâoitâtem occopans , 

Mediaftina "" r' ^'"^""^ parces â Mediaftino, feu meiiibranisijsin- 
îuii & . teriepientibus , qus â pleură^ cxorts , per Sternum ad dorfî 
yme5ras,& a Cîaaietilis ad Diaphragma protendtaitar;kayt 
^hşricte curs fit «oci figUră, vBiteconditur , bubulum pe- 
:: - dem bifidum ptefeferat.- Vtra^ae auren. pars rurfi^ia in duos 
„ lobosifeupjnaas, &aks, fupefiotcmnimhvmy&mfmo^ 
■ 5^T' ^"^^ '''°'"^^"^"'"^"^"^^a«5"^c"nîte-irar,Quam 

aPkur^erci^t,commanemq; p^oinde habet cum Diaphrag, 
^. m2^e.Mediaiîiflo,C]atiicuJis,o«îfliqt:edetntimtJ)oraeisâ^ 
KS£~ «^'*5*^* ^"^qttiî'«5 0mftibasfocietatemgerit. Dumergoâ 

ttS^S ^^"^^ ^««f^"^^ ^iq'^e P«^ă<iit, fieri fion poteft, vt toca 
^cu«8^ morbifica materia per trachcatfi , eiufqn<î bronchia adiiifo-' 
s«'' -«orcmalam ita deferatur, vt niivil adfuperiorem locum di. 
uertat, quî proximior traiifmittemiparti fubieâusefl; Hinc 
ht, quod,cUmcx hoc defceHfu turn fuperiorem puîmonis alâ. 
E'fil "'^^^a^> i^ bypochondrio, feu îateris molii, 
î^. ?,!4 r -^°? ^'''''f = q"^^a^««>dum luperior ala , par- 

u^X^ tT"'f '''^''" '^^'^^ alficiens, confimikm ckc» 


Digitized by 


tex* î5' 

, ?ebriS ^<î?i^ • biiiofaexie eft ^ atque raîida; in pulmo* 
num câmt^ibiis inculcată ^ ob coar^atum fpiritum magis in- 
cand€icit/igneumquecordiimpertiturcalorem ^ quiipii& 

jnacftfebris^ ^ - ^ _ 

y* ioqueîâ? mateiv& animi nrniciu^xvr iBquitDe- x^ingu^cos- 

ciiiusibbfta^tia^^ş^oîfer&râră€ft>m . • 

c^ymu€feîa(,qttâm corn niunkar â Lark^e ^t<^^ 
recîpir/P^lt3î<^ibus& Ventrkiiîoe^d^ fupetpofica, fo- ^.^^^^^^^ 

bie6îaâutcni Cerebro : vnde concoîor effefok^ rediiadandjs coimit^ rc^ 
adiacentiumpartium; Puîmonum videîicet > Ventricuîi , & g"^^^' 
€>apiti5,Qecîajixccftaroxui^ifcerimi,quomm paikiir^^ui- 

fiiîiginibi^><â>%oBgio{knlijbftaî^^ Il^vSSl 

^pi^£ec.5.,^cgroind€inprasfenu p&non cuii,&câBî- 

\^ K ţţ. f r ob biîem tuixi ă capfte Irmentem^ ^* 

. ~ Soperne păillCta^t .^^^ ^ p^jj^^ibu^ euapoiaBtem t 

tt^j^. km,vthabaurtf^e^id.-fea:^^^^/^ mmţaHcreht^ ^ 

j^ fo^îîc humori cognofdmus.Notz paricer eflcpaca animackcr-. 

io . Qgi&îi/ puîmonarys Hngm fota dUcaî > 6" ^jj^^ ^^j? > ^tr^equ$ ^^^ ^ ^ ^^ 

^ ţarSi ^luaaţţmt» Mt ^uthus morlus e^ ad aceram dmc^câ^. ^^^^ 

hâGranU ^perm^ 'otr^mepdmms aU ^mtant ; OuthusCecm^ ex dauicuia- 
dummcdiamco^ăm^medîa* Qmhisficunasimjeţmmtrănjuârpm^ qnapuiir.o- 
infm(^r * Quihm veri vna totaţarsUlQT0> m^^>/iu^Â rijpcn^, "î;'!^^ 
dmtţ^rti^^n^fmt^Siigîtw tîxr't ^ 


den^ammenim'f'^f neck^akterihuşj, Morqiiidmimtoîpm . 

^ *: xi Nampuîmofoloexcreamfefe cs« 

tiXCreat COropaaa . _j^ ^j^ ^1^^ incauitacibus maie. 

iague V4ri| 
coioies , va* 



Digitized by 


11?» ^ua? ^pinpaâ:* eft, quia i caacşpto «ajore incraflâta v 
Periculam feptima aut nona <iie inftat ^"™ peraca« 

^ a * tus fit moc- 

lîus, ^jmftatim^cttcmos.habeţlalîpresjoderiterijue adfinem 

mouetur: nam âcalidapendet materîajafficiiurquepars Cordi 

contigua, cuius iaiic oificio vitac^ere jjequit : Pultno ctenim 

vfas&S <^9r^işilabcllum€ft, fine<-ui«sfamulaţu, eypfUgio fiiffocari 

£cM. ""^ «ecdieiiabe^ard igkuraottam^emanfitdioai Jiic morbuK 

oam poftquara pluries ab humorum iarcina frufta fe ii natura; 

expedire contenderit, fatifcit demum virtus, &: a,b omni opef 

rede.fiiieflSjvitalis&cuIaşmdxiufacatur*. _,," ' 

XIX. H«cautcmprQptereafîunt.CumjnPuImoiiesfia- 
xerkexcapîteper^uttur, & aortas appelîatas , Pul» 

- mo tanquam natura rarus & iic^iiis^trahit m fe humo- 

rem qaamam cius capere poceft , ,&: ybi influxerit, 
maior fit :^ M quiieţn ia TOtum%x§oiţ*-5J£Ef«raira$ 
CjUsmaîCT rcdditâ >vtrumqtielatuscoadngit , & Pe^ 
lipneuînonîani , peîmonis appelhmm motbam , fa* 
cit : Cam vefoaitefuairanaiai , pleurkis, ideii, £o, 
ftalismorbttsSt- . 

^liEe ex&perîorî commcnîatione ficis elucidata tem^ 
XI fest .. lilud tantum aiiQotandum eft A<>/»7>U guamuis 
orta, intetuincorp^vitdemdcuehitipixitum, vitalemquc 
caloism fyftole, & diaftokaaenipcrat ,<uiusn,Gnpauc« pro, 
AottâetiG^ fvaaines in iffimipulxttCHieraidifleniiasfflturi' Hic tamcn pro 
SlfeX "f^^^i^^S^ccipieiidum dl, qu« eartilagineas, £ftiilo&fque di. 
eoriuvenai uancâKonesm viiiuerfiimpulmoneBi tranfmitKBS , flacd- 
TracSfrt f^^ ^"^ futftântiamfuket, totumque ampCs cimiculis mea- 
r"S° ^'7^^_^*^*^"- ^«''-has igicur^ecairroiteiiuxioncliaua V€ruia 
^- tm - ejfipelas, vel pidegmoHem in propofito peculiarique hoc ' 
afleau excitâri, ^ffuâocblleaaquc bile ifl.P«ImoQ«m pori>iî. 
taubus, ^redendam eft; fed filulisijs cxpktis Pulmones quo- 
dammedo mmQiefcere,moIefta^iie adlaaiîone , effiicationc 

Oigitized by 


qite >lâteî^ mâlc afKcere > ac phîogofim â coar<Sbfl:a mnctU 
coîiccptam impertirî ^ indeque dolorcm excitări fetcndum • 

XX, Perîpneumonîa multo perkulofîor eft , & doîores 
multofortiores funt , qui ad laterum mollimdinem , 
& ad clameulas tcnâmxt , & lîngua raulto^ viridior & 
paiîidior r & faficcspr^ fluxîone dofent ^ & laffitudo 
£onis ocgupacj & Ipiritus fexta aut fepxima die cor- 

EX qualibet Peripneumoma maius inftat ăiknmen, quacs 
PIeuritide,cum inillaafficianţurPd^ 
Sîiffimi>quorum riiunuş ad vitam omfâindneceffarium effihsEC ^Pf^^^^i^ic- 
veraper iHâ pferumq^inrerimere foîeat/Peculiantertamenid pi^Sl^ 
verum eft in ea Petipaeumonise fpecie> quam hic haSesas ex^ ^^• 
piicuimusrcum no aliter diiFeracâ Pleuritide^quam fecundum 
magis & mitius.Nam ob maiGtem irruetis materia redundam 
tiam, partiiq; âflfeâ^ maiorem difpoiitioncm, totum occup^ 
Pulmonem; Pletirids v^ro alteram partem, vt iam cxplicauinj 
foitv Maic^ pqr^ceM inie dolor lîon modointeniîue ob 
maioretrrin laceribas comprdîîo^eîiî>verum etiam extenfiu^ 
namad^ixaâiqîieckaicaîam, adrtraque hypochondria c^ 
, tendimr.Linguaâbilc'i eiufqucfiiliginibus defedata magis 
apparet • copioiîor- eisîm in hac redundat materia . Fauces 
autemâdecumbentehumoredokntes, calidsBfliDdonis na* 
mram , & trafîfiîiitcentem partem vnâ atreftantur . Acc^duiît La^ 
înfupcr laffitudines , hoc eft ^ fe fe mouendi impotentia cum ^i&f^^ 
vIcerationi^feBfii ob bilioiam cacochymiam,qu^ad corporîs b^^ 
compagem exprimitur in i js , qui a bdiofa fluxione infeâai^, ^^^- 
fignificct, quamhumorum, fpirituumque in pambus con- 
fumpiio ob coardatum in pulmonibus ipiritum , validaquc 
thoracis concuffio parit , Sexta demum y aut fepiima die cor- 
difiîcilis , ex adaudo vfu, impeditifque inilrumencis , ne libe. 
rcpoŞntfi:iggidoaererepleri,acqueto4gmesexcluder€:^.sy^^ Spkimsfun. 
f4âiemm> iimplîciceritaprolacum, ipirandidiincuhatemnon^^^^^^^^p^^ 
V ' raro 

Digitized by 


^aîtt llgaificaje apudHippocratem j probat Galenus Iib.3 .r ^ 

^^fc^t'-&t£.tSpiv.c,n.ex4, epi<i. x nuikoque laţius Fcefiu&ju OecQ- 

doqttci^gni-'j^om. Cenfendura aucem eft â primis ctiam morbi diebusJ^- 

'^"'' ifaai hanc fpiratioiiem adfuifle ; pectaîiark«rîamen în lexta aut 

Icpdmadic£hJS;mcminit»<3uia£imc, cuminorbusiQ maxi- 

;ino£ft iiicremtnţo , vel fommo yigoţea ita vt aoQ longeabfjt 

iataHs dieş:, indpit quâm maxime, yrgere * ^ 

Huncfînon fepîîina die feîjrîs ditnîferit , mori- 
tur , aut fuffocatur*, aut vrrumque . Si vero nona dic, 
duabus diebus înterpofitis, corrîpiat, vtpiurîmum 
etiam hic aut morîtur , aut fuppurat us eiiadit . Si verq 
duodedaia diej fuppuratusfit. Si quarta& deciţna, 



Xpedîtus a diagţtofî ,mquâ mmraoi^ cauj&ş , &,%^ 

^j^^^ thoracid huius afeâus ample profecutus eft; iam ad pro- 

gaofim 3u:cedit : qu^ ^um ^ueutu^ tempore, & modo cam* 

prehendamr;per.h^c omnia oracioBeaidcduck, viuâos recen- 

fe|îS.periodQ5^ia qnibusaffeelioii^cautadialuEemxermina-. 

xij tfuimphantenaturai^utperimete, ^adem iatifc^nte; aut 

^iemumin Empyema 4:ran&nutari, media quadatn yh uitcr 

omaimodam laliîtem acque intedtum> longa obferuatioue 

coc^nouerat : Nam tthhic morbus peracutus fit, atque intra 

piimum iepti^pariuin fe fe :plcrumque€xpfiLdire xonfueuit:: 

i^Mfâsn-* nihilomiaH^^ ¥t:promlitEb.î*^demorb.^^ liffert corpus a cor- ^^x.iu 

S^li£^ W^> Aetnsăk^tzUy^ffiPno^a^^^ &tmpusÂtempere,in 

.rcntiaimox- .mdO^arotămTmi : if ălî^ THamem tdlerantimn in morhishahmt^ 

bis^^oUeran- ^^^^^^^ ad tolkranâum impotentes -ţroinde xertitudo exaBjZ 

împms > m quo psreunU nonep^ an£9 an kngitmfutuTumjit * 

iimc:2.aph»i9 Acnioxnm morbommiion omniao tutas effc 

Cdf. rib/2. p^oauiKiadonesfaludSj & BiortispronumciaQît, U^ 

•câp.5. init- ^ ^ î;eile Cclfo >în inagnis jmaîis nuIIamiBaioieem fpem elfe >. 

quam yjt impemm morbi trakerijda 'aîiqais effugiat > porriga* 

turqi4£inidîcmpiis 5 quodcurationilociimprseftet. Qu^od ; 

exitioiiiiîmoiiocinmorbopeculiariterYidcreeft, ia quoE 

Digitized by 


Aegei: ydiais oaairs -s'iribîis , ampdifqae partium me^tifeus , 
leipiraţiofli dicaţju:um.,pâmam morfai van âu<ia£, fîatim i»- 
£ipitaliqua faluris fpes affulgere , Ynde 5. <ie morb. Qai* 
sa-îi. flâtimjţuta -oarda [unt , ifdohres vaUeacuti'^UtertiaMeviO' 
rîmtvr; Ham autm tranf^rejji,fănsfcuut . : Qm^ero fanus nan. 
fit fytma y autmom * auî âedim l hic-ţ^purari mciţît . Mej. 
JUmefiatitem fuţpuriLtmt fieaiieUaa^iohr&fimfttypiimsemi^ 
leţbalee^. 'Peîoitita.qus 

nmcfi son feptimaiHe fdsrîs dimiferit. Pf''''^'seH- 

rummquatto laktaribusjggBis, quibus namram fupra mor- 
bumimdcCceve fignificatur, mirig^a km morbi feuitietum 
medicisauxilijs yţtjmpepâfeiQ; prjeparataq; macenaadexpui-. 
fiofie, qu£ poftmodum liberali ânacatbarfi,validâq; expei^o- 
rationeper os e3w7>urgemr, vtdeindeexpiarisipiritalibusvijs 
ab inM^.ixmnextnmxis fabarra, expirantur fuligincs, ac 
feiggidior libere infpiratur aura, qua exffiuaacem cor<iisca. 
îorem atccmpeftos ,£tbitm exdnguit , fpidiibufcjî recr^andis 
©ppormnicatem pj^bct- 
Moritur.'^-*^'^,^^**^"^^^'^^ â febrms'=caioiis viV ncc 
• non â pulmonuin inceodic, radicale in cordc 
fcumiduin peaiius exiîccante . 

Aut fuffocatur* "^^^°*™a™ anheîitusdifficuîcatem de- 
* duciturâiialiginumproiienm.,qu2ne- 
<îiieun£es per «acbeam excludi, prajpeditis vijs â gîudnofa bi. 
tiofaq^- materia, qu^ cuniculatas pulmoaum caiutates occu- 
pat,naturalem obruunc incordecaîorem. Hinc fuprâ dixit 
feptima die fpiricum corripere: tiic eiiim adeo imialeicitmor' 
bus , vz ia maxima aiiheiitus diifiailtace ietineatur Ae^er, nifi 
peniiuse medio tollatur. o 

^ tur^&diilipatisipiritibus^cxtinctoqî 


Si yeroaona dlc^duobusdiebus înterpofîtîs corrî'- 
pianfebris, videlicec,fedata in feptimo, mnonoxurliisiiv» 
candefcat^raorbi nieterianeqsomnino edonuta^ncascuacuata» 

JBb. Vi 

Digitized by 


> \^plurîmum etiam hîCyâatroorîturj aut fappii^ 

ratUS euadit . y^y^i^i^ dimfent, vel cum dimipjfe fuUtur 


itmm makfcerevideatur. nequit enim natura tam breui tem- 

pore vires rcaiTumere > itâ vt morbi vim iterum ferrc valeat • 

At fi vires coaftenţ^ fuppuratus euadit ; mutuis videlicet moc- 

bi, naturjq^ conatibusi haccamen pr^ualente. Notum cft ii- 

lud in Coacis , & in prognofticis. Dolmfica thoradcarumţ^rtm ^^^^"^ 

Idem habet ^^'4^A^^ non quicfcutit neţy expurgatione Iputi^nec fangmnis detra-* 

Geif. lib.a. Biom , Tîeque ph armada jimuly at^ue di^^tayinjtippuraţicnem ver^^ 

^^^^* tmtur. Cuius tranfmuationis iîgna func ex prognoiî citata, 

incenfîor febris, rigor> n^c nonpro dolore> quiprius aderat, 

pondus quoddam «yrauatiuum laceri fcnfeu fuperueniens: 

Aph. 4% ^^^^^ ydum ţus cor^tur yfehres ^ dolorss fiunt^ tune tem* 

fcc.2. poris ipfi morbo maxime reluâance natura > cui fpiricus com-i 

£c^rcm plurimi fuppetias ferunt,â quibus pars phîegmone obfefifa 

febrcs&do magis magifq: diftcndituratqueincsJefciţrHincxfolor &fe^ 

orcs am. j^^sjacceditq; rigorobpuris acredinem membranas velli- 

cantem , quod anteâ in poris diiperfum, paulatim in vomicaî 

iînum deinde coUeCium , ponderis {cnîiim inuchit in vera po- 

idiSmiim inflamraatione • 

si vcro duodecima die/uppuratus fit ..P°^^^^^^^^^ 

rum interfiitîo îta roborarinatura^^, vt turum fere reddat â 

morte^ ac nifi â rccidiua ftatim penitufqi vindicat 6b dade , 

quam paulo prius perpcflfa cft , noxiam faltem materiam^ licet 

relucaanteprseternaturaîi calote, in pus vertat, ac tune asger 

Suppurati dicctur fuppuratus : Nam hoc nomen , etfi anthonomaâice 

^Wy.^aph. deijsproprie dicatur^quibus in thoracis cauitatcpuscoUe-. 

44-2C 5>aph» ^uq^ eft , ex Gaîeni tamen fententia Purulenţi , feu fupputati 

37. appellantur quicunque pus habenc intus in corpore, fiuc ad» 

huc in parte phlegmonc obfcflfa contineacur,fîue ab ea in 

maiorem aliquam cauicaccm eruperit.Qu£E quidem ccleris ad 

faniem tranfmutatio in nona, aut duodccima die in morbo 

âcutiffimo, magnam caloris vehementiam, morbificiquehu* 

meris promptitudinem ofteadit ; cum diâs exaphor. 58» ^ 

kâ»y. difiilaţioms invmtrem Ju^m^emintrâ dies vipnti Jk]^ 

Digitized by 


mM-mitfMiiii m^stf!]&tys^ / i ^5 

Siquar,a&dcci,«.,lânusft. ^^^£'^„^^=7^ 

qaod natura integro,quo conquieuît , feptenario ^ tantum vi. 
rium coUigere potuit, vt vna vd alcerafelxre, qiîicquidnoxias 
niareriei fiîpererat, non modo fuppurare^v^mmf3^urg^ 
aSolvicxtqi valeat : in diepr^fertim , qu^ piaxîme iudicato- 
ria eft , acutpromq; morbonim terminus pra^cipuus * Qu^ 
cmnia non ita Fata,cenaq; exeftimemu^, quin fecus quandoq; 
accidere poiîît; fed quod ex îonga Afcîepiâdum obicmadonc^ 
fie n plurinaum euenire compertum fir . 

XXII. Ecqmcunqucf>f«perîpii€0momây âutPîeîîritide ^^ 
fapbaratî fiunt , non moriunmr > kâ fant fiuiit • ^-^Sf^Itt 

*^*' / -i: y. ': . . . [ mocia Ăr 

PRopofitioni huic nonnuU^e videnmr eiufilcm Hippocra- ^^^o^ 
^ tif authoricates adueriari î quippe qui Iib. de affeâion, , ^- 

' ita abfolutc fanciuit . în morhis timakerdteri facadit , ple^ c^^^"^ 
nmu^^scddit : cum mimc^m^Ă prkjhîtimorio ddilitatP alius ^^ ^^J^ 
marhns accefferiţ ,ţra imiedUi^aU ţerit priuj^iam dt&r morhus» * ^^ 
j^i». qm^flerior acc^t, defmat* Et lib. i^ de morb.fijppuratos er 
Peripneuîrioaia finegOgantur^ tabem atqpe iiîterimm 
^em deduci affirnumit; Vnde&apiu 15. ie^ 5. Qmamqtie 
tx Fleuritid^ JvţţwraSi funî yfimquaâra^îA diSus repurgati 
fuerintah€adie»^aruptwfaSafuerit,khera^ ţ^f^^^^ i 

Coac, adMhemtrmfemit*Sc'mCozcMtcuon2*2iognJB^ mojua ic* 

»u.|-ia â-pttlmoaisiiiftammationefeiuoresm;^^^^ ^^^l 

Sogl tem fiippuradonibus itmiorcs magis perimi voliiit. Ex qiiibus iuucues ma 
»^**^- authoritatibus fatis liquet fuppjuxatis pra: Peripneumoma & f^ ««^ 
Pleuridde &tale pariter cxitiumominari,cona:âid>qiiod ia : 
pt^ientitextudcceriiitur^ Venim pjoftremishifceaiuhorita. 
tibus fatis ^rit fi diomus idipfum > quodiam iiipta inimimus, 
&liaîic Iciiicet aflertionern e;K i jscflc , qxix vt piutiinum veii- ^ 
iîcamur^ acque indefieii, quomimis > fi quamlo hjc fepp^^^ 
tio vd ne^igatur> vel iniubieâo fit prgimbeciili^ad inccritum 

i " Bb 2 cxi^ 

Digitized by 


Moîbus adueaire pofFejprimo quide ger fupera<iditionem,g*^>'sV5ir;/» 
'li^^rci tv Gr^ ci voeant > ho c eft , faperocnientiam j quod fît cum alte- 
miucmi . ra adhuc maneaţe morbo , aîtcr adijcitur : idque tnorbi ma» 

fe^per ma- & i^* scproiii^eiemper maIa:J^eBd€tiîam<^ â iporfjific^e^ 

"^ • terociîqHemateri;a?:a^ adpluresparceş^pdera 

propgatui' tempore i, atque difiunditur ; m iy^^ morbum; 

' Meta^ois procreac . SecuîKloiBodo per MerfitVîft»^^ leu tranliuutâţio-. 
nemj 4ura£cilkexpxi quod 

conringit cx Ms7^V^4> feui^moiuai ad aiium îocura ţran^ 
mifîîoae ; fiue tranfmiffia hxc ex vi morbi > tcî potius,*mor-« 
t^ei hini^# ^rgsfeo^ a^q^ mqukmdipe fiat ; ik^ a^xiamra 
.^ fiuâenteK^xsdqmâpotion pm^ 

ab vtracpe caitfa ; materia icilicec^nondunifirmâtaj&a^nâ^^^ 
;; turaespe&pîi[:Qiiânte£dDcqpoIâ^ 
' - iît cekbcmmiis vkSteph^asR0dcriciîsCa& 

Io QuaeexquibMs * Dicendum iotque eiVHipppcraţcm e<^. 
Î0Ci .lQ€Utuiî> ikifle de aduenientibiis^ ex vi momi, qui mt 

., '- pciores iiînt>'aiita?qiie maH; Bonaiitem;4ei^^ 

aps? perniciofî ^xiflunt ^ ^ â namra Sunt ^pr^uateim > coa. 
ca tta^ iam aliquatemis noxia materia > ; eamqiic^d i^K>l^ 
îiores partes. deponente : -itautper^^/^^itrr/r: feiit abfcraum ,. 
oacioifimo defuijgatur morbo . Huitrfmodi efl; fuppura* 
^ tjo pOiî peripneumoniain , pletiritîdemtie^ Nmilâ^am- 
qije^cum mequiucrit ikiiiiSmos bo&e afeâ^ 

tm iiidma^> i^^ue YaJida fe>i mediam iBter m 
sapparatîb omi^xx^zva ialiitem inklviam> ad fappuracionem deducenş, 
îumq^^aă q^f ^«^^a^vtplirrimi^^ e&conf^ 
nc^iigatur . ^ ikm di^tum fiiit , fit a natura rede operajxte : vtqae babe-» 

' mpi^r4;ammfi^ ^.câfceffus , Exquoetigaa ş.. 

îuueaes cor prog. CX eîBpycis^quî^xpulmaiiis morbis tales fiunt, iuaio*^ 

cîitanmr in ^^^ minuspericuun alferici^îiorum namq; robuf ma^ cu $: 

%puiatŢo- ita vtJaoamodb coquereacliippuiai:epods&>yerum<;tiani 

-> - ^xpellere. 

Digitized by 


expellere > i^quc integre expectorate • Qusb fuppuratio eo 
vtiquetutior eftinperipneumoma, dequa peculiariter hm 
a^itur, qu3E fcilicet â nullopendet puîmQnumphIegmene; 
quod , cum morbificus humor connneaturmagna ex parce > 
non in pulmonutn fubftantia > & poroficaubus, fed in broa- 
chijs; facile poterii per os educi integra remaaente pulmo^ 
numfubftanciaj cuius lacerationem vicus Se tabes irrepârabi-i 
Eter fercfequi; certiflimum eft» 

ixm. Suppurati vt pîunmum fiuntcum fluxas in îâcm 
^elut in Bile contingît;fed in Bile quidem mukum de-^ 
flaitr & vbi dcfluît > fedatur . Suppuratis vcro minus 
defluk > & nonfedatur \ 

E fuppuratîone fcrio hic agere aggreditur , cum & Ii^c ^^^^^ 

pariterafFe6tioâriieumatenon raro procreări foîeat^ sus mms^. 

€tli ab aiijs caufisfrequenrius iortaffe excicetur . Ea namque 
primigenia interdum efl: , dum videlicet fuperuacaneihumo- supparatio 
res â cerebro defcendentes» inque pulmoaum cauitaabus col- î^tciâuin^ 
kCii> coardatique, asaturak, prsecematuraLque caiorem iDiexdu^io 
pus immHtantur ^abfquc eo quod in fubftantia porolitatibus J^'^^fjţ; 
infarâi>phegmonofumtumorem prius procreauermt ; vc iUnca câ» 
£ext.4ilib. huius adaotatum eft. Interdum vero aliorum mor- 
^ borum eft confcâraneaj pută tromatum, vel vifeeru phymatis 
Vt AnginSE , Pleuritidis > Peripneumonise , cseterorumque hu-r 
ius «^eneris > dum morbifica eorum materia neque â natura 
nequc â medicrs auxiîijs cxhauriri penitus>diffoluique potuit^ 
Quaproptcr nifi primis morbi dicbus ^Eger obiuerit;» ii natu- 
ralis facultas valida fir^ in pus eam excoquit: mdmsfiquidem efl, 
3^2î, vt mquiiHiff.^. de moih.,Suppuratatu^ fieri, etiamfîdolch tJbM^^ 
r^fumfj^mimsemmUthde^lnhdLCzutcm traalmutatione ctii doior©. 
varia tem porum momenta veniunt expendenda i immuta- "^^^ 
tionisfcilicetprincipium , nec non tuberculi lupcio , dum suppuiati^ 
ipfum pus acriusredditum > tumentem particulara exedit^ po^T^^^ 
fternicqiubi it€r> vt in ampliorem deinde iiuercapedinem cU 
fu^datur ♦ C^od vcique vel citius vel lerius eueait > vt docet 




Digitized by 


GaL2.prog.t. 57«proafF€ttefedîs, moirbofîque humoris 

diftercntiar . Sedes namque cdiâior Mmoltior y citius Juppuratur $ 

fTigpdior veri acdurior, îardius. Itidemexhummhus calidior 

'^ ^^ ^ fi^ii^^^ /^^rJ^W • H^ quidem Jectmdum rei Juhjiatu» 

dS^iuppuI ti^sm differentU fimî . Fcţrro accedunî ţxtrinjecus e^ ^ qu^ah 

itamr . ^ţ^^ ducuntur , natura , tempore^ re^otmm conditiom &£ virilus 

Aegri* înomnihushis caHdus humor dtiuSyfriggiius îarâiusfiiţ* 

piratur^Hxc Gaîenus : Vnde Mippocr^s 2* progn. ji/f^jw<- ^^ 

riseruptimesjiunîy if phrim^ quidâtn , die vigejmai qu^dam 

vcvQ îrigejima , qu^edam quadragejtma , qu^dam âutem adfexa^ 

gipmum dum ţ^rueniunî . Qux tempora enumcranda funt â 

prima die s inqiiahumorc^pitinpusvcrti, vtpateţ inpro- aii.i^* 

gnoiî 58. lib. 2. vfai tranfmutationis huius fîgna recenfentur • 

Confiderareautemoportet, inqnit ^ţrincipiutn Jl^puratimisf^^ 

su^ptirâtio- ratiocinatites â prima die, quahomofehricitauit^p^uando rigor 

^^^^^ frimumipfimprSendit, Sfidixerit inparte,qu^d^îorevexa' 

haîur, pro doîorefmdere îpjumgrmiari^ h^cenim inprincipys 

jhmt fi^purationum ^ <^oă. vt plurmium decimaquarta dk 

accidere fittendum eft ex aph*8-fec« 5 • Qiţktmquemorh latera^ 

U lahora^es in quatuorâectmdiebus non repurgamtur , y adju^^'^ 

. rationem vertuntur . C^rerum cum h^cpuris generatio ia 

f J2^^ omnibus turn mtttms, turn cxternis pambus cdebrari poffit, 

fuppuăti^amen nomine ij tantamodo digaaiitur , quibus i^^ 

in inferiore , aut in fuperiore ventrc , aut in ipfîs pulmonibus 

Gal. conw contin^k, vtdocet idem Hipp* !♦ de morb.> fedprarcipue iu ^^^• ^^ 

tc)^^^^ /uperiore > thorace videlicet : atque , vt ex Gaîcno alias fîo* 

bis annotamm eft^ purulenţi appcHantur quicunquc pusha- 

fcent imiis in corpare , fîue adhuc contiacatuţ iaipfopiileg- 

mone, fiu^epoftemptionem: ij tamen^c potiffimura nun- 

cupsntiîr , qui in thorace & pulmone huiufmodi affeâionera; 

habcnt; anthonomaftice vero quibus inter thoraccm atquc 

pulmonem puscoacematum efl: Jlc nifi â pure quamprimum 

Exfuppi^a^ ij expientur> tabidi tandem euaduntiuxtâ apho. 15. fee. 5., 

tis îâiiKU- Quictmqne d ţleuritide Jiippurati fiunt, Jtin qmdraginta Jiebus. 

. repurgati fnerint al ea die , qm ruptiofaBafuerit ,liherantur ;fi 

^ero non , ad îdbem tranfenTvt . In prasfenti itaque contextu va* 

rias iacipit ^explicare rationes, quibus fuppurationcm cx ce*. 





rebralifluxionc > vel alijs ex morbîs fieri contîngît . Modum 

autemhicâiFert> qui maxime > vt ipfecUck, confuetuseft, 

dum videlicet rheuma fertur quidcmin eundemiocum, in sup^urano 

Quem ferri diiHmus biliofum fiuxum, nuper defcriptum > Pe- exFinxioac 
• ' ». nî -.-J . ^ , ^ . cerebrali. 

ripaeumomam , oc Pleuriudem excitantem > m pulmones 

nempe; Hâc tamendifFerentiâ, quod iile copiofus crac, ita vt 
totum ferevifcusillud expierec, eleuaretque in tumorem ^ 
vnde fie adauâum , thoracem violentiiis tangendo Isedebat, 
excitabatque dolorem ; quse vtique accidencia fedabanmr &• 
daca fluxione : hac enim deficiente > Pulmones iliico decu- 
mefccrcincipiunc, eo quod materia, quas iam colIe6laerât> 
partimexpurgaiur, partim excoquitur &: iuppuratur> minus 
proinde Isedit} ex quo morbusin dies magis micigari perei» 
pitur. Secusautem acciditinhacfuppurationisfpecic> quat 
primigeaiaeft , nequealium prsecedentem inchoraccmor- 
bum fequicurj nam minus materiei defluic, proindeque noa 
poteft ad excremasarperas arterias propagines permeare , neq; 
pulmones nimium explendo augere; ied lacenter 8c tacite pri- 
mo delabitur, nuUo excitato vehementiori fympthomatej 
neque ipfamet cuiîî ad noxi j bumoris expuIiîoQem > nifî valde 
ieui • Poftquam vero fluxio {cdătz eft , tune non modo noa 
fedâtur affeâio > fed maiora potius incipiunc cmergere accl^ 
dentia: namms^eriaillaconclufa, neque âperenni flimone 
rt prius fubinde refrigerata , incandefcit , inque pus paulatim 
tranfmucatur, &inde fit empyenfia : Mflillationes enim , ex 7. 
aph* 3 8, i» 'omtrem Jiiperiorem intra dies viginti Juppurantur > 
fiue>vthabeturlib. uâQmorh.yputreJcunt maxime dichus w- 
pntiimum. Neque aliam ob caufam cenfeo cafumhunc alijs 
effe frequentiorem^ nifî quod, cum latcnterfiat, ita vt nul- Corfappu- 
lumfignumdefe prasbeatabinitios facîllimenegligicur, &^oac^'^l^ 
ferenunquam impeditur, quominus adfuppuracionem de-.^*^«^^^^* 
ueniat • 

KiY. Fiunt ctîam fuppuratî, cum minus cxcreant, quam f^^lt 
înfluîtinPuImonem: Hoc enim> quod ioPuimone*'''^' 
confiftît j 8c quod influît , pus fit . Pus in Pulmone> & 
inThoraccconfîftenSj ac congregatum , vicerac & 


Digitized by 


200 HIPPOeS^TK IIB. lî; 3?£ LOC. W HOM. 

■putrefach» &poft quâm cxylceratafuerintj abvî- 
■cerato infiuit;& cum excreatj caput fîmul conculTum 
îîiagisfluît, fimuique€xvlcerâtointfaorace,acpui- 
flione , mzgis^mt j & vîcera agitata refringuntur: vc 
fitfî^uxus â capke cefifet , is, qui ab ipfîs viceabus 
yenic j luffidens iit morb«m:fecere . 


iEc fupptîtâtîoms fpecies non aîitcr â prf cedentî difTcrts 

quâm quodâ maiori fit macerias prouentu;qu2e deor- 

fumad^ofdemdeîapfa piilmones , vel tuffim , vel afthma^ 
vei aliumleuiorem ajffeâum cunc primo ibi eKcicare creden- 
dum c&: Quod fi diti perfeue^et^ac non fatis per anacarharfim 
expurgetur ; quod fupcîeft , bronchiorum lateribus afExu m , 
in pus vcrticur . Hoc nouam ddndc aduenientem materiam 
inpuruîentam ac iimilem vercit fiibftanciam, magifque in- 
dies â concepte calore acre redditum > pulmones demum 
exedito vîcerat<yie • Hîac affeâuum ineuitabilis circulâcio^^ 
dum cau&vicem inter fegerunr^mtitudquefoiaentur atquc 
J^^M^!?'^ exacerianmr : iiam pus ex vicercperpetuo , neceiTaridque 
^uiaiio^icf emanat , cum Bequcar^iâucia pars ac proinde imbecililor red-i 
dita , âduenicns alimentum perfc6le «coquere ; fibique affi^ 
miJare : quapropter complura gignat cxcrementa neeeffe efL 
qnx dum natura tuffi extra propellere nititur ^ concutiturca« 
put^ augetur fiuxio^ vicera in pulmonibus refricantur^ «x qua 
phthifium iîicurabilitas prouenit ^ vtnotâuit.etiam Galen.5« 
Kieth. cap. 8. Subditque quamui^ cerebraîis fluxio ceflcc t 
fiippurationem haud proinde penitus ccffaturam>cum vicus 
ipfum aiîiduc nouum producere pus natum fit , & empyema 
fouer^ -« 


suppuratio ^ ^ ^^ pt^tctcz ctiâm ab vicere fuppuratus > & Jeuîor 

1^^*^^^^^- Mc morbus esiftît* 

NE^ quîs putaret foppuratîoncs a fluxîonîbus tantummo- 
do procreări , quod de hîs hic potiffimum agatur;obiter 
mmcfubdir;» prster rationes fupra enarratas,feietiam aî> yî* 


Digitized by 




c^efuppuratum: Nam onHie^ fere Empyemaci^caiife^d tria 
genera videntur ab Hippoerate reuocari , ad iîiixiones nenipe; t^HtTzâ 
adchoradcarumpa^tiuniphI^giiiGnofasaifeâio£ie§; adlolu* î^^^^genfra 
donem continui. Deduobusprimishadenus.diciumeftsDe ^"^'^^^'^^ 
tertionunc agitur fiib vkerisnoinine,v& quartaproponitur 
fiippurationis dilFerencîa • Quod autem ehxk^idtăiylcm vkus apud 
Hippocrati omnera comprehendat continui folutionera , ea ^f^*^^ 
excepta^ quse £tin oile siîuefiatab interna caitfa erodente, -%m£c-^i. 
q\xod v^re ptoprieque vkiis că; iîue ab externa vi;,vt q«^ vul- 
nera peculiariter I-atinis, Gr^cis V€x6r^c^iA><trA nacupaiitursfâ- 
tis fuperqiteftatur liber ^e/^/ gAxa'K, hoc eft, de vlceritus* ^~^ 
mfcriptus , vbi tam de -vic^ribus , quâm de vulneribus agitur ; 
probatq; ex locis conipîuribusFoef. ia Oecon.Atcum de ve* 
to ylceris , quatenus empy ematis caufa e/îe potefi, in fuperio- 
ri cgerit contextu i hic de vulnere , aîijfq> ab externa yi proue- 
nientibus calamitatibus, quas lib. i. de morb* lateprofequi, 
ttîr^quatenus videlicet eandem fuppuratiosem părere poflknt, 
agere par efl: . Ha? fiquidem , fiue rupciones iînt , fiue vulnera, 
vel contuiîones, modo adiatimiorespertineantpartesj ada^ 
pertis vâfîs^ fanguinem in cauitates emindunî, qui, niftatim 
pervulneris os > vel perTracheam expurgetur> aur congruis 
eluatur auxilijs , ad quod muUk penetranţi ia vulnere vti ple- 
rumq; folemus , grnmefcit primo , (fiue idâat dbfiî^as^ vt s^pth tx- 
voluit Ariâot, 3 . de bift. an. cap* 15?., fiue ob fpiritus euanc^ ^^^^f^' 
fcentes &calorem>â quibus fîuxilis intra veiias feruabatur; * 
fiue ob pinguediaemj quas frigidioremîocum nâcla> concre- 
fcit;fiue id omne a naturali , pecuîiariq; venarum virtute 
proueniat , quse vnse cum cordis ventriculis ^ cerebriq; lacuna ; 

fluxilem ieruare fanguineni natf funţ)deindeputref<^t ne<;eflc 
eft i iuxta aph. 2 o. fee. 6* Si in cas^^aicm^^^s ţfM^ matU" 
ram effufvts efl , necejji ^Juppurari , Suppuratus vero vifcera 
exedendo Isdit 5 adq; tabem poiiremo deducit. Pe<uJiari ta- 
men ratione penetram ihoracis vulnus ^ niiî apce ci^e tur, em-» 
pyemaîis caută exiftit> vt docet Hippoc. lib. citato de morbis 
lib- 1» P^^ bsec verba . Quicun^ue â vnlnerihis Jiij^nrati Jhmt y mft ex 
fttt,2^. h^Jia , mt pîigione t ajit iaculo intro fauciati'^dri^^^^ ' ' 

^nidem bahuerit vlcus rejpratim^m firas fer £mHquimi t^ilnns ^ 

Ce ^hAQ 

Digitized by 



^hac parte frîggidmn în feifCum dââticit ^ caliâitmâ fe îpjo 

hac pcLTte emittit 9 1^ pine facile turn pus ^ turn fi quid efi alina 

expiirgâtuT . Et fi^uidein if. interna pars > ^ externa fimul fite^ 

rint fanate yfanus pmituş homo euadit . Si 'vero externa qiddem 

fanată fkerit , interna vero non jfuppuratus fit . Et fi etiamfa-* 

natâe fimul fint , ^ interna^ ^ externa pars ; cicatrix autem intm 

dehilis fiat , ^ a(pera ^ liuida ; rsulceratur quando^uey ac ficfiip-* 

puratus fit . Rurfîis exulceratur etiam fi^uid amplius lahoraritş 

^ fi attmuatus fuent p^ fi pituita attt Ulii ad cicaţricem affixa 

fierity iffi alîo morho correptus aîtmuatm fuerit^ ifc. Se in Coa* 

cis * Quip thoracevHÎneratOyexteriore^uidem parte Janejcunt^ 

interiore vero non^^t ne fuppurati fiant ^ periolitantur . At quibus 

interiore parte infirma cicatrix dtilîa efi ^ vulnus ea parte facilh 

refricatur rupta cicatrice ^^ivicizhxhtc Chirurgis prseceptum 

peneîî^i^ haurire faseftrvulneraad thoxacis cauitatem pertingentiacu-^ 

vuincm cu- racuri, Ulud in primis quserere dcbenc^ ne excerain parce coa. 

inde fuppu- l^f<^2Lnt > priufqua vulneris labia iiuus opdme coalaerinc; haud 

rado fuper- enim facilc vniuntur intimseillas partea 6b membranam , qu*e 

ucaur. ^^^- g fubtexitur ; eo magis y quod medica auxiîia non ^cpt 

bene ijs applicantur^ ex quo Rx^yt clauib exteriori vuineris ori- 

ficio '^ &quid Czniciin media >aiitindma vulneris parte o^i^mi* 

tur^intus ad cauitatem refundatur: pr^eterquam quod non. 

raro veldebiîis omnino cicatrix > vel falfa& apparcns ibi ob- 

ducitur ob exarefcentem faniem in cruftam verfam ; quce Icui 

quauis occafîone deinde excuticur, & vuinus recrudeicic: 

quod cum nequeat conceptum pusextra emkterejad cauita- 

tem effufum, Empyematis caufa exiftit.Has autem cx vulnere 

Bmpyemsu fuppUrationes BOU atiam 6b cau&mcgterisleuiores exifti* 

buJ^Tit niamus , nifîquSdpuImones âfluxione, vel pr^ecefTo aliqua 

moxn^ . phlegmone non dum^ vitiatos reperit , vnde validi cum (xxxt^ 

pus^attrahere , & excra pellere valide poterun t, vel calare diffi* 

pare ; pra^ter quam quod excernam vlceris cicaţricem exeden* 

do,f aspe ibepius jpfiimmet pus cxpedicum fiblviam parat • 

XXVI* l^t autenţextrapulmonemimâxime quidemâru- 
ptup^& vbicarocontulafucrit ^iuxtâim^^ cnim pus 

Digitized by 




congregaturj&congregatum fluduat fîquîs corpus 
€oncuuat,& ftrcpkumfacttî5: iiac vruntur . 

Dlximus fupra ex I. demorb. fuppuratîoiiesprocrearî & 
inferiori in ventre , & in %eriori , & in Ptiîmonibus ; 
mmpeculiariquaâamxaâDneinorbiliuiiis<apax€ftlîocvi- Pafaio fop. 
%s, qu6dpr« cîBtcris omnibusantrofmnfît:- quaproptcrin ^^^i. 
jpfoiaiî«Tncs puris colleaiones nonraro coafpiciunmr ; -ţx fuc că. 

Sed cumfuperidricontcxtu obiter dixeric Empyema^tjam a 
ATulneribus fieri, iure nune addit , fieri etiara extrapulraones: ^"^^ţf 
aam fîcur, qu§ â rbeumate gignuntur purulenti2,intrâ pulmo- bus ^-i- 
laesvtplurimumcoaraantur, itâqusâpenetrşncibus-vulne- ^ ' 
ribus , Taforum , vel pbymatum rupturis , tnodo ntiper expîi- 
cato , originem -ducunc , extra Piiimoncs , in ampla Thoracis 
cauitate .potiffimum fluduant , commotaeq; fonitmp nedunt; 
quamuis in vnoquoq; ex hislocis, tam in Abdomuie fcilicet, 
ouam inThorace,& Pulmombus fubcrcfcere poffit Empyerfla 
turn ex rheumate , tum ex comin^i folutionibus, turn cxpra- 
cedcntibus inflâmatorijs atfeSibus nonTite folutisivî iuculen- 
BU.10. ţer docet Hipp.lib. morb. ciţacojakeratanien caufa in al- 
teţa ex ijspartibus fepiusHic affeâupTodudt, 6b peculiarem 
Codiuone,quâ vnaquaq; €X ijs partibu$ feorfim babet;Thor^ 
ctepim externisîncurfîonibusmagis expofîtus jcftiPulmo vero 
fluxiones seper^excipere paratus; quâuis eas no seperTetineat; 
f^d ad tboracis'etiâ cauiţatemquandoq; pranfnaictac, vbi^ein- 
de pi}trcfcunr.ipfeq;e contra,iniiiagnis cîamoribtis, &in acri 
diftillationejcontinuifolutioiiemjtum in Tafîsjtum in propria : 

fubllantia^imerdum txperîtur. Atthoracicsbuiuspurulenţre ]^^? |a«- 
proprium auxilium^icit effe vftioncm:dum videîlcet tantaefl thonce -- 
purfs colluuies; vc nequc â natura refolui,neque per tracheam «"o^** 
faiis expurgări poffe intra quadragefimam diem, luxtaapho- 
rifmi decretum , fperaiidum fit j cuius rei indiciiun lumitur z 
in»«^a anhelituşdifficuitate, Tiragnam Ipiritalium partiuia 
ştic-uftiam atteftante j vtdocet GaL(î. apluzy., tuncvt ts££^ 
«mus ., vel manif^e euacucmus, adgenerofuai hoc_prsiir 
- ■ pd a dium 


Digitized by 



fîdium^ vel ad fcSionem quam citius properandum eft ; pr^.^ 

kmtckf^ cauendumque ne pus computrefcatj pulmones^ in praua 

4ibciida. iiluuie innatentes, corrumpantur , ccrebrum â putridis va^ 

poribus , furfum iugiter afcendentrbus, vitietur;» ac diftil- 

îationibus magis obnoxium reddatur , corpufqtie vniuerfum 

prauc nucritum ad vlrimam extenuatîonem^coîliquationemq; 

cum omnimoda virium iaâura^deueniatika vtvEger vei fuffli 

catusjvel tăbidus mifcre intereati vidcJket cumyftio in cafTum *^^^**^ 

adminiftraretur : quapropterinfoîaeeleritare totaialudsfpes *^^'"* 

repofîca eft, vt latius docuit Hipp.eodem primo de morbo & 

v&îG ^priâ ^^^^^*'^ &lib.5,epid. fec.y.^t. p. tahejcentes vrere flatim^ ^c» 

€& cwj^^^*^^ Quamuis autem feâio magis propria fie Hy dropicorum , ve« 

le^oHydro lut vitio Empyicorum,iuxcâ Galeni mente (5.aph. 27. , vtraqi 

pieormn. j^j^ien in fiipputatis* ad yfum reuocari poteft hzc animaducr- 

fione, quod vbi internarum thoracis parcium non magna ad« 

firputredo,nequepuris praua admodum rigeat conditio^ 

citaradimri ad vftioîi em audaî9:cr confugiemus ; quam duplici etiam ra- 
f ^^^Ss"^^' tione anciquiaisperactaminuenimus} nam quandoq; ftcrnum 
compliiribusinîocisfuperfîcietcmisinurebant j fcilicet cum 
lâfătisfuturuine^ Sympto matuni leuitate conie6iabântur, ad 
diuertendam , intercipiendum , eaque exficcanda y qux intiis 
in cauicate pt^ternaturaliter ftagnabant : ac tune fub mento ^ 
in iuguio , fub mammis , In omoplatis, aii bique, candenti fer» 
xoînurebant^ vlceraque adaperta feruabant donec tuffisdefi- 
ncret^ rt docent Celfus lib.3.cap.22. > & Pâuîus cap.44.f€xti 
Ebrf . Quod fi tanta erat praus ac purulenta? materi^e ybertas^ 
vt non nifi confoiFo therace y adapertaque in latere via expur- 
garipofleiperaretur ; tune locum elîgebanţ, xjui decîiuis quă- 
snaxime efTetj vt faciliorem inde exitnm fanies nancifccretur^^ 
Diaphragma ţamen a punCÎ:ione tu turn omîiino eflet > quo4 
coftarum extremitatibus fubtcnfum , anteriore quidem parte 
eleuatumeftjpofteriariverofpinamverfusdecliue , depref- 
fumque: ex quo fit, vt aptiffimus cenfeatur locus inter temam 
&quartamcoftam> vel inter quartam & quindam, ( ab in- 
fima enumemeineipientes,) vbi fcilicet ad pofteriora vergit;; 
eciiiciforio, candentique cultro â media duarum coftarum in- 


Digitized by 


COMMIîitJIinS ILLVSTRÂfVs: ' 205 : 

'tercapcttdine deorfum ad cauitatem vfque pcrforandumiEte- 
nim , fie vafa, qu2 vnicuiquecbftarumadhaîrent, euitabi- 
nuis . Quod tamen cautionibus ijs eft peragendum , quas 
îiippocrates luculenter retulit lib.î.& morb.fic in<yuens. |;*;^-*|; 
OfjM ^fljj^Mi îongius protrahitur , ijfehns -ziehemeru , ac tujps cor- ideinceps. 
ripit^iflatusdolet, ifod fanam partemdecumherenonţ<>tefi,Jed ^f^""^^, 
ad dolentem, if-pedes, ^ oculorum cauitates intumefimt .Huncvbt icncis . 
ăidmufyiMhts ah emptionUies aâeft , imita calidahtumin feU ^^^^^ ,,_ 
colkcato,ăaliusiuiâemmanusipfms teneat , tuvero humerum r«ţ.a^^ 
concutito , -vt audiasin -otrum lotus affeâio ^repitum edat: (opţan- ^'^, g^-_ 
ăumautem ejfet in finiflrumj . Hune i^tur locum feces; minus ^^^^^^r 
enimUthalisefi. SiveropracraŞtudine» ^ copia Jirepitum nm ^^^e^?^; 
edat ', quo ipfiimcogmfcerepoŞs ( nam hoc aliquande contingit) ^^^^ 
"Jtrumlatus tmtusrit', ac magis doluerit, hoc infims fecale retro biliipgs £- 
tumorcmmagisy quamanie ipfum,quoptms exitummagisfaah<i- ^^'^^IJ- 
remhaheat. Secatoauteminter cofiaspernouaculam primim attem, 
ârnidefialpello acuto , quodpannicuîoft Mgatum,itavîfmpna ^^^^ 
ip&is sars ad vnguis mapii digiti menjuram expedita rejiet , quam ^^^^ , a^. 
inmrmttăs . ycflea emijfopirem^ntHmviJkmfiimt , vuhus ex . ^^^^^^ 
linamentolind cmdo , dligAtoforaspropendmteplo,conchidiîo,& amefflueii- 
quotidiefmelpus educito : PojiqmmautemdecimusadfumtdieSj ;^'J^ţ^° 
omnipureemiffoy linammîum ex lintea indito, ddnde'otmm& ^"^^f^^^^ 
fy oleum tepefiOtaperfiftulam infundito,nepulmo tnpare hjmiBa^ fŞjiS?^! 
ri folitus , derepente reficcetur : Emittendum âutem efi idyquod mo- «»^^'J|^ 
jie infufum efi , ad vejperaw ; quod vefpere , mane . inc. Strepitus ^^^t. St 
verâ inthorace; ficuti duraaudkur, latitantis faniei certiffi- ^^^f^ 
miimeftinâkiutri, itâe contra j non quoties quid puruien^ fobcraenâ, 
tummeacauitatereconditur/taleaiiquidaudirineceffceft: ^^^-^^ 

vnde incoacis. Inter Empyicos , quihus concufftshummsmu,- p«euat.^a-. 
iusftprepitus ^parcius illipus habent, quâm quibus exiguus, modo p_ °^-i^'«- 
fpiretfadlius , &meUusjintcolorati. At qmhusneminimus qui- ^.^^^^ 
demrefertur,fedfirtis Mfpn^a, Umdiquevngues , plemftnt :Ut ^opi^âu^a 
ţitre , ac defp&rati. Puris ergo crairitics, & copiatotam expiens j,ctiathora. 
^u.„. cauitatcm, impedimentoeft, nedimoueatur , &ftrepitum ce 
&»8. edat ; Quaproptcr eodem 5 . de morb. ten:aEretnade,(ic di- 
aa,vd quod rubra effetivel quod ab EretnaVrbe prope Chal- 
cidem fi» afpoiwretur , adftringcntis facukaiis, refagerantis , 

Digitized by 



2c leniteir emoliientis ^x Diofcoride ) Bquida> valdeque trita^ 
& trepida, unnt Hncetim inficic> eoque thoracem vndequaq; 
contegît, ytquaparteprimiimreficcatumfuerit^ ea fecet& 
vrat.Vcriîm hacde re HieronymusFabritiusabAquapend.efl: 
Icgendiis chirurgicarum part. i . de operat. cHrurgiciş c . 45* 
vbi exaâiiîîme operationem Jiaacpondcratatqueedocet* 

XXVIL Tabssautemfir^cum în îdcm^veîut în fuppurato Au- 

TabcseKfiu-^^^^^ pcrgutrur^ &appendentes Pulmonis parccs ^ 

^^^^^^^f^lappclîatas Aortas^ qu^ pulmonecn & guttur <onu- 

mnt 5 8c coniungant • Fluk autcm in Pulmonem frc- 

quent€r5& pauiarim^ & humiditateEa in Pulmone non 

multamiadt:: reficcaţum ^îm îd^ ^^ 

guttiire compzBum ^ vt pote ^uod non clultar , ied 

paulatlm înfluît,ac dctinerur^tuffiin excîtar,& in Aor- 

tis îd 5 quod influit ^ dct«ituai > vtpotc cum angufta 

foramma Aort^e MbeantVanguftum ipititui locum_» 

^xhibetj&talein^ituîii habere fadt >qui veîut de- 

iecius > femper re^irare concupîfcit ; & in Pulmoae ^ 

veluc non vehementeriiumida exiftente^ pruritus co- 

suppoatiex ting"- Cuni A?eiĂîînîItUGjdetapiteiîuxerit>prurîtus 

Tabidis* ^'n pulmone non £u multum enim eft, quod in ipfum 

iniîuitr&Suppurati ex iiisTabidis^unr,vbi corpus hu- 

ineaius factumiîierit : & contra vbi fîccius fueric &- 

aum 5 ex Suppuraîis Tabîdi. 


^^tgmsaf A Ffincsadmodum îunt duo hiaiFeaus,:fuppumm 

jfj^bes^ vt qui in eadem noninodoinfuntxcgior^e > fed ge- 

iieradoneni^eriam habentinutuani^vtfupra vîdimus; Iurcigi- 

Tabesquid ■^^^^'^^oq^eq^afîpromifcue agitHippocrateş: Cseterum 

figaiEccc. <:um (?>^;Vi^ 3 quam Tabem Latini vocaiit^omnem fignificet 
coij^oris^tcniiatioirem^ colliquationeniquc, â quacumquc 

phthifîsvn<fc id caufa proticniat : deducitur namquc di<âio hsecâ verbo 

dicttur. ş^iî/^y , quodminuiimportat & confixmi ; prsedptîe:tamcn-j| 
& anchonomaftice de eadicitur confumpfioneaquasâPtfl-. 


Digitized by 



in^num înfatiabili vkere procedit r quod vicus aut proprijs 
Pulmcnimi aflfeâiibus {uperuenit> y t criiento fputo,Peripneu* 
moviix^ ca^terifque huiiifcemodi ; aut â cerebrali fluxione cri- 
ginem ducit; & de hac pofîrema in pr^fenti textu podffimum 
agicur s'fluxio fiquidem > quae â capiteper Tracheam> & Aor- ff^'^^i^Jff 
tas> hoceft^hwiichiâ^ inPuîmoriesfertur, aut valde copiofa te&qaanti- 
cfî , confertim faâa> biîiefeque naturse^ ita vt vel alteram pul- ^tt^^ 
manis partem > vel vrramque immodice explens , Pleuridm > 
aut Peripneumoniam ^xcitet > Vel non adeo eft copiofa, neq; 
tam commota repeme, neque calidse admodoninaturse; tan- 
taţamen eft , vt neque facile adurf, neque acris ei qualitasiai- 
primi poffit : atque hsec in Pulmonum cuniculis concaIefâ6ta > 
â natiuo fimul& a pr^ernaturali calore in pus tandem vcrti* 
tur . Aut denique fiuxio feniîm, paulatimque fi t, & per exigua 
qusedam ifîterualla : quaprcpter y "cum non iugiter ânoua fiu- ^ 
xione dilyatur^ atque attemperetur; id^, quodiâmfluxit> s par- 
tium calore plurimum patitur, & aquoiîori parte deftituaim > 
fîccitatem quâdam^ feu nittofîtatem adipifcitur, qua? lim^ in* 
»u.23. ^arhumoresacuit, Id clare de fcriput idem Hipp.4. de morb. 

^exemplp hydrelcei,cuius aquea pars vi ignis exalat, pingis vero ^.aph-î^* 
aduritur> notaturq; in aphorifmis vbicimque auftralis coniH- 
tutio humedtans & repîens ab aquiloftari fîccitate excipitur ; 
non aămodum proinde Pulmones humedat ha^c fluxio, neq; 
copiofa ab ipiis tune excrementa expurgamur , ită aridam vel* 
îicandotuflîm excitat 5 &in bronchiorum anguftis cauitati- 
bus coaCla > primo fpiritus vias coariSiât ; itâ vt non tatis aeris 
ad Cordis seftum attemperandum attractowEgrum fpirationis 
anxium perpetuo detineat. Dehinc magismagifqueadufta, 
inaiore^i acr^dînem > erodendique facukatem acquirit , qua 
Pulmonum fubftantiammordicans, & abradens> quendam Y^^.m^t>i 
<xcitatpruritum,qui, fiab hebeti vifceris huius fenfu non â-;<io^e a4 
adeo pcrcipitur^in pcâorc falte, ob membranarum & lîgame- -'^"^^^^'^^^ 
torum confenfum,innotcfcit ; nimirum punâionibus quibul- 
dam in latercin fcapulis>fub mammilUssfauceique non ieuiter 
irtitantur: locr/^oiremm, Latuiis pruritus, a ^u&i , hoc eit, rado> dedkamx. 
dcducitur. Quaeabrafîo,dumfluxio valde copiofa eft>vix fieri 
potcft ia Pulmonibus , nuUufq; lunc contingit pruricus : nam 


Digitized by 



iqueahumiditas non facile in vberi materia abfumitur,fed in 
pusabhumîdopotius calore tranfmutatur^, vt docct emm 
bai.5.'de c.5.Ac quemadmodum tranipofitis 
incuteraacribus, te-iîuibufque humoribus , primo quiclem 
emritusinvniuerfocorporis habituexcitatur; moxvlculcula 
fuccedunt: ita^ in pulmonibuspruritum infanabiiia poftmo- 
dum fequuntut vlcera , in quibus profeC^o yera tabis idea con. - 
TabisacEm. fîâit.Cum v«ro iâorutnâfFeauiîmteciprocafoîeat cffe gene- 
pyematis re- „ao , itâ Vt modo cx Tabc fiat Empyema , modo ex Empye- 
S?.^'" matetabesjideodocetexqua varia horum mprborum dif- 
pofîrione id proueniat : Naia ex tabe hac , quam ex humo^ 
rum arida acrique qualicate procreări diximus , fuppuratio 
proucnicjâumpulmones humidiores euadunt . Nonvrique 
â noiia fiuxione , f«d â propria fubfiantis , aduenientifque ali- 
■ lîienriputrefedione ; praua eceaim vlceris qualitas fubie<aam 
fubftanriara , & deicgacos alimeBririos humores in pus vertit, 
, macrnumque gignit puris prouentum : ex quo incipiunt puru- 
-knSpluRmafpucamina excrcari.atqucita corpus humeCHus 
effe apparet : Quemadmodum e contra , vbi pus in primoge- 
nio emoyematc copiose genitum eft; fi diutius inpulmonuof 
iatcbris<iednea£«r, incâdefcensjfîccius redditur,& acredinem, 
erodendiqucfacuitatem acquiriti qua dein<ie e^ditpulmo- 
nes , deducitque ad cabem . 

y YVTTT Suppurati îioc modo cognofcuntur . latus â prin-: 
cîpio dolor occupat . Cum vero iăm pus colIeaunO 
nSfe^ cHA dolor {imiliter haber5& tuffis fir, & pus^creat, 
ptoB^r' ^ Spiritus corripit . Si vero nonduai enipitpus, ia 
îatere concutkur , & vdat'm vtriculo ftrepitum faciţ. 
Sivero horutnnihil adâtjfuppuratusauîetn fîrjCX his 
coniedare oportet . Spiritum muîtum iiabet, fubrau- 
cofîufque loquitur » &pedes ac genua intiimefcunt j 
magis atJtem ab ea lateris p2rte,in qua pus eft, & îho- 
rax concaruatus eft j & membrorum dilTolutio fit 5 6c 

& fudor per totum corpus diffluit , & aliquando fibi 


Digitized by 


^fî vîdetur caUdus «fle , aliquandairîggîdus^^ & vn^ 
gues cîrcumtenfî funt y&aluus calidafic • fişfaisiup. 
puratos cognofcere opoitat i 

^îSriş >, Siguid^^aîiajp/um^^i^ , sd varia x 

inchpaoim dcnunciaai; alia pr^fes iam, vel confematUOT 
demofe^ţ; alia tcmpuş denotam , quo pus e vomica> parata 
fîbi ^rodeiKiOdVia, ampJiorem jja cauicatem effimdicur ; Non- 
^iia 4fe#^ni parceţa cjrcusircjcibunt; nec^taBdem defuat 
qu^>qui4.1>QiU , quid miliŞaandiam hr>;pr^indicent^Qu^ 
Qmmz^^mg^,i tCK.^2.$c deincepsi in coacprenot., t*Sc 2. 
4f î^rfe^dif^fe yi^^re eft . în ^rifend auteiii textu ca pr^* 
cipueenaMrr^ftmr^qii^^.pr^feo^tem^ & CGa&mmatamoftcn^ 
4uixt^^UQrm^raâ^fe a^;3pieadaell* . . v , : , - 

îore;sfîu^i:s pîiifimumltMac femenBematerk 



cetgrau^us ^.diflblutis hm^î^rîb^u^ diffipatifque ^iriti- 

nej^>; pijfţ^aelismeatuumînterjEb > in vnum colîigitur^aQ 
ieiii|iimi»ucfe;i^.grauitaiâs - QixgM ^us diiitiiis nSixpec^b- 
tuiîipermai^ric, itemmini-a^ddbit : Hinc mcmbraaanimi 
exmadoi &iafefl:apron£atio ,:iKmai2>i adfcita acrimonia, ; 
qua, dum erumpercxoixte0dit>,ci:odefîtem concirat^iorcm^ 
ftu.17. SciţumeâiUud ^x^^ţmnsml^xp^. Accedere necejje eft dolp^ 

' . ^ ^ -] -i * munîcjue men^ranaş vellicancibuş; aut ipio- Huipyicom 
nmpmreeix>dent^atquec&itum^6lânte; - ^ ^ '' ^ mâSs^c* 

- Vvomicamadhuc pus comineaturiiiequedunr ! 
iupta^:Atiîinpi4î^^uai,c;auii:şjibus^iii: <:oik<^mî tune \ 
. ;: .- ^ Dd ' faci. 

Digitized by 


faciîis fexjuîtur anâcatharfis, dummo^^ pus nequenîmîs crat 
iiun , neque vifeidum iîr i thoratîs autem :robur validum 

Io itcmm incaleic^ntc , Dyfpnsea pariter cum c^terjs t^^ 

înatibus icxacerbamr . Quod fi e îoco^ phfcgmone obfeflai 

pus in tlioracrkintercapedinem deinde erumpat; impedimen* 

taefi quominus pulmonum alse fatis e^tendi^ explicariquc 

pofîînt i vel fi in ipfis pulmonum cauitâdbus ftabuletur > 

craffius^ in dies redditum > fpiritus vias magis intercludit^quod 

qiiidem fymptoma ; euacuato fcnfimpure, enaneicit* 

' <ii xTfXfX*^..^j ^ .. " o Non dum eaacuatunî 

, Siyeronondutiierupjcpus&c^ft p^ ana^atharfim 

edquodnon fed&cxcodum fît, virefijue collapfîe exiffauc : 
quâpropter per osexcerni>^ expcâoiariqiie neutiquampo- 
ftuh&aaasL ttă; tune > ii Concutiancur Empyici^ |îiict iiapo percipitur ila- 
^^I^: gRâfttisiîiuMkimthorâciscauitatei mcdoicrâfficie & copia 
nonimped^tur , ryc non ita pridem iex Coacis animadu^rfio* 
tc«* 15. j^i^u5 hi^ annotatum eft . Atqae iiae^,^t figna > quse' iarti ■ 
fa<ââ^ oftendunţ fuppurâDoncm, ; Jed non durn vetuftare 
coirfrmatam V ĂtB nuila exiiis nons âdfuerit, îtâ vt iîippti^ 
rad nequ0 Vieficmentei* doleanţei ncqu^ tuiŞant> {eu^cxcreent, ^ 
quodpaţi lîîmbaaffitie & c^iâ^profe^t^ 
ra^qiiafiimmobiiitef ladcet5ainchis.iigiHsdig^ 

pi0{b& Irilcido^ qUod î?âlndtorui)us âdiia»tensy nidlăcemas ex- 
p^iâoratiăptum dî j naxursepra^fertim vdrifaus collapfîsy ita 
Vt nullos âdhibeat conatus , neqne ipfaexcitata tiîfîl* 

^ * mâ^smagîfqucjincakfcente* : ^ -; . - 

Bmo^a-i P^<Î^S & ^ny Hiitt^ V ^^ in partibu^ijs 

pSS^So^ caloris p^upoiatcm, quiin Cotdis^Iatcbrispeneiuffocatus, 
mefc^u membra Ula%gida&n€ruofa,t^îilong€âfocodiffi^ 
ucre, vitaliqi^ neaare^iUuâtarenequaquampot^'l * Hi^ 
*'- -^ '- mcntum 

Digitized by 


mttmm noAadp<>feum> iicq; ladfîmifatum jematiMS , ioede-^ 
mîLtofbs i^cicac tumores ; ab jea pr^fectim parte , qu^ vî- 
mto f efp^nd^i: lateri : jiam ilUnc prartipuc yitalemjecipiî: 

. n Suppurationc iam dcx ^^.jcSatiT 

^ Et lioraX CCnCUruatUS eft - ^eMarc in tabinn i^ TOk . 

îabcfltei confiimpxîsproiadei tabida febre adipoiîs.& camo* 

îîs părţii^, quib^ 

^doinineTac proinde Juiţi 

te ; Quinimmo {olidx xmn^otu^ panes ib exi- 

tio|aM<:&bte4ifiRâuunmr, Beque^OAiijîe^aris^ppjiîlu re- 
ftâuranojyca^e&âataiiami^ <^Bai^canomia; yade mquc 
Chvlofîs , ncque Ematoiîs , neque Anadofis ritecelebratur . 

: JEt fudorper tomm corpus Hiffluir. ^-yj-^^^^^^^^^;. -^^^^^' 

.queunte natura. delegatumaîitxvctK^ ^ afumilaxc; 

promdeforâs fiib ioris fpecic egreditur : - ", 

: Btfibîvîd^tur-âlbuandG-caîidiJS effe^ ^^a^Sr 

■ ' " ^ - gors vîciflî- 

- . • . ■ - 3t^a3efeit^ui4icm-^odo iab;^ui«Bpjto-^mcîî^ tudincs pa- 
fnggîaus .. to obhabiwatuîBiafciîi^^ ^^asau:* 

vtcakincafefcit^.aqua; jmodajioi^eaduenamcob frig^i- 
diorisaeris.appulfum, quo, .coaftipacis,ţ)oris,fulighies>qu^ 
â feruefcente puredcuancur , jrcriiieri par.eft rpr^eXertim tune 
temporis humoribus vifceraxcuocatis jinodo a 
ccrebri cplliquamenţis i qu^.d^orfum.fei:xfini.deIapfa,^uof-- 
.dam prima ÎKyrrores, ^âajs:sjdeinde,€xch^ 

JEc vngues circumtenn iunt . ^oru piibiis^uibuslr- JS^. 
mab^itu^atqiipiam^i^ vnguiumfubfta:at^^ 
moru jaffluxu maliis aelucMa.adferu2i>atu 
. - * I^umobA 

Et aîuus .cah4^*^t • qp^^jus jdiuitius:dctentum , magi^ 

,. ,j. mî^%idbaieib«^.HQtyîn^ 

m. vkmffm^ partes . tu^ obiuperatum ,paruum ^oUiqua- dSS^ 
"^ D d 2 menta 

Digitized by 


u* m?BOGRAtis.Lm iLm LOC. ţn hom. 

menta â totias cofporis pratematuraU igneoque caforer^uo; 
rumporao ad inferiorem dclataventriculum, ca!<»eai^^x- 
cicat,mouetqae.nonraro ciiarrh^m,Empyicisfk£alcm acquc. 
tuneltam . Hsc autem iîgna funr , qu^-empyema ad ta^m 
lam dani|iaire , ac fiippuratos ad extrcinara iaiu cidamita, 
tem redactos oftendiuic . 

XXIX. Porr6 cura retrd fpinam îîuxlopfoccflerît, huic 
tabes-fir eiufmodi ^îamboşdokti &antcnores ca- 
pitis partes vacu« videntar ipsf efle . 

DE fluxioac hac ad pofticas pmes-pîuribus egimus tcx.5, 
libnhmus;mhiIproinde cft, quodnunc -addamus . 

^ • Biiis autem pericuJofa efi^ fi Iderus, fiue reglus 
&^:S-- "^f.?Jî^j?ocuIisaccedEtr&m vngui^usjiuiditas fi 

^=": cera hmdx fînt,& cum fudbr non toto cdrpore erum- 
pit,fcdvnarafîqoa^}orporiS"pârt«i-&:e&hi febre âd- 

huc m Pulmoneiaeâpallîdu wrideiexcircatio ccffet 
Sic autem cum ineft & non îneft cogno^ere oporter ' 
Cum ineft , in faucibus refpaamîs ftrepit ,*^& foiritu^ 

i periculofuseftj&fingultusadert.&febrisdifcedit 

excreatione adhuc in Pulmone b^rente , & aluus de- 
bili lam exiltenţi feceffum6cit . Hiec P'^urîtidis & 

BIIemWcvocat,( qaemadmodum 8c Voczuk{mtxm 

S:.lf^^* '^'**^ cacochynua Pulmonibus , moleftoquc 
cp5aau«c^tur;nominc ab mfeila materia defumpto,n 

j^^î,^ ^""Ş^™<>d^<3^usUbridemorbis.dea&io.;,^S ^ 

Digitized by 



datutâm vel â parte afFeâa ; vel â morbofa materia i vel ab în* 
figniGrialiquofymptomate;velâfimilitudine cumaliquooc , 
animantibus defumi . Hi crgo Pulmonum affedus ; cum tri- 
pitciter terminări poffint ; ad i'alutem quidem difcufla > vel ex- 
purgata materia ;adinteritumeâdemconculcata,atqueex* 
affaia in bronchijs; velincertoeuemu ad pus immutata : D^ 
primo acquepoftremoluculemerfupra a6tum efl.'De fecunda 
*^ ^^ • iamagitjcx irio&quaedamfigna proponens>quibusyel^ , . ^ ^ 
hitmoris exuberamia,vel praua quaJitas^ vel efîbeta narora^ft* - 
i^ficatur.Vnde ad prognofîm fpetaat hiccotextus^lScinqiâeş* ; 
^ .,. : . - . ^ iUafcilicetPulmonumafieâio^qu^ 
BlIlSperiCUlOla elt. ^ j^-lj^l-^fl,^^^^^ procreată, Pleuriri^^ 

dis , & peripneumoniae nomine infîgnita eft . 

. .. . luteo colore 6b bile eo e& 

Si lâerus m ocuhs âccedat;^ j^ ^ 4^fi3^^ 
maoculorum ţyartevvbiproptet nitorem iâcritia primo in- ^p^^^ 
notefcit . Hinc fir, quodoculiindicent de toto corpore.dum f^l^t&câs 
color fimilis efflorefcit humoribus , modo ncn intra regurgi- 

- ^auerint. C^terum id ncquaquam critice accidere cenfendum ^^^^^ ^^ 
eft;attenuatavideliceccraffioribileinPuîmonibus,fa6taque pr^,i^ 

, mctaftafî ad^xrimas partes a valida expulcirice tranlpofitas vt ^^^^J^^ 
poftfci^umîbiliofîsm morbis, maximo a?grdrumiiiWî<Ko 

, . quaiidoqî accidere confiieuit. Sedfymptomadcepotius> eo 
i?fq; ob-ingentem copiam propagata materia ;:veItenuioriaîi. 
quâ parte acriusirri^nte , â laceffita natura eo expulfa . Quod 
duplici tune nomine horrendum erit , turn ob delirium:,quo4 
iur^ imminet;, dum leuior bilis portio ad fuperiora afcendit : 
â 'dllinbaut^m&: toiiiiuMo , & fliprema dies expe^tandareft: îa«ritiâqi^ 
tum^b imţeriamin brohchijs rciiaam , qua^ătcnuiori parte ^^^- 
deftituta^craffiorac vifcidioreuad^tneceffeeft, quâm vtper lipncumo*, 
îHiacatharfim euacuari poffit • Pxopter id ipfum in morbişpe- ^^^^^^^ 
âoris alui profluuium pcrpetuo deteftatus cft Hippocrates : 6.^x6. 

âmpTcr^ationov^^mdi^^ .. : de morb. 

. ., ,. .,. rr ^ ob caloris paupertate, ^^- ^7- 

Etmvnguibtislpaitasiiiiat jaui&m:» 

ftminprecoraijsfu&eatux • Hanc vitaUs&cultatis mopiam ^^%^ 

"" ' primo rnaiu** 

Digitized by 



vaguiumîi- p4aioperfentiuntyngiieS:>ytpote încxtremisdigms loiî^eâ 
^kisvadc . -ciâloiris fonte locati iM enim â tenuiffima glutinolî offiuni exT 

a:ancDtip0râone geDiti> caloris vi ejdiccata j vthzbtmxiih^ ^^^^ 
la^e^ ^epri^c-riîapiîanifunt^acfubieâ^^m^ tumhumo. 

vages tem- j^s non modo tempcrameiîţum per^icui oflendunt > ^vnde 
oft^^^ moUcSjplmi^Sc îuddi<um funt, iogoiiii indicând talesaamq^ 

â tenui^ac fpkkuofo fanguîne €«aduţ)fed prf ter Baturaîcs etil 
Hîp. de mt. ^^<>fîtiones;<;^j^minQ cum yOTaain3,aitcii3runj^& neruo ^ 
gTz ""^d*^' ^fi «^euHtatfâfuandicc clai^ant, defid^iids cuiulg; vjrtms 
anai!'atî^ inopiamprimi parfenfiiîiit^^y'itaUspraîferura quamliuorc& 
m.cap,i I. nigtedmc deminciant : ianguis ecaiim,qui â vicdi infliixu flo- 

ridu^ac mbicundus fcruabatiir>iam refrigeratias^elaicit: & cu 

dcnfime opacitate acqukiţvt docuit-cuâ AriftJec.3 .prob^ 

Etficorpusvlcerahabeât;^^'^^^'^ ^^^^^^ 

vicera iiy . ^ \^^ ianguine ,.qm in prrcof^ 

^mpyicoxu di js tiimîum încanduir , dum Jieiâ rej^îratÎGnc , Cor iion iâa$ 
^'^^^^^^ ^«isniperamr. morb Jncp^^ 

inone nimiramtumemcj peâus Piaţeta velut acubuş pun^ 
aflaHikjibig; vdutaikmmaxubo^ .^^^^ 

^^ ^ dimHb Şccum . i,iuefcunt taîia vîcera. yeî ab Immorc adufto^ 
vîc«a orr ^tque ia atîMibilcin tranfhmtato \ vtl cţuod vit^$ &cultas 

. ^t cum fiador non toi»C0p>ore€ni,^^^^ 

Sttdorqni^ . . * ;* V <elt excEemcncum yldmi alimcntit 

^^TO^mbrorum , cuius y aufâ ;atuc :pera^ 

vehicuîum^ ac proinde ab faabitu .vniuerfi corporisdecidi par 

eftinoQjrard tamcn â^enkiombus ^ardbn^^^^^^ 

â peccantium :huni<3tmm imafîa, vc liquido^ocuitiIq>pocr#. 


• ane- 

Digitized by 




affânmîur 9 & 'oapor fit ^ fy cumJţîritupeirmfiumfoYasp^oce^ 
ăit : viidc & lib. de flat. dixit fudore efle fpiritum copacSIum 
in aquam tranfmutamni . Hiac cft > qiîod ex 4. acut, J^w 
rpedes(mmh4S7norkse(lcommunis: morbifica enim cuiufque ş^idorom' 

j£ , . t . /r a * mou« mor* 

morbi macetia calare actenuan ac coRCoqurpotelt ^ oc partim his dicoaw 
in aqueum huniorem, pa^nî in vaporem verfâ; per eutis Ipi- =^»«^ 
ra nieftm fenfibifiter excerni: kâ vt quâuis noxiiis humc^ 
in parte refîdeat, dunimado tamen vigeat cxpullîiîajfudotţ 
- quimdeerorimi^vnitierMsincotocotpotecrij:.SicAnaxi<^ H^d^^ 
Ble 3* epid. 3 Pleiiritideper talem fudorem liber omninb ciia- ao^e iudi- 
fit î & Valeriolaobfe. îVlib. 4. > Pleuriticam quamdam^i&i- *^^* 
lieirem fiidore cc^Sofo , vîla abique expe<Soratione^ afiaqt^ 
ifriic^ni euacu2|£ioEe r integre â Pleuritide conualaifle teftatur ^ 
At ff pe euent£4n magnis vitalium parrium inflanamadonibus, *^ 

dum pr^ anguftia quammaxime laborat natura, aat adeo ef- 
fbetaeft, vcnonniiîex qmbufdam partibus, qu^adfudorem ^^^J^^^ 
^rocîiuio^ăr fent ob tationes , quae iam iam a&rentur, expel- ' 

lerepo&i vetneatimenEirium<îuidem fuccuminhabitu cor* 
pocis continere valeat ^ aut prie nimio incendio nuper coagu- ^^^^^ 
latâe cames, vetâppolttu^m & coaClnm alimentum difroîuâiur , tăics. 
& Colliq«^fcant>:exigai quidam, fed penitusfunefti fudores in 
partibus quibuidam înrorati apparcant; circa caput videlicet, ^^.^ ^^ 
vultumy &ceruicen|: nam,vt docetTheophî^*IibeIîpde ^ciîcfudct* 
{udcre ;Judatex corparis partihus maxime facies , licet 6" fnihia 
am^ofa ^ty^ tmnui hlont y^^^ & ^aput rarum ^ humâum 
■«gyCuiiplafades&coIlumfubiacet. R^n^^^ ;^ 

taţifquemdiciatumalia fmt^ tmt cereh^m d? pilonimortus; îl- f^^^^^^^ 
lud ipiiâem humaitaiis; hirantatis : ^uam oh rem ^pritmm ^ 
maxime judatur fronteyquod h^ec fecundimi cerebrumjh.Ad h^c 
jpiritus contmfto in caputmagis extmditur . Qux pariter ratio^ 
nes apud Ariftotelem regiftratseiunt cota fecunda problema- 
itogB. turn fe<atione . Iure ergo iîidar in aliqua corporis parte inter 
nu- 5. * praua hic recenfetur figna , vt recenfctur etiani in prpgnoâi- 
**'^^* cisr&Hipp^cti lib* acut. jn FenpneiifnmiamalufnePyfi^g^^ 
âiffictdt^ Jpirauerit , d* vrir^ tenues ^ acres , & Judores circa 
£oUum ^ cdput fiant ; taUsenim Jtdores prcm Juntfr^ J#" 
aatione»^ im^lti ^^violm^Jupcrmtihus imriis . 


Digitized by 


Buispaiuda Etcumiebreadhucexîftente excreât seger pallî- 

[ *nimiumâpr<eterxiaturadicalorecxairâtf,quf 
- ' dum feroia parte magis magiiq; in dies deftituimr , âyiridi ad 
" . : . .. atrum properac; acerrimamquc fibi viai adiungens, natur<e 
infeftiffima euadit : Hinc maximas; inquietudines ; Viicerum 
ac peiâoris morfum ^ 8c tandem de^eratiojiem inducit es iib» 
de vet. med. Iure itaquc huiufcemodi iputum, ,.vt maxime'fur ^^54* 
. . , : ^?#^??f > improbacur in prognofticis^in CoaQS, 8c inlibris de 
• ^9ţb^ ^Quod R cum febre zdhuc valida coniungatur > duplici 
^^!^^59î9|ne,prauum ^it >.& quod humoriş ;, yndt gignitur , 
sputâomnh ^B^^^'y:^4i^n^anatyaydoren:i denunciat;& quodipfomec 
maîa que do cuacuato , luorbus nullatcnus mitior euadit * Scitum eft iilud 
iS^âi!^ prognofeo3.0^4! Jpuîamala qu^ctmque doloremnon fedau^ ^«'^^^ 
cur* mf tfîgnifea^ enim vcInQn,edudid>quodi^d^^^ 

• ^^ vei^ fi eduamrp,npn exfâcukaţis robore ^?^^S9<iion:4^ 
confei^nţia operacurj fed vi ipgor^i > ac^^^apcomad^i^wita;- 
ţa natuţi > euacuari: nam jiuvn valida e£texpuI^riK^vHc^^^^ 
nis fi^a pf a?ccfifcre j> j>eximi i9terduwIVXl4^c^flţquc^ cx^etw 
nuntur humores, maxirna cum scgxotum ioUctdJmsi ktquc 
iuuamine^^cadiipfiquidciaomaiâinitigac :. .,, 

^ ^AutfîadbucinPuImbneîneft^p^^ 

sputom va- creatîocefscî ^^^^^^^ ^"^^^^^^^^^^^^^^^^ 

«aitasyadc, --'. ■ t : '^ "^loris ych^mentianiyaut faiimcms c 

ciam ob ainiiam craffideni. iîgnificafeit . Sic & in Pfo<y* ;^7K^ 
l^m^^ fp^tum^ cimâ'odde chlo^^ 

Jyncerumfuerit , vtnigrmiappareat^grammiUishocejî.^îalum 
etiam-pnibilaut expurga yaut admimtFuImo^fid ţlmus invm- 
tHrefirueat^ mm vt habetur ji. de Jpttumnmreiece^ nt.î& 
fit i^durimfityi; coarejcit^hominem ţmmit^ ^^ „, „ ... 

^^ţ^^mk^ autncnîneftcogno&e^c^^^ 
tet Vumeft ,in aucibusreipîrantîsftre^^ 

pericuîdfiîs cft . ^* P^^"^ materiei expei^aratio ilHco cet . 
^f^t 1 fcir.^qrvelimus^tmuiiqwid a# 


Digitized by 


fcer^ oporcet . Primo ex ftrcpitu ^ quem e4it i^îipiratus^jj^^ 
aer 5 fi bonchia craffis yifcidifque oppieta îiumoribus , ot î^ puimoT 
tendat ; nam vt ad cor refrigerandum perueniat, per aîîguftia$ ^^' 
traniîre cogitur^ dum craffas diflecans materias ker iîbi parac; 
i:olIidimr proinde , ftrcpimmque emictiţ ^ qualem feruens , 

cîla vifcido tepîeta humorc> yţimaftîimaticiş^obfeiuarc licer • 
QuodautemtaHsreipiratiodifcrimine^^^^^^ noneilcur ; 

dubitetnus , cum inde fuifocayo immineat . ^ v 7 î 

^ ErfiîK^oîms^defl Nonvtiqueperidiopathim, cimi ,^^ 

âioris , 

cîatur fuperius vcnciiaili orificiiim > cuitis paiîîo efl: iîngukus; 
fed per fynîpathiam j, & thoraciarum pamu^ 
qu2e V€Î phlegmone, yel exitioiâ adîBodum cacpchymia ob- ^ ; ^ 
fîdenmr . Eft etenimficguhiis conutîîiîiia ftomachi aftcdio ; qufj'fff^: 
feuqu^edameiusconciiflîo^ qiia>.quodnoxiiimfcnui:;, ^e 
ad repîetionem > £ue ad inanicionem peitineaCr ^^cucereiii^ ^^ >^* 
titur ; cum exaâiffimi iîc fenius ob infigaem , quem â fexco 
Ctrebri coniugio recipit neruiimsitâvt quâmcumqsnoxam &-. 
cillimepcrcipiat^ acduia iilkatotus y^enmculus^ omaibus, 
cxpulfîu^ facultack ykibus^ckca orificum xocfbringiţur > w 
cniod noxium cft .pron€ÎIat^aa^is aliauid per aomiftfi t^amkem sînguîtDs 
eîiditur , ac Itrejamm , eoit • Id ipium 45uandoque ^mtm a. fecut •* 
proximarum panium confenfii, tâm natuiaîium > quoin ipirk> 
tualium, vbiillaî yelingenriphîegmone>yeivitio^ cacocfay- 
îfiia obfidenmr ; idque vel exficcato ftomacho â vehementia Singaims 
caloris ; vei prauo aliquo feu yapone feu ickore in ipXuai in- f ^^ coafca- 
fpirâţp, vehrroţvo; vt eueiiitin propoiitoxaiu repleti puî- mado£acj» 
s^' ^-' monis . Sic & 2; de morb. fingulcientis^ cuiuldaiiifebris me- ;^ r 
minit, inqua^ob fefâ ipiritaHa finguluis kfefl^^^^&j. de ^ 
morb.-de Pkuriridefanguinca verba faciens>#t«^, inquic, . V . 
* &âfumt ŞngulttiSy fimul^us cmnpiIiMa.sfin£uimsgrumosniff^os . 
tuffimdo reiecerit rfeptimâ die moriţur > ^ apfa. 58, fee*! 5-^ & 
apL ly.fec* 7. £x:hepaSismfimnmationefin£uhus^malmn^ 

Et febris difc€dit.^:a:eaîîone adhucmPalmone. ; ; 
« ^j,^— ^ Non modo ia^6dai|intqu^a:nque.fîuc bona, fi^^^ ^ 
^- ^ * maîaf r«eîer racioBcm-euciiiăt vthabemr aph, 2j. 

E c fee. 3. 


Digitized by 


,. fee* 2v> ttmm etîam a morbo' intetdum ibique tationabifi 
pă^l^^Sl cmhJgspotmtQS &bîeuari y mccr praua figna ^ ioîmoiaîthaî^ 
nem roite- c^nncrmeratâf . Pîurics id atinotauit Hîppocrace^in Prorrhe- 
inum cftT" ticis qiii dem, Mcrtifera omnia, qt^teaif^tiefignis mtejcrnii, fmr* 
tem in propinquo eff^tejîantur * I n coacis vero > Qju^rpmuis cum 
n\im!'6, ^^' Jt^nismittfcunt ymortTferaJunt.Lafm^ 

immeritoeummt > mfmiamfitcif. : Amplum- ttftimoniura prş- 
-'^pid.iec.i. ^?^^ ^^&^ti huic mukorum bîftori^ in cpidemijs, prsefertim 
2gt- z. Hvrmocraces iile , q^i pluriesâ febre îibe#r ^^dem vigeiîma-s. 
leptima vitam cum morte commutauit ; plurimique fum, qui 
nonlongeab extremolpiritu > maiori deguntquiete, itavc 
vuîgus morbo iam deiunctos exiftimcr * Cuius rei multiplex 
ţx^Flhi^ affcrxi poffec ratio ; incerdiimexcremos conamshabeBtcBâ* 
meiias ka- turâ , l*Ethiferum exctemeiitum e prlncipeparţc in viliorem 
^e vidca- ^epdmtur,poftmodum maiori impem reiieriurum; interdum 
vero , cum eo deuenmm eA> vt primigeniuni hiimidum pene 
: eon£, omnifquefpiritus^ turn in vitali principio, 
turn in folidis partibi^ , diffipatus ; tune n2a:uraUs fecultaspise 
extrema imbeciliitateneqae morbificas materias viterius co- 
quereftttdetf neqiievUopadiocommouetvtexpeilat: quin« 
immo e#imâo^eiîeieniuin v^ omnis ceflat dolor , 

:^ CHmrisinqui^udo^euaneicir^^cduniuatitiaexting 
: diî^s i febrilis ardor ^ queijdâm deducioir teporem , vc jn- 
fcbricitationem fere mennatur • lithaîe iccirco fignum eric 
mbrbifico humore adhiic pulmonum latebris ha^rente , ac; 
. fuffacante > febrem dilcedere ; C^od non nili ob natiui cal<^ 
"' ; risex£inâianem.c0ntmga:epotelt, vt modo di^ium^ft . 

Aiaifijmis £t ^uus;alb^r lani^ e^ fecelîUiîv ' facîc • 

atd^y ^ AluifluxHS i^6>tili$eflmmorbispeâ^ 

adpraelcittăp uâsdum ; vtin morbi initio dum cerebralis fluxio ad natura- 
^^* Ies dcriuatur gartes , fii; ne adeo augeatur in pcclore afteâioî- 
Vnde Mb. de &ioc* Quiakumli^uidam hahent, nmad^ 
modumtâfitmttur Bieuntidâ^^ Fmpnmmmia:m quo fenfii pari*i 

L^ţS'^ăiui tâ: aa^^kndum eft illud Goacga:um : * : Quihusm fi^rihsM^ 

m§w ^yX^t^to^pam i:ard-iu;cife , vt .mitificaca infefia 

■ ■ -' •■ ' "" in 

num. 4. 

Digitized by 



k pr^ecordijs materia , ^dque inferas partes demrbata , gc bă, 
cammota ;^uoPl^riţii^i jnorbo iel^k^r 4^iîg3^mr:,fed , 
pemiciofusplerjimque tafo fluxMS ^^^ 
in ipib moiJ>^cu$ euacuaiurjîumor j ex qup^iaîla ftqjrimr 
<onferenda> fed vires potius profternimtujr,^u3 valida: in 
expeâorationc^fle ddbent i <îuaTOâ nplurimum Hcunm 
& Pedpaeum^nfcii^itiofo :m<^<>^iîif^reafe<:ofîl^ 
yrf, fî quid pec<:^tisinateriei^oiu^^uâcuatur > idxeauii^ 
fimaf rkpm^aţqtirîi:;îîorp&î ^^ €rai&&^fcki^per 

îongos & MgujElos vcnarum anfiradus adintefiina de.uehitur ; 
ynde; quod m tiioraceieUquum %ereft * :Cra0îi^^c tenacii:s 
ireddiuirn , niillatenus poftinodum per Tracjhcam educercj&ş 
dEritŢ fed^3cafeum în pij|mcmîbus>-a;traiiam ^ediicet in 

/^a)-m neqm^mms îax^y neqm mmis a^nUz^ţe deht i taxa ^ aîuus îm 

.^^iţiofioijf ^ritisxicato ^x t .ic:mo#>^^?^^^^^,:^?^ .efe4cj>cac, 
. ^^i^^i^?î .^^f^ >.ig¥^2 i^r/ii?« ţurgatio nm^qualii&t 

^vţ peximum Sndicet; ^mpţpaia ^ ^juofion jon^ iupremaiai 
ibefeiîem^Hfeaiar&iaturi nan^ 
cxhauîfi^pb e^ qiîif r^eficr^^^ 

foffapauenlat iymptoma-;-E^ur^^ omnrai ceconomiam 
labeiafiatam ^ ac pene ab ^ruginofa bile eo reiudantc Ac^ 
inolitam iîgnificăbit ; itâ vt ventricuîusnil ampîius retinear^ 
ai! cooiiQquat , nil .atu:a_h2^,iJepar>..ftd o^nm Xuo. xtmtc 
deorfum efâuere £mt^ Vad^^Jy. xkiBorb* Mtmsjwrhata în 
Bktmtdco , ferifne^monicQ > jmtfifpwrj^. Tnahm • ^uod. 0^ 
apk j6. 3c^kbi:no,u oro xegiârammrep£jimus^:Ax^.exAi$ 
omnibusigmsj^thaîeîn ptpiiu^PJ^urmdemcirej-iiojfcĂ- 
mus : quş tamen omnianon; :adeapktiniâ<t^ propria .<ti^en«» 
da func: vc cum alijş acutis morbis.coniungi aequeânt,e.ou;m- 
que exlciofam praiucacem .dem6fti:are;,aqqu3eiacc.rim p.i^i^Cr 
mitteudumjalttmoî.oc^^tilfLiQ Cpa.cis , iii^hs "^kHriskis.f^rjar 
ţitm. mu^Msmp-^^^r^. f >™ 6* jTwVi m^s , d oculta, ^marh xe^ 
iolovâ infk^HS.^.ac căti^nofia '^Mpr.mnt. .- . , ^ - v 

Digitized by LjOOQIC 


Febrjs fedancîahoîî eft per feptem dîes . Potu vten- 
dum aut Acetb triuiro, aut Aceto & Aqîiâ • H^c aute 
quamplurima offerrc pportet ^.qiio humediatio fîati 
eaque fa<âaexaeâtionem fâ<:îat . Et:dflţIor fedanduş 
eft cdefa(aorijsinedîcamentis^& ad i(ari>endum d^ 
dum eft<juicqaid excreatioinera faciti& baJneis vten- 
dum eft quartadie.Quini5la autem &fexea oleum illi- 
nendum eft • Sepţima îauandum eft â febrîs diraittere 
şon veiît, quo pr^ baîneofaddr contii^at unfuper- 
que & quinâa , & fextafortiffîmis vtendumeft ex- 
cretoriis mcdicamentis , quofeptîmara. diemquam 
h.cMrD& tranfîgac . ^\ vero neque feptima die febris' 
ceffetjoona cefsabitjSi non aliud quidpericuiofum ac- 
ţedat . Poftquam autem febris dimifdritvforbitiones 
ţjuamdebilifsira:» cfferantur. Sîverdvacnartrdbbo- 
yiâtur, fîquidem iuuenneadhue eft cdrpus^Otusaufe- 
rendi funt j ^^vttQ ^n'^danifit , trmceiş &bÎMo- 
nibus vtaris . Et eodem naodp Peripneumoniam., 
curato •■ , . . ,,'. •,; 

yV î>{bîuti^ijs j qu^ecod Pîeurîtixîis hiiius diâgnoiîm atque 

î^fenem modo accedat^guam; ed potiffimum dirigitv vt op^ 
preâbş Piilmoiies ab exitio^ yindicet cacodhymia , cuius: 
parţem anacatharfî per "rrachieaHi expurgat^ partem per corw 
p^shabitum fudoribus educere ^ partem balneisfotibufque 
difloluere^ac diffiţ^re ftudet:Cumque febris fymptomaticum 
qtiid lîcin hoc affe^u ,:ac pîeuriridis fequatur naturam ; hinc 
mopctptimo împmmş&pteim^ebiis eafedetur, hoc-fâ,^ 

Pulmonum cacochymîa & iatUinefcentia. tanquam numi/ 
prmcipaliî cumquia hşccft^ quâîpr^cipueyrgec, &febris 
^ ^ '- caiiii 

Digitized by 


caufa: exiftit ; turn quia fcbris refrigcrancibus fedamr, qux 

tamen ex aph. I4.fec- 5 . pc<aori inimica fiint ^tuffcs rnouenr ^^.^^^ ^^^ 

nu- 25. ^ fluxiones : quinimmo ex 2* de diaît.humiditaces in corpo* maia inuc^ 
re conc^elando , hoc eft^ incraflando , valde contumaces red- ^^?^^-\ 
dit^ipuuimque fupprimit; quasomniapleuriridis curarioni pebris cur 
plurimutn aduerfantur • Pr^tcrmittenda igitur febris eft ; f^%f^f^ft 
idque non primo cantum fepteiîario y quo periodo difficillio- «îs • 
xa v£ plurimum tempera tranfigit Pleuritis, incremencum vi* 
"^ deliccc , & vigorem j ac tune precipue feruec febris ; quapro* 
pter de facili ad eam curandam incaute ttahi pcITer Medicus; 
fedquoiiiquemQrbus hicinfuovigorcperftiţerit* Quod 
poftea febris , qu^ accidentaria erat , cb pecuîiares jEgri dif- 
pciuiones effeutiaiis euaierit , ad cam curandam tută deiie- 
nirepacerimus . ludicaiur tamen morbus hic, aut fepcem 
diebus > aut nauem > aut vndecim, aut quatuordecim , prouc 

mi* 2^ coiâia auc cirius aut ferius appatuerit, vt docetHip. i. de 
morb.: & I . aph. i 2. Biliofiffima tamen cum Ciz propofîta 
hxc affeâio > primo plerumque fepteiîario eam iudicari ra- 
tîonabile eft . 

. RotiivtcndiMn eft Aceto mulfo^aut Aceto & Aqua^ 

liam yciabetur lib. de aiieâ. , in Pleuritide potiones danda: pîctmtîtir 
®^- ^' &int acidiores > quo fputum de laterc repurgetur ; inter acida aci4k>r ^ 
veroprirQumfîbivendicatlocumAcetuia^obvimfquamex ^^?*^'^ • 
partium tenuitate obtinet craflâs penetrandi, diflfecandique Acetiviies. 
niateriasj naturamque mordicando irritatad expulfionem 
jtuiîi excitata ^:At ne iuaacredinethoracis membranas offcn- 
4âat:,.m€lk>autaquaatEemperandumeft; iUo quidem fi ab- 
fi<:î£onieindigeamus;hacver6^ fidiluere^ feruorcmque ac ^^^^ ^ 
gjdm jcprrigere iaaiîimofit *- Qiia autem proportione mulfum j^a^^a^ 
acetum^ Quod oximeî appellari poffet , confici debcac , dilu- «îamr, sc^ 
QidQdocmiz.ăcmoxh.BthataMtemmeh mqmt, ^eqmltaffîijo 
M^tQ coBumi iţa vt qumtafiicriS menjura coBifndiis 6* acetijvnde 

^ Stcpiepotabilis, poftea quoqueaquammodico aceto affiifo 
iiuîSr ammife^» Moxirneîiîîitiusredditui:,pofitili^ " u 

aimia v^xediae inuci:^bat , Os , inqui 1 3 . zs:,\x%fmcţf^%ie hmu- 

Digitized by 



Baf:, Jp3ifumedmityJîtmfidat,â mxas, hempe 
qtfoi.mmMâMio^mefl tcafUgskţ . Nam meHicratuai etfi mtit. 
tisuomjnîbus expetendumia ihoracisaiFesâibus; cxeoiern 
■cmm^. acut.Pulmimem ^mollit, JpuţHptntoJeraU educityiufpm '^'^•^^' 
Unit if ahjîfrgit; minus tamen £oaunodum eft ijs > qui amara 

bUe abuxi4aiii:ac proinde ia biliofaiuc Pleuritide kre Oximel 

ei aniepoiiitur : ex libro lumque «itato , aciditates ex aceto 

Acetum bi- ^înarabilelaborantibusconferunt^ Potiopratereâliberaliter *"**^' 

Uo|s pto- .ofercKdaeft, -vtmatcriainPulmpnum anfrajâibus .tumfre^ 

quenu%îrim &febre jtum teijuions partisaffidua expectora- 

oHo^"^ ^ione.craflercens, affidue diluatur^ & liguefcat, vtdeind& 

piofjperpiu penicustiiacuari poffic ; QHapropter non ynico^ îiberalique 

"^«^"S: |'a"ft«^auuenda, aie jn veiitnculumiota.confeftim .delapfa, 

iiuuc-3ggranet,peatonyer6pamra.autnihiIprofirj fedcom- 

plunb-us &rexiguishauftibuspropinanda.î it3«tenim>vtJiabe- 

tur iCorde , aliguid lemper per internam Traches, 

iuperficiem delabinir > quod perbronchia immcditatc excur- 

rit.diIuitque:ita&2.demorb., acetummulfum piulaâm isu-w, 
=& ircquenter Jbibendum .tradic:. 

^t ddoriedandus eft caMdctorijs medicamentîs, 

Kil fiiic Hippocrad antiquîus ia Pîeuriticonim curatisiie , 
affe<aaminagis magifquc concitaretur,& jnfercaaîn pJileama. 
.m maceriam ytcunque difcutere atquejeuacuare , priufquam 
vel^mwm peninis incerciuderet, vel , in pus imrautac Jem. 

^yemaps^aret ; nam vc docuitprimo;de,morb.,Pleuriud .«u «s 
jam ^tojftattm,euadimt, :aut i^opioikAtfxidat fuffocaiwur- ' ^ 
4Sî^ autfuppuranmr. .Indiciaautem:fa2c4efe'pr^-b^nt4aieptem 
*a ftdanda '^^D"«>^"î:îîO"em5aut;vndecitH, autqQaăiordeciin; ProJufi 
ItTpS ^g^^^^««dis^atim ab -înido calida adhibere fomcnta 
K.« forre. :^°:Pf^^'e-'f K^^^^^^^ Id Jpfum pr^cepic >. acut. 

ta:iintadibe ^o- ^- -« ^.-xie morb..^aIibipIuries, Atcamenlnticcoiiiaio'""-»» 
^i«"- :ecnxer.^maaduedkntur,- quafî flaginum.&p^ 

<orp<?re,aiec.duînc{€data.fluxioneadiocaIiasdel^ndefe:m6i î^.;., 
dicameuta, gu2.cakf,cieadoat«ahe«emaâis poflfimc , motw 

Digitized by 



ţjumqueaugere : Quapropter,inquiunr> îpfemec Hippocra* 
îiii.8^. ţes lib, de affedion. id prohibuit his verbis • C?^»î /j^^f^»? p/x, 
ideft coăum fputum ypurgare înc^erit , latus.ccdefacere conâu-^ 
cit yfyforinfems matur are ea y qu^ circa latus fimî : prim mitem 
•u.2«. hoc facere non expeâit . & 3 . de morb. > Citm iuâicatîonesjunt , de 
Pîeuritideloquitur, Mentes locoshumiâisfomentis tepefacitt>y & 
oleo illinito JVcmm quam iniufte cam proficuo detrahant conlî- 
lk> , ex ipfkmct pleuricidis generatione , fads eolligi videtur , 
m.n* quam i .de morb. lueuîenter exaratam habemus, vbi affe6tio- 
nem hanc tune potiflimum gigni afîeritur , cum â nimio Vini 
potentioris potu , vel alia edara caufa , vt violent© motu , vel Pî«2rmdis 
fimilibus , totum corpus incaluerit meabileque rcdditum eft : s^î^^^^^^^- 
iHcalefcunt pariter humores , ac hume6îantur , hoc eft y fi uxi* 
lesiiunt : His enim commotis , concitatiique , dum per car- 
nesferuntur, rigor fuperuenit calore intcriora petente . Quod 
vtiqucmuîtomagiseuenietjiîcorporiiţa diipofito fubi turn 
fîi<:^us, ventiue aquiîonares , cfrandantur : cumque latus carne 
nudum fit natura prse omnibus corporis partibus , nec fit in 
ipfo quicquam , quod renitatur y pr^ter ventricuîi cauitatem, 
maxime rigorem percipit: Etcumriguerit, ac reirigeratum 
fuerit> turn caro, quas eftin latere, turn ven^ contrahuntur , 8c 
coHueîknturt&qaantum in ipfâ carne ineftbilis, ac pitui- 
tSE y aut in venis , qux in ipfa carne uint> id magna ex parce , 
aut ţotum fecernitur, inţroq; compellitur ad caliditatem > car- 
neextrinfecus condenfataj acque id ad latus affigitmr, & dolo- 
rem vehementem exhibec , & percalcfcit , & per caliditatem 
^ trabic ad ie ipiam â vicinis venis ac carnibus pi tuitam ac bilem 
iitt.8. g^^^Quodindieauicetiam eodemlib. de ane6l*3 inquiens, 
^iţ^mitm hic morhus maxvrru exţotti y cum quis htiineSîato corpore 
auiJohrUiS , aut ehrius friguerît . Quod fi ica eft , potuit ne op- 
porcuniuş excogitari pra^fidium fub morbi initio in Pleuricide, Pom^nta^ 
quam calidum fomentum ? quo frigefaclum, rigidumq; larus, ^^^^ 
îcuitcr incaiefcac Jaxetur^ peripirabilior euadat cutis^ &c humo- batiui. 
re$V q^i a4 incetna , deniacis niixdrum excerioribus cum car- 
ne, turn venis ^impellebantur, inqueaâe<^âm partem inîar-. 
ci^ntur 3 exrrâ effiiadantur y diffipencur y reibiuantur * At fi 
sî^or fuerit afecîio , quam vt poffit hoc vno auxdio dolor 


Digitized by LjOOQIC 

fedari, itaut ad vcnz fedionem ( quod praecîjmum eft prâN , 

fîdiumj fit dcueniendum , non .ne noxius humor â foţuatte- . . 
nuams cliquatufquet, facilius c parte aîFe<Sla proximioribiifque 
locis hauri^cur, vt dacecetâm Galea*^*epid* fec»5.paru29*, 
atque ita ilîam faaguinis mutadoiaem fperar^^^ 
Hip» de vie* acutân Pkutiucomm phkbotomia€xoptat?iub ^^^^^ 
iiiitioitaque, primo videiicet^ aut aîtero circitet die huiuf.: 
modi fomenta admouenda funr, quo rigida illa quamprimuni 
â latere remoueamr affeâip ^ iiifaxâique euoc^ntur humorcs^ 
atît ita diiponanturj» vc anacachariî , aut vena^ fedioac euacua* 
ri poiSat * At fi hoc tempore haud fe^eîiH: dolor, deiîftendum 
crit , ne â iugi calore cenuieribus rcfolutisparubus, pulmqnes 
exiicceatur xjkcant iîquidem ^ cdida.^ qu^ nimis^calefaciunt & 
fnggiM vU nîndumfngg^aciunt , inquit Hipocr. i . de mor^ 
bis eitat., morbifica materia crafîîor euadac ^ vel nimis ad (n^ 
purationcm difponatur r nzm calida aqua ârppuratoria eft ex 
aphorifn3.22* fee* 5 . Vbidemum fpuca apparuerint cum fîgais 
coCiionis, fi opus videatur eo qupd copiofa adfic materia, nec 
vndequaque excoâajadabfoluendamcoâionem, fomenta 
i tcrum admoueri potcrunr,iuxta prfceptum affeâ:.^& 7^ 
de morb. cit. > qu^ non pure anodyna fine & aperitiua y fed 
coquendapotiiis^iravtempiaftica, obfeuenteque ficuîtatc 
caioreEnilîesâ parte g^miaare vaîeant: quodvdquc noxium 
ab initio fulfTet^rion diim euacuato corpore, Neque de fuppu^ 
ratione cunc aded timendum erit: nampoftquam csepcritnp^ 
3dus bumor aliquatenus euacuari ^lăy quod rcUnqmtur , non 
valdeinârcâum & conclufum eft in parce obfefla,coacepcufq| 
c^orcumrefiidantchuqaore&ipfceuaporaţ* ,; 

^rflrfpkx ^^ ad forbefîdutîî dandomefrquicquîdexcrcauoî 

^^" nemfacîr '^^^P^^^' eftvic^us acutomm es; reineceffitateiH- 

^'^ uentus,, Sorbi* au,îo. 
tio , Cibus; quibus varie pro maiori minpriue morbi acuti^ ^^'^^ 
vx^ndum eft. Et quamuis Heurids morbus fit p^r^utus, 
foîo camcn potu haud contcnâus eft Hippocrates pro Pleu- 
rkicorum nutritione, vt in plerifque huius generis morbis, 
confiîeuit^ folo mcllicrato ^ aut oximilUţe > aqua ex craC. 


Digitized by LjOOQIC 



fîorîjarînâ, aut temiiflimatipiâîia detiaeiissegrotames; ftd ^ ^«^^'î£=<^f s 
forbitiones etiam offert,quauis valde dilutas propinet fub ini- po^i©^ SI 
tio,dum adhiîc morbusperaudus eâ : vnde ^potioaibus cas xe^^nt^ 
inccrmiicet,vt paulo pIeiiiorîvi<âuvires&miorcsfem ^ ^ '^ 

qualcs maxime opus fiint iQafîacarfîârfi,quf no ab vna namraîi 
cxpulfiuâ facultate» fcd muîţu fiinul adiuuante animali perfici^ 
tpr, dum valida thoracis niufcuÎGpim omnium cocuj&onc fpu- 
titm eijcicur; Hincpri^dpiteodcm primo devie. acut,,forbi- 
tiones iiâfce augeri guo magis fputaproced^int, adiudicatio- 
nem vfque » & vlţra per duos dies, Quod perperam aîicui fa- 
<Sium videri poflet , m^dicifq; dogmatibus aduerfari > cum ex 

câ^is. Qaieni decr^to i . de cri£ > in îâtearum & Puînionum pafsio- 
nibus tune ftaţus fît^ cum copiofa £Q<£iaq; educuutur fputami- 
i|ii;inftatu vero ţenuifsima vi6iusradone vteiidum 
aph.,8,> & îo.iec^* I. Giii dubitationifatisâciemus turn ex 
iam diâis , ob peeuîiarem Thoraciirorum morborum condi- 
tionem , qui , dum fputo iudicaniur, validis non modo natu- 
ralis facul tatis , fed animalis etiam viribus iiidigent ; tu m quia 

jm.7. iî verum eft^quodHippocE* modern ţ«acut* ^otulit^quod do* 
Ipresin Pkuriticisibtipa fbaipQnţeceflânt^ vbi memorabila 
quid fpuere>ac expi^garieoep^rimî/quod «yiidem non aîiim- 
de prouenit ^quân^ quod morbificâ materia ex parte euacua- 
ta^ incipitinflammatio detumefcere, minuiturque tenfîo; 
ynde c^tera iymptomata mitefcunt ) dcciinatio ha^c v,etuis ^ 
quam ftatus nuncupari poterit* 

Et baîaeîs vtendum eft quarta dîe . Quînda aiitera, 
& Sexta dleum illinen4um eft* Seprima îauandum cft 

fîfebrîs dîmîttere non velit, quo pras balneo hdot 
Cohtîngat. Balnei quemadmodum plurimus fuit P^ î^^^s ^^^ ^ 
temporlbus vfus in valetudine tuenda, itâ& in morbis ple- iîteacio* 
lăs'it* rifquedepelleit4iseohaudadervriconiueucrunt* Ma^ad- 

moiumfmâere^ţanH^ inqtiit Hippocr, 3. acut* , jî^^^r ami ^^^ ^^' 
TeBe'îfaluitfhalneTmiyalieaffeBamî^ ^ lauari fumt ^^^tus : ^vd^?^ 

"Vtl^mturjincn fuermthtî . In Pleuritide tamen & Perip- 
neumonia pccuiiariter prodeft ob prarcJaras facultatcs,qu3e 3* 

Ff acut,> 

Digitized by 


22S mpmcKÂTisLiB. II. DE LOC. m hom. 

acut* cit* y &in aphorifmis^ei mbuunturylate^^ 

zo^dJ'ln. & ^«>^^ dotoeni leniendi 5 fpucufn mztmanâi^ acque educen- 

mSrbis pc- Ji- faciîcîîi rcddic fpirationem, cutis fupcrficiem emoiîir^ qu^ 

^^ omniam thoracicis curandis affc<Sibus quam maxime expe- 

tuntur ; eaq> prasftat îaxando y kmttr digerendo>euocandoq;i 

vt de fomemo dîximus,At ipiiim admouet die quafta, tranfa- 

&o videlicec principio > appîurefitibus coâionis notis > deple* 

toq; aEquatenus vnxuerfo corpore, vc fupponendum eft:quin* 

immononniiî femei eovmur;repecfEq; ni morbus ceifet, 

feptima die > vt pericula cuîtet , qux ex nimic ipiîus viu immi* 

5.aph.56. nere poflent :n am caJidum , diccbat Hippocraceş in apb* > ijSi 

^ ^ , ^îfi fojiîii^ ipfovtuntupyh^cadfert incommoăa* Camium effasmniU 

cumenti, îtonem y neru&rum tmhcctUitaSem > mmtis tm^rem i & f qnoa 

GâU? -ph. jji2gi5 i jj propofito caftt negotîum facefsiţ^jâwgî^mii p'ofiuuiâ* 

xo^e£h.îo* obfluxion€snamq;ba}nei vfum plurimum excimuit Gateij. 

5-âcuwex. ^jj internis^ inflammadonibus , nec non in febribus putridis • 

At fi parce eoquis vtaturyvrhic prgcipitur, cutis ipiracuîa 

aperiet , rigidam in latere difpofitionem remouebit, euocabit 

humoresy difpon^^; adl -fudqrem>qui fepe^xcitarifoletia 

morbo biliolb > cuiufmodi eft propofita Peripneumbnia ^ 

Pîeuriti^ .. Neque<îei3i|xlonibuS' ţ^de txmendum^eric, cum 

tepens balnenm tam rarb adhibitiim, fuccos nequaquam pof- 

iitde facili eIiquare:cxquodicebatHippocr.eodci^IiK de 

acut* Balneutn pleriJqHeinmorhis zftefitihns confertyin his tpd'^ 

dem afpdue ; in alifs verb non . Intermedijs verb diebus vniăio^ 

ne dumtaxar contencius fuic > vt qnaefatis fit aA^oBem qua* 

litatem reruaadamj quam die quarta balneiim inuexerat* 

Quinâă ^ & Sexta fortifsimis vccnduţn cft excretp- 

rijs medicamentis , quo fepîimaţn dîem quam fâcilIi-^ 
me tranfîgat . Cum enim peracuta fit propofita affe<âio , 
plurimiimq; biliofa , primo feptenario fg piffime terminări fo-. 
let ; ac nifi fiftatur fl^xio, maceriaq^ in Pulmonibiis inculcată^ 
vtcumqs imminuatur , craffior â frcquenti j^iritu reddita^ ^^^^ 
heJitum intcrcludit , mtFoeandoq; inteţimit . Jure ergo :4e 
feptim^pLA^aîde foUicitus cift, & priufquam âdfiţ>PuImones 
qu^^ poteft^ sieabiUcs reddere ftudet ; ac qu^nadmodum 



Digitized by 


^mîs diebus folcmniorijbaş f emedijs^ ţq^ 
pus euacuantibus v^^zifk^rc^^nâmi^jt^^ ^ 

mum ceclegmatibi^iqoe^ ^abft^rgendo^ M^ ^icsZ ^ 

luendo , atque îrritao do > txpaâoriâ^M pron^puarc j^iTunc , 
quammaxime încumbit» Plurima veto ^x expeâoxoadbxis 
huiufcemodi recenfoitur lib. 3 . de morb. , qui$iîş,vtpote ca- 
^^ ^ lidioribus , acrioribufque^caute vccndum erit* Atque liiec câ 
Pleuritidiscuratio ^ qu^ Peripîieiiî^omşpariteEaptaripore- 
rit., cum yxraque Pulmonum fit fgritudo > neque ajiccr diite- 
UQt, quam quod illa rna tantummedp pârrem>haîc vtramque 
aii.25* occupat , vt pate t ex ăiăis . Ita & 3 . de morb. Cur^e Fleurî- 
tidem hocmodo cporteţ , înquit , i?f ţlurîmum ; *velut Fh^enitîdcm 
^ Perîpneumomam ; _ţraeter^uam^wdj?tc ialnds cdiâis iţ Vim> 
«^M- âulA vtmdnm efl; Se iib .de aiFeti Per^ptusautem ^ forhitUnes^ 
^vmtrîs JuhduBionemacfrij^aM eadem.curaîo^ih^a^ 

Poîlqaam febd? dîTOferit.itue Sepu^^ 
coatingat forbîtîoBes quâm debîlifsitn^ offer^^^^^^^ 
noh certe quod tune temporis aenmus numendum fit ^ cum 
«U.5. x..devic.âcur. So^iuoncsproute 

gendascfle docuerk^ crairfaâoquemo&oxdeiâk^âipot^^ 

vacandumiiti vnde&dataibbre ^ criticcîs bic^tituribrbitio- 
iiibus , qu3e proctaduKo magts iiutriunt , quâm feoî^eacc^; 
quas «quum eft prius exhibuxfle , cum excreationem maxima 
^ cxquîrcret. Mqmââare^ookimsT^^P^^ P'^^^^^^ 
*^^*^ Hb. de affeca. , alicamdato , d? ţtifanamtntkeămyh^^mmfor^ 
litiones fmtfirtiores ^fed cum pera<£biudicatione :, & fedato 
iam morboin eadem vi<aus tenuitatc biduo 4enacndu$ fit 
iEaer ex tcx.cit. de vi<5t* acut., quo magis in yalcai4ine^fiabi-- 
lîamur PIeuridci,qm iam iam ab Horaiauciî^s er^ti imxhSc 
ab omni recidiua tutieuadanc^eo m^is^ xjuod debăes fmt^ 
rieâcopiofo alimentofuflfocentur; fubitaquc^euiteturmuta- 
tioâ tenaiiisimo .ad pîeniorem vicium , qus iensim faaenda 
cft:, vt tutofiat • Cumque viâus Pleuritico coimeciens te- 
nuifsimafit forbkio 5binc4icitfedatafebre:haGC.^e.o£erc^ 
damVin eodcm icilicct vidu aîiquanti^er adimc^flepexfii 
ftendum^Sic fie Ub. 2. ^e morb^ in primaPIeudndis ^ecie. 

Digitized by 


1 3 o mWmCRJTlS LIB. IU DE toc. W HOM^ 

Vhi vero febnsJmifmt, îtKjuitj feirWkmni miUum hîs in Mei 
jfor J^f # Sao^tertextum hune a M 
- xnutatts verbis> cam Zuingerio : qirod tamen minime nune 
necefeearbitramur, Gseteruniqusrfintdebilifsimsecumibîv^ 
bitiones, turn alimentav docuit HippocrJî vet* med^inec •^^ *^* 
non lib. de âffe6i , inquiens . Leui^hna Juntciharia d? potus , 
Cibî&po* ^olfomayqu^ moderate in corpîis^^m amplimjH*^^^ 

uJMmT^ pr^^fiodum > neiijue^re]^eHQnem'€xhîbenî l ne^ue tormenp neque J7i* 

^concoBa fecedunt y^ţeromnemâiem invenîrming^â, mini* 
me malejiajunt , etiamjidm ante ingefla fuerint . Gratda autem 
funt qim moderate exhihitayaut infrâ modunti repietionem,^ dolo* 
rem exhilent ,^ ^«^ neque dari^ neque^edi^^eque hibiţoQimt,qmn 

edat, etiamjîc dolorem exhihmt ,^ non pro ratime fecedunt * 
Ita ab efFedu huiufmodi cibariadefcribic Hippacrates,quem* 
admodumâ priori tic eadem explicat libi de vdt; med. Quod na, 24. 
in vno/^/jne fipte, ^humanam^aura potent eji, qut^uenm 
. P#^ fi^psrare^ hocipfumUdersJMxerum > &hp€aHferrequaJhie^ 
^id^"^^ ^»*- ^ortiŞmum autem eJiîMter Mda dulcijfmumyint^ 

amarifjtmum , /w/^r adda acidiffimum , ăî pmnilus adeo rehus vi^. 
goripjeacfumnum . & paulo inferiu^j* RpW , &aupmnţum7 
iralimentum pr^fertimper nihildiudcmtmgit , quam^uodpro^ 
hetemperatum eft» ^nihilhahet intemperatum , neque forte ^fed 
îotum imumfaBum. efl , it fimplex 6* non forte . ExpefluĂ iiaq^, 
primarum non modo , fed fecundarăm muko ma^^is , Se terţii 
ordinis-qualitatum in caufa eil, quod alimenta difficilius fu- 
perentur ab humana natura , inque fuam cranfeant fubftanţiâ> 
eaquc dicunturfortilsima; quemadmodum temperata^ qu? 
facile tranfmutabilem nada funt fubftătiam^fiue â natura, (îue 
âb induftripr«paratione> ea debiUfsima leuifsimaque Hippo- 
crati nuncupantur •.. De forbirionibus verd ibidem fîc pariter 
îocutus eft . Sorhîticnes inuenerunt pama exfortilus multa aqua 
permifientes , ^ rahur ipfum temperatura dr co0uradetrahmtes: 
<^arumvfumfic citato lib. de affeâ. expbcauit /Sor^^^ 
infmn^hisomnilm dasoauîptifanamymtr^^^ 
m aUcamt^qmctmqmex bis dederij ad p^e^^pmad^Cy^ 


Digitized by 


mA^sţercoUOidt itădoraţotîus,qiîifdfiora,aut et^oraXi^v^ 
riad rohur,aut ref0cillatime,craffîoraipi»guiora,^ moderate coBs 
^c,Aii<:a,velut6mmum rohujii(pma,Sfii'rina veîut hîs niupior. 

Si euacuatiooboriatar, fîquidem tuuenile adhuc 

- ,. r Varie apudrariosha- 

cft corpus ,pows auferendi Junt .^^^^^ hfcle6Hoîcom. 

muniternamquelcgitur i'r/W*, hoc cft , Enacuatio . Vati- 
eanuscodexhabet>:;5,^f, idcft, Pimâio, Caluus a«v//o/^, 
hoc eft,SiQgultus . Nos vulgarem magis probamus j nam id , 
quod modo confulit Hippocrates , fubons cuacuaaoni mc- 
lius aptaEur,quâm Singukui auc pungenti dolori , vt iam vide- 
bimus: cum enimfuperius dixifletfebretn peft adhibiţa me- 
dicamenta feptiraa aut nona die. ceflkturam in Pkuritide , fi 
de morbo fcilicec iam tfiumphante natura, fauftum cxitum 
habitura fit, ac nil interim periculofîus accedat , qu©d rem 
fecus fe habere denunciet ; docuiffetque quid fit agcndum fi 
febris.vtdidumeft, profperece&t; iam innuit quid ag^e ^^^ 
debeamus fi contrarium eueni3t,ac qnidpenculoium acceiie- <te «eami- 
xit, qualisefteuacuatio, feu aîuiftuxus,Pleuriticisquâmina- '^^^ 
ximefi»n«fi"S» vttoties didum eft . Tune^ «şaio «bo- 
pîiuscopiofîsadeopotionibus , quales in ţhoraciciş morbis «•^* 
îupra probata: funt , effe incum^^endum , fed aliquantifper 
temperandum ab i}s,ne aluus magis laxetur, deijcianturqua 
' vires,abfqj eo quod aliquid de morbifica minuatur matena : 
Idq; prscipue agendum eft fi ager iuuenis extiterit,ac proin- 
de nequc tantaadfît craffities in humoribus , neque adeo dţ- 
biiis fit, vt noxiam q:iî«eriam , nîfi quâm maxime dilutâ. 

tur excrementa,qu2 ab imbeciliioribus eorum viribus mh di- 
lutiffima , eJjci non poffunt : ac proinde â potubus non adeo 
comnwdc vtiuuenMteinperate queuatm his afteOibus . 

^^ Atvcr6fttppuratiscaputpurgareoportec>non suppug 
fortibuscnedicamentis, fedpaulatimauertereînnâ- ^^^.^ 
res , & fimuleduUis vcnirem fubduceatibus vu . Et 


Digitized by 



mm |M:iadpmm m<)rM!K>n dumeft 5 fcd coflaxus 
verţîtur ^ ac vergit ^ excreatioîiem facere ^ & iu](sim 
exckare, & niedîcarnentis infufîîibus in narcs vtîy 
& cibis fîmuî iogeftîs • Cum aurem excreationem 
facere oportet^pluribus cîbis&falfîs, acpinguibus 
vtendum eft j & vino aulîeroy &cum fie ibaaci: , tuf^ 
fis indîiccnda * 

MOrborum ^ quos â cerebrali iîuxîonegigni demon- 
ftrauic , curarioiiCHi proiequitur^iuppuradlque in hoc 

curauo . ţ-^^tu opkulari inftituit, per breuemtamcn , diminutamquc 
propoîiit curationem ; icâyc proxime podus immincns Em- 
py ema prxuertcre , quam pra^icns curare doceac : Quaprop- 
ter qua^cunqu^ ad abfolutam argumenci huius traCtatio* 
netn requiruntur, exliK z.dc morb- eru-nchuc transferenda^ 
Tbide tmorbonrm curauonjbus ex profcAb agitur. Suppuraţis 
itaqxie > feu potius , futuris fuppuratis ; vbi fcilicec morbus 
nou duminchoacus^ft , fed fluxionem ad hoc tendere atquc 
înclinare obpecuîiares condidonesfapra t.23,aflignatas va* 

^^ : xijs^ fignis colligîmusj tunc'primdcaputpurgariconfulir, 
flipdonenique auerti ac declinări tumad nares^tumad alaum# 
<^0d vtiqueprf cepaim no buic vnijfedmoxbis quibuflibetj 
qui a flttxione prcmcnbnt^ eommune eft . Notum eft ilkţd 
Bbri deliumor . Fiepenîium humorummedela declinatio , ăenua^ 

gea<:caiis<:a ^^ ^ ^^^^ > moblijjfia , qua maxime Teţît ; autreuuljto tn Juţer^ *"^ ** 

tihmjlnximetentatîs^:timf^ eflfms^ 

Vnde& j.<!eiBotb,încuratk>ne edamPetlpnra mi. zj. 

rintab initio caput leuiiis redd^ndum ^oluit ^ qu6 nihil in* 
îluat ad pciSbs . Ca^tenim id caute , leuioribuique medicjs 
moidsperagendu m eft, ne nimiiim agitaris in capke bumo^ 
ribiis^inthoracevehem:enmisin:uant;qua4ecau62^proc'* *^ **^ 
ftcrniitatîîenta in ^omnîbiis pe<iîoris morbis improbantur . 
stcrhutamc AMum lubricanubijs iddem-eduîijsfubducit,^^ 
moflS^^ "î^^'^««V^dflTixiGmniâpe<aore.deriuandâm 
probantul . piandum;; aiuus ecenim cxiaanitatrahit^ coto corpore,& p«« 


Digitized by 



cipucâca|>îre; turn v£ corpus mcabilc vcâdn , febremquc mitioremrnMi Tt legimr libro j .de moîhis peCtorîs 
oportet infernam alutim ne^uă 'oalde Jtfpprejptm effcy nefelres 
fintacut^ ; neqne valde egerere , quojaliua Jurjum educi pojpt^ 
i/ ^gervirihus valeat. Pofthaec ad pr^caucndum ne noxia 
materia in pus traniinutetur , ilîam pnini arte expectora- 
re tentandum cft , tuflî excitata faîhscibarijs > quse-vioiha- saifairritat, 
beiit turn irri tandi, turn abftergemdi atque actenua^di; pixşgui" &f K^Tirl 
busitcm, qu^elemunt, niateri^que exitum faciliorem red- ^î^g^i^ve. 
duat : Quod ipfum obferuauit Hip.lib.2. de morb. in fuppw- & meabiie' 
ratis cx Peripneumonia, cibos exhibens quam laliiflîmos, acq; ^^^^^^ - 
pinguiffimos . Vino denique ycicur aufterb , vel pouus, {nh- Siippiiraii* 
.ayfterp > & quod modice cal^. ii| , ne , fi nimium adiirjfîgac , g^^^^ 
cphibeatfputum : eteaim Vinujn huiufinodi fuppurati^ pliiri- piab^rHip 
bus .nomLiibns prodcfTe poterit , cpm & leuicer irritanck> %uC* F>«atcs . 
fîmexcitet, promoueacq; cxpeâorationem ; flaccidbs y ni* 
miumq; laxatosab excrementiciahumiditatePulnscmes, & ad 
putredincm diipofitos, leuicer exiiccando corroborat, &i 
putredirie tuecur ; Aiiflerajiqmdem , c% Hip. lib* de .affe<^. , ad Auiiera câ- 
robţ4T ^ Qccîî^mteofmnodA Bint . Aiuum denique maiîu tcnet , ^p^^ ^^^ 
njC quacunque ex cauia nimmm laxcţur , cum inj^ximo virium £ccitatcm - 
diipendio :; bipc enim &neft^^ 

profluuium . Alba mitem 'vina , & aufisra, inquit lib. 2. de ^F^i^^ 
îiu.î5 ► diâs c. cdfzciunt , mapjque ^vrinam cient, qumn aluum monmti ^5® siaium 
»tt*44- vndelib.2. de morb. fuppuratis ex Peripneumonia fuccur- morb.fik^ 
. rens> fufEjtmigium inftituit ex Sij fucco > laâe, & vino tornio , 
feu poqus tortiuo, quod poft primam vuarum prclturam prf- vimn» tot- 
Jo cxprjimiţur, itan & acinorum > & corticis > & racemorum uium quod 
Juccuş extrâliatur^ indeque vinum aufterumiacerbumqi elici- ^^^'^^*' 
tur , qupd exafperandi vim babet atque irritaadi ♦ Cel&s pari- 
tcr inTabidorum viciu vinii probauitaulierumIib.3.cap*22* J-^i^s^a- 
quod paiîim in cmratabis obferuauit Hippocraces^vt viderc numo^cre- 
;.; cftlibro de intern. a&a.& alibi • : dumdi. 


cîiraao . 

xxxm I^^^bîdos Jteiiî eodcm modo , quod a4 reltqua atţî- Tabidarum 
p^ cjirabisj p^^ter quamquod cibi noa moiti Jimul 

ingereadi funt > &oblbnia non plura ţ quam cibaria 


Digitized by 


254 mFFOCKJTlS^ 

frametîtâcea f & vino inter alendum; vtcrKÎum e& 
aquofo , vene calfaciat 5 &corpori debili exift^^ 
caliditateiai cxhîbeat ^ & fîmul ambo caîftcîant in €0- 
dem tempore>&câIîditatenîulcumfîîîxunimducant* 

EX iuppurarione ad Tabem curandam defc«îîdît:coîifeâa- 
nea? enim ad mukem {unt ha* affediones , vt diâs vîdî- 
. mus, multaqttecoafimaiâhabcnt: Vtraquenamquefepiffi- 
mc 4 ccTcbxzU fliaxione gignicur ; ycraquc fpiritalia obfidct 
iBtml>ra;invtraqueiccircdcuranda iîuxioprimumauercen- 
4a, acqnefiftcadaeft; mdxexpeâ:o3:acioproairanda;aluu$ 
rat>iaoxum iamediocrkât€c<mtinenda,IUadtamenpeeuIiarchabecvc- 
^mk^^^ ^^ Phthyfis, quod morbifiea^cks mat«iâ aerisatque erodcris 
^Emp^ko- cft , &exfemido ac putrcdiE^rfe piUmomim vkere fcntam fe^ 
'^'^^ bremperpetuoadri€xamiiai>et, âquapartcsibîidaromîîesm 

fummâm deducuntur maciem ^ <juapropcer maxime iangu^c 
«atura» î^Uiifqţ^c^orfummc imbeciilis^xîftit, Hincfic> 
-quod cibi baud ica mulţi fimul fimt ingerendi >-ne tenuis ofa- 
cuamr<aloi^ neq; plu^a, hoc eft^ neg;alia<:ibaria offerenda cx 
tera etenim, qu^ Suppuratis proponebancur, piiîguia &: âlfâ> 
îâ^â^ac Tabidî€ intern. atfe<â.m na*if, 

^^Mmkz. ^^^ ^^^ <^^ci€^^x;Capitipjmspur£aurpharmacîs adnares appih 
ftis : Ctbaria ^ohfinia ientttr neqtiepinguiaynequenidoroja ,ne^; 
^.3ti<fe ^3îa*ii«^SdUcet quod fâcultatem habeant^rodentcm vim 
âugere inaumoribas ; <Mm frumentaceanattuo lentorc iî- 
iam potius obtundant; neque ab igneo Tabiderum calore 
corrumpuntur ; nec facile diffipantur, ţferinmmqttcjitiţriunfi 
HithyGs^'aa nam cum Phthyfis vjîde ctonicusik morbusv ita re ^d fepti* 
^qu^l'la «^«^^ v%ye annum , & ad nomim quandoque exteadi poflSc, * 
icxiendimr. exîib.s.demotb^ Sc^mt. aârea.,'pîemoremproind€rcqui- ^: 
îitviâum^quoviresperdurare poffint: Vtque dicebatAra^ 

v^^l^^oihciîianequiîcmficerei^Hodautemfacmmum minus l^T 

xanderPetron. lib.udeaItto fÎRemed.molI.cap,^. in finet 
acriccr eos Medicos orpit , qui pra?dura« Limacum, Teftudi* 

Digitized by 


ftum^ cxtetorum(^e teftaceormn > & cruâapcomm carncs 
Phthjrfîcis , atquc Hcâicis^quorum vcntriculas imhecillis eiti lil^cSC 
quotidieofferuni:, quippe quz ab Ms con&d nou fine graui ţ^a^f^ 
$/dea- noxapoffuntî nequeGaIcnumre<SieiateIliguiit, dum de ani- piuhyiîcis^ 
•^^^ 0iaIibus^quibusteftapiocuteeft,laqukur,cxhibetq;^ 

modixibaria ijs , quibus ingefta in ventriculp ob praups fiicT ^^^^ 
cos corrumpuntur } nam recrementa, qusep^m âTăbidis bus conue^ 
marcida&purulemaexcemiccHi^icimus, none wHtxkuIo,^^^ *^^" 
fed e cîioface magis procedunt ; ijsqne tantumodo alimenca 
hsec vtiîia cxiftiînt,qui, quamuis valde graciles axquc extenua- 
ţi, ventriculo tamem maxime valent . Huiuimodriunt viri qui- 
dam ftaui , pr^calidi ^ iracundi , macri , nidorofos ru^us fgpe 
teddences , in quoriim ventre leues ^ cibi putrefcnnt , graues 
b^iecoquunmî: >. Haec vel fîmiîia Petronius . Sed pace tanti Cma^cca^ 
Vin noa video cur &Phtliyricis, qui hectica febreperpemd ţ^^, 
to^enmr, ventticuliq; fubftantiamigneocaîorcpr^calîdam quciie^cis 
iiabenc> cibariahuiufcemodi profuturanonfint; qua? refrige- 
t^ant > & vaîidum prsegant alimentum ^ minime putrefcibiîe> 
aut diiTipabiIe;cusi^oTeî^culi imbeciUitate aliter âcq;âîiter 
Ol .pMs4 pofe^ > comm^ robur co(9:ura aut mixtioneiras;* 
«, ku^ varias & potiones^ iciorbitiones rcdigi. Etiî quis 
debiîior &t ^ quam yx |K)ffit ea iiiperare^ Cancros exhiberc ^^^ 
Boterimus^qui es biofcor.lib,2.cap.9.> carnem obtincnt fria- ^^^^l ^^ 
bilem^qu^q; facillime digeritur; hifquc morbis â tota fubftan- ^^^Sf^ 
tia opitulari creduntur • Vintim prseterca propinat , vt debilica- 
to^corpori, & db folidarum parcium cxfîccationem pene refiri- 
«^erâto, Cî^itatem, velpotius caloris fubftantiam commu- 
nicet:eK vino etenimfanguis, & fpiritus augecur, â quibus ^^^^^ yi- 
natiuuscalorvclconferuatur, velreftituitur^ Exhibet tamen ^^^^^^ 
aquofum » ne nimiiim calefaciat > ita vt adauâo turn a febre » 
tum â meraciori vino excraneo calore > corpus] magis elique- „ 
fcât > maioremq; inducat iîuxioncm. Cdefcmte corprre, inquit, 
m^iu Hipp.- 1. de morb., humidm maxime eH^natur . Etqu^ ^ui- 
^ ' * demj^ţemisfartibmeliqiiatm'y injupemum vmtricuiumma^ 
ximecgnjluity^'pusfitadhocyquod iaminiffoefi^pars'oerQdm 
etimtin infemum vmînculumjluit ^ ^ ^uandoi^ue duusaiipjf- 
tnrUtur , ^ hominmpmmit : mm ciUin^^ificed$mt inconcoBi^ 

Gs d 


Digitized by 


3^ MirromAfu un. tuimioe.msojiL 

trjdjtente; if â (pMtaqmdemJuffbcatur, ^Jkrtitdum nonpurg^ur; 

kvmtre'verofiue^e ăeUlitatur > ^ţlermnque psrimtur^ Se zA^ 

^^ ' v^ nUomfirni^dGTwt pvnis Jme^ 

effimdit^ qmdmimmoua^c.SHcci{a.^âmQ<mmc&hmc^^ 
tioyqumviK aliîid> quam Tabi<k>nmi regimeii coatinet : ^ua* 
propiier fuppienda eft , vt de ftîppuratione pariter diâum fuk $ 
ex alijs libris,ybi fuse argumentum fa oc pertradatur. Et quam-. 
i^SS^ ^is lib. I . de morb. & alibi , morbus hic inter eos aff^dus re- 
r^ preferii cenfcatur, qui neceffitatem jbabent^vt ab ipfis perimanţur dum 
^^tg^ fi«P^pt£efcrib&£uriidhiIomîniîS.cairatiofîesc<^ 
ciaipeSHtcs ficis, nonvtiquca qyoexaâ:e€urentur> guodjmpoflîbiîe eft^^ 
f^m^" fedpotiusycdiudusferuentur; fepcŞim"&ad2 
adtrigmca-» znnos cum hoc mothossgtos riuere poiî^% ipfamet expe-* 
f^^'^' ncntianoafemdxiocuii:. 


XXXIV. Cuîîa porro per gulam flîixus ia ventreţn firoccfffc- 
rit 5 morbus infrâ fit , âliquanrfo eriam fiipeme. Unic 
Hoxioadve fîquidemin ventre doîorinerir> fubdueenduseftpfife 
Hicttianu jjj^jjj medicamento,aut fucco ; deindcpfaarmaco for- 
tiore vtendum eft . Cibis vero aluum fubducentibirs 
donecdoiorperfeueret ; Vbi vero dolorfedetur, cibis 
validioribus ytatur.. Eodem modo vbi morbus piurcş 
dies haeferic,eurabis . Si vero debilis fuerit ,& pr« im- 
becillitate faasc oflferri aon polfint , primtim quidem_^- 
ptifan^ fucco per clyfterem infufo , altius eluenda eft ; 
_ poft, vbiper faune purgaucrisi aliquoexadftringen- 
tlura numero • 

INter occultas capitis fluxioncs text. 5 . lib. huius cnarratas ^ 
ea recenfetur, quaî per palatum atquc oefophagum ?d vca- 
triculum defcendit , vbi fi nihil immoretur, fedtnteftina prf* 
tcriabens, deniqueper federn extraemiuatur,jmlla grauio- 
ra in uehit mala ex ijs;qu$ ob a««h mtrofamquc facultatem 


Digitized by 


«oâenao inter4uiB «xeitarc foî^^in t)^ bonis «oawmeran- ^Sk^^ 
dumerit. Ac de'ftuîciombushuiuânodiloquensHipp.Ub^^e ^m inter- 

extremm potemttmacîmfiereon: ^ fiqtddm muîtmtfm^ 
aehumîdtmflercusiumeBarepoteritţjîvero fm^dam^'uonhoc 4- 


ioflteKtu ,ciufquepr*&itur curatio, vbi videhcet infefta ^^^^ 
maceriapcr fedem nonexccmitur, fednuncm venmculo^ 
nancininccftinis detenta, varias ibidem parit aftectionesi in 
veatricaîo quidemnaufeam , inappetentam , imbeciMitates, 
dalares î inimeftinisverd, dumlentus& viladus humorte- 
tiaciter adharrct & obftmit , vel in-fîatus diitendeateş a^calore 

vertkuvafmina cxekantur vehemenaffima:ac quemadmodu 
fymptomatahac-omnia â repletione origine ducuctca meua, 

namprimdaluumlcuiter medicamentofubductt, quod^YW ^ ** 
mdxfomori vtitur phartnaco ad ipfam pitmtamxdHSendsp, 
<juamattenuantibuş,aT>ftergentîbus, coquentibu^uepj»? 
praparaffe fupponcndutn eft , ne , dum valido catharaco^d- 
h^reatem tenadier materiam ft^m euacuare ftudet^majora 
inuehatmalaVUIud namque pro certo habendum js inte- ^ " 

ftinorumlaboribusvîx vnquam fortiffimapharmaca 3oc^ ' inttftmB 
liabere, vt qua:fuccumc ionginquis partibus adfcdemafie^ „^S''^. 
aatn deducere valeant, obftruaionemqueaugere 5- corpus ,ia7atjain. 
etiam debilitant fubtrac^o alimenta, vehementiqae^alate 2u«T^ 
fteicora magis adurunt . Satius igitur crit i)s agere,qus ioeceş, 
an. ij. foUdiltnqîescremencum leuiter euacuancvt pracepit Hipp.J. 
de roorb, incuravoluuli, turn ad paulo validioia accedere , 
vt diaum fuit . Cibaria etiam eiuldem facukacis ,^it£ icflicet 
^duttinducere oata iunt, exhibet dum dolor infeftatv ipfo 
autemfedato," adreficiendas vires vaUdionbusTatur, ^a: 
Tberius dimentumimpertiri valeant :' <iuibus ijfderacatmo^ 
a&us, vbimorbusaiHiaspermanferit, curauopromouend* 

G g a eft • 


Digitized by ^ 

^^8 simomMmuB^tum WG. m som: 

cft . At fî^debîUdr 3î]^tik, qulm^ pc^tiam diSa^^îi^ 
inaci ferre , turic alaus clyftere duenda erit^quod vim tabek 
abftergendifimu!âtqueemoiUendi^u^kndique>cui^ v 

>eil ex i'ucco ptifanf /Morbofa vero expurgau ^^^^^ 
gtnm cottfulîc, & roborantia> vt infimus iade roboratus ven- _ 
cer y neque adeo prompte iafefta recipiaif; i^cepta rero con- 
coquat , ac demum excemat : aam y t annotauk Hipp Jib.3* «^Vf- 
Ab îtttcfiî- âcxxuyxh.Sivduulcamoto yfehrisipfum corripiizty defveratm e0* 
luuîo febris oD lapias , quaş reperita luperiori morbo vircs :f&rtaffiş mim 
Ssî«iJr. ^ ^^i^^ aluusfiluta ipjum qccideriu Hxc Hipp» fepe namque 
* poft faeiiiora inteftinorum tormina aluus , quse prius maxime 
adftri(ăa erat, im modice cietiir , eo quod ipfprum facuîcas ^ 
pene abolita fit^cura tamen hsec eadem^ ( febris fcilicet^; âli4 
îîuxus) fi volu«do adhucvrgentefuperuenerint, pituitofas co« 
quere materias,vc euaeuare.poterunt;^cque ita^nitatem aff^ 
re t vnde iilud 2.c^iâ.£cc.6.Volmilum filuitfebris ţ^ dyfmţeria 
cifra Marem. Iure igitur corroborantia in fine prsecipit îum^ 
/^ : ^ mus Pr^eceptor^ vBi iHlicetmaxima adfît m^ 

sdftringentibusLetenimcorroborata natura , fi QuiAinuis 
iioxium adhuc latitac ,{dtcilius deturbari poterir , " vt docuir 
JucuJentcr etizm Gaîenus 2. de aîim. fac. cap* 2z.Sc îib^ 12» 
fn^.cap.7» ; 

- î. r '^..■^ - ' ■ . . . , . ■ ■' " 

XXXV. Cumautemretromcimesiuxtâvettebrasfiuxus 

«SbS« Ş*P^"«^î'«^^op'2mfecerit,ficmederioportet. Caro 

cw»ii4i»ş. in cqllo inter venas cruftlstribus vrâtur;& vbr vfle- 

' ris >«>aftringatur , & cicattices quamtehuifsinuB Ja- 

diicantur j & vbi fluxum obturarîs , medicarnentuin 

in nares adhibcj vt eo vertatur , & aliud r urfus donec 

auertarur: &anrerioresquidem capitis paitescale- 

fecito , pofteriores veropcrfrigerato : &pofîquam 

interioribuscapitis partibus otcalfaSus fuerit, cibos 

cdat quâoa pituitofîfsimos , ac minime vcntrem fub^ 

ducentes, quo fluxionum mcatus in anteriore căpitis 

parte quamrnâxirae dilatentur i Poftea vbi ob:urari$i 

- - ■ ' ' ' &■ ' 

Digitized by 


, coMJimiTÂSJisiuysTKArvs: aj^ - 

&^ii«l^rîs Auxionem ,15 <juid pmiSy^Hâmcuraris 
luxam j in corpus peruenerrt j fîc mederi bporret . 
Siqqick'm ma|is âd cutcm feceiTcrftyexternis parti- 
î)uş fomentum adhibebis : fi vero iutus ad ventrem y 
fodsautemabQ canfpicuum fit , medkamenrum bi- 
bendum dabis. Si vero in vtraraque partemiab vftraq; 
detrahes.Verum hoc ftudio habere oportet,vrproxi- 
-mom exitutn fecias îfîaeinferne,fiae fuperne , aut 
etiam aliquaaiiacorporis p3rce,vbrexitus funt . ' 

X TYdropisfeuii» ideam , quz occalte fitfiuxione. excitata |f°ioM td 
l~l per carnes , pluribus explicuimus ţex.3. • fecundi hui«s to-^ cu- 
îibriycuius ciirado iam liiodoproponkur jluci^eiwriaus, 
atque dilutide «naffrata . GumiuasindicatioQes Se  matern 
:fiuent& , âcabea^qua iamfluxit , defumit : ilam âpoftics 
ad antieas part^errhinis reuellace conatur ; priores vero vias 
vftioHibusexficcaiido , denf andoque , & refrigerantfcas coa. 
^rfl'^eHdo iiMefc^ă îptenuiiijnaa tamen vftionum-itigmata 
relinqui ftudet, tfei Cv&iffiotz fînt i coUi in diuerfas p^ECces mo« 
'tioBes-HapedmmriieaK^erd.paKim refbluentibus difeipaţ-, 
partim permcă&ifr' ediK»- j adcpios magis vei^ere confpici- 
'Lti iuxtâ apBiM^niii^frxceptumfedt. I. Q^jucereepor- ^^^^ 
,ta>iuîfnăxime r^uktreoÂucereop&rta, per cemiententes locos» quanjpro- 
^nodo iîlud obferuetur , vt exitus aSeda; pardi proximior eli- ^^^fj}^'^ 
«atur ; Quam eaudonem etiatn infia repetit , mquiens ii^^te" 
^rîmm&rhleA ţartSiquapeodmiftmte^ceniifunt-, ^^K4|uy>- î*-3-tex-5i 
^e-Ckgulutţâtm^mmprtmmm e§ ; extrahenMi&c d.epid. le£. 5. 
fiki^e :linaai queoiadmQdum adpr^eruandum quammaxi- 
jmeconduck cuacuatio âJQnginqui9ribus>Tr natura adcon- 
de n4^ trarias parces tranfmittere affuefcaţ , vtinnuic Hippocr. lib. de ^^ ^^^^ 
^T' **' nat. hum. , & de off. nat. Enitetidvmifi: vt feBiones quemlm- uandti^a â' 
'de offi .gin^^lodsfadamuiyvUdokrerfieri,6fanpdsxoHig^ foia; '^"S^^^?- 
j"*"''* ^enint mutatio ntmm derepoiîetmgnafiety^tmfitetudiium ^^^^^^-^ 
^-mmtthityVtMna^lminmdemhcumxxlHgaîur. Itaadcu- cj^j^^vc- 
laiHium-MOMinior exiţHs,inodd eonucnicns fe, eft eligcn- '^;^|^^- 

Digitized by 


ţoris caîififft,ex'hm ; j? partis 4ii4^$),^m iţfa |^^ 
4mt certe ^uâm prcfxhna^qtiia ncn -viî^ue mim^otejî ^fed m teni^ 
ţQTÎbus^ in Iracch^s ^iuxta talos» Mequeigncfri^mfâam dim^ 
^amîongipmeînde,^MMif:,effe mtitendum'yftc mm'm^ 
fi^at^^ curjîifn- at illo modo in i'd ipjkm , q^iiod p^mat^ jmcâri. 
Ssd idiţjum faljum ejî^proximum enim Ipcîim^ primo ^pchcmritii^ 
"vlteriorilus autem eateniis fin^is fe^mturyquatenHsemittmr: 
^is'jlippreŞiseJi^qîdâ non trahitur, ne^enir qmdem . H^c 
^<tfiu''^ <^lfus. Nequeid repugnat Galeno ,. aCerenti ^per partem 

tataflîmons parîe^ qmlrcdund^t ^ remller^ .ne^ua^i^am od eam 
trahee cmuenit.mmâi&ingu^tiânm cft. Noxij humozis pars 
iiimiracft^p^sî^m&it :^eaiiimotu,pax5:denique fiuxit-> 
mq^c ^c<^ta Iede continecur 8c moihum fack;hanc itaquc ck 
^tietta pan;evv;cl proxiimori cduccrc cxpcdit, ia quo vcra 
i;ui:atîoxonnitit . Fluxurăaâ lojogmqiuic^rcsâccontrarias ^ 
4es deducendaac tcueJlendâcfti idqjue ad^pra^feruationem 
Ipcâtabit. Flmms ^mcmzd proxima pzţnmJ^msLnd^si^ Re* 
<tendaj medioqae modamtftjmî3itiojacm^i& pxmcmnicium 

Unox^ pzttts,^ m^s yidelicet Se <xcldhplmmlimtxilccmc^ţ, 
atqueita confttmgnamr^ vt -diSum fuit tex* 7. ^ eas nojdjno- 
4o.mnîafedsa:rhinisfotibufq; îiume<aarc acdilatare iltidet, 
Timîtofacî- '^^^'^'^ f t^aiintrmfecisauxiIi)s;nampro,medkam£nto.ii3ixo/: 
^^*^*^" ^ ^^*^ piGikofîisiumor^ pituitofîi&nosnamque confidit 
S^mT^^^^'^'^^^^^^^^^^^^HfaducanLiEx^^^ «nim genitapi- 
rom™ ^^ta^^que in ventriculo. detenta,; â capite oî> naturalemana. 
tcs. logiam tex, ^. Jib. i. «^îicatam , & figuram > quam ©îitin^ 

cucurbiţularem ^ trahetur ;; ibique ceruicem yerlus dum flu.e* 
re iiequitob intercepras-abinuftionibus vias,ad anteriora/o, 
încCtabit,^ dilacabit, yt ^uicquid in polterum^-excrcmenţi 
m cerebrofupererip^per mturalesiîieatusnatura^^^^ 

Digitized by 


hr, q«at^<>s pituîtofiffitnos kabet > & ttăx radonî haudpe- ^^^ 
îîîtus ittcongrua eft > eo magis > quod de Hydrope hic agitur , baria incer. 
nonânaturaliumvifcerumrefrigerationeatqueimbecilluate, ^^^^ ' ^ 
vt plerumque.fii: , proueniente , in qua pituitofa omnia , qux 
fr%^ăfen htMîndumque îu^ 

%tMo haberi jM^î&hî j fe^ ea diidîîaxat^qtt^â cerebrali 
fliMbne p^t imifcidoiaspdftic^iHB partiumcames pBoiieGit^ 
in cpaiiaturâlia vipera ppeualida iiipponunţur r & quae ftig- 
gidoş^etiâm cibos fuperare apta (înt . Veriîm quoniam .W>ua ^X£>ma 
apudHip^ocraiiem non modc> humorem qucmuis friggidum ^£f^^: 
bumidumqj;; fignificat , vt fcribit Galen. îib- 2. de difFer.febr. cat. 
cap,5.ifedetîam inframmationem&ardorem denotat, vti 
affcritidem'G^eniitteiegefi^pfuribnf^ quce 

dilic^enter anaotata videripoirunt apud Foeiium in Oeccno* 
mia^iiuxtâquem fignificatum , torridiim etiam calidumque 
humorem indicare qiiandoquie confueiiit : & hinc pariter 
şKhyiidvtr Hippocmi intumefcere importat , &in^cJefn 
augeri ^ vt infrâ m libvj . pafîim pluries faCîitatum obferuabi* 
mus : ex qua demiim fîgnîftcatione ^tri& rdţxiyiM^&H^ttys^ 
qu^ verbaxîbo^cpâmpitaitoiîffimos interpretatus eft Cema* 
^us i cibî %nate^iţo^ntiquî plurimiim , optîmeqae nu- 
triendo>ebrpii5ftiîme^ant,&in molemaugent; qcriprofedd 
defcriptâ ii^ Hydrope non inepte etiam exhibentur^ vt abali- 
menti vbertate & diuitiafiuxioniîm meatus 5 qui in anteriori 
cofpbris part^ ob^ficcitatem coâr6lati fupponebantii^^ 
ââtii^di!atariqueţ>ofiffit i- -Sîc ţariter firperins tex, î 2 . in fio^^ 
cîafilîppitudine>vbi^exaflki penehumo 
ctymas^:6eântip«ngendoque are ^ 

e muMuur y^fe^Hî' <:orpt^^ i^ atqire^ îpfb^ 
vbefioriaHmenco huin€â^c>& adlacrymatumeîîuiîonem 
aptiores reddere ftuduit . - Hxc tamen conlilia num ample- 
6tcnda*fint , non abfoitite deeemimus^ ratiîta fiquidem funt , 
:. qu^inbydrope^&e-erebraiiîmsfiis^ 
toia i turn piurimumîmti^iiHadehe^htur . -îUud^ihilomî- 
lius cauedu, ne â magnisAtidioribus menr^biă^odita^^^ 
cotenamuvaut improbemus,etfî â recentibru opinione remc> 
tapquâuis înrationâbiiia, 5c ex loiiga diffuetudiiie m<>rife^ 
" " ' nobis 

Digitized by 



aobis4ippaţeant : p^urij^a enim j i^uoţ^ 

fcis temporibus 8c maximo ia yikx & longa expericaţia coxn^ 

probau extitenmt* 

,^^^*^' tolam medicam aMigere oporteţ y&forâş tfaîiere3& 
non fcarificandoper cujaxîerei &cal€^^ 
mentis în pota exfaibitîs intus cdefacere > quo exitus 
Bat turn forâs ad cutem per cacurbîrae tradionem ^ 
\ turn întiis ad ventrcm per caîiditatem : nam c-um ob- 
turatus fuerît fluxus , & non habeat quo îţer f acîac t 
viam ad a«icu!osfaat, &in id^qupd cedit^mfimt^Sc 
fîc coxendicuinmorbuinfacit. ^ .,; 

iOxendicum affeiiione m a^fluxionc excicatam^quam tex* 
,^^^^!§.propofiia:at ,iam cutare do£et.Eam tune ^eri affe^^^^^ 
dum commotus Jiumor TOdequaqî- a fortioribus partibus <le- 
pulfus^ncgueiatusjad cauitates ^nequc cxtra ad fuperficiem j 
cxitumxepjerit : qiiapropter adperamplum^ cox« articulam 5 
iempereşccipexeparatum ,refugit. Hmc f parâaţuni in a^rti- 
xuli huius intercapedine humorem partiin^ex akq atţrahJeati- 
i>us ad iupcrficiem âcducere flude t,partim interniscalefa- 
dentibus ad interiora trahere^ vt inde per âmpIos>& naturales 
ineams poâmodum exp^urgemr» iţa curabatui: Eupolemus 
^^^^-^^^ Se Licon ia Oeniadis 5 . epid. ^ cum in eo a&di^ AulJum ob^ 
tineant locum repercuticntia, yt notaiiit Galeoiîib. ? cule mc- 
zfcHaţids dîc.iocaLcap*2, Âde^rabfnd^m^^rojatquee^ 
tuaunquâ caiidum , |u:imum iîbi Jocjum vindi^aut Cu^ur^ 
coaucrnut. rukidem Galcxi.,^nam hseob vacuum ab 
Cucmbim- extincia fiammaxeli(âum, vtfe rcpleant^ quicquid poffunt 
^^. validii^imfi trahunt • At qu^Ief efle-ckbeanţYbiinfeftusJiu. 

mosrin alto delitefqt, dooiit ipfe Hippocr. hi0odc Medic» nu.^» 

Ij^ Verf>iş^ . CMOirbtamm £or^ moM mtmmM m^mt^ 

qpAnâo mmjkomţmcul ^k : ^PP^:^^. carne i cgmţ^^s fiimt^ 

CuditMtu- cinulum ipjks hreuem ejjeop^rtetyiţfamq; non ventrofam pjeâ 

Umsc2ieiâ% ţr^U^amţarUad mamm V^gmH , non graum: qun^ mimtalis 

5 . 

Digitized by 




^ ^ în âireBum trahet > ^ ferofos humores J^aratosăc dŞanBeJ' 
ţroU ad cam&m adtrahet . Quod vîiq; rcmedium in Ifchiadc^ 
âc Celfo pariter, & alijs maxime prc^batum eft^etiam cum fca- Ceir^î»^ . 
rificacioxi€ ; quam tamcn faic non admittit nofter Authpr,vei ^^^*^^' 
quod non pendcat â fanguine pcopofita coxendix( tunc^nirri 
au,57- 'probacur tale auxilium imer. afFec^. > venamque incidit 
in popîiteyfed h^c cum cerebrali fiatâ fiuxione, ftiggida pî^- 
rumque ^îlimanda eft : vnde fruftrâ vulnufculis aifligereiur 
affecfta parstquinimm© magis debilitaremr, esxîtato dolore^ac 
maior jSerec humorum attraâio .; prseter quam quod ab eua- 
cuacQ fanguine înteditur frigus, &: contumacior redditur mor- 
biâca maceria.Yel quod in profundo refidens, vix vnquă con- 
Ipicuus fir morbificus humor ^etfi valide trahatur.Ac,vc pra^ci- ^^^-^^ 
pic M^âico,vhi fcarificationem fuhter cucuy-biculam aâh> i« quando 
'"^^^ he^re-jelis^fanguinemfiarificandorum locorumapfpctiumeffe opor^ icanucad*. 
tet : alias nequt drcukm aâtrăBumfcănfcarecu:ţertundereomr- 
tet: dehiUorefienimvarokcidohreaffeai. A^^ â/^<^^^i- ^^^^^ 
culis inftrumencum, qwo prifba vtcbatur medicina ad cuocan - inuâioai- 
dum, erat %nis ,non xninoris vtique efficacici s ac duplicitcr ^^^^^, 
adminiflrabatuK nam y-el aliqua in profundo l^ebat iîippura- h^ ^^^ 
tio propi os ifchium ; ac tune igakum intromitteBant gladio- \^l^,Jj^ 
lum quoufque exicus puri paterct : pr^ertim fi pus prauas ex- ^^ifcUa. 
tkiffet quâîitatisparuceps > vc videxe eft 5.epid.tex.7an Eupo- j^ola^ 
lemo: vel noxius humor vndequaque difFufusaffligebacs ac ^leniat. 
tune plures profundafque candenti fcrro vfliones in nate exci- 
tabant > vt calorc extra attrdier^nty'ficcitateYcrd niiiaiahumi- 
ditâs abfumeremr , nzc non offen&m comyboraretur mem- 
att.5l. brum,vt patet inc. affeci. , 8c.6. aph. do. C^cera, 
qiiae pro intcnfionc hac admimftrari pofli mt fub cataplai matis 
forma>minoris piane cromt yirtutis . Idem humor adeo pro 
fundsE articulâtioni impa<5lus>validis medicamentiscalefacio- 
tibus fimul, ac purgantibus,tumper os exhibitiş^tum clyfterc 
infufis,auellendus eciam^ac per interiores meatus expur^andus 
eft: vnde iib.eodem phiries citaco de int.affcâ:., vbi ad amuf- 
fim de Ifchiade agitur^fî morbus â melancholia pendeat, ni-- 
grum exhibet Veracrum;fî â bile^Scamoniumifi âpitui^?gra- 
num Gni4ium,au£ Hippophaem, fomento prius adhibito , vt 

H b ^ humor 

Digitized by 


243 mPPOCRATIS tis. II. D^LOC. IN HOM. ' 

humor itâaftcnuaws eliquarufque, facHius trahenti medica, 
îfchiad-cis mento cedat . Gîyfteres tamen morbo huic infi<»nc auxilium 
Sî^^prol ^^"T'^ attulcrc; hi namque, fi vaUdi fint,ab affeâa parte pro- 
, cui . ximeeuacuant,valideq:impaciammateriamauellunc.VaIidif- ""•?'»• 

iîmus porro illeeft,qui hb. de inter.afFea,pr£fcribitur,ex Cu- 
mino,Colocynchide, Nitro, OJeo, Melle, Viao, & Betarum 
fucco in magna fatis quantitate ; itâ vt ad ternara vfque diem 
aluum commotam iri fperandum fit : vthinc conijciamus co- 
piofam moliendam effe euacuatione, fi quid vtilitatis Ifchiadi. 
cjs afferre in animo fuerit.Interim,c!im Hippocratcs calefaâo- 
. np medicamcntis in potu exhibitis intiis calefaciat,vt morbifi. 
A.UC. !ib. 4 '* "^^^^"^^ ^^^^ ^^^ in tusadv entrem per caliditarem i non 
f-i-maV* anuale fortâfse eflet difcutere num fanutn omninofitArabu 
c^^inrn, «^«"^^"^«i.qui in Variolarum & MorbiUorumcurationc, qud 
exhibi:â nâ cxpuliio cutim versus promoueatuf , caJida coafuJuHt medi- 
Jeika' Zt <:araenta ex femine FoenicuIi,Apij,Raparum,deco(aoFicuum, 
L'h^^'' *'■ *=^«'^°'^"f que huiufcemodiadiuuandam, vt^icur^.humo- 
cxiius *Au, ^^ ebulhtionem . Venim haec aliis . Neque fiîentio prstcr- 
cWcii^' «""<^"°^ textum hune loc. in htîm.citari ab 
antiquo Authore Calio AureJiano tanquâ ex libro vere Hip- 
poeratico, vthic etiitn oblter annotatum fn librum hune om- 
ni state Hippocratis legitimum habitum fuiffe ^ 
™i « Tabes ex fluxione retrorfum.Qiîi hac affecfhis eft 
fSu^ ei caput eft purgandum dehîli medicamento, donec 
Z'^l^ fiuxus auertatur: Di^ta tamen vtere velutintabc 
luperiore . Medicamentum potandum prsebe Ha- 
terium deorfum.purgans,& inferne aluum Iade infu- 
fo elue . De caetero fomentis vtere . 

Q Va fit huius Tabis natura,pluribus di<5tu fliit tex. j.hbri 
huius.Qua: autem ei debcatur curatio, hic potius in- 
., T "^tur,quâm explicatur : fuppienda proinde «rit ex intcr.aff€c., vbiabundedcfcriptareperitur ; etenimin nu.î4. 
cp coniimt,vt caput & corpus vniuerfum ab excrementis ex- 
pieturjttuxio ad c6£rarias,veIproximas,aucrtatur partesjopti- 
. mo viita corpus rcficiatur,vt maiora deinde prafidia fuftine- 


Digitized by 




î€ vaî«at;pîurcs videlicet inuftiones, a qvdbm pofticie dcnfât^e 
partes^toboretur >.^axioniq;via intercludatunynde fie loqui- 
tur. Keficcatur msdulla fpimlis maxime cum vmtd^ eiÂmeiullcm spîruîismc- 
tmdentesfuerint'Qkurat^;item^ueexcerehro acceJJus.Prapter cor* ^^^^ ^^' 
ţorif autem affIiBimem h^cţatitur ^ ^grotat . Keficcatur eHam joil *^^ 
âVenere^H^cigiîur patitur. Dokracuîusincidit ipji încăput^ 
collum 9 b i^ lumhos,^ in lumhorwnmufculos^if inarticulos ctvî^ 
rum^xttâluluandofkHerenonpojpty ^^ercusnonfecedit^fid fifli* 
tur , ^ -vrin^e difflcultâîe vexator* Hic in principia quiâem movH 
^uittus degit : qHcmto autem magis tempiis morho prolonoaturftmt^ 
ma^s omnia dolet ; ^ crura velut ah aqua inter adem tument : ^ 
roîceradluftihis emergunt , if aliaqiddâm fanefcuntyolia "vero na^ 
Jcuntur ♦ Huic cum fie hahuerit, capit purgaîc Hippophais Jucco p 
OHtGnidio granOi corpore prins valde bene foto; Vefperiverppop 
purgationeniy pHfan^ duas hetnitwfirieat, melle ajfufo^Vinum au^ 
tem hihat alhum mdk . Potera die ajmini la^s ^Hiy melle affujo , 
ocÎQ heminas ehihendas ipfi dato * Si 'oero afininum non haleas > hu* 
huliyâut caprini co^tres jemicpn^osymeîh ăffujb .Et^ dumcorporis 
âpportunitas adefl^lac hihat^fero 6* îaBe vtens per ^uin^ue if 
quadragînta dies.Gihis autem if olfonys vtatur^uam maxime per 
aluumfecedentihus. Vinumhibatallfunhm&Ue^Mend^^m.* Cum 
autem crajp^jpmîtsfi£erity inlumhs ipfiusahvtra^ue^ertic^hrum 
tarte crufias^atHorinurit^y ^in/hrjum vtrîfujuequindedm; ^ 
in cermcem duas inter tendines : Si enim 'vfliojuccefferitfjamimfa* 
des : efi autem morhus hic grauis * Hinc licee mîrari inancm , vt 
ilc dicam,noftri temporis mcdicinam,dum validiffimos mor- 
bos Icuiiîîmis praefidijs nos iuperare poffe confidimus : nam 
quis ia propofîto cafu , fi vnicam Inio cruftam inuiîiflei:, po- 
ftrcmum, yafidiffimumq; pra^fidium ic ao ^xportum fuiflTe ar- 
bitrâretur?ita vt nil vlteriustcntare fas efler: cum tameo aobi- Afiţiţa^» 
lisbic Author quadraginta inuftioncs prseppiacSedhaud file- ^^^^ 
tio inuoluefîda cft Martiani in propofinjna ccxmm aiinotario : -"^^Aiiii- 
Jiam^/parcant riiis Manei) Vir acerrimus allucinatus cft i dum ' 
Imerpretem arguir,qu<S Gr^cam vocem '^kat^^Iov . tran&i- Mam^afis 
pocratis fcribit hanc voccm fîgnificare non moda x4<P^ « 
filueflri Cucum^JT-c confcctum «ft , fed quicquid per infemas 

H z partes 

Digitized by 



fzttcs purgativuk cnim Martiaaus in hoc textu id > quodfii* 
perne purgat,diâioi3eiIIaiîgnifieari.Quod duplici probat co* 
ieâura;Primd,quia no rationabile eft in Tabe, de qua habetur 
fcrmo 3 per inferiori purgari voluifle, quod exprcfse prohi- 
bet lib. 2. de morb. , vbi Tabidos omnes Helleboro purgat , 
euius proprium cft fursum purg^ctimmo inTabeex pul* 
monis aftedu Ver. 35 5. fec»2. , itâ temperad iubet;,ne aluum 
ÎBfernam moueac. Sednon aduertitbonushic Vir quâm fie 
diuer&m curare tabem â Pulmonc oriundam; & eam , quaîâ 
pofticispartibus fluxionc tentatis origine ducit; in illafiqui de 
prg cipuum ftudium eft fpucum copiosc educere^nam hoc fup- 
preffojftatim fuffocaîur,acque e medio coUitur ^gerrqua» 
propter iuri timec Hippocrates deorsum purgantia: nam vc 
habetur lib, i .de morbis^S: alias diâum eft, Sputi Jursumpur-' 
gatio non ^^ualis contingît duo cdefaUaj^ omnict infe iţptm tm-* 
hente : Quod mmime condngic in tabe dorfali , vbi nul* 
la fputi ratio habenda eft : immo cathartica medicamenta 
plurimi vfus in hac efse pofeunt , dum caput expurgare y flu- 
xionem â poftcrioribus auertere partibus apta funt . Et quod 
hsc fuerit Hippocratis mens^luct clarius apparet in textu mo- 
do adducio cx lih. de inrer.aiîeei. , vbi in Tabe â Ipinali me- ^^•^'^* 
dulia Hippophais ruccum,& Gnidium granum exhibet, qu^ 
fine dubîo valida funt,ac deorsum purgantiapn hoc enimaire- 
&u aluus plerumq; adftricla efse folet , cum humores ad alias 
ferantur partes3Vt patet ibidem.MuIto minus negodum facet 

» fit fecunda rado â Martiano adducia ad fuam probandam fen- 
tentîam,dum inquit.yuh ergo Hippocmtesprius darimedicamm' 
mmperfuperiora purgam\ddnde infernam aluuTn infufo la£îe 
dui. îmum dumdicit ^^Jnferne duum ehiSy indicat pr^cedms • 

■ medicammtumpHrgaJfejupmorem;a}ioqui -vox infime fiiperflm 
ejfet omnim : Nam quid implicat dicere, medicamentum po* 
tandum pr^be deorlum purgans,& infernam aluum Mit in- 
fufo elue ; cum hoc nil aîiud fit , quam poft validum catharri- 
cumclyfterem infundere^, quo^ quicquki âmcdicaniento reli- 
âum eft in infimo yeatre , abluatiu: , & praua medicamenti 
^judita^temperctur. ,..^^^ 


Digitized by 






Liber Tertius; 




Textus L 

Cum Splen pr^ febre magntis hăus fuerît ; fit ati- ^kn îm 
tem cum corpus attenuaturrexiifdem enîm & Splen bCI^coJ^ 
florefcit, & corpus contabefcit : Cum autem cor- <^o^ii^^«^- 
pus tcnue fuerit , & Splen BorueriU & Omentum fi- 
mul cum corpore attenuatum fiierit > pinguitudo in 
Omento colliqiiefcit . Vbî vero vafa pingiiitudine 
vacuafadafuerint ^ & â Splene florente :, acauge- 
fcente in Omentum defluxerit , vtpote viciniun val- 
de exiftens, & vt vafa]iaţ>ens> eaque vacua.excipit. 
Et vbi morbus femei in corpore fadlus fiierit > ad id > 
quodeftmorbofum :> vertiuîr> nifîquis probe dijt 
ponat , ac curet : nam etiam fi quis bene tradet , 
periculo non vacat. ~ 

W^ci^^ G I T in proximo fceundo libro Hippooratcs de 
^ rj ^ ccrcbrifluxionibus^dcqueindeproucnientibus 
fe âP mbrbis, co ordine, quem hadenus dilucidarc 
SiîJ^SsBiSî conati fumus: nune autcm varias incipit pro- 
poaerc humaai corpoiis affe^ioncs , varia Aromata, ac bcn- 

Digitized by 



tenuas j aphoriftice tamcn , nuUa feruata mcthodo , vt nota- 
. uit etiam Zuingerus . Hf ne c& , quod no$pariter non modo 
tertium inde librum exordimur, venim etiam in explicando ^ 
de cextuum inter fe connexione parum poiîhac ioiliciti eri« 
mus : Nequicquam enim laborare videntur , qui aphorifmos 
Aphonfmus interpretantes , tanto ftudio illorum ordincm ac nexum inue» 
vnae di^^us. ftigarc de fudant , fî de aphorifmi efFentia eft ,- vt ab alijs fepa- 
©uret-âdnc ^^^"î^fiî^>^^q^ediuîfum, &indicâtverbum5 ^^opi^i», quâd 
enâL^t^î'sS %^g^ce> &: feparâte fignificac* Scimus id conftanter negări 
pra Hoiier. âDuri^o^afferenteaphorîfmosdicifenteatiasfeparatas, non 
litltc!^'^^' ^"^^ finclll^ad inuicemdiftinCix, fed quod ex libris alijs 
breuiiis exfcript^& extrzăxilnt : vxide BeneSidus Bufta- 
mante Paz Hifpmus abfolutaiîi omnium aphorifmorum 
atque îibroruiîî connexionem in feptem aphorifmorum 
libris , fchemztihus quibufdam faris ingcmosc deoinxit . 
Venim boc etiam admifTo, non video quomodo inter flo- 
fculos atque fententias hinc inde ex varijs libris deprom- 
ptas vera ac perfeda connexio aptari poffit; cum non pa- 
rum fity Si vnaquajque iuxta varia argumenta , incommu-. 
nes locos digefta fuerit ; Quapropter Pfailotiieus qu^erens 
Bixiu'^'t ^"^ aphorifmusdicîus fit ? Quoniam,mquit,in eocircumfirî^ 
apkoz. hătw fmtmtiă , mque Xfllum habeat comnerdum cum ijs, qu^e 
iffam vel mteceâere , vd Juhfiqui ţofsmt . Proponit crga 
in prasfe^d textu nofter Author Hydropem quendanx â 
Liene prouenientem , cuius occafione vifccris huius na- 
Sio!"^ turamperbelle detegit. Eft fîquidem Lien ignobile mem- 
bnim feculento fanguini cxcipiendo;, proîeCtandoque dU 
catum , vt fie tota humorum nialTâ depurata fuperfft, ip, 
fumque nutriatur . Inde orgânum rifus â PJacone appeîJatus 
«a : nam fanguinem expurgando, iUuftrem illum reddit> pu- 
rumque, qualisad rifum requiritur, Extentum vero eft in 
liumani v^ftîgij fîmilicudinem, vt legiturlib. de corp. referii, 
bubuîam iinguam refercns, Ventricuîoâ finiilro laterc fuper^ 
pofîcum , molii fpongiofaque fubftantia compaâum : vnde 
L-ep.isvr«s- ^!^%^^^^ quibufuis fuperftuitâtibus, â ventriculo prsefcr. 
'tim aquacxtento, eftajpuflîmum : nuiîa ctenim renitenti^ 
recipic, autrcceptarcftituit : aoncerte quodabiflfitafacul^ 



Digitized by 



tate cas trahattnam hoc de mefâchoîico tantum fanguînc dice» 
du eft^quo nutritur; fcd quod flaccida ac ipongiformis fubfta* 
tia, vc diximus>qualcunque humiditates auide abforbear,& ab 
alijs partib ti s rxpulcricjs vi tranfmifsas facUIimc excipîat;pluri- 
mumque faspc fepius laborat ^ d mediocricatem nimium cx- 
uii.39- cedanc > Id hquido exprcfîit Hippocr* lib. de vet. med. partes 
^ ^' defignans y qu$ ad trahendum > alliciendumque cfEăx funt • ^^ 

Intra hominemj inquit> natura dr fipira talia fimt Vejîca^ Caput» trahendma 
ifVtemsin Milieribus : atque h^cmmifefie maxime trahunt» ^ ^P^* 
femper plena fimt attraB^ehumiâitatis . Aî vera cau^ ^ ^^^S^ 
figiîY<e j influentemquidem humor em maxime Gmniumjujcepen^nt , 
non autem fimiliter attraxerint . Solida dutem ^ rotunda» ne^uă 
attraxermt , nâ^nefufieperint : dilahitur enim , ^ nm hahst fi^ 
dent y in qua mâncat . Spongiformes vtro , 6* moUes , ^eJtit lien > 
Vulmo i h Mamm^ > vU admot^e maximi fiierint ^ ^ adh^^efirint; 
elihimty dura^ue funt , ac augefcunt humore accedente ; maxime 
Bilmo : Non mim in vetttriado inejî > in qtio humor em extrinficiiS 
conţineai ipfe ventriculus , inquo ejî humor , 7;t quctidie exhaurior- 
tur ; fed cum hiherit , ^ fufceperit ipfe in fi ipfum humtrrem , % 
'oacua X 6* ^^^^ » ^^ parua penitus explentur > i;pro raro ac molliy 
durusac denjus euadity ^ neque concoquit , neque dirmttit • Opri- 
mum^rgo vium fplen prseftat humanas^ natur^> fi narar^ium 
partium j Ventricuîi in primis > cui maxime adhserec , nimias 
humiditates abibrbctj ijfdemque paritcr refticuir ^ iî coquen^ 
4o indigas quandcque reddjcse fueriDt ; Quafi quoddam fie Lîen efi 
aquas promptuarium , naturalibus prsecipuc parcibus , & reli- ţSi^^' 
quo etiam corpori inier-uiens . Ex quo.pâtet quam perperam 
dixeric Democritus in epift. ad Hippoc. de nat. humaa.^ Sple-» 
nem dormire nulîum negotrum exhibencem . iddocuitpa- Lieafri^di 
riter Hippocr.4..demorb.iienemaqu5efonccm appellans^non eâ domici. 
modo?quia melanchouco nutncurlucco^qui t^rreus cum MacicbOib. 
fit & friggidus ( friggidi enim domicilium lienem appel- 7r^j,^-^'-4. 
lat MacroDÎus , & uniltras parces debiliores eiîe âfleric> i^SdcS- 
quod coniagione trigons iîniîtra obtinentis hebetetirur^ ftip- ^y^^^^^^^ 
ticitatem quandam m ie ^abct , qua ccrrea?, craffiorefque par- Hdaacho- 
ces plurimum coguntur^^iinen^ ler-ofitatem â fe cxpnmunt, ^^^^^^j^ 
fegregantquc, YtlacconicCiocicoaguio: vcrum enam quia fuâimdautf 

aqueum ^^**^ 


Digitized by 



aqucumhuni;ore,vndecunq;poteft> rapide forbct.Subdiţergo 

inferius . Ajfem vU homo hihit amplius i^ corpus > ^ jpîenem 

a^uam in fe ipfa atfrahere ex ventriculo • Et (tplus traxerint, ^mm ^^'^ * 

eportet ; flztim hominsm ^ffligi ; at^ue hoc ita fieri intelligunt qmr- 

^ cuYKlmhomines fflmicjexifltmî • Quodqmdem ijs potiflimiim 

"^^T^^ ' contingit, qui eruda> crafla, paluflriqye aqua fefc explent , 

'''"'^ ^' r^*^ qusE dam in ventricule immoratur, ilitnc magnat ex parte 

trahicur 3 indeque intumefcit , vtdocuitHippoc. dcaq.acr. nu^xo» 

&■ f oc Quinimmd fi aîiqua excaufa humidf ^ac tenerrimse cor- 

poris parces co!liquefcanr,feranturque ad infernam regionem; 

câs illico abfumic ; quas nifi ad veEcam aut aluum craafmitta^ 

augecur, & quaque versus diftenditur ;; ita vtappGfîtiiîîrae di- 

.z' (Stumfuerit,exijfdem SpIen5flGrefccrc>&Corpuscontabefce- 

iLien cxa- re : nam Lien, vt diximttSjamplrficatur vbi plura reditadarint 

?a^^choiiS^"/^^^ aquea , TCÎ.melancholicaexcremefîtaiiJIa qtiidemâ ca- 

^Qi^u ^piofb fnggidioris , crnd^que, vel crafli & palaftris aqua? hau^ 

^^ftu, vel â cotius coUiquadofîe ; faax verd â melancholicis 

cibis y atque intcmperaco Hepate : & tune tota corporis mo* 

lesabfque dubio tabefcit^ vel dcnegata ali$aonia ob fanguinis 

cgeftatem j vitiata iam coâione in v^ntricHlo^iecinoreques 

vel diffoluris a deurente ca/ore liumidis atque tenerrimis par- 

ribu«, vtcoaâa recentius carne > adipe, reJiquifqueiumpri- 

bus:Hinc Traianus Imperator Fifcum lienem appellabac: nam 

Fifco ditefcente>Populus depauperatunSencenriam hanc mu- 

tuatus eft Plato in Ti mzo • Froximum kcori , inquit , ad fini^ 

firumlocatumejîhums gratia memhmmjVt purumboc femper^ 

clcmiTnque reddat , ^ injiar Secuii nitens > atque perjpicuum , ai 

imaginejque ^xprimenââs accommodatum : ^uapropter quando oh 

corporis morhum fordihmiecurahundaJ;^ Itenis raritâs idpurgans^ 

eas conhibit-y cum Tnembrum Jjqc concamim fit ^ excmgue : vnde ' 

purgammîîs impletum , excrefciî , tumetque fanie : ac rurfits cum 

mundatum corpus efi ^refbn^wnin feipfiim confidet . Galenus - 

etiam afFercJbmnc locum Iib.3. nat/acul. cap.9. ^ vbi librum de 

Libcrdc loc. -Ioc. in horn. vc vere Hippocraticumagnoicic. Quodautem 

mr^i^GaiSl ^^^^^ pâricer, atque expurget v^ntriculum; praîccr Hippocra- 

taquam ve- tcm y teftatut etiani Arift. lib. 3 . de parcu cap. 7.inquit enim , 

fS^^"^*' ^^ "^apores vacantcsyhoc eji^wniditates fiiperfiuasydiuertit , ^ 


Digitized by 


fuifr^ dimmtdimmodkolm^fiit, ^ţropter cat^mmmt buc ^^^^' 

modo ys , 4}ţd jupram^imt mnpmî ^ diutHimîo humoris * 
Nec deiunt qui pr^ftantiori zSmc mtinerc vifois iftud infi» 
gnîrc coîiad iînt: qmppcqui, clarifiSmus Vir DaQielS<m. 
îi^rtusiaâic, îibm i, cap.^. &libro 5* praiSL pirte4* cap^ i^ ^^^^ 
'4c v&lknis, fîoa mod4 mm feanc aqua? prolcâatriccm ia ioi^ai><^ 
fflo agaouit j rcnim eciam ematofîm , hoc câ ^ ^^lificatio- 
nem qiiampiam ia €o ce&brari , crafîiorfe nimimm &Qgainis 
i craffiori daăo €x Vcnorkuîo Mcfentcrioquc per iplenicum 
ratiTU m ad inferioris ^entris vipera nutrknda acaaâo > & ex ^ 
&i^ ^ CK Galpari HofiBaîmi fentenda aflcrere , mithorka* 
tibus > radon&ufiji^ non adguî ponderis probare non iiubi- 
taaîc .Venim vt hxc non peniais improbabUia exîftimamus ^ 
ita nuac alijs exaclius difcudeada relinquimus . Ramm itaquc 
fit in doârifia Hippocrads Liencm nou m©doâ fgcuîcnto ian. 
guincHepar expurgare, venim etiam veatrkuli, cseterarumq; 
Baturaliumparuum aqueam humiditatem ipoagi^ inâar ahi. 
iiimere , hydropiquc non raro occafîonem pra^bere . Quod 
cum diucfemode accidere poflk,pârtîcuîarfequîdamînodtîs %4îo?5 a 
hkrecenfejtur,yideîice£cumadaui5lo^îene ab bumidkad- ^^^^*^^^^ 
bus, febrisvîgenîds, 4umcotporis habitum atquc ^mnes 
bumidâs partcs intenfo calote eliquat ^ Omencum^ EpipîooB ^. ^ . . 
'Gxxcis j membrana flla nimkiim , quaî â Vcntrîcuîo âc Colo TcripUot 
4^orta & dupîkata , marfupij fîmilitudinem î^erens, na^iis, 
artcrijs^vcnulifque quamplurimis intexta, ac copiofo delinica 
adipe, Ventriculo^intcftims.j ac magnaexpar^ Jicni fupcria- 
cets Omenrum, inquam , quod licni proxime adă^rcns , 
eandcm colliquauonis calamitatem in deurente iebrepacimr; 
hinc adipe dclticumm , humoribiifque intxz fiiayafa contea- 
^âisfcre exhauftum,a Spîcne tumeate per venzs, hoc eO: , per 
vtrumque «pipîokum*racQum ^ ytputar Senaerms , perque ^^^ l^| 
alios coecos duâus eafflemccpctitiiumîditaâss j eique, mor- i^> ^ 
bofo iamrcddico, atquc imbeciUiori , omais transfundicur ^z^-^^^»- 
fupcrfluitas, quam cum intri vafa ^ ^m inai iuam cauitaîcm 

li îccondic. 

Digitized by 


nu. $7* 

reco«<Ut ^autaluo txmîmmt. Siquidcm propriu^ cft partiş 

cuiufcutiquc prseternaturaliter cxfxccata^ humorem vndecun- 

que cducere, vt vidimus t. 2. lib.a.Idipfumquandoquc 

patitur ab Hcpatc > vt conftat cx aph. jj. fee. 7^ ^ 

lecuraqua repletumerupent in ommtum ^ys venter aquci expletur 

ama moriuntur^ Hanc Hydropis fpecicm regiftrauit Hipp. 

lib. I. de morb. miiîieb- inquiens . Simuîieraqm inter cute la* 

horarit , Sţlene iţfms magm h if>^mp> exijiente : fit autem jplen 

ăquoftis al hacaffeiîione.Cumfehrishahuerity ib nm âitm ferit 

homin&n > ^fiîis ipjum corvipueritfortis ,& Uherit ^ acMon reuo^ 

muerit : nam ^uod in veficamţmetrat yţervrinam reycitur ; reli- 

^uumvj^ojplen capit? ahjirahms â.v0îreaâfeipfum> vt quira-^ 

rus efl , ^Jţm^rms\ ^fecundum/omtremptus . Etfi his fie 

habentihisnmem^rit^e^ue alms Imetur^al hpcjplen aţipUiturj^ 

^ hoc magisfi aquafumtţotm ; ^-si qtds ipfiim contingaty molMi 

eJificHt mollîjfima ţluma , fiue lâna ; quandoquâvero etiam reni- 

tituT* Mlemtus autem^ impleîus 3 difirihuitţervenas corporii it 

maxima in Omeptum J^J^j^s circa ^ventrem i; crura: Altera enim 

ţarsad alteram delegat j^ f^yrţofâ:p:oUfingHlis^ţlufiiuam oportet 

affueriţ > _i:f:Contin^eMm. poterint* Succeâit etiam exhocfemper 

hy drops y vhijţlm'x^fieipfitm trabcrecQnfiieiierity cum natura 

rarusfit ^ mGllis. Şc lih-.dt^cci*fitpkrufnqîiellydrgps curit mi. 23. 

qds exlongomorh impurgatm multe temporepermanet vcormm- 

pmturenim cames , iţliqmnţur» iffit a^ua . Cseterum peri- 

culo non vacac hsec affecho , non modo quia 5 vţ habe tur lib* 

/ progn. ^A^u^ inter cutem ^^ ^c^}^: "^Tm^J^^'^^^ > P^P^^ *^^" ' 

Hydropî ab l^ fimt : mqueenim dfebre UheraM^ & V^de dohrofie funt ^- 

îcSaS^-^*''^- l^thakş y veriim etiam quia Omentum , quod natuiaîes partcs 

f fbuere^iuaque denfitate iaiîtum,calorem vniturnatquein- 

' tranfpirabilem reddcre debebac > fi aqua repicatur ^ ciim yen- 

triciilo immediate adba^reat , co<ăionem piurimum vitlabit , 

c%>remquelanguidiffimum^,reddet: pra£:ier qnam qucd aqua 

vdut in marfupio cpnteadiayvix indemedicainentis educi po- 

~ ' ^ teîic . Verum docirin^, Huic baud facile acquicicent j^quiiura* 

Gal- ^» <k^ rurir in verba Galeni afierentis nequaqnam fieri poiîe , Vî vn^ 

U>QaU^7' quam quis fiat hydropîcus^nili Hepar a&<^um fit. At quein-. ; 

admodu îd confccutiue verum eiîe non iniiciamurinam noB 


Digitized by 


COMMEmAKmiLLrStKMVS l ^ .-iH s j r 

pcteft aqua diutius vel in Eiene comincri^iel m Om^Qy.'^l in 
^r itanco>qirin Hcgp! craC^ tcm|îbrii norx r€&îg^recur;iţa a4 
aqu^ generacîoiie iâ luilteeaus neccfle eiîe, cum Hippocrate 
a^rmamus,nam &c calor pituitanijadipenî, tencrrinias partes, 
vbicunque fint , coliiquans ; & craffior ac frigidior aqua affa- 
tîmingcfta, attradaquecvcntrkuloâ îiene; &omuestun2, ^^^^^^ 
Hepatis 3 mm Licms^ turn Vteri obâruCiioncs a calore in corpoi^^ 
âquaiiirefoliit^> Hydropiimmediatc occafionem prsber^ 
poiTunr, vcliquido conftat ex varijs Hippocratis monumen- 
tis, quiiflatur^ arcanafelicius abfque dubio rimatus ^it>eiu% 
aniplicudiîiem ingentj vaibtace mire eft compîexus : ex qua 
veritate mottis etiam Afckpiadcs apud C^îium Aureliaaum 
lib. 5 . chron* cap,8- Hydropem aîium ccierem dixit, vccutrij, 
qui rcpente conftituitur 5 alium vero tardum , vt cum , qui 
tarda paffione vexer^Scd de hac re piura diximus text,7.1ib.2* 

^^ Hune fie fanare oportet , Medicamenta in potu £^^^9 Jîy- 
exhibenda funtquse aquam purgcnt,&e dulia quâm n^^^ J 
pituitoîîffima offerenda . Si vero neqiie fie leuior 
fîatinurend^ funt cnifl:^ quâintenuiffim^, & q^âm 
maxime in fuperficie^ quo aquam con tinere poflls 
circ um circă ymbilicum, 6cYnainvinbiIicmn^ & 
emittere fîngiilis diebus . 

Explicata hydropis buius ciTentia Sc caiifisscuratioiam 
proponitur , cuius du^ pr^cipuae funt indicationes ^ 
Aouseeduâio,. Vifcerunijtotiufquecorporîs attemperario ^ 
Gircâprimum . Nobilis fuit, plurimumque agitat^ quseftio 
apudantiquos, num pras^ftaret iliicoeducerc aquam in Hj^ pri^i?^- 
dropicîs , vigence adhuc vifcerum intemperie , â qua npua fu- d^Iair^Hcc- 
binde regignitur aqua; an ipfa vifcerum kiccmpcries prius l^j^^^^^ 
corrigenda,qii£eftagnantisinAbdomînehumorispodiîîma <iropc. 
caufaexiftit. Venim Cdfushanc paucis dirimit: nam ctfîâ ^^^ ^ ,^ 
vîfceribus ma!e affedîis, veimalo totius corporisbabiţu Hy- cap. zi- 
drops dependeat ; tamen aqua, n-fi emittimrrqua^ contra na* 
turam ibifubfiftic ^ ^locinori , & c^t^iş inferiqribus partid 

' I i 2 bus 

Digitized by 


t j^ HippoczJTis ZIS. m> m mcis in hou. 

bus iîacec»Conucnitqpecorpus nihilomkHis cffe curanctoaiţ 

lîequc ^m &nat cmiflSis humor > fed H|edicinaelocum 6ckt 

quam, mtusinclufus> impedit. AtvnaHippocratîs autho» 

mds fatis eife debebac > qui duobus inibumcntis eam quara 

ocyus cduccre ftudet ; Primo quidcm hydragogis > fcu aqui- 

ducismedicamcntis, mm per oseshibkis>tuin clyftere in* 

fofis : Cneoris & Hippophacs fucco, nec non Gmdio grano 

vtiturlib. de inter. affeâ.,vbicxhibeudimodum per repeţi^ ^^* **• 

tas viccs tradic Nos fucc© Iridis , Elatctio ^ marina Braffica 

vel piîulis Mezerseoa idemmolircmur» Enemata fimiîiter 

HMJcit ex Cncoro trito , meEe , cum plurimo Bctarunvfucco; 

▼el ex Vino, McUe , Oleo, Nitro> & fucco Cucumcris filue* 

ftris > vt vi<kre eft lib* pluries cita^o de inter, affeccl. Scd cur ^^ ^^ 

bydrâgog^m medicstac^tum in pom iam adminiflrari prar- 

cipit> quod tamen 2. de morb. âperteprobibuir in fplenici^ au* s;» 

Hyaropids ^^q^^^^^' Si^verd^lânicmfu^t^nepurgâSinequâjHCciSineqilaBep 

mcdicame- m^uefirOyfidei^riimdimMmf^ ingejîwn tmtkum educet • An hoc 

Sa*^Sî^ inijs proprie feruandii» eft, quibusLien proprio affcdiu, 

«Uiint. atquc effcntialiterlâborat > itâvc quamîibet fuperfluitatem 

facillimerecipiat, acproindeâpomlentis omnibus medica^ 

mentis arcendusfît, nccius aquamagisaugcamr > vtdoiftcr 

asnotauit morb^mul.îmnoc.iii verfum j io.? 

Venim ficca Se extcn^mnda propinanda, vt non moddcathari* 

tica vi, fedaliapâriter extenuante quaHtate atncilro fet . At in. 

propofito affeâu Hy drops, non â lienis imbecillitace , fed ab 

impeniîus deurense febj^ y eliqoanteque proucnit , quam 

vtique fcbreot ii^t'^m^tMihm eseti^uere <]^an>primum 

Hydiopi enitendum eft : Qoaparko: rari^ae pituitofifîîma cibariahxc 

1^^?^^ echibct, qu^ alias; damnoia peiiitus , atcpic irratipnabilia , 

tuitoiS *u- cenlenda eflcnt ; mit ii^ edani ini^Higere velimus vt text. j 5, 

MBQu. . i^jj^ ^^ ^ vbipituitoâffinia cibari^^a ex Hippocratc efle dixi* 

mus, quaî^copios^ atque optime nuiriimt;cuiufmodi in cor- 

pore colKquâcaacpeim con&mptorequki eerţiiîîmum eft^ 

vc eo^corpus reficiatţu: * alimentique beaignitace liumecăe- 

tur . Quod fi b gcDonâris fiiexuiţ > ad cbyrurgiam coiifugit , 

inque vmbMici ambmi piures imxm cruftas fuperficietenus^j, 

m^ mod4qud4Hydrie>^c^ ykcmm fecilc<kinde fancntur 


Digitized by 



c% aiph* 8. {că.6. verum etiam , ne , fi aHuspaaetrent , zqm 
per plures duâus afl^cim cum xgn pernicie egre<&itur : miic *- 
lib. etiam de mtct.Tt&â.fmps'vrita > inquit> c^ta. ma inm Hydrdpîct-* 
ţercipiens > aut ferrammtis » ^;?fi» mtdta cauîîone ^ obfirtmticm > xMm^m^ 
nevltrkţ€¥mas ; fo^^ i mt^U principia fadto . ,Quam citias 
enim id pr^ftandum eft^& priufqtiam vifcera ab aqna viden- 
tur y vt etiam motoemur 5. epid. {^.-j.Hyâropic^s celiriterfi^ 
cay'e<f(>rt^ ;T^eJcmte£ vrere fîatimifc^Ahdo^ ^ 

fiimque praefernm OrneBium^ quod kumore difteimimeA» 
înuftH>mb«s hifee exiÎGcare , ac roEorare intendit. At 5 aqua 
in alui amplkit^nem efibfafuerits tune opera? pretium erk ia 
ipfomec vmbiîico punâioaem, feu paraccntefîm acuEo ig|ii- 
toque^adiolo inftigcre^ e^aque paulacim^reheratis vicibus, 
cflEundere , vt abfqtie virium diipendio euacuari poffit , iuxta 
aphorifini mommmfeâ, 5. 27, Vnde lib. deint. affeâ. ca?- 
Icni feruat ordinem . VhperforaiafiieriTtt, inquiţ, ^i^ţarjim. 
emttito ; ^ vhi emif&risy linamentum ex crudo Um inditQ,^Jpm-* 
pnmmoUem^^juperimp&mîo : deinde , ^tnesxdâaty linama^um 
âelignio.Emiîtere ăutemţerâmdecimMa aciuam oţm't^yjhmlm 
die : Pcfl dmdecimum dutetndien^, fiqum^ deâmai^rtmîti^am 

^"ventremdkis^xfrccare ♦ Aiiimadii€Efioi»e irrteiim d^um 
eft in hoc textUjquod etiânotauit Andreas Laurentius,quam-. cap^*^^^* 
^ uis ex Hippocr^is mei^e fecandi fine in tertia cofta ab viei» 
au.2^ ma inter. affe<5t, attamenmaxi. y^^^^ 
mam fecandi opportunitatcm effe in vmbiîico > per qnem 
fep^nmîero-ipfenet natura a ft^iaaieaqua fefe exfeHier^t- 
re coniueuit: coeunt fiquidem ibi vmbilicalia vaâ y qu^ - v 

aquarum impcîu fepe ab inuicem difiunguntur : cumqs Pe- 
riconaîum naturalirer ibidemfît perforâtum,-vt tractam ijfir 
dem vofîs pra^beac , in punâione vnacutis fecaitdafupererit^ 
& vUo abfque difcrimiae tantum praefîdium admkuftrad 
proiade pocerit : quodnon euemet^fîinfra vmbilifum^r^it 
in lateribus fe^lio fiatjquodpr^ecigit Aeginetj^^ casteri<^ om- 
nes , cum Perkonagum neceiîkio perforandijm fi^ 
tş^mcn re videndus omnino^ft Hyeron, F^itab Aquaped* 
parta.chirurgicarumopcradonum cap, J4^> ybirem liane 


Digitized by 


^^BiSirmiM&^mti Cxţcxăm de chiruj^icoThoţriuxilio an* 
• riquaiuit j at nobiUş jquseâip inter Euenorcm ;> Eiraiiftraciim, 
^ Medicos ex altera parcepluritnum agitata^ quorum conţrarias 
rationes luculetiţer teceniet Celius AureLtard. paff. lih*$ »c.8. 
AmmuaL, ^^^ actemperaBdi^autem vifcedbu$, ă: habitu corporiş, ^du'^ 
quaefdo^de Ba dftcrc, v£ di<ă^tim cft :, piî;uxtoMîma ^iriggida aempe & hu- 
l^âSr.^ ii^idâ > habica i:ationex:aulsB , â quahydrops^ic fubcreuk ^ fe-; 
brilis nimimm c^oris diii colîiquantis . Ita & GaL i o*meth. 
c. c I . Febricitantibuş buiufcemodijconiimilem prasicripfî^ vi- 
Ciam ex ptiiâna, paaeloco> câ^cenfque huius genus , quemad- 
modum 8c idem int*afFect. , &: CelClib.3 . c.2X* 
si fcbns quQjim ejîcum hyânţe ; h^c in trimis fiibmmenda ţer 
emraiipnes jţo' quas bmcjkcmzri ţo^e ţropjîţum; ejî * Sifim 
fehre^aeger e{i y tumdemim aM ea veniendumefl ^ ^^ipjîmorho , 
medm folent:xt3sn quo 2kă reliqua certum eâ hydropem>ieciisf 
quam ideritia > iuter serumnas curari opus e^^^ ; yt babe tur ^^^^^ 
Hydfopici $^^^i^l3.yâTQţi^timlcimihus f^ 
aemmnisctt. Udum p in oleoUhcre y nmmultumlauarly iţ ca^uîîeţlâi * Vinum 
^' autem album ^ tmud iţ Jornums aimliatur , & lib^ de afFecl* nu.î^, 
Cihos autem , iţ ţotus » ^ lahores^ac d^amhHlatknes .coufiituito ^â 
^îdhus £racilis if Jtccus madat ^ 

jrj Cum enîm marbus perîciilofî^^^^^ tis pe- 

pericuîoib 4f^^ opprtet : Si cnm flicceflerit ^ ianum iacîes; 
ftTcutzti fi» mlm^ y quQ jd ^tiam alias iiiturum eraţ , id ipiiim ; 
opoitct w perpeţkur* : ' d. 

OGcafîone Hjdropis> pro ciiius airatîone &fernim &: 
ignis ad vlum reuocanda funt, obiter , atque inciden- 
tei^Vg^^ericumtiDbiscraditurcoiifîIkim, quo cordati Medici 
exeitâcurafîimtîs ad generofa qusecunque prafidia, aliqua 
eriam cum-diicrînîine;hau,da6ier experienda > fciiicet vbi 
m^tbiis euiâeiis minatur exitium ; muica fiquidem in pr^ecipi* : 
ti -pericuîo re(ae'fiunt^> alias omittenda; ^ fatius eft an^ceps 
expem^uxllium ,. quâm nuHum ; cum anceps fpes cerca de- 


Digitized by 



fperadone fit potior ; vtque docuit Galcn. , melius efl: iegto^ 

tos iuuare cum pericuîo^quâm nuHo prorfusremedio adiutos l^^f:^ 

finere mori . Nequefententiajhukaduerfaturlibelîusdear- ^xic^o 

te> in quoHippocrates inter Medici oiEcia recenfet,eorum, ^^^^ 

quiâmorbisvi<ftifunt> curationem nonaggr€di>cum idin <io£aercj» 

confeflfo Ht y quod Mcdicîha tales fanare non poteft; quod fa- ^^^^ 

îubre coafilium neq; ipic prset^rmific Galen.>dum i î ♦ metfa. 

cap. p. itafcribit . î« quo dejbera^xmmino Jalusejiy imprudentis, '^^^{^f^ 

conjilîj fiierit apud 'Dulgtm infamxre f-r^jiâia^quie miiltis fiiere z^adsl'^ 

Jaluti; & Mefues, Cmteyinqmt^nemdanim cegritudinum cwaţic'- 

nemjujcipias , ne mali Idedici nomen admfca:ris . Mukum namq; 

intereft inter graucm metuni, cercamque de&eradonem : in 

illo periclicari conuenic; inhoc,ibio prognoftico vtendum ^ 

ciem eitis , ro^toccijiy^nem firs ipfim peremit. Deinde^U graşds 
metMS fine certatamsnde^erationeeji^ indicare necejfar^'S pmcli^ 
tantis in difftcilirem'e^e ^ncji xnSa ars mda fucrit > 'qcI i^grpf- 
fe^vd f^elli^^'mdeatur ^ . .^ ' ... . . ^ 

IIÎI» * G^teriim iri piiero feyâropem: fîc curar^^^ puerorom 

Partes tumid:^, & aqua pleii^ j^peneiMse iMt^ ^^pps. 
pello , & frequentep & parum- educendumeft . Edu- 
cendum autem eftâfingulis corporis partibusv& 
fomciitis ytendiim> &femperlocu^^ 
eduxeiîs y calfacflorio medicamento îllines . ^ 

PVerorum iubflantia omnium faciHime digeritur & diflt-^ 
pacur y propcerea quod eft omnitim humidiffima , vt an^ 
EatauitGâîen*ioaneth.cap.i7.:yncmiîioraexigitpr^£dia, r 

in ijique curandis 11 m nydropem incidcrint, qucnjadmodum 
ia caeieris imbecillioribiis ommbus , fîmpUci &<3ioiie pro ■, 

aquaeducenda,iureconcen6îus eftHippocrattSjCUOiinadulr 
tis , robuftioribuique ad ignem ftacim cbnfugiac . Hi etenim 
cum duriorem habeant >4iccK>remqtic fiibftanciaEa Ipiîgius â 
naturali tcmperie deceflerunc, fi quanda inorbp hoc eos cor- 

Digitized by 


^^s mF2omjns tis. ix. mioc, itt hom. 

ripicoîitingat:: ficciora promde requiruat auxilia , cuiufinoii 
i^nis cft 1 prsBto: quam quod propter aUas etiani caai^ 
Cjd.Aatcî. tu difficilIioKS exiftuntmam yt rcferţ Aur eli^us de Hydropc* 
mâ, ^âC secundumnatursmtvd fixtmtâifkilm^scwraţmei^^ 
q;ufri2aVa- ţ^ foâfuinos marihus : item fecundwnjeţâUs^fmUpres curation^ 
^^M^mtln pi^^^*^^^ ţiiimîes;d^iles 'oero â^mis medU , vel fines , mn 
hj>dropccu. jhlumquodnatîiracrefiere^elmgâriy ^li^eminuiveldşcUnarcvi^ 
tcator. deantuTtfid etiam quodaŞ prokiheantur , dif cpgmturid^ ne^uc 
Jîiadere,nequscop pojfe ţrohmSwr* Mitius ergo traâandifunţ 
pueri, ac vbicuaquc per tumMemmaiQra ita^nancis aquas 
appamerintindicia, magifque ab intcraneis cutâiîC3?xectiîc- 
xint partcs , ibi feâio adnuniflranda eft , iîuc criira liflc^ iîuc 
Fomcntaap Icrotum, iîuc abdomcs* Fomcmiş pr^ţcreâ ^xficcanubuiî 
po^Ti^S -calefacientibufqMc vi:eiîdum :, fub quibus cat^îafmata ctiam 
ncm Sidfo- ^ linimenta enumeranda func, qaom magnâ congeriem apud 
Praâîcos reperire cit • Vulneirataiiidcm pars Câlefaâorijs li- 
Bimentţsfouenda^ ac rccrcaiida , tie cdor- in capemtiis extin- 
^atur. Q£3£ommanonitapucroruînpropiâ arbicrcmur^ 
quia caîteris ^tiam HydropicisconuetU2uu;fed vtpuerorum 
hydropsleuioribiisJbis medicamentis vtplurimum ccdit, fie 
inaduIdsacrabuiiioribu^prsEfemmiîco^^ nonniii 

ff iŢO & i^nc fuperari coiifiieuit ^ 

V. ' Pîeurîtis fîcca dtrafluxuin fit cumPulmo valdc 
Ptomsik* :ţxfîccatusfuerîtpraefitiiîectîl&ria:Puîmoeni^^ 

tura ficciis e^fl:ens> yfaâamplîusguicquam, cjxiâm 

pro natura, fixficcatus fuerit^gracilis fit; &impo- 

tens xedditus, & adiatus prae impot^ntia iccUmtiis, 

Jatus con-iingit ; & poiiquain contigerit , ip£im iiu- 

yaîmoiatc- anî<îum€xiileîis> cohasiet, &adgîui:inatiir,&Pleu- 

catlr^rj ritidemyfeoceft^lateris jnorbîim facit . Tiincvero 

Sf^ &doiorfitinktere;&inckuicula;&ibbris,^ 


l^uîs lâ^mm-dolor^ dummpdo oblăîfas Ipiritaîium 
pardîi ââioacs,Pi^uritidis Wmine dignandus fit ^î 


Digitized by 


. : - COMMENTAKlî IllVSn..ÂTVS. 2 jj ■ 

whn^rorsuîin eoperosexcernatuE^ /îcca PleiKitis dicicur 

ab Hippo«ratcî nam % «âuiratum; njhil exccrae» £cco- *^^^"'=«- 

rum oranium morbonim .notam e& docuit Galcms i. m^oX 

de yi6i. acut. pam .Z2. Jl(^«, ;?ecibr , inquic , ^ultis Jjgno^ Itm^tr^r 

Jcttur ^odts y quimqmm in vnmerfumcoTKtnwds Jh ratio di- ^^ctp^ 

gnofiendi. P^l>neummaqmJ^,^Plamtiî,atqtuomninoqm «^b^ 


ab aJleBitexfmturpanihm,Imnonsvero,.'velMeJkrSy'oel 


conihtaftt,aut pro nec^JJîmeexcemat turn Jicca,tum Jura, if 

cxpramnt jkrceri Jîmilia excrementa. MorUfiui ttmarteria- 

rnmytuntvmarumdimofcunîurlingiia Guiţate y^ ea, qu^cu- 

t^^»ccupat,anMt^e.Sicx>lceraficcaf^ ^^j^_ 

dxt tchoru, S<epius ^inOcjdisphlepnones ficcx oritmur, nihii 
eaeernantes^ Cerebri pr^Ureaagntudines , qu^ neque per nares, 
nsqiie per palaţum expxrgantur , ««re sptimo ficc^ diamtur: 
SuQtitaqueiîccx Meuritidcs , in qaibas aihil per os excerni- 
cur : noQ certe, quddmorbus adhiic inprinc^io fie , eiufquc 
materia , vel adinodam tenuis ,eâ3âta:iuljgiQisiaipetum ciu- 
dat r vel craflSorquâm par iît,&gfatmo/5or, expul/îue co, 
aatitHis Boa obtemperet ; vd. dolor tunorem incatiat ; vd. 
cfîceta:- deiaum vkcs thoracicaram pârciam coriciHlionem 
cicre non vaicatit ; lîc eteai m Pieuritis . :qu2Îib^t iicca aii. 
gaotempore dicipo-iretîfcd taiis vereacproprieeft, cuâis KesTâidi 
morbiiîca materia taataseiigktinoiîrads & crafTitudinis, affe,^"*'*'*^ 
aaque pars adco denfa , vt nii pemtusaPMegtiwne auel- 
ii , aii refudar-e po^t, itâ vt dciperau omaino (k anacatar- 
hs, noxiufquehamorper alias quafcunque viaspotius cdiid 

natus fit . Eiufmodi autem cuaditdwn abMtcoib vekalorc ■ 
velfrigoreimpenfius patitar,atqu€ exfîccatur : âcalore oui- " 
dcm in alitu m foperfluo bumido diffoiuente ; â frigore ve- 
roipiura calor«m expcJlente; qui dum egreditur ,°nimiam 
biirajditaiem vnâ fecum educitjac dumperhumididifcef&m 
iKCicasintrodacitur,craflrefcit humor, atquccoagulatur.Coa- 
gulatioecenira qusdatn exficcatio €ft,quar,vt diâumfet â 
fftgore itidcm caulari pGtefi,quod,yt docct Ari«ot., cogit, & ^^t 
cxnccatj&liîcraflfat; Quapropterfic^adiceturhîecPkittitis "^'•^s- * 

K i non 

Digitized by 


non mo4o-qiiod nihii 'm tae3q>u«i« , yeriim ctiam quod 
moibifica dos materia inexpeâora&aîsptncifiecitâcered. 
dita fîf . IdnobisexprdfitHipp. I. d«mQrb/iieinquieHs. ««i' «î» 
mo^fe ^ P^//w«/«w»îd d? Pliîtriiisjmejpaoae^^exeadm cmjk , ^ 
y\t!imi^iit P'<«fi<^"f^-tsi Siccma ataem^ caUda., vhinvmitm caltfiuiunt , 
Si^mr ■ &frigpda<vUnimumfii0aăHnt. QMgelatmaumtlatiiSy ^ 
quxfiintiniffQ'oesuit ^comeiUtiâr, ^.qmfaummiffimeppi- 
tuiu aut Mis , ida caUditatereficeatur, ^dolorem inducit , ^ â 
dolorefebrem . Huic autemmnamficare cmdmtmmem^leni-- 
tidem afpeUatamyauthepatitidem , iuxtâvtramfanefMerit mor- 
^ '^t'pieficdoloTmoUiorfk y^latMs^ i^^ 
-vena ^ quMawm miţfaefl'hiiu ac pituit^,acipjim fmgmnis agro- 
tmtis^ , diffuudâur , # a cd^aMorys ^infern adUbitis^ ita. vt 
morhisper^tottm coffiudă^pergafycr^Viicatm autemh^c Pkmtis 
Jmefpuro. Neque diăkjmtGsi., crîfîb.cap. io. fic . 
habet , Cumţa.gîa exqu^tiangufiafiimt, ^vduti alligaw in 
fit aptyfii, idefiy-jhu^a notmnoiur. B^ammQîbi hu- 
lus idea , qu2 nonin f|aitQrun> tiMtttmjaa44 vaciatateii 44 
in- ficea poaus cy in partis; aifea» , cum «oxii humori^.. diC- 
poCnionccoaMitt quod că clarius paiet , quo mie„€- 
gnafîcc^fiPJeuntKbs ,:alba atquc piEwicoâ exaemejitâ Me 
recenlentur ; pîopoiiras iam tcxtus perpcndeiîdus eit , io- 
quolaterahs quidam doJor proponimr , non ab humorum 
ftuxione , vel copiofacongefltone proereaws , fed a Pulmo- 

S|m ^. fettnatutalem bumidieiigeadam , quf iftpuîmoaibus necef: 
i^ pul- too rcpemur,min.quia&ciaaacurafimt, tumquiaaffidu^ 
»««^'«- «ioiiemur,cordiqucadh2i««,âcui«sperenni^aI,ditatc, 
actuligimbus, numquamaontQfrentur» atqueexficcamur- 
ex quo lugj ladjgent hmneclarione înpotu per trachsam fenl i 
riînd.elabence;quafifraudenmr, prsfertim fwliquainfuper I 
^cedac ocficcationis cauik v£ loiîgum iter, cx^ftuans aer Jra. I 
E*bal)s feruor , aliaquc k«iafc«»odi , mm gracilesfcant ne! I 

. <=«y«"^'^'i^"ofoqModam£urgoredeftituti,lemitabidiflac, 
ceicuDt , iiique.Iatus coJiabuwuri qwod^ auSnofo aJiquo 
J^WBore obduaum naoci&aatur , iinpJicJu adhmnt , len.- 


Digitized by 


j^uiqw hMî^or glutinofîer mim â concepte caiprc redditur^ 
-^umc^c htm jConcaIefck> ţc dplpr <?xcitatur i yeram Pku- 
riddcm ementkns.Neque mirum fi tmmOj^ in cofîfenfiim 
trahitur , & febris accenditur , tiim propter vicmitztcm , turn 
jquja praspcditiş Pulmoaibus ac libera cxpliccnmr ad yenti* 
Jandunî , djenegataqiie expedka fUmpfîtacum ^fflatione^ calcxr 
.pr^îxrnaturaUtier in Corde ikiîi nego^ri^ intenditur : alba 
aatem.€xcra^ gîumicfocn m Tlioc^^ huGxorem attcfiaţiu:^ 
a^- 57- G^»Mmc falcmr Hippocmes dcfccipfit^ fuifqtie Jic^cis de- Poiniom» 
lineauit lib. 2. de morb. p^ h^c yerba . Si P«/îKo^^^ ^^^ 
l/tpjusfumf , tîf0î^ ^i?»^ , & ereSi^ ^^eruidş ;(pratîo > i;fdmam ^^ / 
tnfftmhre'^cit.dlmn , -^ dolcrăâfeShis & dorftm mtrpt > ^ 
imîmlmsFiibmintendiî , ăgrme^M mp^oreincmnhere m* 

fiimtimemfroMisty, & (^nfeBmt ^^ l^f^ âecuhimmfuh- 
pimt nmmami aifamm y^enm-vdt^ip'^^ quiddmn ^Âă 

fymp^îmmm ^aufas do^e profcqmtw Saîius ibidem t ca^ 
dcmqiic ^"eâio'cxconfoffo inţerdîOT^ Thor^e aut. cx^ 
dificâo fixppurafo>lvbi incauuus admîriHfaraîa focric cwrar 
tio>yt ibidem abHippocratcindk^rtir.^Cafîm^ Tuîmoaa 

ţi tcxm dubkar« cofîtingit > mim Piâmo re<5le dicaturiiu aa- ^^^^^f*^ 
turaficcus , cum mollis perpetuo ienţiatur â xz&m^ & guod: 
molie eft> & hamidumiîc ,^Calcni teşu3a W). a, de tcmp* 
cap.j^ QjiiB^ciam Gaicnus idem exprc& verbis Pulmonem' 
inter mollia membra; pluries recc^uit i .. de temţ>er. cap» 
vkimo>:& eodem 2*^ temp^ c.3*Pro<iuaie4icendu «^ 
ducimus Vilcusiliudfeifle a iî^:ura;Coadim Bxlawmk 

dilafâcionis^^ coafixi^ioaiş motu atcf^ctumaerem, pr^pa- ^^ • 
rammqueCorditrafimdei^tadnimium eiusardorem moi^ 
randum^praîftandamqtîe%iridbusmateriam- quod mimis 
commode aggere poffet, fi humidumi natura exiftcrctjsam ,. 
veluc coriaceusfollis nimiomadorefufFufus, &graueeiTct, 
& eiu$ partea coîidderent;itâ Ytneque expedke moueri> 
<|uej&m explicări , dîhcarique aptum eflct- Hiic acceditji 
quod ab humidion te mperte aer haudpurus & fîiridu^ , ciw 
iufmodiad vitâlcsgigncndos fpirîtus îîecefic^ftjfe4<n?afik$ 

K k 2 pouus 

Digitized by 


^So hispocsjITIs us. iîldb ioc. whom. 

l>otiusv iat^c caîigin^^s reddcrctur . Optimo proindc iure 
ta(âum cftj vcinnumeris fpcrmaticorura vaforum diuârica^ 
tionibus Puli^^num fubftântia incerfcâafit , ( cx quo mol- 
. lem fâltum Cordi circundatum appellaurt Plato mTimxo) 
cxiguaque caro laxiffima atque leuiiîîma ijfdem aftula fucrit, 
-quaiî faiiguÎBea fit (puma coagulata>^ vt a vafonimikcitatc , 
& fpongiofce carnis humiditate moderata qu^dam oriretur 
iîccicâs , qua? duriticm non gigneret ^ fed commodum potius 
vfnm > qualem iam defcripfimus , exhibere t . Vtque ia ea 
crafialTemaretur, kâlocatum fuit, vt quicquid licciţatis a 
perenni motu,& ab intenfo Cordis ardore eiufque iuliginibus 
adijcimr,id potus pars, qu^ per TracH^a internaîacera ieniim 
deîabitur , & Gercbri , cui e dire^o fubftrâmm eft r bumi* 
diores influxus, ^cseterae omn€;^ faumidicatesy quas fpon- 
giaîinftar viîdcquaqiie dliicerc namşi eft, temperarent/At 
fi qu^ ex caafis ijs pra^ualuerit, modM-Biînio madore ftac- 
cidum , piîtrcdini^c pbnoxiunrconcfdit^^^^^^î^ 
citate femiaridum; atque cxfucpuml2i>^;^i^m quod rarum 
& moîle in fea^âîbftamaeft r^tetnmrimr^caiiferumalterat^ 
nibu$pl4is quamfâtis obimxium:exiffit. Dicemus itaque Puî^ 
jnaniizn fubfiandâi» moUem â ienlu iudicari^ quod ab extra* 
neis humiditatibusperpetuo madefcat; id quod reipexit Ga- 
Itaus locis prseaiîegatis ; cum tamen ex fui natura *moderata^ 
iiccitatis fit , vt Equet ex rationibu3 addudis, &c docuit etiaa^i 
Auic, lib» I. £ I. doc* 3* capv a^> ^ multa ante Gâlenus ip* 
iemetde anatom. vinoruraj^^cap» dea|iat*Gordi^ inquiens^ 

maiis^ ; . : complexi^îem ^ qsdamttmturcalida ^ 'ficcojanguineffiilicstchde^ 

pinm vas phlegmatis^ Humor enimdipUktâcerehra ad ţulmo^ 
ţiem > quajipluuia^ vndâ cx accideMi ahundaî in eo ţhUgmaîicA 
hsmiditas . .. . ..i 

^ ' Hune muîtis potibus ciirare oportet / &c îaîiare* i 

sicj Heu- 2c3oloris medicamentum prsebere, & alia, qu^ cj^^ 
z^ cuia. creationein faciimt/Hic feptem diebus {^.vls fit:? 



Digitized by 




& morbus mihime pcriculofus cft , & cibas prâebe- 
re nou oportet. 

DIximus fîccam Pleuritidem duplicitcr fierf; primo quî. 
dem â copiofa materia 5 qu« ob fîccitatem niinio caîo* 
re vel fric^orc contrarăm craffa adeo , ac vifcida reddka eiî , 
y t intra venas, phlegmonifque porofitates coariSîata > nihil În- 
de expelli , nil refudace poffit : quapropter expedoratio de- 
fperacâpenituseft in boc affeâu> vnde ali)s quibîîfque r^ 
foluentibus atque euacuantibus obfeflam partem ab infcnia 
farcina liberare ccntandum efî: & de hac Pleuritide dixic Hip-^^^-.^ 
pocr.incoac. Fleuritidesficc^, ^ finejţuto âifficillim<e fimt . 
£c lib. 5 . de motb. Sunt Sficc^ Fleuritfdesjîne^uta; 'oerum fe^^^-^ 
* difftcilesjunt ^c. pendent etenimâ ccpiofa materia plurimum 
conturnaci , quse neque naţurse vi concoqui> neque medica- 
jninibus diffolui , auc euacuari, nifi difficillime potcft. Alteia ^almotm 
jeraficcaPieuritiseft, dequainpr^fentiaagitur^pendetq; ^^« 
a^Pulmonibus flaccidis , atque exfuccis^ lateri adhasrentibus , tis'cuxâtio* 
ibique glutinofb hiimore implicitis ; quapropter , cum nequc 
copio& fit hxc materia > iiteque arcâioribus locis concuicata > 
fed inter Thoracis;» atque Pulmonis iuperficiem media iît j 
lî^orbumparit minime periculofum, fedcuratu^fecilem, vi- 
delicet primo ieptenario . Huius curatiua intenţie ea hume» 
&aţio cum Pulmonis , vt ad priorem naturalem habitum re* 
ducamr; ţum viicidse materiei >pulmonumpinnisimplicitse> - . 
n diluta , ^enacitatem amittat , libereque moueri fînat • Iurc ; 
io^itiir Pleuriticum * ^ , 

^ /. ., - PotuvideBcct 

Hune muîtis potibus curare oporţet. ^^ ^^^^ j^ 

berali& copiofo, vtpr^eternâturalişixcciras abunde tempe* 
retur ; led per interpolatas e tiam vices > rciceratifque haiiti- ' 

bus afliimpto : ( id enim imporcaţ pluralis potionum nume* 
îuş)lta namque & percinacia muantis pcruicax morbus iiipe* 
rabitur , euitabimu£qae ne p<^tu|entu^ humoraceruarim in- 
gurgitetur , fed paulatim , fenlîmque h^uriatur . Potus immq^ Totqt «a» 
atfatimingeâus, dcrepentc toţus fcreinventriculumdcijci- *^S^ 
tur: Quod fi feafîmhauriatur; magnacx parte per trachs^ <kkbia«^ 


Digitized by 


rimuîamin Ptdmonesddabi poterit. U annotauit Prarcep- 
torhfadlodecorde, ingaiqns . StomachusvelîainfimMkilukx 
potus copiam exapit . Fertur eiîam in Cititt,,^ .Pe/ „^'^ ^^ _• .. 


. fent ^mdsm ali^md ampliorisfatus penetrare . & paulo inferius 

debentpouaaes, iioceft, varise , diuerfiquegeneris; qiiod 
mMrauumadfkiîiorem €xpeaorado«em cofldSk ^^ 

Pîeuritîco- t? 't * 

.Tcaf^f' .^^^°^orîsmq3icamentumpr.^|,^^e, Scalia, qu^ 

tione fcda- Tk 1 i "* 

1« membra humedare, cpiarcq; mirifica j^ZL .^'''''' 

Ec cibo,5 prsebere non opo'rcet ^^^^^^»^"» afecx:fî-c- 

■'^^ ■"•* cationepedeathgc 

tioac feda* 

Digitized by 




Pleuritîs ; îtâ vt cea Tabe laboca:^: thor^icac p^tes , aîimen* 
toqueproindc rdkicndsBfîijr^ â^uapartiam fiibftantia hiî- 
medatur dutn fanguiiient & j^irititm copiose fuppeditatt 
nihilomînifâ cibaria ]xmă oflferenda; func , vt q\xx naturam ni*, 
mis aggrauattt>€xpîendoque fpîritales parccs coarâant , fpi^ 
randiquc difficuîtatem augent. Sorbitiones itaquc fatis ermir,, 
vtpote acuta morbo coauenienâores» ^ 

yj j^ Febres porrd proptereă fîttnt . Cum corpore fu^ '^f :i; ^ :j 
per inflammato carnes.intumuerint, ScPituit^ac ^^^iâ^^^^-^ 
Bilis conclufa quîeuerint , &:îieqiTe refrigeretur ^^-^ '' 
quicquam, nequeexeat> nequenioueatur> neque 
aîiud quidiubeat . " 


Nteromnes human^ natura calamîtates^quasinnumarar Febmm»- 
_ propeiunt,quemadmodurnnullaaucfrequenciorcxiftir,. xxo . 
atu exitioiîor ipfâ febre; line qua, vx non nullis placuk, neque 
vitsc clauftra abrumpi fes eft s kâ vix aliud ex medicis argu* 
mentis vel magis iaiplicicum , vel ambagibus iniiolumni re» 
perias : quapropţer pluriinum quo vis cemporc magna vexa» 
uit ingenia * Nam ecfi eius elTentiam in quodam caloris ex- 
ceffii conliftcre fenfus ipfe diiudicec; De caufistameaseftua- 
tionis huiusicc vixcerd aUquid^afErmare audeas ."Calenus j^^^^^ 
porco lib. I • de cauf* morb. cap. 2 .ad quinque eam cauiâ& re-^ cx Gaieao . 
diîxit , ad moxum nempetum animi, cum corporis, adpu-^ 
tredinem , ad vicinitatem corporis calidioris, ad ftipationemj. 
ad alimentum caleiâciendo accommodatum : quas omn^ 
m*2t. ficpamerexprefficHippocratesIib. i^dcmoth.CumB^ & wj ^»^ 
mituita cd^aBcL fuerît 9 tQîumreliqii^^ cx Hippo- 

vocatur h^cfehris . Cahfdt aiitem hilis ^pituita. intrinfecus qtd* ^^^^ * 
alem â cihis ifpotuhus ^ â qidhm etiam nutritur ^augeîur , extrin^ 
fecushero alaiorihus ac "oulnerihm y ^â^alido ninuum cd^* 

hxc eatenus tantummodo corpus akerare naca funtyquateniis yebmmpe- 
varia pathemata in animum inducere poffunt , qu^ accorpus JJ^^ "^ 


Digitized by 


2^4^ HiFFcxKATis JJB: ni^ mijyc.m^n^ 

vnâ immutant . At pro hamm explicatîone videndus eâ 
Saliusibi Ulcoinmenco : Aţtamen ftate pcriodum Icges ia 
humotîdibus febribus , vel quotidie in certas horas rcul* 
uefi-emibus , vel per tertias , velper quattasdies, vel ion- ^ 
gioribus adhilc iiiţeruams , tanto ordine ac fytnmetria , adeo 
inirabiîesfuac, vtprohammrationibus reddendis ad occul- 
m putrefcencîum humornmnaturas &proprietates cosfii-^ 
^ gere neccfle (uent: quod tamen quantasinuoiuat difficuî- 
tates , quam diificulrer intelleâu percipi poffic , quifq»e ^f vt 
.- puro> per fc experiturjcum cx pro&aciffimorunt Auchocum 
ceftlmonio dcncur etiam quinroiis febres^ fcptan^c^anse & 
nonan^svt prartercam eas^quae de decimoquinSo in decima 
m^icim.2, qitinati m iiiuadunc^v t tefîamr Nicolaus Florentinus; veî qux 
Sum.4. dm, fingulo quoq;ai>no>eadem natali dic,vt4e Antipatre Sidonio 
^ă'£hb. 7. ^^^^^ i^^ţ;^^£Piin.&Va]er.Max.,Nâ annuo hoc typo ad vltimă 
v^c/*MaK ^%^^^^^^^^^^^"^"^ ^^> ^c rande nataJitio dic ab eade hac 
lib.y'^^c^!'^* febre extinâus.Neq^hocPlinianu commecum arbitrcmur,nâ 
d^^icb ^^ ^P "^ Thomasâ Vcga,AmatusLuritanus,Gennlis,& 
Amat.Lufî' Beniuemms obferuarunc ; kă vt propter hoc non panim nobis 
f^f'i^ femper arriierit opinio illa , quâm do>aiifimus loannes 
nb,7.& cur. Manelphus in aureo dcfcbnhus n:a6îaru regiftrauir, ecfî eam 
GcmTâ^âd ^^^-^^ P^i^s Horatius Eiigenius in Cais Epiâolismcmdxix 
schenckiu. ptodiderat^ caufam nempe intrinfccam febris atque imme* 
sfS''' ^i^f^ effe iiifluentiscaloris/Tânguimsfciliccî>arterid^ 
f^ltîibr ^^P^^^* %^^^"^^q"^ ) vnionem in Corde^ ââam â virtute vi- 
'""Bl'g/rîJ* tali> vtitâadaucto calore, roboratifque fpiritibus, eosde-- 
^^ iude tranfoiittat per totum corpus, vel ad pr^cipuas partes , 
u^mkofi ad noxmm aliquod,quodfunâioni alicui impednnenco erat, 
^^c^; espeUendumrvnde prout noxium illud magis vel minus ir- 
ntans^ autcontumax eft, icâfepius vel rarius ad expellca^ 
dumNaturainfurgit,aut diutius in id agendo perfeueractqug 
yt in OiîHîibiîsordînatilîîniă exiftic quotiefcunque valida eft; 
id & infebribus talipaâo obeundisftaras feruarcleges ratio^ 
w™ nabile&erit. Hinc compiures fedancur morbi â febrili calo^ 
re; corpus Kalidiusnonraro, noxijfqueâbiiumonbus expia- 
mm rdinquit; prauaque exiftentc iiura corpus materia, rae- 
■ Ijus cft febricicare, inquiunc , quâm feciis : naai t]ai letbaliter 


Digitized by 



febtiei^nt<y cum propc mortem &M, â feb^ imnniîies red* 
duntur > ea quod natura iiimîîi« i^e<:illîs * Bii vl^rius co- 
^cjueiXjautexpelkretcmat^Siqueiateri^eritiper accidens 
id eft : natura etenim dum pîuries expulfionis opus a^grcdi 
cc^^itur y fepiulque efferuefcerc ; repetît^^ h^ cale&Ctiones 
humidum radicale cc^fumunty vnaquc naciuum calorem cx- 
tinguunt : quodliquido exprcffit Hippoc.5.€pid.feâ.5,dum 
inquk . Hisminis anima fmţer reficitur %>fyue admorîem:fiai^ 
temeţerhuerityfmmlcum^orhf ^ ammăCGrpt^s depafiit%ir;fto 
aftima prârcipiiuni eius infîrumentum inteîlîgens , calidum 
ncmpâ tuni influens, turn fixum . Vertlm , qukquid de hoc 
ik, xertum cft Hippocratera pîuries de febre, pîuribufquc ia 
locis egifle;> ^4; de vfc. acut. ^ liî>w denae^ horn- , lib. t.fc^ Traâams de 
j:.cţMdiy&I^.6;feâ^ ioin^v>încoac*yiGHb,de^m^ fcbni>i2s ab 
aîibique frequ^^er, vbifebrium cflTeiîtiaaa > differeadas.eau- coSS^ 
fas^ prsemy^i^V curatio^ejGşieeft p^fec«^«s; fcd mode^amiiîuscâ. 
€3fprifcoTum fententîa Ibcutus vi^îettir s med^fuaîn protiilît 
fe; obfcure tatnen> varie, & concise ^'ită^vJ^perarduum & 
«xâfibe concipere quid hac in re ipfe fen&rit : quod indc pro- 
eeiiire arbia^raur,q*tod tra<Sbţ usdefebfib usviiiuerfis>queiîi 
fe xompofuiie teftaţur lib; j,^ morf^i ^ tempomm ifliurîa 
^* dq^rîcnt 5^ nune certe pecidiaremdefîrribîc modiuni Bippb- 
cnttes , quo febris accendt con&eukv vbi cor^s-zh aîiquaJ^sx 
praeternaturalibuscalelkîentibiis caufis , labore niminirri , d*^ 
bo > potu , ira, csetcrifque buiufcemodi inealefcere coiiăn- 
crat; tune etenim , vt luculenter docuit Gden. 1 1* meth; Sr«^:«jg«- 
câp. 4. ia fine , fi bumores^ vel quantitsă^ , veP qualiiatc pec- 
carites adfucrint , acaiore eliquati , iîi'e3dforvenas,ărrâîa{q; , 
ac demum iii corporisbabitum^ efen^fecitâr , atquc băît car- 
nes intumefcunt ; ibiquc coar<^ti,immobil^îiemanaît:; 
quinimmo prohibita arteriftrumvetilatione, peripirationcq; 
ab obftruciionibus , ncquc refrigeranturhrhumores, neque 
coturn aliquid per alitum aut fudorem cgreditur , neque aK- 
quid, fiue ab extrinfecq, fiue abintrîiifcco,e6 ingredi potei^ 
â quo aliquatenus attemperenmr : hinc feaiîm ac fenfim ma- 
gis incaJefcunt, atquc ioflammantur, cordique impertito ca- 
Ibre, demum febris caufa exiftunc . Perbclli^id docuit Hip^ 

LI pocr. 

Digitized by 


2ăS tiîPPOcKÂtisu^. imimwa IN HOM. 

poclibro 2» de diart. ^ it tumidis* corporibus praîter con* ^^^i^* 

Fcbrcs a k. ^î^^^"^^^ cxercitaris loqucns * B^c mm muk^m colli^mtionem 

boâbus» emitîunî • Qmcquid igitur exfitdaritfaut cuni corporedefur^atunt 

fnerit ffton exhihet fnagis iahoremin corporis parte pr<eUrcon* 

pMîiiâimm macuata . , Qmc^iid veroah excretione intus reman^. 

ferit y mn .folum buia lahorem exhihet > fid etiam eiparti, ^tK hu* 

fmditatemfiifcepit:, nonenim cGtnmoda efi partijfedinfefia .Etin 

cames quide??! carporum nqn Jtmiliter ccngregattir , verum in car* 

nofas partes , ^uare his lahorem exhihet, donec exiuerit: tanquam 

emm drcuitum non hahens qidefcensy calepttum ipfa , turn qH<^ aU 

Uhuntur \ Si igittir multumfiterit q^od excretimiefi^etiamfanum. 

earpiis exjupevat , 'ot totum concalefiaty^ fdvem inducit^-^u 

Caîterum> vt dicium cft ^^pariicularis efimodus, qui hic de- 

fcribitur > & vclut ad exemplar pofitus^ non vniuerfalis ic 

perpetuus;.ciimcertumiît pro yariatum âgentisri> turn pa- 

tiends diipoiîdonc^ vaiios parkerfequicfieâusreccnîmii 

neque copiofî iayenis repqriantur fucci> neque eraiîî & vifci* 

dii ^ens verd non iîţLpoţentiflsmumjtiinc fpiritus tantiim- 

modo inikmîîubit >^exciatbitq; vt plurimum diariam febre, 

diei fpatio fol ui paratani * Ac fi vchcnicnruis: a^^a t>kumores* 

que csficcando diffipcr^ icâ vt ven^ exhauriantuf^ tune h^ bi- 

iiofosc carnibusacque vifceribus accrahent icbores> â quibus 

ifebâ^axdf. fanguîacamaisaintcnfiflîme inflammatâj, ardcntemfebrem 

^ca«- cxdcâbh» vtdocetur4.acut.&i. demorb. Veriim fi hu. bu.jv 

moreş > vt fuprâ diximus > aut quantitate , aut quali tate in ^^^ 

• vide fînt ; tune â calei&cientecaufitagΣati>cxtenuatiGue > & 

in capillares venasdctrufî,, vellcuem glgnent obftruciîoDem, 

Giî.$^€- ^q^f 4iaria folummodo febris excitabitur ; vel , ii magna 

th.ctp.4-& focrit obftrudio > etiam putridafiiccedei; febris , vt lucuiea- 

4^*^ ^^Ii<^aturâQ|Ien.^m^^^ 

VIIL ^^^^ itague kflîtucîo occuparît , & febris , ac 
repîetio > iairare muka aqua cportet > & oko illine- 
re , & quâm maxime calfacere > quo caHditss apcr* 
to corpore pr^ fudore egrediatiir . Confeqneiîter 
autem iia^c facienda funt per tres,aut quatuor dies ; 

Digitized by 


aoMMEmARiis iLLVsrRjrys, 2€^ 

& fi non fedetur , ac celTet, pharmaciim în potu ex- 
hibcndum eil,qtio<i bilem edxîcat,& febrispexfirî- 
geranda eft, pr^ter quam îî qiiartaria exiftat. 

K^^oo Latmisîaflkuda, tnofeftam î%nîfîcât difpoiîn<>^J'||^ 
nem â nimic motu în corpore relictam* Sed proip- 
foiiietmoru atq;îaborc qtî.mdoq;^Hîppocr2tc vflirpari^clte- 
di Oecon. -xA/V.wo'/i sut^m , faoceft> rcpietio^idcm 
figstiîcathoc locc,quodhumorirm abuMântiatiaiyiciiriî cor- 
poris obftrucntium • Propofita itaq.curario -ea liquido cilcn- ^^^^^^^ 
dit j quas fuperrusdiâa funtj videJic et a nimio îabore , aliaue cuSaV 
confîmiîi extrinfeca cauTa , leuem quamdoqitc obftmciio» J^^ ^^ 
Bem mcarpore procreări, •firrtpîicis ritq;diari^ fcbris-cauiam, « ^^ ^ 
quxj niprotimis reinoticaiur, putridam pariter acccndere 
^otis efîj» modo iam iupcrius expIicato/Hinc quăprimum bai. 
iieis 5 ac linimentis , qus vim habent non refrigerandi modo^ 
atquehumeCîândi, fe^i cti^n laxandi ^ difcuckndique > cor- 
•poris habimmperrpirabiîem reddere > împaftofque humores 
aîijs calefacienubus^ V£ fridionibus> difcucere, inque alitufr^ 
fudoremquc v^rtererutitur, primislciliccttribiîs^ aacqua* 
-mov diebus: nam -eo^vfque diariaicbfis^-qu^r exteniîua iccirco 
nuncupatur âGalcBo^imerdum extendiconfueiiiî:, Exindc 
vero > fi obftruiiio contumacicer hâ?reat , liue ol) humorum 
dbftruentriîm copiam , fitîe obîentore^ & craiîîdesi ^ 'Ttz\x 
febris adhiic perieuerec , ac de pucridaiu^ timcndum fit^ 
pharmaco bikm^ liumoruni ca^terorum fomitem ^ educe- 
re aggrediturt h^CKamquete^suiscumfîc , calida & iîcca „ 
febnlcaiiacilîirr^c concipit^alorem , quem reliquis humori- 
biîs impercitur>eamque proinde potiiTimum expurgat ^Pitui* 
ta enhrijfqiî^ aîioqui & ipfa febris huiuscaufa obftuendo exi* 
ftir) naturali friggîditateihumi di tate^j; febrili caîori poiiusad- 
uerfacur. SubdîcdemumfcbremquarauisrefrigeraiKiamefle, Bmăs fc^ 
pra:ter guarcsiitim : ^tia m re ^ fine dubio materialem reipexii: ^f^ rcfiîgc- 
caufam , qu^ cum Rlaîanchoîicus^fit^u^K>^friggidus &:£c* ux qn^ 
ciîs, rcfrigeratioiiîrerimecur, ycqusiuccum iBumcraflîo- *^**" 
remi magifqueconcumacem reddere apta fit, Scd curiioa 
idem dicetur de qiiotidiana > qua? â phiegmacc friggido^ hn* 

LI 2 midoque 

Digitized by 


midoque,iiix^Ga!eni dogma >depcndet? An aHterde'fe^ 

bribuş philofophams eft Hippocrate$ , qui humoralium 

differcnţias non in vnam humorum variecatem, fedin maio- 

tem pociffimum , mmoremue bilis<:opiam admixtam retulit, 

.v.t p.acet ex lib. de natvbon).. ybi quotidianam âpiurima bije^ ^^ *> 

( Phlegmati vidcîicet admixta) procreariaiferuit . De qyaî'- 

.tana aucem fie locutus eft . Atqtiortan^ relupd^e iuxtâ.eanâ^m 

ratipncm hahenţ ; fed tertianis dmtumior^s Junt , quanto paudonc 

^^ . . hilis parte participant , *zmde caJiditas augetur yiţ praptereâ quod 

fccmim^^ corpus inipfîs plus perfrigefcit , id /ţucd ah atra hiU ipjis contingitj 

^^*l^Jf^^^ Jj^iperflţdeadeOi 'vt ^egre frigtis dep^Ui pofjiî ; atraerdm hilis inter 

masfacit. ^m^cş c^rporis hutmres vîjcofjjlma eji\^ fides Mut^ 

onanan s J^^^*^ • Huic Aiiftoteles fec !• probLjS* quartanis fcbribiis 
febnbs'igrjs igncfu corpori intcrferendumafleruit . Hanc diarias curatio» 
dîL" aT^' ^^^^^ pluries inUmmut etiam Galenus lib. i. ad GJauc* &in 
mctiiodo . 

IX. Medicajiieîit^ia Umcn » <k>nm corpus floridum 
eft y ne propinato : non enim vaciiatur , mfî parum y 
vtpote corpore turgente . Cum 2,utem gmciiis , zc 
ma^cilcritm fucrit > tune bibcndtiin exhibe , & 
euacuabiuir . 

Medicimc-; /^"^ Enericum eft boc prseceptum , in morbo quouis a pîe- 

hiSndltft vJT li^^^dine religiose obferuandums cuiusradonemcx. 

corporeiio. prcifis verbis ia pr^enti contextu annotâtam i perbelîe re^ 

ruiocxiuftc tuUx Author lîbri deRenum aflfeâuum dignot.& med.cap»4. 

Si-^atuoTy mqixlt yhwnores iîixţâ ahundmerint , potius "uena in^ 

mk^ purg^ ad[^i^ antspurgătionem ejî , ({mmpurgandum mte verLcfeBo- 

tionicftpr^. mm* Quoniam B per fanguinis tmffionem corpus priusmacuatum 

auucnda. fuerit yţHrgans medicammtmn exhihitum 'oenas ^ arterias 6* 

inanes ccrporis repoms inuerdt non oppktas : qmfit vt ^hf^uevllo 

impedimento in miim corpus dimanet ad attrakmdumjuccos yjd" 

* . dUimsque-^aţeonim msu;ii0iopervajOrum^atia.y ir fiijionefn^ 

ţentdtatemquejuccoruw, Namfi vafijanguine repletajtnty ^ pur- 

g^iman dedmsy nmp^tmt propter pîmitudimm in corpus diffhr- 

m i vndefţ vtjuhpa , ^ nihil efficia$ : autji quicquam fatit , 


Digitized by 


^«ytoto ; qudd moxbum ydixiqm&mkilmh, cx ctientuiac^ 
;ii5kîabilem ; fuhditquf îî^^^.«^^Mg^^ rejţoj'dea^^ 

exp^gmdum mirifice fâp$ fkiisâ^s^mi^mMmix^£^£A jfpnf 

\Quandopir^£m^^m^^^orţm^d^k^ Aph.9.fec.2^ 

Duretusu lâi^i^n£^<^h^tf^xâmcim, Hîppactates dcinâam* Acut^u.36. 
inatioGibus, ti^Bb^acuc., turn de Vem^viaiaquiais.^ i>cvcr.yur> 

fum 3 nihilaufimnt ; neqt4emîm remittity qtd cnahis ejî affhBus . năconcmi^ 

vero deliii fimtâi morhjfiiţeraU (^ immdkciMsm^m hai^* 
Hoc tameîi dogma #OB yiqueadeomuiolabae pm 
ad deplendum pariimper corpus , purgacicmque <Mfponm- 
dum, phlebotomiâ pharmaco iît pcrpetuo pr^mictenda > 
quafi aliter graciîefcere non poffic, aiunumqi^m ab imcio 
medicamentum exhibetefasfîcj mmiiequ€hoc|^rp<^aiiini 
€Îl in Medicina : dixic namque Hippacrate;> > doTiec corpus fish 
ridumeji^turgens vt magnam mdicaret venarum repletio* 
neni ; tune enitn fortafle non nifi emiflb prius fanguinemc- 
dkanientum tuto exiiibcre licebit : A«amcn, vbiacKiadfe 
jtantşhtunoruxnexuberantia, tenuior paucoium diorumTi- 
dxi^> mit ipiimec cîyAeres fatis eflfe potexunc ♦ Aţii in ^wm 
vijs copioiâ adiit toeculent^s materişe congeftio5 exiaiioai 
vcntxis grauitate , aut ex aluo diutiiis fuppreiTa confpicua;cur 
knicns aliquod medicamentum prius. exhibere nonliceat i / ^ 
quod nullam d venis trahendi vim habtat ?«fi pîura îmiusge- 
nerispaffimalferaiimrâMedicis, quse> fîue obmmiamdo- 
fini>iîue quod talia ex natura fua fine, purgatiuamhabcrefa- 
^uLoiicm qopioiâ deieâione oftendiint * id crgo dcfimuit 
ftii.44. Hipp. iaiib. acuu ex vrinis . Qmbusy inquic yinprincipio^uri^ <5aî nam^ 
thtmbulof^» OHtetiam craff^fmty îaks dcpm%we op<rrteU fi |^|StL* 
ttiamalia conîulmnt : Qmhust^ero inprinâpo "vrvye îmuss; tdes tomădi %t 
mpurgao/fdrfi'oifumfkmî^ infiifispm^dyP^smadhihcto • ^^"^g'"* 


Digitized by 



^taflîs^amqae VEJnk humoresiam« venis difcedere,iâciîeq; ■ 
.. _ . <xpufgarioftendimri<5ueEBadmodum£enuibusHOflduniilIos 
:ţ>affe eaacuari; Ced coarâatos in veaisj aiiaue ia parte coiii be- 
j:i ; y:eKntur wiquc noDnulli -ne , fi faaguis hatîd pra-miAb 
pljarmaco eraittatur , «raflus fuccus fecali materia in inâma 
-regionc admktus intra venas ad vacuum cuitandumtrahatur, 
iiamorumque maffam<0înquiaet; ac proiade dyftere faîCcid 
ţ>raîcaHere<<>nantHC cam tamen fatius effcttimere ne irnpro- 
^pereaiccedatpurgatio.aifi pMebotomiaprsmitatur . Siqui- 
dcm ven2 moUc$ cum fînt, ac przter naturaliter rcpkt^, fea. 
iim lUatam latcra conciduin 4umfanguis exilit : ^uapropte^ 
«equaquaintimendumeftdevacuo. Secus euenitiapur^a,' 

tione , corpore^orido adhuc esiftente, turgidoque:humoris 
«nun voertas ipla-fibi viam ofaftruit ,-atque occiudic; ex quo 
£rahenti.haud cedic medicamcnto i HiiK Hippocrates Ub. ^, ,.. - 
4e morb. de dolorofa ccrebri repJetione verba faciens , "J' "* 

X. "Febrîenticîbum ne offerăs , neque "forbîâoîiîbtts 

Uibtiis aluum ducas . In potii dabis aquam calidam > 

;Ffiggiduspo .^ 2<juam muirara,& âcetum cum aqua ; ii^c aurem' 

^ropââdus. tuentpotus,caiidus.exiiiens ac manens, ex corpare 
«grotodetraket, & veJper vrinam eiiciet, vei «tfu- 
dabit. Vndequaqueantemapertum, &re/t>irans, 
•ae motum corpus ;;id,quodcondiîcibile eft, iâcict 

oficreadus . 1. Author, pr^cipitqucprimo ne obum ofîeraraus : ou6d 
vtiquedupiiciEeri«teIIigipoteft, veine oiferamus dum'a(Stis 
tebncitat, Bon expechtapriusintermittentia , aut maniTefta 

fibHsper.cirmîi^ex^erbatimesfiHnt, inexacerbatiombmU- 
loudunr&craffum,haud minunam adfoennioaam sc-^tan! 


Digitized by 



, cojmmrjmisjiirsTR 271 

îibaî, Tt latius dociiitlibelde vet*avîd.>cufebricitaatîî>usfo> 
bilis potius canueBiat,atq; kumidusviâus ex apb. 16. {câ^u 
Monet prasţerea ne medicani^atofis forbitionibus akium iu- ,Sifife 
gitcr kritemus : kuioribiâs namque forbitionibus biice nihil îf^ i^ ^^' 
2e noxia materia^ qua^ iix venis: pleruai^e î^tat> demkur >, t^Sfam^f 
jfed quidam taatummodo hkorcs dtijciumur,quibus ciim vi. ^^^^^^^^^ 
ţes non nihil decidunt, turbâ£ii^jq;.natwa ae id praâar^ 
quodalia^prbficuumiuturum e&t. 1}$ itaque verbis nequa- 
quam prohibet Hippccrates aîuum:lubricam fer^ari^ quo na*, 
turâîyotisrefpoiidcatmfoecum expurgatione ^ cwm ecrtunt 
fit ab inteftmoram, impuritate fehrcm & &iieii> & aiigeri 
; maxime poffe ob puiEedkiem , qus ibi perpecud viget^aMc de 
fiKili excitatur i vnde ^•.epid. fe6l. i . rigores ex fuperion. cen- 
tre y febrcm ex inferiorc ma^ proueiikc afleritur j fed qnod 
moaet eft ne ia morbisândefinenter ali<yiid feaiper mouca» 
mus , ne leuiffimis quidem medicamentis, ita vtnuUam natu^ 
î^ quietem Goncedamu% qu^e ţamen vesa morborum mcdi- 
catrix cfl: , infeftaiH maţeriam > ăc vias > per quas apte expelîi 
poteft> optime callens^ Hine dixit in aphorilinis. Inchojmtilus Mh^că» 

ab^ oner QĂ^cina aliqtîafîcuhim iliblesandam , vel adyias e^ 
pediendas } moue; ingenîihus emm ipdefietemelms efi. Eiufdem. 
naturse motus interim accurate obleruans,vt,cum opusfueriti. 
optimi miniflxi muneî;e fungi poflîs:: ex quo in cpidemijs ♦ 
C^fmriA^ facere > inqx^k,. î'n/^^m^jar^ .Cum deniquefebriS'^Fiii^-* 
kxc ab^bftrui^ionîbus in habim corpori&incEoaueritjfbuea^ 
îurque ab ijfdem;j>mîîem edcurationem dkigit, vt omni ar» 
te iBdîTubm^ueat, corpufque vndequaque perfpkabile xed*^ 
datury cumipfa obftru6iionisfoîutiofîcfebrisluiiiK fanatio 
cx Ga},^io* meth» cap.2*.Naî:ura ctenim qustfcunque tune vias- 
inire poterit ^ per qi^s commode ^ qpqdnoxium cft , expeî-^ 
Icre valeat^ac quemadmodum adhoc balnea.acque vnâioncş^^ 
exterius admouec, ita intus copiofits potiones exhibct, qu^ 
?kes babent laxandi , aperiendi , abfteigendi, actenuandique, îufcuîa ^o. 
i^cfiinc Ai^a calcns-, ( cuiu^^ice iuâulatnospropinamua^na*!^^^^^ 
turae magisfamiliaria , vkefque fouentia^;MuJ& icidem^/atqicxatt^^ 
P<>ib •. Copio^ verd exhibet^ne» fi pauca fit potio , fiarim â^ ^^ 


Digitized by 


fcbriît calore diflîpetuî^f fed Tndeqiiaqw porius âd corporî^ 
cx£î^îsaieimmr> vc vmmi^ vd fudorem ita pîou^€t> Ad 
^uadn<>n; pî^um^ vdq; conduck a(%alis c^hih^ mhînc diic2N 
mi^ acai^qi^ i>^«^ i^ lttimoralib«s febriBus irig^das a^ 
|K>rioaes Aegrotantibus ofem,qa^> etiî tales ab ijidem ma- 
ximc expecaatur , cunv seftuaatem in vi{c€i:ibto iDaloj^oş-îses^ 
ctind€re>&r aliquateimsatten^aare valeant; pluîimdm^ 
ob&at , duto imbcciîliorem v€ntriculi<:aIoremtedere^ via^^ 
omnesaâ-ualMfiggtdi^eadftringare:, noxiamqucmatmam* 
cootumaciorem > acque iocoâilein magis^r^ddcreiiats imt • 
Exhaccuratione iîludquidcm-obferuaredebcmus^ omnem 
inîduftriat-n in e<> â-fapien-tiffimo Sene Iocari,vt ea^ii^fiunquc 
rc-m^ueantur, quar natutse fuîs^m operibus-impediiiacnto eilc^ 
aKquopaâo'pofîent^ vt omn^emei curarionem. deind^ corn- 
mittât, Ex qiio noii panimilîi arguendi- videncui?^, qui nun- 
MeŞ°qS quamnGi2âiiquidinaî.grotancibusinoIiridelînunt: Sicenim^ 
^^^'^c-^cV^ vt^ inquit Galv2-. tiîedu cap:.-i 5^,- maii^^^ Ttutceâemfi acceptu^ 
gros agerea rosjher^^ty cum tamfen cofiUum fuerit Hippocratis- lib.3 . de ini.54^ 
nofl-^c^utî j^^j-i^^. ^, c«m iuîpc^ fercur^morbus> ^ A^gm, &M«dicum 
i.iuiaslu& ^ur^Lâonibusquîeic^edebere.HincpromUtLium^ 
^*^ Hliî:<>K^ Princep^M^co^pItts interctaa*^qiikre,quam mo- 

W4ido>-acqueâgcri4<> pr<>feiăî& • 


Cum vero gracMem exiiiefltiein^^fe^ 
fefEim efli ^fao^non 1^^ tttmoxfem fe- 

Brîs occuj)eţ ^ Etfî nonceflfety nut^ &; 

î^mî^im taciere .JEtfî^^ 

qpocl nou op<)rtueriţ febi-emiii<âu€eTc. H»<: Itaijue 
medicamentiîni potarc oportet^ qiîod educat qiia 
p^te febils m^s^ăsareSy focy fep6îiî€, fîitc infemc* 
Et fiq[mdemfitpern€^i^ feperne; fin infenfc, 

nîfornc, : 

Digerat erîaffittidinîbtîs în'Pîctborkonimc<^ 
mcdir ob&uâionc accendîr quod quia baud perpe* 
cuum eft, vtiuprâ'diffeniimas";inamnononme, quod defa-^ 


Digitized by 


ccMMEmjRimiuysm.Mrs^ ^ ?73 

tigâtur ccHTfms y turgcţ Hnmor&is ; aîkm mcda pf oponk ca * 
fâm 5 ac quamodo ijs m lejbribus coieâari d^ edo- 

eetmam fi quădo pcrgracill komii^m fo& lâb^rcs apprehf n- Grâciinim^ 
derit febri$ ^ Cmc graciliEas haîci primo ©?m exdi^eiât c^ innai. c^^l "^ 
to f emperameiîto > caîido vi4cîic€t atqiie ficco , promdeque 
biliofo ; iîue poftinodu^ acquifita e? calido ficc<>que mâuy 
mtâh:,hhonbnsmmijş^cmis^m^^^^ in r^gionc S^lS 

câîida ficcaqtie,- tempore ^ftiuo, cjdique confîmHi ft^i); tune ^t^^- 
haud iliipicandum eft ob corporîs tumorcm , feu repkxiooem 
febrem ex^ftuaffc , fed potius ob inanidonem,exficcatis vide- 
licct nimicim humoăhuSy zcxmihu^qm leddkis: cam bis 
tmm (mixuB timri it^mimmmî > ac diaril excitant febrem, 
^g ^Hgu|L|4iit Imi;?<>furi copiei pmrefco-e parata , v| pucrida 
pocim febris înde accendatur. Inhocigiturcafupleîiius nu* 
triendum eft, gracileque corpus atque exfuccum, vberibu- 
mid0qu^^1ime»i;oMclendum: nam aHâs in febrem arden- 
îem>ac demum in heâicam, atque maralmum tranfitus fierer, 
vcla:edocuit Galio. meth-^ap.5.> ficinquiens. Simgraci- ^^^^^^^ 
Uhus ăccmdiîurf^hisfroţtermordenîmn ăcrimoniâ excalefaBi aU f^^^^ jf^ 


doque exhibito altocnto > corporeqj liberaîius enucrito , 
fcbriş tamen non dum ^xţinguatur ; tune cermm eft , %no 
^b ipfatTiet curarionne 4e,fugiptp;,non al? inatipne ţantummo^ 
do^ bumorumqueacrimo^iaiebremaduenifle ; ac proindc 
ique opormi^ ifebjem inducere, bo^ eft, copk^ori aÎK 
mentoipiamperaccidensaugerc: nam ^ yc modo diximus 
ex Gakno, maximo malo eft cibus febrientibus ex putr^dinec 
mukoqti€ prius docuerar Hippocraceş in aplioxUrnis ^ Si ^1^4.^^^. 
ătdifihrimti^ ciii^det , ^umfing exhihet , fano qîddcm robur , > ' 
^0mti^^c mopbus . Tune it^qw iufpkari poterimus , etfi 
gc-acik, & exuftum:^^e^febrkitwas ^9m^ i ^^^^ ^^^^^ \ 
ab alimento non reficiatur , puţridup:^ aU^^^?! l^ F#^^^R5 
humoremâabuiaci, iqu0 kbris iCiceiidatur. Me^ 
turn ea propter ^^ib^ndituîi^ aţ« %î^ aut^nfea 

Mia prouc 

Digitized by 



proiu&breaii aut'cius caiifam., in fuperioribus, autinimit 

pariibus ma^s vigere a|>parumt., & ia hanc , aut mam par. 

f^^^i ^*"^ raagisinclinare coHJjecerimus j nara proximus ei exitus 

pattemeua- feciendus*ft,iuxdp£a:cepmna iB tex.j5^1i5,i.;rc<Tiflratum : 

*"*™** * Dolorei autmjuprâ feptum tranfmrfum y im.ţurgatione op!s 

. halmt^fitif^'ver-mţurgMmemMgeKefigiţă^ 

ţer cmimenîes lofOi ^ 

XII. NiJnIo auteia minos oportet etiam d^biles fortia 
medicamenta potare,. fed lîmiliteriaut foiimi fîc, 
vt fortibus (juidem forte „ debilibus, vero debile 

IN" hac textu , v&i occa/Tone purgands febris , vniucrialc 
tradicur pharmacis exhibendis. Latini Ia- 
cerpretisIapfumDotaţMari:iaiiu&iaverbisiJ3'i^i^eV<rS'«a» S'h 
. . ^-ft> niiî^îo aucem minii&rii^OT ^jM:d^x,ert2^atmi,afî^ 
• mm fermmem- trajlulit., coritrarmmjhţjumeiaccmimdamty 
jnquit jpfe ,affu-matiHam reMeus fententiam , ş^i* «5?^/^^: 
Uggenda erat ■ du* enim nsgatioms.» ' tpixapii Latinos aknnati- 
uamcoriflitHunt, eŞcaciusnegmt apta Gr<*«i. HjBciHe.De 
cuius annotatianis veritate alijrdecernendum^ relinquimHs / 
eum nondum nobis fatis confleE, num diro iUa verba , nihil»- 
mnus^aux fintdiceridxnegationes, cum diaio, mims, com- 
pMauuapotius, qmmncgatiua fit . JîlTid certum eft vuiaats- 
Iccttom abfq,ue vîla prorlus immutatione optimum. {t&m 
^taripoiTetalipa^ta. c w*u»ia 

^^^ Nifcaaauî^m minus oportet etiam âeUks fortia 

Scariaedicamenta potare «i^^^Ii"^ <i^biles forti aJiquo 
aflUmercj , . . H3orDo compi xnierdum continoatj 

^fa«flt. Bam w habetur infesids ^in. fortibus morbis- natura, fombus 
. pharmac.svcendumeft. 

SedfîmiJiter 5*^*^^^»^î<î«*^t?menadhibitafimiljtu, 
; dine Se propomone inter medicamcu. 


Digitized by 



mm:& iEgmrn; nam etfi fprte najt^irapharqiacurn of&rre de- 
-beasv ea quod &: fbrtis fit j^iorbus; iarerforcia ramea minus 
forte eligendum eS^fî debilis fit Aegec; fumptaque indicatio- 
neâ viribus, non adco validum p rqpines ac fi viribus coi> 
itarct. Forte autempharmacumilladprâefertim Hippocra- 
d eâ ^quod valide .fiuefursum a fîue deorsum purgat* Quo^ 
ft aoiueris in debili Ae^roto yaiido medicamentopericUtarij 

Foxtibîis quiăemforte.deMibîrs vero debile ex- 

liibeas. At circa hanc poftremaiîi regulam , quam&cunda- . . 
ra inteniione , & ^ vt m dicam ^ coaCîe propoimite .yiaetur ; idebiHori- 
xjiîandoqmd^m {k iaferius decreuit ^ TmriisÂna- ^^^^^M^ 

turajforSihusphărTnacisvteniumeji y mâcbilibns 'oeroyfhcmni^ţr Eiiraforcio 
<i^«o?^ ftr/?l^î^^:.nonnihildubicârecontingit: namlîDebilis ""l^^^^^ 
forti mori)p co^ripiatur, ^uid p^rodeat idebiie ciexhibere cu^acui. 
tnedicamenţLuni ^ cum lib? de aţte ica pro^aunciauerit Hippo- 
*-crates* A^ vero ex medicaTnentu ^^fi^mrm'a.kui&res morbos 
airarenon foQht» mn ăiim fatis contat i^aknîij^mos autem^ 
mărhos > potmHffima etiam injirumenta cura^snonfojfe yqnomoi^ 
mon fit manifefium ? Siquidem ad liac vt agens iliperet pajF» 
fum-jrequiriutr proporţie maiorisinaîquaIi4:ark, vx dxcuiit 
Philofophi^ vnde Areth^us îib. 2, diut, f^ff* cap.i ^^^morhii^ 
iamlt. ano di(ţ>luimturirfnăwra-eff^^ quemcitar ^ 

etiamiEgiQCta.. Galenus vero ^guale iakem medîcamen- lib^.iafi^ 
turn requirit,; kâ\^tantiîpyer$us aîteram^extremiaî^m ex- 
xedât^qnamum morbus yersus altecam^ Bxxţâxe^uîam apho- 
Xi{mi3Extremîsm:>rhS}exîrâma'retneâia: vnde C^li. hb^x.x r. Ap^^fecs 
in fine y nonţotej%\^ mqm,$ '%>ehemmtitmhnifi ^quivebmims 
auxilium ^fiiccurrere : nam înedicamenti magnitudo â-morbi 
magnîtuxHne indicâtur, non â viribus; &, vthabetur hxc infc- 
riiis t^. 49. medicammU :fmt omnia^^Uze ţrsefmtem fiatim 
iranfTnoumtytmniaâMemfortioratranj^ Kis-tameş 

Tcipondctur quamuis adcito>, integramque de conxrario vi- 
doriam obtinendam maior requiratur vis Magentci raro ai- 
Mominiis id congtuic hnmanse natura, in qua mulţumi ^P^îf^-^«^'- 
repente euacuase ^ aut replerc^ aut calefacere,:, autxefri^erare ; 

Mm z aut 

Digitized by 


tj6 njm}m^fîSTMAu.m loc m hom. 

aut quomodocumjuc corpus immutarc penculolum efl^om-^ 

neque nimium ei inimicum : etfi eniiii magnus morbus ei- 

^ cam luidemolitionem magno fortique medkamcnEo indi* 

cct 3 obftaiit tamen non raro virts,t}uarum profe<ao maxima 

eît dignitas^cum per has viuete t;oîitiBg^ ; âtcyie h^ dum fiii 

confcmatioiiem femper atque primarîo îttdicantyfepi ea 

viriiim ra» cmnia prohibcnt , quibus virium fubftância, ( qu^ in humb- 

t^<^^<^^^g^^- ribus.lpiridbus/oîidifque parcibus conliftit^ aut nimiu^Ti dii- 

ITinuâik»'- .fipari^aut adcGrruptionem vique alterări nata eft,cuiu£modi 

modolon- funtomniavalidiora medicamenta: quapropter & ipfa: ad 

caxx^oi. reniedijinuemiGtiem fecundario quodammodo concUrruut, 

dum illud moderant . Ae quemadmodum h^ nune validr 

exiftunt, nune debiles» nane me^omodo fe b^ent; itâ nuc 

pariîm aut nîhil indicant , mMraaque earum habetur ratio ; 

interdum piiîriimimy oftinemquead fetrahunt Medici indu- 

ftriam ; modo mediocriter : vnde & morbos modo vaJidis 
medicamenn$ turale licetv dum fcilk^^ 
pires , nuîlafque dantes induelas ; vires a*item conftant: quin* 
im mo , etfidebilxofesaîiquahculum, mm fmrbm pericukftj^ ^'^\^^'^ 
pmus f,t , in his pmcBari oportet , docuic fupcriu s ; Si enim 
Juccejţerit famdm facies^ jin "miniis ; qn^ 
erat', id iţfim ţerpetitnr; modo debilibus> vbi videlicetanor* 
bus exio^uus eft; aut fi magnus> vires caiîicn debiies extitennt: 
tune enim > quod affeetu^ rem^dium eft , id cum virtuâs cu^ 
ftodia pugnat iprcnndeque cpor/^,inquit Gal. 9* meck.eap^î î . 
vhi iTidicationesm^fihi ăâuerfdntur ^ % păulatim qnod mtiajkfn 
efi macuare > ^ pânlatm ifmieefpt , lippod Jaluhrc ep > pro eo repOr 
nere; vocant Medici 'empnodii>itio^ fiicd curationem Gr^ce epi- 
i>ebiîiusmc crafim » Potcft CTgp «tebâiusî quoque mcdicamentum pluri^ 
quomodr adhibitum, & d nacura a^Suium^ validiores morbos fuperare> 
vaiidiorcm diu turuiore rameh cempore : nam dum omne agens agendo 
«xpiiSa^ îcpatitur ^ validior eciam morbus , dum imbeciliioris mcdî. 
camend vires eîudit , păulatim atteritur ^ donec iph mediea- 
mento non modo ;^qualis , fed inferior etiam reddims > om* 
nind tandem extetinina tur. Quodetiltempoiisdiucurnita- 
te indigeat> tutdnihilominusfit/dum denturinduci;^.Atquc 

Digitized by 


^tuii minare» ^im j^mBkâ^yţertmiymd^^ nma, cum imrm 
hoie^mimeMo fio/i^e.jEquîdecamen medicamentum prsc 
ca^^ris omnibus digejBdum eâ, fipor TiresBceac,; quippc 
quod neqa^ adco magnam fubiiamqae iauchit mutzuoncm 
in corporc > vt forţia mQâic^amma^nac^ adeo m longum 
prottahît ^GuratîoGem > quemadîi^ditfii dcfailia; kâ'vt mor* 
br^s & vires acquirerc ^ &. aflfeSias paîxes labd&âare^ hamo* 
relqueiiiaiîuni contaminare v^earj quod vdqtk^acddit Ie-» 
uiori in medicamentos dum ferim ,q^âm opus ci&c> opera-^ 
. tur ; fedin mediocritate quadam conltitutum > tuco , cino, Hc 


XIII» *^ Ardores v^ro potîonîbiis & forbîtionibtis^queîn- 
admodum febrem frigefacftorio medîcamento>exol- 
xierebportetCam^m videîicet, aut alio qaopîam 
Euiufmodi : Et fi ianfeam contraîiat â frigefa(fit6rlo; 
calfacflorijs yterc confcquenter . Vbi vero nou cef- 
fati frigefadorijs rursum ytere • : 


EXtînâaîam felM?e>morI^feîs€uacuatfeJtoi<Mites, om* 
niqtie corpore perfpirabili reddico , foîet attameB^ 
gratiii pcasfertim habim, cuîuş febrem iam coalîdeta.uit îiip.-i extinâa ^* 
poerates>quoddam adhiic cea fcbris veft^ium> & empjrreu^* ^^^n^fet 
ma ign^kio^e fixperefle in vifceribus , c^x^mQ penitiis abo- attcm^ 
leamr, nous fd>ri caufam pr^ber^ coniueuit:no modoquod^ 
corpus ita difpoiîtum â îeui quacunque occafionc itcrum 
prasccrnaturaîiter incaieicic ; vrenimctiâm quiacopiofiimii- 
îis prouentum quotidie gignit^quse recidiuar caufâm peri* 
bec . Hasiam yocac Hîppocrates wvpJ^ius ,hoc eft, ardo- 
rcş y quos rcfrigerantibus potioaibus-, ibrbkionibuique, vt . 
Gammaro ^ aliiique iiaiufccmoidi diadt-effe extinguendos , 
quemadmodum fcbris ftige&âcMiophîaanaco i^âta iu^ / 
icâ vt^ ctfi iâm a febre immnnis appareat Aeger , in refîigo» 
rantetamen viâuperaliquotadhucdicsperlîft^re debeac. 
Quidautem lît Cammarus ^ nolidum Hquido confiat^ cum 


Digitized by 


âiBîoiim&msi^ams^ mtmmit Hîf pdcrites * 

icKectaiîctum le<^Q,;tum ^aificatiis ^ leguatfiquidem plo» 

cft , CamEEiamm'^ ii Gambero , Vîilgaricer ^<âum ; & Aco^ 
niri ipeciem, qu^^si^mi huic perfima^rhabetradices, 
' fie vctext s^peU^ <qtîo^ixmuiC;edam Plmius nat,Mft, lib;27. 
cap. 5* Sedaddit neumim ex4uobus his fignificâtibus aprari 
poiTe t^xtui bţuc -deloc in faoHî. Zen© Heropkylius , ScDio. 
dorus grammackiîs, vt rcfert Erotianus in Onomaâko , aife^ 
nint Dorienfes Ckmzxmeo momine defignaffe, appelîantcs 
^am Kct uopQVyqmfi Kct^coi^opo^ihoc eft»mala mortemafereî^ 
tem. Eeufisdeiîiqueinlib. 2. expîanatioaum, pkarmacuiu 
qu<^dam friggidunvv^ %aifkari v^ Erpriimis qukkm Zeu- 
lis , & Zeaoiiis -expjicationem magisprobat, dum iaquit., ^ 
r0om Mcnfânţaneum eft r^i^er^ormm ^odd^m fnarmacnm 
^ jţ 'odf^tdpe Cictitam, cum dicat Hîppocr^esXmmTiarmhrs-' 
pT^an&m^^^ adhnc teret aniOTi^ 

ttee fatâsespIaHationi huie ae^juiefcit 4- vtik iîqmdem Hippo^ 
<rates ardores extiiigui debere potionibus&^rbmanibufque^ 
qucmadmodum febris refrjgeratorio medicamento t nam 
cmn ardores fet^^t^diâuînrîiav qu^damextinâ^i^ ye« 
. . - fî%i^> qua? inxronuakfcentibus, ijs pr^fertim j qui graciliori 
" ■ ; ^ ;^ finit corpore> adhik fopei&Bi:^ videtiîr monere iiimmus Au- 
. ; r ' ^^ ^^^^^ temporis hajLid ampliiîs medkamends efleiadul, 
^gendum, quemadmoduna tcmpare febris , fcd fmkmbusy 
^ ^ forbitioiuimiqtîet^igeraiimbus, qM^ alimeiiti Ipecîesfunt, 
Sc, vtira<^^erba dic^^ ia jidiâu pemigeraiîte tuac efle perle- 
uera^diam. Qiîid igimr di<^mas ? A^ pro Cammaro nuRc iî> 
teîligeiadâ eft 5quiJJ^ fpccics ^ oiifiaceum videJicet animal a^ 
quacîk friggîdumq;^quod laudatur cgttra aLia crufta. 
ceo tegmiee conreiSiaâ XSaJeso 5; de alira. faculc. c.5 j. in ijs, 

musiib^iAc ex lecoreiQ eum conâuu^t^mcinMusximkh contineantur? 
ălc^i^^ AdditPetroxuus^ealese&^irosquoaâmflaiios, praecalidosV 
propefînem. îrâcund0s>'graciles,nidotbrosruâusi^pe reddentcs, in quo. 


Digitized by 


commentMiis' im^STRAirs\ 27-^ 

padciărationeDiofcoridesiîuuiatiJ'es CaDcrosi^^ ^ "- 

Tâbe conficiuniur, cuEn.ijiigiîed> acrique , quo>p£^etu*6 ffa- . 

grant^ardore, ciboşadwendo cpfTttîiipaijţ jproiodcque ea> 
au,»o- qu2 P^trefaâioaihuic, vtcruftacea aniH)^CHla„refifluoi ,ijş 
propiflanda fum.Qu^inimrao Hippocrates ipfe lib^j^e Dift.» 
in affeâtu qaodam calido, & intense fîcco ^ Locufije , Mityli , ikbWisasq, 
Heririaceij, Cancri ,& ConchyKararii fuccum hac eadem ra- "^«^corT 
tione buaauit. Ar, inqmes, proponk Hippoerates hi iant ^c^lSl 
diCîk-ardoribuspotibnes^ fbr^itionefijtie, euKjfmodi Gam-^ uemuar. 
maci noafunt, qui inGoiîileaa prsîereahabeatfebflaatiam, 
conualcfccntibus-, gui imbeciUiorivtpIurimiHn fuat v^ntri- 

cuio,incongruam. Num etiam ex Cammaro.forbitiones con. 
Hei poffijnc ; Se forcafse talem nune Cammarum appellat ? Ita. 

& Diofcorides Cancros coSos» & Ture cfitatos probM in Ta- 
bidis ; iis vidcKcet , qui non modo â pulmonis vlcere , fed ab 
alia quacumque caufa^ixcenuati valde-funr: hlnamquc ohineS 
commimi nomineTabidi appelîaamr . Verum kiflabis- . îam- 
ex Galeni decrete talis iaterpretatio damnata eft , dmn aSc- 
luit Cammarum pro fquills fpecie acceptum ncQuaquaja 
poffe lextujhuic apari. Fateor»itâ dixit j Scd quid'noâra?. 
Sequcnda rati<> ^ eQn.auţ6prrtas ► Tu,^un ciieverbaiui^J 
rafîi, omniaqnepofthabes;qu«nonexciusojej,KmQaanjt^ 
cx Tripode^ emariâucrint, bs^cvehitobiter diâ-aiînncăccii' 
. pia&quoufque aptiorcm aferas cj^Heationem'/ quam' quan- 
documqueexoiculabimuc, nob^ifque Apolimis inftar eris- 
quaudoqmdem diuinandum potius hic eft , quam esplicaal 
dum . FngefkdroEiasaatem. compkres pstiones. propofoir KgefiAo.. 
JW.Î9. «ipp-hb^.?;, dcmorb.j.quarumalias miâMinemiaducefe °*î*?«>«««- 
^iasaluiegeftionera,.alias-vtrumqueprsiiare,aiias^eucrumf ' 
led frigefacere tâtamaflbruit. Quddiî ârefrigerantibus huiuf, • 
modi medicameto&aiimetisvenadediEobur <ăiibluatur,;ta 
W âiirigor* vitiâta coaioluperuacaneas gignat]i^midi^:ates,i 
qulbus naufeet madorc laxatusitunc calefactorijs tantiipcr in-^ 

roboretur^demda ad refirigerantia ruxlikred«undum,ilardor 
videhcet nodii-fatis extinCtus.appaceat, doneccoroBs vniuer- 
îHm »usmperatum^nq;priftinalubicu pxorswsxetkaii tUent. 

Digitized by 


X IV. ; lăcmţ^^ £ycj-şgii^ mojrbum 5 ^ cyi* arepppxv 

i^eri€u«^. tet/Cii»îâiieeperi5ni2ţnmv^^^ 

«o- fajeienîibas, po tibuiquc ac cibi^ iiumeâato per tres, 

aiit gtiatuor dies. Poftquani autem iiumeâatum fue- 
rit corpus , purgato , & refîccato i^itirXy pinguedi- 
' ; nemque deţ^ente jexhâurîto , & vn4eg[uaqueV fî 
poffîbile fît':şppdicaE^ humîdiţatein 

; . cdiicitp . Ad caput y<rd purgatorip debiji yîitQr,& 
ymam cientia bib^nda dato , eaque ante cibos hoc 
tempore.quo turbatam iiumiditatem purgaueris , in 
potapr:^be, ne âb eo tempore corpus nutriatur , 
Cum vero attenuatiim fuerit, ctiani balneis ptegato^ 
âccontvSz Cucumeris rihicCtiis rădice, eaqxîcin a- 
qiiam conieda , in de jauato . Ca^terim xaedicamen- 
ţa bilcin 4uce;nth ne, propinato » ne corpus niagis 
coaturbes , Vbi vero ficcum fueritid, qiiod contiir- 
batiim ftierit , îiutrito , niillo aluumfubducente me- 
dicamen to , neqne vrinam cicnte ytens y fed vino yU 
nofoy SchiSy qu^e rubiciindiorem iomînem faciunt. 
Sîveroyiiidîs, acluteusfîtVriirî^^ ne- 

quaqnam verpJGcc^ţp, vt rie ^î^ color ftabilisred- 
daţur » • 

lUmmacorpori^ id9Mîo; vndeto^u^ 
penteinaurenniji vdatrum^yel vindem > vdaîbiduincolQ- 
rem pro morbafici liumoris variecaie immuxatur : nam color 
fimilisieffloreicit iiumoribus , xiocuit GaL.2. aph. corn. J . fi 
noa^i^iu^ cegargitaaermt : omnibirfqiie cum in propamlo (\ty 
omnium <>calos ad feailicir > inque admiratioatm deiuck . 
Plane acerhm iâmdumefi^ jiujnic Aicvtm .3 color x^ero^eci^ 

*^' {uk 

Digitized by 



foit â varijst mfignitus . nam Se îâ^mm aî> lâidc Gr^ds, La- 
tinis yctă Vxuerm , qui iyîuefei$ Muftelte ipecies eft , cuiiis xi^SI!^ 
oculorum color aurensconf^ciaji: ; &Auriguiemâb aureo 
totiuscorporiscolorc, 8c Arcuammab Iride, cwius yario$ 
imitatur colorcs , & Morbimi x^giimi , â xeggi js deHcy 
cuparunt , quarumopus eft pro morbiliuius curatione: fiim- 
ma namque iuciinditate > animiqiie ixauquillkate iadigei; js?-!: 
curetur : Vnde Q^Sereaus . 

Reg^us efl.veri fignatus nm^ine mmims^ 
MoUiPerhic^umiam^ regia curatur in jMla* 
Quodcthm ceftatur Cornelius Ceîfiis . Affcănshic fir ia- îa^-^- 
terdutn critice in morbis acutis, tran%oiîtoiiimirxîm>Yei dif^ 4^^€iîc^i* 
fufo morbiiîco humare ad cutem , vbi ob craffitiem iiâkur^ mtdt^^^i 
quo mi0iî§ poffic per fudorem euaoiari: & de boc iâcro disk ^^tp ^o^ 
Hipp.4. aph. ^2. Quihminfelmht4smorhmTeghuftantef^^ ^^^pocuc. 
^K4^ diem,mdum. Quamieiireatiam Plinius ea , qua înMer 
dicosoniaesardebâcrabie>aaitatus,îuilîam cxprobiandioc^ It^l^ll 
fioîîem prseteîmicKas, iib.a5, nat^bift» c^,. ii.impugnauit: ^i^sqiaiKid 
infdiciccr tam£n>vtiampatebit* BiţpcrMesafeptimadiâ^ in- ^°^"^' 
qait^ velpotiiis^aîiteicptimamdiem, infehremprpfeyvm^' Hippocrates 

ttone . C^uâii noui aîiqmd actuicrit > neque muîto pnus id xp- nîa de iae. 
fum Hippocratss etiam obferuauerit, qui primo epid* feei^* ^^* 
¥uemnt , inquit , ^nîbus "merii regifJh^aJie ;fid hos autţer^ri^ 
nampurgatio , aut aluus turbata imiobatyOM magnwn p-r^âftmdwH 
fangmnis , 'Vî Heraclides . Quin etiam Pbiliftidi die tenia mor^ 
busregiiis acceffir com rig<^re , &fepdmaperfe(âciudica^ 
eft 7* Epid. le^ 2. Plinius itaqiie iapicaulTîmi Senis mentcm 
îtaudeftbeneâffecum$;4iâmpr^terquâmquckidixitin^bo^ ^ 
rifmo efle figniim malum > noii axitenr inordferuinj qj|«ejdu0 
valdc inter fe difFerunCj neq; iâtaîcm iîkid moriendi nccdSa- 
te oftendic :, irâ vc cum boc iîgno nemo vmquam liniari pot 

m $» ^^ > fuam etiam fcncentiam alibi cîaritis aperuit ; vr lib. î« de , 
xeiotH.'PehientiacUlwfointemfore^ hcmmz* 

vbi iHud, in temfore^c^zt^\xm<i^ criticam dicm ,. ^modo pra?- 
cefleritcoâio, prociild4^bioincliidii:3 quodciaritisotfl^ndit 

g^^^ ^2iCUtAn<imcns*InfihriUlioJaantefy^^mmJ^ 

Nn tnoT'* 

Digitized by 


îSs m?mcKĂris lib.uldb loc. m hom. 

morhus repus ăccsdens y foluitfehrem . Verim fne rigorefiacce^ 

dat^trâtemprisoccaponsSypemiciQfusep. Propofukjgituria 

aphorifmo feptimumvdat inter omiies maxinjc eridcwn^, 

ante quem raro perfctls? fiunt crifes , cum lougiori temporc 

pîe.mmque opus fit ad co 6iionm : C^terum huitis cxempîo 

vniuerfale fanciuit praeeeptum de morbo legio , ejiii , vcluc 

^eliqu^ excrction €s > âum pofl coâioncm contingat, quaiiis 

die critica falutarirer apparere potefl, etfi yalde raiQ ante fep- 

laeru&pri- ^^^^ • ^^^ ^^ ctiam citrâ febrem lâertis^ & fbrtafee fe- 

^ariusynde piiîs ; idcjue aut qiiod pkrima gignitur bilis , aut quod non 

^IsvîH co- rite expiirgatur * Copioia nimis gignitur aut vbi Hcpar , veî 

^eâ^âa*- ven Xy vel totus corporis habitws caHdior rcdditus efccontea- 

ârofqueiiuniorcs i£ibilemvert^nt>aduruntquc5quod &â 

venenofo ptenaaco humorum majQ&tm corruîppente, & ă 

Feranina i dîu aeciderc etiâ poteft ; aut vb iolidiora cibaria^ 

Aromea vidcIi£et,Csep^,Aliia>VinaqipGtetioraaflumutur* 

Atnonrite expurgatîîr dumlccur,aut feUeamCyftim^ 

pultricis aut atcradtrkis imbecillitas, fcirrhus, aut obftruclip 

obfederiţy atque ideo neqtfe â bflofo bumore cxpurgatur ian^ 

pis , ueque excren^enrum hoc ad inteftina tranimittitur; fed 

in venas coiiaquinatus cruar rcfunditur, huiuique excremenţi 

pars ad yeficam, pars vero ad cutim delegaţur^ vbi ^ dum ob 

craffitiem in fudorem, mt fclleum vaporenj.verti non poţeft^ 

fubfiftir , cutemque inficic , vt lucuiencer 5> de Ioc. a£ cap.7, 

Gaîenus explicauit , Id ipfum de nigro lâero > lieais vitio ; 

autdeaibido obhEfum ventriculum, qui fepiffimemorbo 

1^^> vel buiccaufam decbt, vt docuic AretseusJoco citato, dicendum 

^S ,* ^f eft ; nana albidum regium morbuna a pituita ctiam , hycme 

^^ • potiffimum > excitări poffe^teftiseftipfemetHippocrateş iner*affeâ. , vbi pJures morbi huks fpecies recefentur. *^'^^* 

His id prse&tis proiîxaiore propofiti affeâus inteîligentia 

/quandoinpr^efenti contextu vix aliud , quâm curatio attin- 

med cură- gi^"^ ) ad expofitionem modo deueniendum eft . Jn tria er« 

ţî^^J^ gocemporavideturdiuidi^âeri curatio ab Hippoctace;quo^ 

m^vu . rum Primum humorum^pr^parationi ; Alterum expuroatio* 

oii ; Tcrtium vero reftaurationi dicatum eâ: Vnde primabi- 

liofum bumprem cutis poroiitatibii^ in&r6tum,venarumquc 


Digitized by 



«tî?emit^ibus, cum craiSor iît^qQâmvtfudore^aîkiîquc 
diicuti paffit:, aut purgantifem ciiacuaH^\asequ€pariter aa- 
guftse funt i pleniori v:iău , balnds, potubufque dilaerc ,iiu^ 
meclare , atque actenuare aggre<Utur , yiafijiie Jaxarc t Quo 
vdque tcmpore aulica^ deJicia? > aniiiiique nanqiiillitas coa- vitîctrâqaii 
fuîeiidaeft^gua^xorporishabitunvhiîmea^ iiumo- rlfL'S 

refque aî> intimk ad exdmafundit^ indeqtie ofeftruâiones ^'-ioseair, 
remou^t ; fugiend^i contraariin^ , animiqtie ciir^ ^ gus !e fqac"^ 
fpirim m ^ fanguinem adint^r iora ^um reuGcâtjdctkîeacq; ^ extima^ia- 
Jhutnor£S^xficcânt,atque incraflant,exquo obftm^iones nse S^ 
adaugenmr • Hoc pariterxonfiiîo vfus eft Gal. Jib*5 . de loc. f^l^ ^l^' 
aff. cap. 7* in cura illius , quipoâfebrem in feprima aiiriori, âmaioncs 
nofus^cuaferac . SpJo^e,in(^k , aPparmUâquo^ > Ci>wî^' Ukm ^*^^^ 
e]p dijjîpân-contmmcem' yfracepidta^ue laboranţi , t^^ ^^^^^^ Jk4- 
pe natura^alida ^dt^uidifiutiendims âffet^'vt^etnr; acpr^u* 
rea viBumadhiheret humiâiorem ^ qtd humorum cr^ttidinem 
moderate ţofftt externare . Hume^ato autem cafpore , laxa- 
teque ; dilut© kidem biliofo hamore ^ tam eo ^ <pii <^ud iu£. 
fiifus eft , quâm qur fanguinis 'maflamxrcânquiii^t, itâ vc 
dîfcuti -euacuarique iam aptus fîcj tune omm .mit â qualibet 
Gorppris ^egioneeum exterminare nitiî:«r^ per fudorem , per 
vrinamyper feceiTum; eo taiBen ordine,vtprijî^m purcraatia 
ac diuretica oâerat, qud fanguinis mafTaâ biliofo humore 
primiitn expurgetur^ moxad eut^m detergentia deuenit^ vt 
horridum iUius colorem pcnitiis deleac.-Hocigiturtem- 
pore corpus âb omnibus pene humoribus , ^s^^^ote coinqui* 
Hatisyexauftam.redder^fi:udet,\vt alios deinde puriores pro 
^fî& reftimat': vnde diuretica ance cibum- exhibet^ vt-aît^ 
menti paaîm intiis : remaneat > ne Qorpus repleatur prius 
quam inquiiiati humores penitus fere exhaufti fînt . De 
quacurationis pacte abfque dubiolocutus eft Hippocrateş 
Hb* 4.*epi<l* t.6^. , ijs verbis - I^^^o^iahorare^Judare y panem _îâerick 
comedsreyUheremnmMÎfumykimn ncf»^vlS^ 

ţctius^epido , vinum ălii0:z,^fonmammmuItovtuMtmnnQ^ ^ coancsiit* 
fo fiquidem hac ^ -yJcSu <orpus^ vndequapue exinaxiitur • ^ 
peculiari tam^n :prouidentia -profpicit capiti , eui non exi- - 
glia biliofî huraoris portio in iâeritia4eIegacur,iioiî mo-- 

Nn 2 do 

Digitized by 



do fecundum cuwas ; vnde lîB^ de inicr. a&<a. in prima *»• ss- 
.morbi fcgîj fpecic. Iw capitejuh fitiş vdut cortex yfeu , mch 
Ii(^riufnfiihfi; ?erum cciam in ceretri mcmbraniş , vt oftcn- 
duntoculi, quorumnicorpr«ecîpucfedaturinâurigine; ho- 
xum aitcem m eoibranse mţ^mb«aiiâium celebri foboks Iknc • 

fuperius adânăix^tmmur^n M^mt ydmfitatemque nmicularum 

cionti). 2, de morb, & alibi, fe^c iîqmdem â capitc trahunc, 
fcd prascjpue âb oculis : quemadmodum pro lotio cicndo , ^^* ^^ * 
deobftruendoque > fi id opus fit, deco^um ex Aiphodeli ra- 
dicibus> & foljjs Apij , & ius Gkemm exhibuit eodeqiloco . 
^piata fengiunea maS âicUco humorci q^ 
xibusomnibpş:, qtiicoiaqumaueranc, maiori ex parte con- 
fumptis^, corporeque â caihacdds atcenuaco , â diureticis , la- 
chok<? boribulquej cuncfiquidinrutefupereric^idomnmodeter- 
I cwtfq^ă gendum eft , vc floriduş demde coloxitcrum rcuiuifcât . Quo 
bcndtlf ' q^î^^^ tempore<te>lagogjimprohib£t, mea quis morb 

c us humf^ ia looginqiiiapajîe , ia cu£Cinimir«m tantuminQ- 
dpiam eiîe iupponicur , a qua non iiifi validiffimo medica^; 
meiito eJid poflet, quod Iţia yioJeisda turbaret podu6> quam 
Cutis non^ v£ vil^îi vuluacem aiîerre vaierec: viide Gal* inhb. 6; cpid. 
^uf f • ^^" ^^^* ^* ^^^* 5^* ^'^ incuujiint^ inquk ^ fieri non potefivt per 
^cci^tlJ? almmjxpHrgmHVyfedfi)tihus $ & cdidis meâicammtis excutiun-^ 
UiTj turn qiu4 corpus valdeat£enuâ£uiîî> vix ea medicamen- 
ta liiferrccs quiîymmo caloriş notam iîiurerent >'qu$ bife 
j^ocreatiomitemmoccafîonemprarb^ret • Eodemqye iîQC^ 
modoiatcJIîgendumexiftimamusHippaaatemydua^ ^^ ^ 

purgatjonem Iciericis interdicic , quam tamen alias in morbi ' ^ 
iilius curatione admiferat : inutilis namque eft ad purgaadum 
humorem, qui icîcriţiam fub cute immcdiate caulat , quiquc 
fâcilius exţrâ admotis deleri aptus eft ; tton autem ^d humo- 
rem aBteced^mcm, âcperfenguinismsflb^ Ad 

. bo<;FrQp£erea :TOlia funt jytoea > qu^ pjurgare <^xiţyel eo 
quodiqcoqiiit^ quse bilc^m pu^3^ ^pt^liim^cuiiifoiodi^ 
Silueftri^ Cucumeri^radix ; >vel pui^re nune cric yi^umq^e 
detrai^^ ■> veliedacerei ^uo quidem nomine abftergentjia 

ctiam ' ' 

Digitized by 


ctiam purtare farendum erit: aţque hînc non modo sylueftris 
• Cucumeris radicem> quse maxime abfterfîuaeft , fcdhuius 
lum , Furfur , aliaque huiufcemodi nos addere poterimus , 
âtque itâ fecundam cuţrationişpartemabfoluemus, quamin 
diffipando vtcunque bUiofoiiumore confiftere diximus» Ter- 
tia, iaţn fupereft curationis pars> quas renumcndi adaHgcndiq; 
opus iîbi adiumi c.quapropter fepofitis purgatioaibus quibui* . 
cunque deliciofus vi<Sius,quem â principio inftitucrar^icerum 
affumendus eft^optimis aîiffîcmisavinoqiiegenerofoy quod 
01 uîtum nutriac , copiofus ianguis gcnerandus > a quo flori» 
dum corpus > atque rubicundum, optimi videîicet colori« , vinditas ia 
cuadat. Illudtamen animaduertit, quod fi color viridisiit, immorihas 
quaîiş e melaochoHci humoris mixtura euaderc folet ; Teîlu- Satt^^^** 
teusăiaturaEa3& fîcciorebiU: tune ita exhauriendi erunc > 
euacuandiq>hi faiimores>vt â fîccâtibus abftineamus; nam ter* 
rei cu Unt>â lîccitatc magis durefcunt diffipata tenuiori parte, 
indclebileiq> euadunt, Ex quo hume6iantibus iimuî, qxxx di- Cautlo în 
luendo atteiîuai) tjatque euacuancibus^ dilToJuentibuiq; in hos ?J^^^^^ 
pugaajadurn erit . Totam hanc curationis feriem paucioribus ^o • 
lai. 3 3. expreîlii Hipp. lib. de zffcâ^ăc inquiens . Jăm-hmn regiumfa 
curareop^ţet .Bxtrinficmquidâm corpus mollien^ 
calidis.Jjjms verby 6* Vefica humeBanda ^ 'vrmam cimtia d^mdas 
^ti^Junfp'^fcripta • Si verofartisfuerit , purgato copite pharm^ 
cumqmdd^mpQtandt^Tndato y^uodUlenideorJumpurgat: po^ka^ 
verovrinam cientihus vtendum . Morhus autemjit cttm hilis corn'- 
motajub cntem v&rtitur. Quâm autem raciori confentanea ha^c 
fit , nou eft cur pluiibus oftendere laboremus^ cum raţionali 
cuique per fe parcat : neque iHud vino v^ertendum > quod de 
morbis , quorum foboles hic ly mptoma eft ^ nequaquam hic 
agatur> fedcuratio totaad cutancam illam afectioncm de- 
kndam bHemque e corporeexpurgandâm directa lîts nam de 
obftru6lionibus , de Scyrro > alijfcpe naturaîium partium ca- 
lamitaribus, qux lâeritiam procreare pîerumque folenc^ iam 
alias fuislocisegit. 


Digitized by 



284? HIPFQCRAtIS LIS. 111. BE me.SNHOM. 

XV. ' Yîcus ferîhum in corpore proptereâ venit Poil^ 
^'î'"' guamcaro tmnîda, ScinHainmata drcum circa fue- 
nt, &^raâr^ines ylcerisraagniextiterint, &vlcus 
ipium iiumidura ,&in vJcere fanies reiîccata inerit 
aut ylcus conftriaum fuerit; fanies computrefaciens 
ab vlcere defluens, foras prodire â conâri^o ad 
carnem vicereprohifeetur: Caro autein fufdpit , 
ytpote eleuata exiftens ab inflammatione ; & , cum 
in ipfam pernenerit fanies fabterfluens , putrefa- 

demferos habec mor« «,edicame«tis *|rrime<edel , 

difcrafîa .cal«ia,vdfnggkia, hun,i<la, velficca,<:^^ 
autf,ne.i autexiîumorumafHuenta, qulvd qu^timc vc^ 
qualuace natur^icge. excetou .- b^c.nun omSLT 
diunt quominus in vJcer^ vcl^arnis regeneratio , fi cauum «r 
v!cas-vtca. Vfil exfîccatio &a^îutmaQo celebrări poffint- nro auibu, J. 
^^ju.^ fta.d^& fubieaa caropro naturali m^odSStb^?' 
|. «ffcdc. cum hscopificis habeatrationem; &qui zdâmt {knouis^ 
qmmaten^iocoeft &bonus, & quairitate mediocSr 
ncceffc habcc,exeodcmlib.4. medi. cap.i. Vitiofusnamqi 
magis erodttî mmms verd,fordidum «rddic*kus,exf,ccatio! 
pocraresinprsfenti textu,-dum vkus priponit, .:uiu, £ 

^rms.exccefcentxa; cumqueexcrementicijs fcateachumid^^ 

^ âatur , qu^|rau2 qualitarisfluxioaem denotat, calidam al 

mirum, aduftaa.que , vel â circumadiaccnte tua^^e itâS>t 
aacur ,^ vt fubie6ia fanies ex vkere redundans, fora, eS 
minune poffir: Retendum itague malignun» adeo, alquc 


Digitized by 




ptttrefaciiuum excf ementum , â rameâcia carne excîpitur^ 
camque magis putrefack , iî>qiie tumorem attollit. Id ei^e- 

^*^2^*: Hire afferuiţ \xh. 4. de morb. fi vlccra diebus iicparibus, cu.m 
fcilicet humor in corpore turbări folct, curentur? oiBcenim 
vt plurimum inflammari fblent : Ymitemmhumor adomnes Jl^^^' 
vmăsdum turhatur ^ eajque reptet ; ^ vhiad 'olcus peruenit > ji- bus b6 fimt 
^uiâem non curetur , ^ pis exitumhoBe^» expeilitnr ah tumore, ^^^*^^^* * 
^î/i in turhatiom accejpt > 6* vlcus foras expurgatur . &' x>ero cu* 
retur r^ fus exitumncnh^leatiiţ^c'vnammeaiqHQdacceffky 
fermanens ^uafî cx noud- medkâmeHti impofîtk>ae>nouaquc 
deligatiofie iaimpari die facîa> excrementi emiSio impedia- 
tur^ doloremiTiducity h ccvmem circd'DlcmaîîQlii%^c^ Rel^nîa vicus qşia, 
vcro fanies fecundikn qaatuor vias alias atq; alias mouea cS- ^, ^^ 
foeuit yL^^co^V Iceră^uf^tc^quatuoit qi^^^scjE^m* 
viashah^revidmturpvnamînprofiindum;b^caHfemJimffi^ ^ 
fiulofa ,ir^Uie fangume fkua fimî, ^inîus excauatapaltera in 
altum , qu^ videlket carne fipercrejcunt . Tertia'ma ejî in latu- 
tudinem s atque h^c Junt , ^ua appellantur fir^ginofa' . Qidarta 
i^îa ejî fohy qa^ fecundum naturam motm e^ezdâ^tuTy Amn fci» 
îicet ad vnioueiii prseuia exficcacione properat . Has câlani> 
tates părere folet reieiita fanies erodendo^ aut prauamgigne^ 
do carnem in vîceribu^ > ita vt propoiîc^e huius maKgnicatis 
effencia in prohibita hac euftcuacione prajcipue confiftat^ 

^ii-3^* Cui verităţi attcftacur Mulier Abderita j. epid, ;, cui Carci- 
noma crat circa pedus> & per mammam iiibcruentaiaaies efi. 
fundebatur: intercepta namq; fluxione^mertua eft.Hi tamen mt^tc^^ 
tumores , etii ykeriobfunt iilius aggluduationem impc- i^biesmaxi 
dicntes,ab ali)s artamcn potioribus maiis plerumq;pr5eleru5i:, ^ ^^^^^^ 
dum malignas excipiut fiuxiones ; vtconifat exaph.55.fec.5. 
(^ihus tumores în ^lc£rihis.apparentynm^ă^ 

injaniunt ^ His autem derepente dijppatis, retrarjum qtddan Tumcria^ 
conuuljiones > o* dijîcntionesfatnt ; mtirarfitm vero^njani^^latens ^^^^^^ 
dolores acuţi , 0^4 fiîppuratio , aut dypenterki rtiUcundi ma^ ^^^ 
faerint tumores ^ Hiic alludit iUud hbri de Humor . Qjdmnquc ^^^^f^^ 
ahfiej^HS^vdutfJiHÎ^ra^c^rumfnedek^t^. ^**^^^*^" 

XVI, 'RuncmcdiczmQnthhumQ^zntihusijpkmYÎc^^ 

Digitized by 


aS8 mFFC^i^rXS UB. IU. DB LOC. m HOM, 

lîaere cportet,yt exhumedato vlcere fluxiisforâs eil 
fiuat, &: no iubter carne Jnfluentia etiamin vlclîsfr^• 
- gefacientibiis plîarmacis iUmeBda iiint ^ quo perfn^ 
' ^fada caro exîftat , & iion dîriipta rursus fluxîa- 
îinendafunt,& fuper ipfa humcdantiaimponenda 

S^pe accidit in morbîs^vt fuperuenîences^ compKcatique 
afiecius diuerfîmode indicent, atque ipfe primarius mor- 
bus : quâ inre quid agendum iît, late docuk Gakn.y.mech* 

co^kxioncs yn.'îXîme MfcTimen Ae^Q impendere *vîdeatur . Secundo hco^id^ 

qu£%ie exhis c^mf^rMonAohtineât ,^ quJ^ah iţ^s effidantvT • 

Tertio, qu^ pinari ante alia fojjinty ^ q%u£ non ţoţfinUvhi namq; 

a qiîoquamăffcBimm nonîme ţmculum înfiat,, aâidyquoâwget^ 

Jirigi potius curantis cmjilîum dehet . Vbi aliud efficuns eJîyăUui , 

^HOÂ ah eoje^^tMŢ^ipfaxauJk^Eianâa. At 'vhihKiC ctarari [anii 

vîccrum te- Ulud nott Ucety od id, qtwdordoMBat^reJpiciendîim . H^ omncs 

^^cmamî:t ^âu&fuadencin propofîto vkere^vcpofipoiîcapr^ecipua vî- 

nics,Grxcis ccrum itidicatioiie, quaîcft exficcatio, iâniei faumeâ^ntibus 

UciK a^l cxpurgandas intendamus • Vrget iîquidem hxc {ânieireten- 

cîâfTaîneit» tio> quat/nus ad nobibores ferri poteft part€S , &uaque 

wntThliî^ excitare mala, vt confiat exfopracicaroaphorifmo;caufeque 

dam , €x rationcm obdnet refpeiStu vlceris > ciim affidue erodcndo ad 

dii redduur auas arquc alias partes lUud «xtendac: neque vmn ac cicatnce 

d^â^S^ obduci pottft > nifîipfe prius expurgetur ^fedetur fiuxio , ac 

tibus fordi- .pra^tematuralk ommsremoueamrintempenes , quodlib^de 

fibS^x^lt» vkeî:»lucidenter docmt hisYcrbis* F/j^r^Kon p^j^^î, non nu.j. 

<?^^^-3;saich, j-ommtti fiknt , etiam fi addu<:antsir , neque fita Jponte comnt . 

*^"^' * * ' ^U circunfitae vlceris partes inflamfnat^ fuerint , qtiatndiu durat 

infiasmnatk > 'ulcera mire non fi>lent :Jed ^ vhi circumfit^ par^ 

tes demgrat^e fneriTJty ^ fiinguis pidredine , aut ctiam "oariccyin^ 

mc^Si>is' fiumonem famguims^ihmte; neque b<eci^drefilmtj fi non cir* 

qoanaoqicu curfitas "vlccris portes fanos ficms ^ Iu>e ergo in propofico 

hocfeiinovk^reeopotiffimam intcndk^ vcatidam intem- 

". pcneuî,quâ&b^k<âacohibemr{kixeSiWii;cCl;âncib 


Digitized by 


exîtomquc ei aperiat . Fluxionis vm, qua inflammatio ^ 
nimiaque fouetur humiditas , refrigerantibus > adftrincreati- 
busq; incercludat , denfata nimirum carne , ne , fi kxa r& ab ^ 
exceptis humoribus rarefacla , ne dicam difceipta fit, fluxio- 
aemrurfusexcipiac, Subdkdenique. 

Sed & alia vlcera frigefackntîbiîs obîinenda funt 

alia videliceteiufdcgeneris vkerâ^boceft,âridadilcrafia fîmi-- 
liue fluxione vexata. Nequeinanis cenfeada efthgcrepetiti o; 
nam cum vlcera per ie cxfîccancia perpetuo expoftuler^ y ner- 
arduum poterat alicul videri humeciatitia eciam quandoque 
conuenire : proindeqne pr^ceptum hoc pecuîiari ftudio ix^ 
finuât , qup haudaâet^ cum opus fiierit, in vfum reuocemus^ 
vfque adeo verom eft , nihil non variabile repcriri in Medici- 
na. Ad humeâandum v-ero vlcus tepenteaquapiuriesvlus 
eftGaî. ; bsec namque ex fei natura humcciac ; &: quacenus ^-^^ttîl. 
cepida , poros fîccicate adUridos, laxat, humores fundir^ euo- pîiiS^ 
cat, pcnetratq; facilius . Plurima autem huiufmodi medica- ^^p* 7- 
menea, &humecaancia, &adâringentia, alijfquepr«editaj&. 4cSfb^^ 
m*n. cukatibus habet Hippocrate^ lib.devleer, C^teriim ne aii- ^^**^* 
cui manca videatur vlcerisiiuius kHuxiontytxzti curacio eo 
quod, de repeUentibus > reuulforijs , atque^xpiir^antibus au- 
xilijs nihil âgatur, qu^influxionecompefcenda perneceffa- 
ria videntur; nam alias pro hac fedanda generalia tradidit prse- 
cepta: hic veroiuccinCte nimis,& quafî perfundiorie de mor- 
bis agitur^v-t pluries dic^umfuic^Sc pociora tantummodo pro- 
ponere Auchor profitetur , 

XVII. Angina , quain Cynandxcn Gr^ci vocaiifc, â fan- Angii^âa. 
guine fit , cum fangnis in venk , <ju^ in colio funt. ilvcnS 
compadlus fucrit • SicaffecfHs ă Ycnis , qua^in brac- ^*^^*^^ 
chiis funt, fanguincm detralies, & fîmul aluuminfer- '''"^^* 
ne fubduces, quo id , quod morbum exbibet, detra- 

_ iiatur.linguaquoque, cum magna vlcera habueric, 
fîmilitcr curanda eft . 

Vam Latini Anginam ab angendo , Grabei Cynanchen Angîats no. 
& Synanchen â Canibus, & Suibusappellant ; ab bis ^^ ^"^^ • 

O o qui^ 


Digitized by 


fluidem, quod fepânumero morbo huife obnoxijiint; ab Ms 
veto , quod Anginofi lîdentium Canum inftaf , iiianţe orc > 
exerta lingua , lequenrique anhelitu non raro coDfpiciantur . 
jauces fiuit Fiucium & Jaiyogis proprie paflio eft ; phkgroon fcilicet cas 
^na°fldl pattes obfidens jacncceirariasimpediensaciicmes, dcgluti- 
&gutwris, tioncm, &fpkimm: acproutintimiores,veIexterioresan- 
mf ^^t git partes , eo difficilior, aut ikcilior eft , variafque couftituit 
Tf' ^" ^ ipecies ex lib. progn. , cx 2 . de morb. , & ex Gal, 4. de loc. ^ 
4.°! ^'' âf. cap. 5., &curiofiusexPauloIib. 5. cap. 27. Hîppocrates n-U-U 
Anlnxfc^ attamen, vt notat idem Gaîeaus, fub nonaine hoc omnes dş^^°^ 
mine omnes comprehendit tum gutturis, turn circumfîtaruiji partium afie- ss. 
S'î^mFau" âus, qui quomodocunque deteriorcm redduntrefpiratio- 
«uro.mnu^ nem aut dedutitionem : vadc 2. epid.feâ.2. Anginofos re- 
partium affc fctc ex ccruicis vcrtcDrarum imus luxauone ob enatuin in cer* 
âioRcs. y|^^ tuberculum , qui vertebramm ligamenta corrumpebat^ 
iiideque Faucîuna>ac Giîtturis partes prcfl&>coanguftabaatur, 
Et Ub.acuc. aliam defcribkJH^berno Vernoque tempore fre- ^^'^^^ 
m^^fcclS qwencem, cum fcilicct^fUmo^capitc multa &glutinofaa4 
«anţ pccics. . ^g^jj^^^g ^^^^ fluxeric , qusE fpiritus & fanguinis vias, boc eft 
arcerias &: venas obturat augetq'ue ; frigidaq, cum fit :, fangui^ 
ncm congelat >immmobilemq;reddit. Hinc> feuproximas 
Faucium regiones prseraant tumefadi^ vena?, & arteri^ ; 
(^lutinofa namque cum fit hxc fluxio , baud poteft per exiles 
venas in partium porofitaces efHindi , phiegmonemque pro- 
creare ) atque ita Guttur & Oefophagum coardent ; teu , vt 
Czîklp. qti? explicat Casfalpinus, fanguis Se fpiritus furfum repens, obftru- 
^*!^?'^* ciafquereperiensvias, retrocedat, & in Cor & Pulmonem 
^^ ' ^' refunditur;indeqiiieoppletuaPulmodUata£i atque conft^^ 

ainequeat,fufFocatioueminuebit. Quas vtiqueanginaapo- 
plS^a?"^ pleiSica quadacenusprpcul dubio erir, dum obitrudtiş maiori' 
ex parte iugularibus venis , animales etiam fpiritus minuuntur 
â denegata materia in cerebro: quapropter fenfus omnes tum 
interni > tum externi, diminuti appareanmeceffe eft : vnde 
etiam morb. qusdam recenfetur Angioa^ in qua Aa. 
ginofi vident & audiunt obtufîus , & pras fuffocatione non 
îatelliguat neque quiddicant, neque quidaudiant, nequc 
quiâ faciant . Haud huic abfimiiis eft Angina , qu^ in propo* 



Digitized by 



fîto tcXttJ taîîgitur potius , quâm defcribatur, qu^e fieri afleri- 
tur â fanguinc in colii vcnis cbmpaâo ^ hoc eft > dcnfato , 
ac fere coagulato â friggiâa fluxione , non autem in Fau- 
cium porofitatesef&fo, vt opus cffetadphiegmonem pro- 
creandum • Ac quemadmodum pecuiiarem t^antummodd 
morbi iftius conditionem tetigit circa eflentiam & caufâs^fan- 
guinisvideîicetcondeiktioneminiugulâribusvenis^itâvnum v 

autaîterum tantummodoproponitremedium, quod pr^ci- 
puum obdnet îocum in hac cumtione>phlebotomiafB nempc 
in brachîjs admorbificam imminuendam materiam > paran- 
damque fpiritibus viam , vt furfum adcaput afcendere va?» 
Icanc ; & alui fubdui9:îonem > quar caput depîere , 8c flaxio- 
ncm â venis auertere potis fit . Reliqua cx Ub. acut. fupplen^ 
"^^ da, vbireueilentia , deriuantia, quseque aflfedampartem im- 
mediate euacuant;^ compaâum fanguînem diflbiuiint, & ad 
exteriora euocant , ita brcuiter proponi^ntur . Aeg^ cito (uffb^ 
€â£uT , fi nm qm^ cito auxiliumfirat^ ^en^fiBumemin hracchlfs 
fadensy ^^Denăsfiihlin^iajecans ^ if ecckpnatum delinBu cu- 
rans 9 ifcdUos gargarifinos exhihens > it caput radens : Dehet ^^^^' 
miîem c^atum<apîti ^ coîlo ciramt^mere» ^ lanăs ohmlitere ^ ^occatc* 
^ (pongp tmllihm tx ^ujua calida &îcpreffis fouere^Bihat autem 
Aeger iupmm^ ^ aquam mulfam ; fiiccmn ^ero ptifanae tune 
fumet 9 cum iam ex mdicaticme in tuto fuerit. Morbus enim 
acutiffimuscumfit, tenuiffimus ei debetur vichis , folaque 
potione detinet iegrotanteni> nequea3Torbitionem deducic, 
nifi tranfadto niorbi vigore , ac poflquam ex deciinationc fa- 
lutisfecurii^iiluxerit. Sedneque videtur filcntio inuoîuen- 
da altera qu^dam Anginse Ipecies citrâ vllaminflammatio-. 
na. 4©. ncm eodem4. acut. hune in modum regiftraca , varijique 
crenribus noftra hac ^tace fsepe atque inifcre admodum ex» 
perta* Cum^piuo > inquit, atque autwnnali tempore fiuxto ca* 
tiâa ac nitrofa de Căpiţe defliixmt , ^îpou ex tempc^e acris ^ ca^ 
UdafaBat Talis ^efl^mordet ^ ulcerat ^ ifjpiritwnimplet^^ 
ereBa cermcisjpiratîo auedit > ^ficcitas multa» & qu<e vUentur , 
g^acilia apparent ^ ^ tendines pofieriores in colk dijiendimtur , ^ 
veba intetano difienti ejfe vidmPdv > ^ vox aimipta eji^ ^jpiri^ 
tus paruHS efi , iţ vetraOioJpirîtus dmfa iţ vioknta accedit. Ta^ 

O o 2 libus 

Digitized by 



Uhus arteria^keratur» Fuîmo ardet cum nonpojjtnt extrinfecum 

Aphth|m^ j^yiţj^pj^ inducere . Etfi his affeBio non vhromaad extemas colii 

^^cntes.^^ ţartesd^eraSurfgrauior^acinemtalnlioreft^ &proptertempus , 

^^uodâcalidis» ^acribmjtţhumorihus, Cuietiam atteftatur 

prognofisilia • Eauces exiiicemU mm febre , horrend^funt • »»• *î* 

csfaîpiJî* Huius fuffocationis modum ex hoc loco fie explicat Caefalpi- 

^mcd.'^qulâl îi^s . Non hryngis ocdufio horum caufa oftenditur , fed^quia 

17- ' acris defluxio mordet , vlcerat , Şc ipiritu implet : feruntur 

enim fpiritus ad locum demorfum ; liinc Pulmonis repletio , 

vnde Grthopn^a , &difficiIisinlpiratio, eumnonfitlocus, 

in quem externus aer admittatur , quantumcunque thorax di- 

Aretx.îib.1. latetur, Affedum hune Aret^eus ad aphthas peftiferas redu- 

acut. cap. 9. jjjj^ qyag â tonfiUis atque ipromet ore incipientes > fi in pc6tus 

per arteriam id malum inuadat , eodem iUo die ftrangulare af- 

ferit: Pulmoeaim& Cor,nequetâleixi odorisfasditatem, 

neque faniofos humores iuftinent , fed t.uffis , ipirandique dif» 

ficidtas enafcitur, miferrimoque mortis genere breui e medio 

toUuntur . Sordidum igneumque vîcus , regionibus feruidis , 

vt Aegypto , ac Syria? familiare > ex quo Ae^ptiacum atque 

Syriacum appeîiant. Ac Hippocrates Jib» 2. de morb. intet nu* ^^* 

,, Tabes cronicos morbos buc aiFeâum zdnnmtxu.Siexfermdo 

'vlcereaţhtha appellata, Pulmonis fijiulalahrarit^ inquit^ fehris 

tenuis tenet ^ ddor mediumţeBus ^ pruritus corporis adejî ^ ^ 

vox raucofă^ ^ faliuam liquidam ac tenuem Jpuit ; quandoque 

etiam cracam veluî npifcihus crudis ; ^ alias at^ne alias injatim 

apparentduravelutfiingusab'vlcere. Num hocex benigniori 

fie materia > atque aliquas proinde dat inducias , itâ vt non« 

nulla Tabis accidentia inducere poffit ; indeq; inter Tabes lu* - 

re aliquo recenfetur ? Negle6tum autem., &c ipfum ferox eua- 

dit>&adintericumdeducit. At quomodo inter veras Angi- 

nas connumerabimus, etiam fi ab initio vfquc e nitrofa adu-- 

jftaque materia originem deduxerit , cum nuilus in faucibus , 

proxîmiique partibus , nuUus in iaiynge appareat tumor ? Sed 

neque aphchas vereappeîlarepoterimus, cum ambicus oris 

confinia excedat. De nomi nibus haud contemiiendum eft^ 

dummodo confiet igneum eflfe vlcus , ferpens , fordidum, 

fGetidumque,â lutroia, calida, aduftaque materia prouenieas, 


Digitized by 



ocyffimeinterimens .Hifpani^ &cxltali$ Neapolitaniidfe- 
piffime mifcre admodum experiuntur . Exa<ăe de ijs e^t 
Ciiriftophorus Perez dcHerreraRegius Mcdicus. Arei^lis uh Lcy^ 
praîtereă Anginam defcrJbit ex folms fpiritus vmo.Injîrumm^ «P- 7* dc^ 
forum coîlaţfw menit , ^fingulorum Natur^^injignismacies, ^ ^^"^ 
praniulatiovehemensyvtipfîfinet inţeSterelatmiorihuspartihus ^^S^^ ^ 
cinumCory at^ueVulmones ahdita effe mfiammatio wd^atur \ Si'^J.^ 
Anginam banc appellamusy quafi interius 'vrgentem > atqueati^ 
gmtem . Ego vero exifiimo ipftm filius fţintus -uitium efe^praua 
emuerjîonead caHdiJJimhmpcciffimumque comierft^ nulla corporis 
ţarîe inflammatione laborante . lâ autem mirandttm non eji : nam 
incharon^is firangtdatns citra-vllum corporis affeSîum acutiffimi 
ţmtingunt : irnmi x>el 'vnica injpiratione , prim quam corpusma* 
'hficiumcontrahaty homines moriuntur ifc* 

liiiguaquoqneciîmniagnavlcerahabnerit, fîmî- '" : 

iiter curanda eft ^^^ ^ niagna vkcra habet , â fluxio- 
' TiC procul dubio ea dependent vclut 
ipfaAngina; phlebotomia proinde^ âtquepurgatioQccpus^ 
Jiabebit ad antecedentem reucllendam niarcriam^deriuadam , < 
cuacuandam . Sed quoiîiam compendiofa admodum y acqu^ 
dimjnuta vtriufque iftius afFcCtus propofita curatio apparet, 
idedgenencamporiuscradere regulam promorbis omnibus 
âfluxione podiiimumprouenieinibus percurandis, creden- 
dum eft . NotanduiB incerim iuffi& iangumem deirahi e ve* 
nis , qux in bracchijs font , pluiali viens numeroy vtin dicaret 
ex vtroque bracchio iangumeoi copiose c& eliciendum : id 
mmqiin more poikum ^£t Hippocrati yt caii numere vtrumq; Fm An^aa 
bracchium fignificec, vt aduerut cciam Saiius in lib ^ de ^^s^ ^ 

morkt.^3A'alIes,4.acuuc.3o.vbiedamBraiTauola,quam So^'^^f.^! 
prăximtundendi vcnuique bracchij venas inAnginofoaâe- ^^^"^"^-^ 
ăuy cum valde rauonabilis lît (laboranc fîquia^m Fauces 
inter leuam dexceramqne Iccacas , ad neutram partem ma<^is * • 

vergcntes : Quodlî alcerum huius parcicula? latus inccrdum 
iaborareăppareac, leaionemquein bracchio e regione po- 
foomdicet i perraro tamen fit, qum rraciuremporis alFc^ 
wo, fi perfeuereţ:, ad aim^ Faucimn partes cxtendatur , 


Digitized by 



jcnm affeâa pars an^fta fit , fuafque omnes particulas ma- 
xime vnitas habeat^ Gaienus cciamlib. ij-meth. cap, ii* 
cam iaiinuaiiit • 

XXVIII Morbos â princîpîo curare oportet, & , fîquîdem 
iniSt^ â fluxionibus fiunt, priniiun fluxiones Sedare ; Si ve- 
"^^'^^t ro ab alia caufa ; principium morbi fedare . ac cura- 
Icrâ/'"^" re, deindeid, quodinfluxit, fîquidem muîtum fucrît , 

educere, fînmodicum, per dictam moderări > ac 


BReui hac verborum fcrie pîura tradit documenta , quî- 
bus omnem fere curatiuatn mechodum compreheade- 
re videtur : monetque primo morbos aprincipio curandos , 
ijsnimirum occurrendum prius quâmaut nimisaugeantur, 
aut ab bumotum copia opprimamr natura ; vel audia putredi- 
ne , prauam qualicatem acquirant ; nam . 
Clmdhn • *^ • '• '• • y eteri pojî ohruta^morbo 
lib, 2. iiu» Corpora , Foeonias ns^uicg[uam admouerîs herbasl 
Euttop. ^ principio inquam, cum vîgetiiaturalis vis^ nequc admodum 
â morbi Trehementia oppugnatur ; vnde medica qusecunque 
prasfîdia perfacile ferreapta eft , iuxtâ aphorîfmi regulam ; 1^2^ 
& zL feâi^ €iţieMibm morUsjt^uiâ tihi videtur motwniumymom,; Vigentilus 
^ero qmefare melim eji . Circa principia ^fims omfdaJehiliara 
fmty circâmgores x>er6:yfortiora^ lunc igitur minuendus ma- 
teriei apparams.5quaKpauIadm vitium contrahît :, inftag^turi 
ignis^JimenturncefTura:: nequeadeo de^crudkatetimendum 
eft -s cam non quxîibet in venisexundans humor, crudus di- 
eendus fit, fed is taammmodo , qui Vidatus in fubftanua^ a 
natur^e imperioiamreceffit; prsefertim liinpartemaliquam 
in&râus , neque ^xpulcricis vi , neque trahenti medicamea-* ^ 
to:&cile cedic ; cuiusxeitndicia yritia vel tenuior^ vd craffior 
quampar fit-, prseber^ poxiffimum confueuit^ iuxca Hippo- na. 44. 
cratis prsecepmmin lib»acut. iiKaucem de affeâ.fic loquutus 
€& • Aegrotos confiderare ^porţetJiatimmconftituîiQnis morhorum 
prindpioyqtia re cpus hahmtU'^^qucdesJint vtphixrmacopurgm^ 

Digitized by 



ţur\mt vtdiidqmâyquodcumque tandem "ookeHs , exhiieat. 
Sivero omijfa principia adfiam iam •Qergeme tmrU exhihtL 
ris î» delajjat&iam corpore ^ forte 4mddam pr^here veritia ;pe- 
rimlum efl ne ma^s deUn^as^ qtrnnfuceejfum tfonfapiam, Vbi 
Hotandum dixiffe : ftatim in cottflttutims morhorampincipio . 
Nam cum triplexfîtmorborunipriiicipmmapudMcdicos, E,Gaiea i. 
primus fdiicetţnorbiiofultusipnmi tres diesj prima totius mo^'^f' 
moţbi pars, qu2 ab omnimod^ cruditate defimeur ; morbis M^^m 
quideoccurrendum eft,non primo infukitj nam hiceâ pene i^Jtu quot 
impercepribilis . non primi$ tribus morbi diebuş, cura fcili- c^tio ia 
eet non dum nobis faris conftat de eflentia,au£ morbi cau£s, ««»?î>«'î"*'> 
fed^omnia adhuc in incerto funt ; vnde apud Aegypdos me- ^f ^*°*°' 
dicinx parentes poft terţiam diem m ouere licebat Medicis, 
quodfî priiis, periqulo id agebant fuo, vt refer tAriâot. 5. 
policcap, 13, Exdpiendiţamen funt morbi peracuri,qui 
cum excrejBJaflatiai habeanclymptonîatajftatjmpariter cer- 
tam de fefîgnifîcationcm prsrbenc, 5c quid opus habeaat> 
ţkre oftendunc : Vnde aphorifmus . ^edicM ia valde acm ^ " ' 
tis t fi materia, turggty eademdie: fardare etenim ia talihumor 
/wwe^. Sed in prima morbitorius pane» vtia ea latitudine, 
( quai-n ad quarcam vfq^diem extcndiin acuds collkit Ga- 
kausin Hippocr. 1. prorrket. com. i. , etiî vkcritisqim- 
doq; ^loixahsxm) axorbijdeam &: formam bene percmcrer 
poffimus. Conftiru£ionamque,Gr«ceK«r«V4<r/r, forma M«rfcin6a 
ett,^ccies,atque idea: exquo principium conftitutioi^ ^'^S'-^i 
morborum eft,cumprimum morbi effentia ex pathoono- eommS 
momcis lignis incipxtiam nobis inaotefcercactuncpnmdrt''**'^'*' 
jitt.45. agere comienit.Hinc lib. acut. Incojîatttesfihresfotereoportet'''' 
donec cmfiiterinf. cumverlc(mfiăermt:,Svi^>&ciiTaiime 
cmumienti occurrere,Jpeadatione fiamdimi»atttramfa£ia^Hzy 
Vtinquit Celf. lib, i. in prooem. >aousrdn(mefi:cerianotitia, 
mu opinio certum reperire remedmmmm potefi , Cjeteriimne 
opinemurcxterapeftiua haccurarione fieri poflTejVt croni- 
cus ex fui natura morbns , breuis omnind euadar i aut Eacu- 
tus fit, iUicQ euanefcat : nam ytafTeruitPiataiiiTimacOwmf Morbi «a- 
morhrumconjîitutio animdium natura ^aodaoimdofmilis.efi . Sa^tă'S 
Saneanitmlimt cmpofato ab.ipfigeneratiema^iff^ei^ tem- w«°?Bi« 


Digitized by 


%^6 mfmcRATis tiB. nL DE mc. tif nou. 

pmmamiaM termimtur yU^ue &genusvmuerfumpafitury 

tisneceffkrys paŞomhus^cmttnet: : Etmimtrianguli ah iţfoinitio 
fnguhrumvim ţojjideni^ , vfyue ad certum temţus fuffident^ 
advjum^it£ coh^ent . Vltra U nemini xntaţrorogatur ; îs 
quoquecon^itutionis moius languorihus c-onuenit;qms fi qms intra 
. h ii fi^^^ temporismrjumpharmacis amputare contendit, exparuis 
quisinte^ tngmtes yexpmcu mulţi maâere confiimerunt : Quapropter âU 
^mltii^' lig^^^i^corrigmdiy&pihmtandi morU yf rotit cui^^ 

ducri£.ia£aît datHmotium;neq;diffml€infeflutnq; maîumpharmacisin^gmdu. 
ma|.quixn jj^c Phco . ynde^oîligimustenif eftiuecurandum eflc ,-vc 
dempca mareriâ , morborum frangacur impettis , felicemquc 
exitum forciaatur ob dducxilo 4ubleuatam aamrara , in c^ce-. 
ris fea qua^que tempora percraniîmri > iuxca naLuraieni i|>fo- 
mm dilpoiiiîonem^ Docetur lecuado in propaiito contexcu 
qud primum<lirigenda fie CHratio>feu potius^â quo aufpican- 
4a ; ab antecedente nimimtn^aufa , â qua morbus originem 
duxit , atqiie fouetiir^ vc di6lutn etiaoiiuk fuperius t.y.lib^i^ 
Hsec emm quam maturius refcindenda eft ^ fiue fluxio fuerit^ 
'. . cuius medelacxlib, de humor, declmacio, deriuado:>reuui-jau.i|* 
tclel^'''* fio, & ftcxacio eft; fiue^alia qua^uis caula^vţplethoria^caco- 
ohimia^ autpartis cuiufpiam^iatkcfîs, cum ab ipfa morbus 
foueatur , atque mcreffîencum accipiat ; «rcumq; fit noa 
poffead perfeciioncm affedum vU^mfanari, manente ad- 
ţi^jpfa, rade ortus eft^ caufa, vtdooetur Ub. 7, mcth»c.i2* 
Diummodo iUud fciarut, operadonem haiic ad pr^ecautio- 
nem potius vquam ad cur^tionem ipedare^ vt habetur apud 
Gal.4« metlî. cap.2*Vka namque fxuiorfuturus morbus 
prsecauctuf ^ ^oBam mtem ^grituMnem , iaquit GaL lib. art. 
mcâ^iM^^j^^^^^^^ ^r^ar ; i^u^e nondum qnid&m 
adefl yfid^fi^ura ep j,^^ , ne fiat ; Eius autem, 

^dt adhuc fit , qmd quidem foBum efi , ^urareaportet 9 q^od aw* 
ţem fi^unmrpr{)hiherff ^ Amota iraque antecedente caufa, 
coniuii(âam demde xefpick, prajcipitq; nofter Author, quod 
materiei in partem affeclam iam fluxit , immediateque mor-» 
Y y %mn&dxiAjco3^(^km fit, cuacuantibusauxiiijs educea^m 
- : j^jfiui^i^cphâ^ fint> .fiue -chirurgical iin modi^ 


Digitized by 



cum ; foia diset^fis , inque fex rebusjDon naturalibus modera» 
tio fads cffe poterit turn ad minuedam morbificam hanc m^* 
teriam,tumad componendum^ hoceft, atcemperandum . 
Eteoim diseca maceriam fua tenuitate > ope nadui caloris im- i>^ ^5- 
minuît; quaîitate vero attempcEac quod incemperatumcft: & oSS 
vnde <^. epidiedLS. Conîrary viSîus in mmrho. Quod fan^ pras^ tiuimmet 
cepmm plurimi^cieaduna eft ; nam , vt loquicur Plato m Ti- pharmacau 
m^o , MedicâTum purmio , ^/^^ vharmacisfa , tune vîilu efij, ^on mâ ia 
cumjumma cogttnecejjitas: ahter ^oero mmo modojan^mmîîs b(h ccâznc c». 
minifîifcipiendaiViqac aiîeruir Qt&iS.folââhpmMiafmevllo ^^^^^ 
ţericulo meâstur * 

XIX Capîtis fradurse , Siquidem os fradum fiierît , ac ^apkis ^a. 
* contritum , periculo vacat y & curare oportet hune ^^f^ 
humedantibus medicamentîs . Si v^ro rumpatur, & 
fiffura fîat , pexicuîofum eft . Huîc ferram adhibere 
oportet , ne in offis fciffio-ata îanies înfluens , iiiem- 
branam ccrebri putxefaciat: Nam vt per anguftum 
intrans , non aiitem txicrts , aflSîgît , & fiirere lionii- 
Hem facit : Hale itaque ferram adiibere oportet , vt 
faniesexitamliabeat, non foîumingreiru.m> ampla 
ferratura fadta . Mcdic'amentîs aiitem vtendîim, quse 
humorein in fe fe trakunt^ &lauandiim . 

DE capids fratStaris ( fic-aiim generaH nomenclatura co- FraâM^ %^ 
ţinui foîutionem in offibusappellamiîs^ fiuelapfulisc §j^^^ 
hat , fise idu ) pa^ca modo attingic Hippocrates, vx qui in* 
tec^umlibcIlLmi, etimque abfoktiffinHim > jis calamicaribus 
dicauerat* Cumque hariim diâerendse ad xres podfîîmuia 
rcuoccci^r j C^fionenHConCiifionem ^ & FiflTuram ; quarum Carfio mi>& 
prima , hoc eft , C^fio , cui & pim6Ho finitima videtur , eft ^ ^^^^^^ 
qtia* fit â teatiis aciciinftriimento , quod ampîum atqs patens 
fiiiveftigium, fedemq; rdinquic in parte oblarfii* Contano ^^J!"^^ 
vero eft qu^edam fuperficiei compreffio, fen rei , quse pcrcu- ^^^* 
titur, inie if^am denfatio, ob graue obtufumque corpus > ei 
Validi ioEidtum : qua |y:optcr occulta eft qua^am coaupiiâ 

Digitized by 



folutio îa fubîedis particulis» quse infenfîbiliter pene Jacerao- 
mic: Fkq; interdtim cum diiceflTu conmfas partis â 
dum adiferfam in partem cumatur ^ fimiJiter ac mms^vas 
^^%^ ^aJâde allifum ; cui comes & pltmmqt^Mio , qixss cerdaHl 
^* * folutionisfpeciesia offifcKîSjca^pilkrisnempc* atgucanoiifta 
rimula, ia folidiori corpo^c excitata^ âum â re graiii , obiufa- 
qiie percutictir : ac proinde adulromm offihtîs > qu^ âniioxz 
fiinc > frequentior , quam pucrorum ; quse fifftira longicis fe* 
peimmcrq excurric, quâm vbiiaus ^xceptus eit . Atq;harum 
diiFerentî^umvnaqu^q;<amplur€S fub fe comtinet Isefîoau 
ideas , modoique ^ vt videre licet iib. de vuîa. capit. xiuper ci- 
tato ; Atcamen prsefcnti contextu prima? tantum, atq; poftrc- 
mar meininkHippoctates > c^fioEM^ nmiirum ^ atqu 
quamm ilfani finep^:kitilo; banc difcrimi 
ferit : nam conmiîo , qua ad periculum , in eadem forte eâ 
FraAio lars cuiiî fifEone . Si^Tgo Crânium ab externa vi csedente faucie^ 
%^â^ turcita vt fraaio ob laterunj attritionem comminuîtionemqj 
Iacii. nonadftri6ta&capfflari3,yt^cimr, fedlatafoperfit.atqiic 
ided percominod^ queat ab omni crtiore > fafîieq;^xpw<>ari; 
fi in exteriofi prarfertim fi&Mm lamina, ac fubieâse partktil^, 
cum cx, qux xn caluari^ meditiiUio > vţ naruuli, arteriofe^ve- 
B^que ; xum qn^ imi ipiam caluam latitâBC, vi membrana , 
& cerebrum, nullatenus îasdantur ; tune perioilo yacat, vr do- 
cuie etiam lib. de , qui texms male â Cornario 
mop d^ '"^f^'f^^^^^^^^^ Atverofedes ipfeperfe 

vuincVcapi, J<^^pnUs înojje ^ fiam-a > cmtufioney dîit intr&ceffhne ffmt 
tkcap.îi. mamkefîmliter^in ţo^more capîis ţme) tx his mors nm 
(mtmgitfectmJmnm^îimn, eii^ficmtinpt. Dhit fecundum iu- 
iUtiamydummodo viddiceî: vuinerati corpus baud valde caco- 
chimum>maleq; difpofitum fo^tracbra aute appofite atq; op- 
ponunecuretur;aââUâs,vtIegitureodemîibelîomiperrimeci- nu.i. 
Vuînus ^U- ^^Oj^ulluCăptis *mlîmslâîdtercontendi âehufye enim cutisCoU 

ziiâ-rc^^:». ttimmr£tur ; ^odiaififangm c&ncretus non e^c^^geU^, mt aliud 

Mbit; & aliquandoetimtfihrem inducit y^ Medico quidem nem^ 


Digitized by LjOOQIC 

mttemccmmmt^ ^fne di^iÂmaUcs^cmtrahaîi ma^^fim^^^ 
curetur; mmtferfarmoţt, ^ alias âemdatOyfed fam, i;^ f^^a^j^ 
UfimemaUquwtextdoh-âeai , ^tamenfmum^epu$^ur;p* pio*» 
rkultm magis îmnmet^ vt ju^ţm^atumjîary idcft ^atre&at^ 
etiam^ alias fimmmmneff^; Si ^^^i>0samhie^^ 
6* inflmnmetmx^ conjiringăSurJtĂ^tpus exîremonp^fjit t igm- 
fcit mhn , ^ multa flamma implaur * Etpme os ex ămhientihus 
eof^hus infiipjum calm^mt i/flammam^ ^ ^u^seamque ^nala m 
fi iţfabahetx^Oy trjshity^iţ exhisitâfiippdrmimju iţe. Cmii- 
btt igirur Capicis ?uf neţi feduid pro^icieiii^m ; dummodd 
illud iciatur , pericuîum omne in affeâicmibus liifce circace- 
rebraîiiîm pariiuFB iaf fionem vetfari* Tale autem vulnus Jbu- OpidsţitU 
meebHdbiisme4i€am£atis<;urarepraîdpit^ iioncerî^qiiod. 5^5*^^^^ 
Jb:iîmeâ:ari re^mrat ^ quandoqiudem libro toties cicaco de txhms cu^ 
ay,i3. rn^. c2^z. rulms ma^nUymquk^^H^ ^^^m^* 

•comienit^ne'omo^mdem: cumtamen Ylcera vniuerfe non nHî 
jm.x. vino lîumeâaudâ tnomierit initiolîbridevlcerib.; fedpro 
humeâantibus, coBcoquemia&fuppur^imliîc inteHigerc 
dd>emusj quse caiidafunt ^liumida, afteâ^ tamcn parris 
naturali temperamcnto^ quanmm potejft^affimiJiâri dd>ait. 
Goguentia itaque pdmo applicai^iui]^^ Tt -cc«iUiiâ,&la- 
ceratâcaroquamcKînisiapi^verutur^atqtîekâprscaiîe^da SS^^ 
inflammatio. Confeâo autem pure>& expurgaix)^ tune 'Cslk^ J^anma^pii- 
camibusagendumerit, vtcommuniterfitinreliquisvuîneri- «^«iaiuac^ 
mu.23- bus. Id exprciîedocuk vulncr. capit.> fie loquens. 
SuppiTcaMm ^idâm ^uam celerrime ^dIcus facere oţorta: fie enwt 
ambientes tAcas ţârîes ^uamwmmitm b^amrnaTnmtur^ iă 'olms 
Cîtiffinîepmmimt : necejfeejîmim CAmesconcifis, .^ c<mtî^asâ 
telo^fuţţuratasfmy ac confumi . Fo^%iamaMempir^^m£mfm- 
rit y fîcdnsferi 'ulcusx^ortet : fc emm dti^Jimefimwzfet , ficca 
came gerfrmcmtdy ^mnhumida , ^JKqmpteiolcericaroTumjur' 
ftu.3- perfcrefcât. j&iib. de ¥Îcer .Siqua£arjaextdocondfi.^MŞe^a 
eji,eam curara op&rtet , ^m qumncelernfmfuppuretwri nam ^ 
fnmusmfîmnmatm>y if neceffe efl carmscontufasacM^aspi^ 
trecere , acptsfmj ^ eUquari acconfmd; i; psfteammim cames 
nafci • Perraro autem Caput ab externa m laîdkiir^, quin 
aliquâ fubfit cutai^as partis contuiîo ob fubieâum Craniuaib 

P p 2 9"^^ 

Digitized by 



quod refîftens, ia caufa cft > vt caro , & fui pars, adreratur. At 
fi altius ad mcditullium > feu dipipem vfque ^ nec non ad altc^ 
sam concauam prope cerebrum calug fupcificiem extendatur 
haec cakmitasradhf c^nou Iâxa^& medicameacisperuia fît^fed 
jiTaiamm t^^^^risjtenuifque Mtu:a;hmc muica fane^â^iimmaniaimmi^ 
difcrime ia acBt difcritnina : nam praster diffiraâas venula^, quse fangui^ 
capuc» jjgjj^ iBtusfuiîdunt ; lasfum os inxbecille faniem neceflârio gi* 
gmî;> quaeadfubiedaaîCerebri membranam per rimulam 
penctrans > indeque nequiens egEedi,velabftergiatquc ex- 
purgări > eam putrefîtcic > ingcntes excitans lîaflammationes , 
Febres>Deliria>CoGuulfiones (aduocatis niminim vndcquaq; 
calidis]btinioribus)âc dcnique Mortem:Qu6d pariter de con- 
tu fionibus dici debet , a quibus > nifi dekantur , paularim os 
vidamr ; mox labes communicanir membranis, cademqi in-* 
furgunt âccidcBtia , quse nuperrime numerauimus • Sic & 2. 
prsediâ:. Forro ex Capitisxmlnmhus kthâlifftmafimt , ^u^adCâ" ^b.. j, 
Tehmm ţertingunt >, velut ^iam mte fcripttm efi . Grauiajunt 

diffroBum. Si veroojadwn'olc&risţarmimfUmt, fiffura vero 
cjjis aliguandiupermanjmt y fericulojms efi* Heec maem cmnia 
ţrauhrajuntfi^mxtâjuturamjunti ^ ex Iccisfemperţericulo^ 
o^caîtat'co. ftores jiimmiin cotite exijbmt.At quod maius faccffit negotiuni> 
^^Tqu^ eft calamitatis huius deprehenlio ;.nam mm contufio^tum iit 
»o4o dcprc fio 9 nune dete^a eft ( oiTe videlice t deniniato exiften te â iu» 
Capitc!^ ^ perpofita cute>omniq; alio velamento) s nune occulta>eadem 
cnte integra remanente; vel calua alibi fiifaacdiFraclâ cft^ 
quâm vbi idum excepitrac quemadmodum in illa>immiffum 
Ipeciîlum fatis quandoque effe poteft > vt exploretur > ab 
afperitate nimirum , quam fîffio ia reliqui offis î^uore pra? fe 
fcrt; veletiamaffufum cum aliquo medicamenco atramen- 
tum candem detegit> dum abfterforeliquo ofTe , rimulaatro 
infeâacoloreconlpicitur : quemadmodum 8c contufio ex 
immuţaco colore in albidiorem depromitur ; icâ hasc omnem 
Mediclinduftriampeiiecludic, nifi infîftamus argumentis> 
qu^ HippocratesTumma diligentia non femei nobis expo. 
fuit ; d^promca videUcec ab ictus qualitate , confiderata Per* 
cuticntis vi^Inftruinenti grauitate &c figura, percuffi Offis fo^ 

* îiditatc 

Digitized by 



lidit^e & robore > â fuperuenieadbiîs fymptomâtibss , & â 
fenfu iplîus vîius . Trimumymqmt , caţite^vulnefato intercgăre jj^^^^ 
oţ&rîet per qHtâvulf^âtumfît.Ddnâ^ vuilcs^/ 

^.i^, 'vulneram fmt . ^(^imqmfmevHlmismfl^ inîttm. 

Contufiones^fiffwrasmoţfâ non aţţartntes , ^ tamenţrafentes , 
tx /vulneraţi refţmfime cogm^ oţortety a» 

tale quidţnjfumfit osy aut non paffmf^Deindc roitime» ^ opere ex» 
quirere, jcitrâjpecilli admoticnem: runrpiturjtqmdemos» ^ ^h- 
fcuris f^urisy ^ manifefis ; ^ cmtunittur ebfmris antufimibus, €h finditiîr . 
^inmexjka natura maxime cedit, cum alter ah aîterc fauda- ^.^^"^^^^^ 
ttir , 4emdujinajauctare 'oolens: aut cum exalîîon kcopt zftm > ds, auiiEa- 
mt ţlag<e i^s , vter tandem fuerit ,magis , qmm ex plano hcc : ^^^ţ»^ 
»^ contineat mânu telum ,fiue iaciat^Jme percutiat ; irfifortior aibufauc • 
dehiliorem vulnerat . Ex his vero > qui cadentes , vulnerantnr ad 
^s , aut in ipjum cs^is, qui ex altiffimo loco- codit , ^ in durifft- 
mum^ ^ ohtufijpmum ; huic periculum efi^ vt os rumpatur ^ ccn* 
tundatuT > ^ intro cedat exfiia natura - Ei ^vero, qtd explano ma- 
gis loco cădit p ^ in molliorem > os minus haec patitnr, aut etiamnon 
patituri^£.Azq},hzc quo ad percuffionisqualitatcm.Quo vero 

EU.Î6. ad fupcruenknîia fymptomata. Magis , inqnk ya^t minus fau^ 
datîp h^cjignajunt • Si imlne ratusfiporem altioreminciderit^ ^ 
caligo offufa fuerit, ^vertiga, ^ fi ceciderit\i pcrmrbatis nimi* 
iiim aiîimâiibus fpirkibus> corumque fluxu ad partes , vel in- 
cerrupto, vel peniciis intercepto . Sic facilius in iyncipite^atq; 
in ipfa futura os I^editur^vbi imbecillius> ac tenmus eft, quâm 
sOib). Hinc pulchra virgo Nercifîlia ab Amica lata manupcr- 

^.aj* cufiain fyncipke/asuiirimisaccidesitibusmGnuaefl^exlib^j* 
Epidemiorum. Demum in Coac.prarDot, idipfum fie cxplo'. 
rari docuic Hipocr. Ex ruptis capitis cjfibuSi diffidlHma cogmtH TraAicacs 
[unt ca , qua circa fiitnras rumpimtur; f id fcilicec re ipfa in Au- ^^ciiS^ 
BOtomo illo didiccrat 5 .epid.> cui fynciput iuxtâ fuiuras lapi» «osnolbui^ 

4e percufliim fuerat;in eaque Iţfîone inueftiganda, â futuris fc 
cum Acgriperniciedeceptum ingenue faffus eft; de qua re 
Ccliuslib.8. cap.4. Sutura iîquidem seque ac fiiîio afpera «ti- 
ftitj eoqj nomine non raro ipecillo cxplorantibus errandi oc» 
cafionem prsebuit .J rumpuntwr autem maximi âgramhis r ^ 
rotundis tetis 5 d" exhisp ^u^ exjuhmrmio affefuntun ^nonen 


Digitized by 


ţÎMoloco. Mil^^^ qnihus ăntUgmm eji ru^^mjmt , 'od 
m^i indicm^opartet . Exhiheto ăâmmducmâMmm^traw^ 
f^^Um^A^^deH caukm f /^^^ 

£îiăm aUtev , de Jh figni^:aţi(mnt frklent : nam ^ c^rmş 4J 
{^jfe difiejjus fi( ^ ^ OS im^Mm _y ^ dolores , fame afflueme^ 
jk^c cmtem ^i4 im^ OH^ilmmadmittîmt • Hi5 videlicet arg^^ 
menns,âli}fque conâmUit^us coniedt^^^ 
uumfiiTum os , autcoatufum fuerit >nifî cutCy &cara^iit 
denudatum; vel fi deiiad^ţu,cenuis tamen vâîde,ac fere imp^- 
ceptibilis fie fiffura atque contuiio * Cognia ergo Cranij, 
{^fione; fiqaidcKamanifefta fit ^atque ampla fedes, minus 
certe obrinetpericuli, nuUaque indigec abrafiouc > perfarar 
tioncuc 3 led coxi^oqueiiâbus & ficcznahus peragendun^ 
de vaiccap, ^^ > ^5 fiocuit idem Hipp, eodem lib* > înqnicns . Qu^cimqî^ 
nu. 35. o]pt fjîi ra contura, cedunt^^fm ipfirum natura» rupUt ^ mtetiam 
âijfeBa y'uald^ miplaytalm smimsţencuip^Jmt ^'vUmâmiram 
ţmAJkerU: Et ^quae ţhmlmsjîjfims :» ^ampliorilus întm rupta 
fimţ t adhuc minus pâncuhja^mt i & ad â^raBionm facilita 
finnţl ^Ttidlum^sxţSihâSp&t^arâ^fportety i^c. Ac iî aaguila 
cslitericfiffioj niiicomîBpemadacoşjitaytadmembranam 
laon peaecrec , abradenda ^ft , dum oihîi^ ipfîus deleamr ve- 
ftigium, quodimmiflum aprameatuiB: indtcabit: idcmquc 
feeieadum eft etiaoiia concufione ^ Qudd fi ad membranam 
yfque perdaeat, tune perforario adminiftranda erit ferrato 
iftodialoi cuius ap« offis portio^quam m^odioîi circulus com- 
|ie&mr, «srimmda^ oînmfque <ducei>daş., tum i^nguis^ 
tam iânies > quse <brâm membranam coinquiîiauerât . Quod 
-vdque quam ocyus, lioc eil» iatfâ triduum pr^fiândumj 
piius qnam putreda aduemaj:;, feuainuefaeas fymptomâca: 
idque ckius aeiiuo tempore , în caîidis litimidifque -corpori- 
feasi t^rdius Hycme> & mfriggidis & fîcciş «atm-is > coatixi* 
gereaffojet., C^averoiadute perfi. 

cieada iît, tx ipfbmctH^oaate îock ci^tis intdUigi po- 
teriuDitbium aucem nonkmextaî: deoccjulmfaifce contu- 
fiomkiş , Se Mxuk dum iojtegî^ ipediamr <uâs i aut aHa 


Digitized by 


pane faSşct fjflÎQ , quâm vbi iausceddit;quod condn<»erc 
ipterdum,teâis€ftHippoc^S^, Ceifiis. & experieiăia; ^^^j^ 
fuadetquexaaoiinfohdopjsEferom cwiiio dai£s interfe<âo «^^<Sfs 
fiituras , in^cominoţiisafe Jâu aer , wânis valde cirozm- «^S.' 
tcrtunJNamvbHoljdumcraniunipercatituijacr^^miDtusIa- «"«iandum. 
titat , fubito, validoque idu commorus , vtrimque in orbem r**'*-"='» *- 
arcaconcacum ckcnm&xmr izd^a&cpie ia f mc ^ vbi aer r»-^-^w^- 
Vj^rq;concurriC»alIidicur,a£<5Be ad extta impctwn &dens,i^^^ 
caluara inflexslem fi:aQgk . Tucc igi wr curn aouquoriim om- 
cmm, vt Hippociacis;,CeIfi, aliorumquc opinio fiierit, atque 
înde in praxi lemper obferuatum fit, ad latentes has vd ccn- 
mhones, velfiffaras , integra ita fuperâite cure, perfeâe 
cognofcendas, iupcrpofiiam cutem qmm ckius effe inciden- 
dam , dilafândum viiînus , fauciumque os in propatulo exi>o- 
ij«idum 1 nihilomiiius aŞantur aonnaJii fc loogo yfu, obîer- 
uafle plures refiitui ex ijs , qui citrâ icaîpcili operam , pardm 
lenientibus, partim ficcâRtibus, curaniur ; quâm quibu&cutis 
iQciditm,a:que Os denuiiacur,di]ata£urq;ijfqae ratio fufea^a- 
rj videtur : Innuus fîquideai calor per te , integra cuie , fdi- 
ejus & fangiijneiîi, &:cplk.<aam feiiem diiiutit/vejpef natu. ^ 
rales meatus, &îares,M^ţuro,A«*es,Oc«Ios acque Eaitmâo- 
ria , propcte , fra^ăgue glutinat o^, qaâm diffc<Sia cute , 
o££qu€ ejc<;iib, medicamenta poffiat ; perfpirar inmque in, 

naijis 13S £âIor per vuînijs,qui medel^ oiiufquc pra-cipuus au- 
thor eit-Patetid m caterorum offium fiadiuris: eteoim maois 
facanuir crara , & perftadta braccim vbi earo Se cutis mte|a ^tS" 
elt,quam vbi os aeteCtum: nudato fiquidem o&, &perim '"^'^ ^« 
rsEce calore,humorempun:«fcereneceifeeâ; cui ni dcL&. * 
mtus ,_ iubiecîas partes viijare , £ intri eaioam deiineantur . 
Hsc, hmiiiaue, habet Vidus Vidius in lib.Hipp. de vulu:ap 
înnixus te&roonioIacob:Perufîni,chirurgi expertiffimi,v£re! 
fextC|raî i.Veidsi eaefiCeiebri,mebra- 
naruuiq; jpfius conditio,v£ jâniem aequaquam diii ferre apta 
fiţ,donec ab in£ ato calido iJla peoi tus difcuciatur,cum id non 
mii pwribus dieous praftarc valeat : N<que certum cil , num 
i^am per naturales oieatus imiSuxz fk natura; qudd iî deficc. 
m , cercus eifecikucij intcritus ; Eînc tutiuscenfendum eft 



Digitized by 



Prifcofum infîftere velligiis> & quâmocyus , vt ăăntn fuît y 
m propofîtis cafibus ad fcăion^m deucnire î in qua Mque 
magnus excitatur dolor^îîequemulcum laboris cft in reunien- 
do : Velamends âutem^atque cataplafmatibiJS fadsprouidcri 
fas eft , ne caîor ianauis adeo expiret ^ 

^ ^.^* . Febrîcitantî caput ne purgato , 7tnc furiofu^fiat: 
caputnoiî^ caliaciunt enim caput pharmaca purgatiua; oc lanc 
purga iun ^^ caliditatem febrîlem acccdciis ca^ quae in medP 
camentocft, mfaniamfacit-, 

) Lurifariâm mceîîigi poteiS praectpmm hoc > ac pro 
ind^ fenfus ^iicieadus» ^i verităţi magis confonet, fer- 
uatifque Hippocratis principijSjSuîîam p^acur dilficuîtacems 
Namiî âbfoluce , proutionat^ intelligatur, quod fciliceceij 
Capntpur- ^^ febricitar, Caput nequaquam p uigandum fit; iîue valido^ 
^ dm^ ^^ iiue km mcdkamcnto naribus immi^ id mteîligas , (p^rga- 
cmcmf ^ T^^ enim caput m dodrina HippocratK,idem volunt eflc non- 
fîuUi , quod medkam^Gris naribus appiickis Hlud deplcr^ 
etque euacuare} &pjiîîm€ idĂlfum comperieSsnifî m ardea- 
tium febrium ^nere id tammmodo v-ezum cfle affirm^mus t 
Mulţi fiquidem febricitaîit > Îoîî^s praîfcrtim kndiquc febri» 
bus^ cuiufmodi â cralfioripituita excitări foleat^ quibus tra« 
&,u temporis caput adeo craflîs> ac pituitofis vaporibus reple* 
tur> vt non modo illudpurgare iiceat , fed pemeccflarittm id 
fit^ cdam validis , calidifq; medicamentis > EUeboro ^ Pyrc- 
ro> Elaterio, cseteriiqj huiufcemodi , pro peccafîtis materiei 
diuerhtate. Siveroint^rpretemur^ vtiionnuJlis placuit, ie- 
bricitanticaput^ hoccft>escapite, aut propter caput, non 
efle purgans medicamentum exhâbeiîdum ; neque id prorfiis 
verutn erit : quâm muici cdim fimt ^ qui a pcrennicapitis di- 
ftillarione per vcnas dectiîrentCi putr^icente^que , febricicant^ 
qux aâedio , cum rcpleti Ccrebri foboles fit^ quis ambigat^ 
îaumomiîi^te caput tune euacîiare iiceat, catharticis pras* 
fcrtim^ vt morbi huius priaceps caufaatqueorigo'abfcindaf 
tur?Qua^roptcrHippocratem de ijs hic locutum arbitra- 
laaur , qmbus caputiatense , quacunqu^ ex^aufa ^calefadtum 

Digitized by 


^ • acproinde capuţquodammodofebridtat: accepta ii- 
niilitudi^? 4 toto coijKpre ^ qup4 ichmiuxcSmm.yCîim 
^rşţcoîaturalkcr iccaliicrk . <2oD{ueuit fîqui^m magnus 
Jîic Auţhor partcm quamuis itf afieâam , febricitamem 
appcUare ; vtcpnihti. ex libro ^e Fa(5t V^ v^^ :Febn$ - 

ttt-ts. j^dcus'^ pulfam atque febgckitans ^^^Ite ; & de tiuL^^^ 

xnorb. Mul. Si vterrextra naturam prop'e^i fiierint , fehnlis 
mlorhciheî pţimâm^t j^ îmum v^nţxemi^^c^^ is^oăns hic 
dicendi ;)oiius eft etiam in doârina Galeni , qui 2, ad Gîauc*, 
xap* irirxfiammaţionţn) febrem ni^mbri appellat . Dicit itaq; 
,eum > cui^aput febricitat ^ hoc^ft , kfîgaker calcfaCiuoi elî: , 
non ciTe purgandum^ neqiieaafîpurgîjs ^negue ah^ 
cisiBe4icamerati$5 obrationem> quamiatescu liquidoex- 
^Xt'^ittftirlMte^^ iiâquitlib. de hu* 

^îim. *. ^^^^ ^ — f^* 4^. rnprb^ Qu^cun£[ue medicamentapurgatoriafiinti 

^u* 51. ăuţrfîiţ^eij^ki autiţifâme> aut ^iam 'vtmfn^ucfr^ant y 

fiLciwnt i Pmnîjzvalde vrunt ; ^fortia^uidemex ipjts ^fiţm^tem 

ali^mm teneram corporis amtigmnt > ^am^^icukerant : miticra q^J^^ 

veri turhuîentum corţorismotumfadunt-. Augent itaque excra- xam ixid^-^ 

ueuni cdj©rem p^rgantiâj^ indeqt^^^^ 

fpirkibus, in fiirorem atque deliria Aegrotances. adigimtur -^ Capite 

^a.54, Vndelibro etiamacut.^ purgationeminterdicit ijs, quibus ^^-^^^ *^^, 
Gaput dolet ab exercitatiohibiîs ^ aut ciîr/îtHis ;, aur psrofe- efîpij^i^\ 
âioBibtiS y aut venationibus^ aut cx a3io qualibet inteiupc- 
ftiuelabore, cum talia Caput plurimvim calcfacere canfuc- 
uerint . Quod vtique prşsccptum quâm inuiolabiîker ob- 
feruauerk Hippocratcs iia naorborum xiiirauonibus > pater 
ex 2^ de morb. , vbi varips Capkis morbos deiciibens, 
in proppfito afFe(5iu purgantibus pharmaciş mmquam ^ti 
aulus eft ; priufquam calor in capite maiori ex parce ex- c 

tinCtus eflec : inquit et^nişa . ^Rimr ^ dohr , ^fehisper ca-- .Ri^or ^fc, 
put maxime aâ Aurem.^ if adtefnpQra^ ^ăâfyncipiî^ h Ocţt^ ^^i^c^\ 
lorum rencnes M&t^ ^ (tipercilia ipQ inatmhere videntur^ & ^^^ ^tiâî- 
gramtascapîitdetînet, & jtq7iîstpjJ0nmo2ienty m^nget^^umm-- &potifiima 
turn ac facile minoit ^ ^ derUes P:>rpent , ^Jiupor.ipfis tenet ^ ve^ ^^^ţ^ ^ ^- 
n^attolhmtur if puljant in capite, if nonpoţefi qmâttis ejje 5 fid t^hctin ci. 
anxim efl:,acdefpitpr^dokre^HîiicJi^dm 


Digitized by 


itureseeu^t, a^aţroflvit Juhpmttenta t &faniaeHadif: jht 


fiiwpieuerit ,Aut inehriatutfiuntt aut mfile ISorarit . Cum fie 

bahten't , priimm fimgmnem â^fiapîteiimttito , tmdeamqHf tiU 

vifimfkerit; itpop;ţh^imsmjJfwnemrdfi 

riaipfiadhibeto- &fi'ahus Kcmjuheat,i)^fttmper dyŞeremim-. 

m'ttito;mţatu-veropHjhi^^iimfi'i^Mm data, ifaquam in" 

fitper hihendam ; Si -oero aâr^rigerM&riAnmvemittat itranfinu" 

tationefaBayVtre'otJtor, ifcalefacm . Fofi^ucmautemqmme- 

ritMor^ciksvtaturahiiţmfitlemtiluSi acntimpleatur : Vhi-oero 

-oigejhmm âiemattigent , feâaîo dolere, fomento capiti ipfmi aâU- 

hto ad naref medicameatumaţfcmto,i^inUrpcfito: tridm , meM- 

famentumdeorfimpurgans aătihet^^. Haec Hippocrates ; vbi 

qtjâm caute a purganri&as qaibofquc abftineat, quoufque 

capiit ninao c^orc dednetur, facile v«ierc eft . Neque quis 

ohi)ciacFuQon€miaSyro phra:niticum 7. cpitt. cui, erfî ma- 

van. s S"?^'^'"!'*'^^"*^^»'^»««*Tapfmtamencxybitaeft,&be^^^ 

eua&i Exempîum eaim rarutn^fl , &: nonimitandum, vtdo- 

XXI ''-'' 

Atwbâi, Ex qifacunqae cawlâ male afHigente qnis atram 
SSr ^^ ^^^em euomucrit, moritur , qui vuinus habet . 

< Apms ftaduras , vuîţîeraqtie confîderanda propofuit 
V-/Jupenus Hippocrates; mox quxdam fubnexuit, quar 
vuiaemm ^d cadcm ,. vbi magaa fîat ^ quameunque înfcderint partem , 

ba 1U3, qus^in Gt^co textu apponuntur. ^«.i^/j^» t^«'^^7c: ; 
hoccft.lcthaîia vulnera r Huie precedenţi cohtextu de fe, 
bncitante capice , ideft , intense calefeâo , verba habuit : 
tale emma magnis etiam vuiaeribus caput reddiratlonabi- 
le eitî um altcrmni proponitlymptoma, quod & vt cau6, 
& '''^%""?^ «^«"ie calamiîofum exiftit j atr^ nimiram bi- 
iis, toc elt , pcximi humoris, acerrimique atque erodcn- 
tis vommo :: nam etfi in quouis morbo d«tcftandus fit 


Digitized by 


îikîiiimar i s^quiad argri pcmîci^a fere^mper ^sparesu: > 
irtdccetuţaplu iilo . (Ik^usmm^mcrhismc^^mîihis^jtatra ^^^^ ^ 
mii^ fmi0n mt Âforsim. pi^>Smf ^kdmle ; fOtiA aiihilo^ Aţxabiiis ad 
tyminus vtiîi^r inijs quai^oque app^^e , &iudi care ; aut ^^ '^' 
fâlt^maim^i.eiiacuatiGnc1b:uâri«groţ^it€S5 vt cootingic ^^acieâa^ 
HerophonUjEpkratisvxori, ilîiqqe^qui iii hortoDcaicis Hcroph.îib, 
4ecumbcb2^;lemp£tque'fer€ idfiet, quotks poftcocâiosis ^'^/^"^^'^ 
figm^ţtpmicnttfjquzmms de atrabSc, quse taîis exquifîce Efictvx-Hb. 
&^iitmu|iiamfeid vidi^i^ftam T^rvli^ţ. 

cimn pexiums liumot yk vmqnam cociioscm recipir, aut tc^ ^^-^s^a^s-s « 
gkur â natura : quaprcpter , qui ad {zkitcm quandoq; excrc- 
ms referair,ai:cîion faiffe proprie atram bikm dicendutn eft^ 
autia tam^ ^cxigua qiiantkate ^ ^t umniiienteni potius praai^ 
tatem , jquam ^pra^kiitem fignificauerk * J At in yuînexibiis j^^^^ . 
pextmim£b^crfig0mndi,xumquo^^^^^^^ fe- busanâW 

mxm âut^iiCer^feiiprsei^iîB tromatibus. î^otaefiCaaca^^^^ 
Prasnotio ♦ j4^î>^^^|sfe^:;^6^ • V,o* 

inimsiiamq} fuperuerikvidnerîbus,şofî quihttfcimqu^^^^ kd 
îjs > quse magtiî^ , profundaqtxe fiiGî ; m quîycuoqiie infede- 
îmt paia:e ; &d pecuUarii^r >, âi^ftş^eiKÎtJŞ in ijs ^ qua? capiş 
.mfliguiuurjrm^qpifcoiş npn 43ipd^ia;OT^Iffli^tOt> aut njo^ 
vigocei^um îdddGceţ^ace^^ 

flamaîati0^ Febrîs ^ Dolpr, Vigai^e , i quijbus omniÎMiSa ^y^^^^ 
adaudo pnetematurgUter c?Jore^ jid^me^Wj^q^eo^ 
tur hprnores^^iifixrim^qiiiquîuiu^ 

«Ki^^mr chokra:> mi£ :^ruis projcedoaţe yftkne > jtţrajucritis. 
bilis fit y abiiimpţa tenui acquckiiprii^paîîe; vnde ipîen^ 
rcmanigredincm , atque erodendi vim fnaximam iibiad- 

kikk> humorumqueomniumi?ua4vJ^^ 

nas, Hepar, & Melir^um in IateIîi]^a^ţ Vcntncaluin refo. 

fă] aut â Căpiţe per Oefophagii adVentricuIu delaca^vomitu, 

aut funefliflimas deie6liones commouet . ifinc î, demorb* i.<femad>. 

&deAffe6L:,Bile acBituitda vidneribusincalcfcerea{îeriîit.j^'^^^^ ^ 

nan modo > inqtiam> in augmento > aut vigpte , vt m magais 

cset^rarum partium milncribus , yomitus aduenitcapicistro^ 

matibus; venim etiam ab ipfomet initio^ob peculiarem mu- . 

tuumq; conf<mium,^ui incerduas iias^artesiaceru^c>yt 

^ Q^ z tex,5* 

Digitized by 


tex, 5, Jib* î. explicuimus . Hinc protulitin GoacisvQ^fî^ 

^î^ / Dixit , vrpitarimum ; nam non in quolib^^ 

aKamm partium vulnere aduenit vomitu^tîOB emm in leuio-i 
re y nifi maxima fit propeaiio ad vomend^m in ipfi> vE^ro- ' 
_ taiice;fedinm3gua & pto&ndiori faocfi^perue^itfympt<> 

^Jsf^^^ î^^-2€proindeitiaphorifmiscumdixit.Q^2fe^r^r^^r^^ 

feBîimfiiit.his mceffe efifelrem.i; lilis vomit%maccedşre .- Qus 
^ ^ fcmeada iiabemr eti^n lib. i •de morb. , Hippocrates vfus au. z. 

quIarS. lS ^*^ ^^^^^ h^KO'^ii, quam magnam, proikidamqtîe diffe^ 
cer. ^ ^loa^m fignifîeare , tcftamr GaL corn. in aph. 1 8. feâ. 6. ^ 
Se latius explicat Foef. ia Oecon. Quod (olic^ diffeiâioni. 
bus his magnis^ atguie profundis , necclTarid adueniat vomi* 
uis ; alijs Fero kuioribus , aoa-foiilicer ae^^ 
ximus , vhi mzgm adik propeaiîo in ipfo ^Egrot^te. Funci- 
iliffirmîs icaque eft atî:sE: bilis vomitus ia yuinerâds=, â <^a^^s 

vonjîtasm ^"^^^^^^5^^^^%^^F<^^^^i^>^««^^a,Ikdoîor;: 
vuineraru ^^^^ iftfiamm^îo & felmş ; ffiic vigili^ : mm vt vomitus efl: ^ 
S^& ^gniim Icmper, pi^îrfundiimq; vutou^ %|iificaE; vtautem 
vîcaafa, p^'aui eft hui us hui2K>ris;-^as2înumfemperexceflbm^^^^^ 

t^rnaturalibus cauiîs cfenorat ; atque itâ peximum feiiiper 

iîgaum cft . Neque vt cauia minus cfî funeftus hic vomitus - 

nam minguam feuiorieddjcur mortms ex iiiaiufoiodi excre! 

tione^ cum vuhuîs 00» p^d^at âb atra bile , cuius. percni5i& 

eftgenerâtioinprauisTOlaeribus; &partes om^^^ 

ter kbitarvfif perkb prsefercim vemric^^^^ 

tcr îâîsciţiai^^ calamitose afficit> atque lâbefaâat. 

XXII* -..::.• . .^ , 

«ota^^"*" " -^^ 'î^i âb cuaaiatiane cfetinetur,& debilis efl ; & 
d^ep^â^ tenmsexiftens, derepente ficcus futfîdit , moritui, 

fi fiatur. Ie» _^_^ . « 

- ' J--f ^^cpantcrfententjajvelut ?Iîa fuperiQr,ad Saucio- 
X-/"'«» pragnofim fpectat: ac qucmadmodumiailJa de 
vomitu ^^ebacur; itâ & mht>c de deieâioiîibus; cura vcerq; 
biciympromaibeadembile, proutvemrkulmn,autime. 
ttma inleitaacnt,cxcitetur. Siingenti igitur vulnere afEi- 
C.u&,pr«oratain habeat aluum , profu&roque, ob plurimam ; ^ 
" - .: bile'm 

Digitized by 



ridne j febre jvigiîijique, vt liîpîidiâ^ 
£c Tacuatio fasc fiâatur ; mprimr ^Eger^fi debiMs, a^ue a^- 
«mâtus cxtitem: non potcft satBqiie rep&ma tec lupprellio 
a^vukcrekm mitefeente prGU€rin^>^um id non cîfi paul^ 
tiîîifei pi^tjetgo fîgBum crit bifeî^iliâ^yel ia intefBnis, aiâ: 
ifî^veni^4€£În€ri^€Î H<>bilior^^p^î^ ||arţemimpemin arrqîC- 
xtif rionde^ae4y{&nteri£4 âî^^^ 

toiâsafejaioaes immînerc : quicquid vero exhiscoiitiDge- 
riti fauci^s Aegcr imbeeiBis iamjâtque cxcenuams> ferre ne- ^^^ ^^^ 
quaquam patis erit : cx quo mors iure prsdicenda . Quad fî^ ^^^^^^ 
Vircs conftaremilocumiorEâfse-habeict CoacaiUa. ^i^iati^- v?i«aSc5. 

'&(:wfoy lAcrymofus iăhfcefusdeuenit .C^terumiep^rgaîio -ventries 
deorsim flurihusvkmlmconferUAăâitVÂţ^^ ylcer^ 

^ m vulnenhus4u^ fmî in Caţitey&mVmtre,^ in ArncuUs^^ 
if^m^mhmCQrruptionispencultm^^ - 

2XXII-* - Cumâcaîidîtate^ktentovkufcu^^^ 

bili exiftenti circum circa liuida moritnr : Cum « 
îridrbo <3nopa;ai^^ > âet>ilî iam exiftenti ^tlim- 


GOniunximus fîm^ duas hasfentemîas , qnodin vntmî^ 
fere r€€idant , & vtriu%eadem fit ratîo.VIcufcuîa igi- ^^I^^q 
cur ^ fiue febricitanti , fiue alk> quofâis morbo affeâo, erispc- tia imcm€i» 
rifîtflatentemfcmperca€o&4iiam,fc^up c^^^ 

îia&s fcilicet ,.aut atrabilarios , oftendunt; e quibus maligni: g^î^^^^* 
quidam Ichores^, acres > atqiîe erodentes, ad^utcm expreiîî, yi^j^^ co* 
cam exedum, cxukerantquc . Vlccram autem color humo- îor peccas- 
mimpariter fpecieni primo atteftamr, vt doc^it Calenus 4^00^^* 
in pto^ofim iilam .* Vlois fitie pr^fiârit yfim in morho fiat > 
edifice cmueniP ifinafn^uemontPtrus lom&^ ăntefmfrtemHîd^l'^^^^^^ 
âum^ficgwîmt 9 aut ţalMum S ficcum .Vbi G^lenas , N«i- - 

lusyinc^t, color in eo femper erit yfidţra Mierfnaiehîîmonm ^^l^^^ 
in-corporcs ^prommRiraUfîonis y'omiâhit : (i mitn hiliofus ^u- ţioatnut'v^ 
?mr epcHţeretfCrQceHS tntcohrijt nignhltmHS^atitlmtdtiSi au 


Digitized by 


tem lib.5.e?id IST r ; ^ *^r^^*^^^P«*^ ^^^^^^ '•"' 
cungue illam diffioarevaW , - J * ^'^^ agcoHa^u*,. 


Digitized by 


tei jMttta^fcentis <aîora^ 

tem fecim ducit > ^Cfmm «aadem^exficcatum reUnquk ţ 

^tie mernum fit frigus , <^c>^ iie^foi^ cafikm exdudat ; 

fiuenatiui cak>ris> Ipirimfij^ i^^rceptia , auc paupertas ; 

ka^t ad mith^ pa^^exteîîdi âwn^ 

tăKqae îii^^w fbbcuranei ;te quo ealeisce^ 

r^rij» ÎUGîdi^^o^^^^cdctet^^rt!^ den&ntur 

âtque x^actf atamr acqiiimai: : i^g^^^it^q^iem^ ^îodmjidfer^ 

iâum hmefl , Higuit îĂrift. pcbi^^i^ fec^^rj^ Q^»24^J^i^«t 

rere apt^ fun t ; taliterqu^ affcâi hum^res , iî fub cute exti- 
ecriot, tali infieîentcoîore . Quîb on^nia ie iiuore pariter di- xiuonsrauQ 
dafunţ,cumhi nonalicerditFerant, quâm fecundam magis 
^ &^miaîfe^ 3x tos omiri&iîs paî^attc^ isac&e ia pute colores ^^^^ 
pmn4i&ţ^.feadtifti0Ăerii^;^exlkcaii^ in iubiedis «l^ao^, 
Eiimţvryjus c^l^Biiţrc ; <%uadâTi6 aiîtem , Se per accidens , : 
prout alia aut alia figaaadaexa haţuerit, A^arias etiam denun- 
cîare eaufas y a quibuş caliş vftio jâjSa cft : quapropter letKa* 
liffimum quandoque fignum efl^^^ vtdum nadui calarisex* 
tinclioneminmorbisacutisoftendit ^ quandoque diincilem 
tiaiEţma^^îajcia'atkiţtraal fignifeare i^ vt in fdmko patfiTi^ 
viccx^V'^€>^iGfa^aîiuni HK^um erqmpat ^ vt^idimus loc^ş 
dtat^de^ricosi^ii^iuio^ FtJikm ia 

mi:ş/fe>isaet«^i$vceiebr2^iam coâione> moibifici > adiîftiqae 
afebre humoresad extimas 5 atque ignobiles critice depellun* 
ti^panes:, quod ex colierantia confcrenîiaque dignoicerc 
prog. licet/ vtdocemr inprogaoii ilki 5r^ri , ifpedesmmmm^ * 
^™-^ ^ejhmymnusţmdd^Ş^ aliapgna 

grat^ y caftm^ . Sedcur minQremţJ^nickm ininatur uigredo, Nigrcdocur 
quâxniiuor,cuîpiiiainc€ttfiorfe, &^xpotei^ 
deat > An quialiuor io propOifiix>cCalîi paucamiîiQrbdfici iîu*,^^^* 
moqris quanti^em ^o depiOaip^^bc&ndit ,.iac p^^ 
f]^ţ^matice:nullunicmm^ quodpaucuin^.e^^ 
cdtioîm . Şccds acciderci ftacaloris^î^âioacpea^ret ii* 


Digitized by 


A^%2 HiF^omMJ^ LOC. w som. 

dum in pr^4agîcadoi Himiapp^^c veritas propQiîtseprpgno^ 
fistadhocetcaim-, vt Jkmitiavlaifculafatdemdkm^^ 
^dfuturam demiacknt , debenr vel feb^ 
actîto raorbo affcdafiip^i3ieiur 

MhiUs efle Acg^ţris fecultsî:^ prjefertim viodi^ quaş cxpulfu^ 

ceipiratiGH^qua pr^c^ue^ cognofcicur y vţ eaiorientem. in^^ 

Yiiâkcn caîorem eeri;6 coniectaripoffimus • Sentend^ imiq 

corport'lS ^a^dabfimiliseft. coacă iU3.px^aotio.QtdhmnfiImsafym^^^ 

perueai^ces; pjfj'fe/^ /"ij^o corpore fiihoriunţMry martiferum illudefi, niGpHmlenîii 

ai?jccjjîi y qui mcpotijjtmum ad âht&s erumpit^periculQ defmgatur^ 

XXIIÎI P?^ quîs â medkamenti polii fitper^grotarity • 

Hyţ'ercatiur ^i^^i'^^^^^c, &:fiiperne2b ipfa feceiTerit, vliiiiiii for- 

fîi caatio . beat , prinuim qiiidcm diltitimi, deinde mer^cum 

frequenter > & fanabîtnr , Medicamentum- atitem' 

aieque euacuatiuum, nequevomitorimn llim^^^ - 

I Occmur inpr^fcmitcxrti ijs fiiccmrere^qai-mmiapmr^ 
_ — gauoae ab accepto piiacrnaco infeftanoar , tantoquc/ 
impcm agicaa iumM&^ir^^ajdiat^flina quandoque fenui< 
tur , vr eorum pars ad ventriculum etîam lefluat^ copiafaquc 
iimul ddcâio & vomitus cojEidtemr,veluc in CJiofcra nuncu- 
Hypezcathar P^ca . Hanc hypcrcaîharfîm Gra^ciyC^teri immadicam^ acq; 
^vndenau e&amâtâm^€uac^ţk>nemapp€|Jm. Afe^ 
GaLUb.j.dc 9'^<^ti^ exlîibitum câi^mcHm , autquantiîat^^ aiit deleteria 
1^ med. w vique adeai^alidum^d^ Şe^au. 

uam eorum acultacen\ imtanda, mordicando , affidiieque 
VK^T^^ ^^^^^''" qaapropter^ vt docuic etiam Hippoc, 
iib.4e nat* hum. familiaiem primo Jîttmorcmpenijcus educat^ cjt. j^^ 
TOQx c^terlf^iîaniriiribcci, teniîiorespriu^ 
res, omnnm^uepoftremus^ in%remo pene fpirka, ipfe 
eiîacuamr^guia, qui , namra? thefkiru? cum ilc,diuciffime 
d^memr>i.prius^a«a educiiocipiat^ Qnodviique ceniea- 


Digitized by 


mn cum fu^pmfhzrmz^^ v. h -T' 

d^m^xtiîi<am^^cabuîtl Mis^eigo toinaak ^-r ^ 

piirgatîcme yexatk y i^ob^bSe €ft^xa:ein<M^m k^geratio^ 

B€s^ ^didos^fudores^^^niuilfiones^, £n^ltu5 > viriiim diilb- 

hition^^ y & ^îCopem^OieBire; opţimumfroiiKie^ pr^ck 

puumquc rem^knn cŞiulk Hîppi^ 

ma diktum r^einde ţnerac^m^^,^^^^^ ^^ *^^«^ 

^alem caîorem fou^e , âiffipatos i^^ar^ef^^im^ apram eâ ;: 
craffiat^ vero^ venprieuium, inteflina-j v^aaimquc orificia 
adftrin^endo roborare ; a<}uofa4€m^mfubfteîitia , cum pr^* 
fertim ^kitum^y p&armaci csâiâmxem ^ mcrcdinemc^e aî>.: 
temp^zw^ cp^ ■ qiii^î» cs^tîiiS^^ ^n^na»^ propinac j. xjuoi 
magîsfoueat pexâ^^^iTK^iieţ)^ &icitst^^ 

iîe5^'CofAc^& offe^ poms , abîuendoc^e* 

cmcaati<Ji^m akkugeâî. Mos^c pr^i;ereâ4ie me^amaiuim, 
ieu î^omMuttm ^"fet^^eâ:qrium propi^iaaits ; pofiet cmat 
4ecipi^^^qâ<^^omiit^&pe vomitui^ <^cd &n^ 

T>ifsec€pctHn-^quind<>advfîKn^euox:^^ ^iâs-dboebi-f 

iiîus^: nwfîck:^i^ j^moxkmi^Eifec^^y &eqiieaîer pro: 

ftip^rpwgarion^ fedânda^tioă mo4pqs ^quse coilapfesvireăţ 
expedite reparare apta fu^t, vtcxculaitis vjurijs & pomleaiis^ 
fcd i)S€tma ^^qaeddeteriam medi<:a.meîid frângere, hu-f 
mores incraflare ,lbrtmumqi^3:o«u:%î^^enc*^ VaSd:i{b^ 

rifqu&dQtheriacafcrupulum vtmm, Thiimy ifi^$^u^fimis ^ , ;; 
XXV Mis vbi ipon te e^perittr.aiit i^^«ie;aut liperne;, chokta dUi 
difEciliiis fedatur : quae enim Iponte procedk , pra^-tî^lSî^"" 
violeiitia c prgpm S«3| ţaedî-^ 

cgfneţp Jjiiaţ > iionji gen^^ 

[ Ypercatharfi , deişo^ju^do-c^^bj^ 
parat : nam &c bsec immodica cft ventris perturbatîo» 

Rr pa: 


Digitized by 


314 Hiw^aR^flPK tis. m^imt^cu inbom, 

ttîlf''^*' «^ere atquc incaute.eîAibiţo; J&mHiarcm nM hu. 

morem proJeâantc ; ha^c v^ro {]^m^ cxdmntj hoc eft , 

nulla extrinfeca arte , fed /ympEomature , yj morbid, feu 
lîîorbifici tuaiprii,,. qqanţiiate >.ia;m.âcrimiQokyim cor- 
pori infcreiiris 3 irri^niiique : exquo natura vadiiiMuai 
id expciicndum , kofiili qiîodam impetu , yalidiique co- 
natibus infurgit . In Jhac humores non foîum mulcj, fed 
maligni vt plurimiîmy atquc acerrimi; Iu illa id miniaie ne- 
ccffceft; H^cdemumâcontarictate.^tquc inimiciţia pro- 
venit natuv^ cum humore^ quiexpeliimr , ac proinde fum- 
mo impetu :> acferQ impiacabuli ; iîla a familiaritate &.cpgDar 
tioae,qu3? imerpharmacHm;&:humatem incerccdit , iaquo- 
rum fuhilaBtia lîmilirudoquasîdam lăutar, ideoqueplacidioxî; 
Hinc eft quod illâ iît fedari Ădlius > qud foenignîorîieft. mo- 
ms â famiHaritâtc ptonenieris , quam quiab hoŞilitate • Huc; 
accedit, quod pharmacumycumiu Vcmuciâdorpeoxiţ^^ 
parcibus fit , vnâ cum humore agimo .^isi^erpitur^ avivâl^o* 
peru, ^^al^xkerijs 3 & narcoticii de 6ciHcarrigi*âtqu^âţte 
perariăseft, cum e comrlJtikftmMim:>j^^pcîYmd^şî^ 
rumque diâufus^ non priu$::^finei; fuaacrimtiiiia* pra^aq; 
qualxcite irri^re , quâmp^im^ euâcttat^3^^ 
terim vires omne$ eyerciţ^ pmeiq; pxsttereundo labefacîa^ 
ki vt immam cruciata -^gţym. pi4u§. i medio toUi > quâm 
,iliâîncomî^icicomDgât^.M^£U^^^ ^ , 

... Bmyhi{ixzfponttciîi0 

^ _ ^ ■ :*- / c^arte^McdicjqimdiH 

ftria; cunc di^cj^ius i^r^erfi^ut^ ilia emcuatio Maturj^ ■ 

atquc coinp«:;^Lt^: ,^atm , , .^ X ^ 

C^x rponce prbceditpras vÎQÎentia ^ 

impeliitiîr.ab expi^ffiua videlicet/acuîcatc^quaî ob vim cor- 
pori merdendo , ar^ue irricando iîiatan> ab acerrim*-:^ bile, ad 
infeftum adco humorem propelfc'fidţim ftirore vere hoftifi - 
infurgit >fum'LmfqUe;<;ogatibiise^^* / 


Digitized by 


Si vero a medicameaţa tluaţ . ^m^^atiritat^ anEinna- 

hoc eftjob cognat^ae«i,affimcatetîiq; 
i A cognatione . ^^^^ f^^^^i i^^i^^px pharmacum > & 

iHtmerbbfubflMti^fîmilkudinem, - : 

^ -: , Nonvicogimr, am rialentk âdigitur^, 

Non violatur .^^^^ ^ expellicur r id cnim imporrac ^at- 
fîuum t^rbiimB/^^ic^yfedanuccpotius alîk^^^ 
tur: placidiorproptereacrkhicmotus, minoriquen^g<>aa 
compefcibiiis. Haudmultum huicfententi^ablîmilis vide- ^^^^^^ 
tuf aphorifîTms iile ^Excrementa dui nigrafanguini atropmilta y ^' 
fponte eîinrtiăyfmecumfelre.fiuedtraf^^^ ^qiia^ cf^lâSl 

n^mLf^făieselp^Miif^\f^ : âmeMc^mmîo mim falia ext^ âtn'^^a! 
^^f;2^.^^'^;f;t^^^-^iw^^^ ippmimfluresfmrîntcclores. ÎSiâm quâmâaa* 
ouihumoresfymptomaric^ expelîuncui? a natură, aciteleni ^^^ . : 
habefîî pr auiDacem , qua de fa^^o infeftaîit-y at^^c ofteiidiîîîc ; 
Ât qui £iî2cuamur â medicameto^prauas vifcerum difpGfitio- 
n^ 4eiiuBciafî^%iî^sa€n iiondum ommmodam maMgmca^ 
^m2^<^i&eruatrq«at^uis proxime 4i%>fîi:i fint, atc<:^rt& 
br eui ac<juirerent > .nifî â cadiartico pr^cuaciiareiuur* - 

XXVI. CumiufceperÎ5YÎnolum>&?^ 
ne leiato : vomitus enim euactiaîKm 
l[us autemv omitu-s poftea fedabitur , Si yero defaiiis 
fuerit , quii^c patitur,foiUBi£cummedkameatiim- 
â vomitu pr^bebis . ^ ^ .:,::: : / li : ^ 

*" ^ îaum-p^2?cst€es>qu^ turn Anim^tîieieorp^Mri'paîHîy -^^ 


« malis :j fi ehjs pkrîqtaâîîv deceat, imiriirtiiCy mcerqtJse 
non minimum certe îJludeft , quod tib. de fiac- facun<te ad-- 
mbdum' reeeBtet-^ ; Qudd Temulentisfer ehrietatem, mSîor^ 
pmtefangmne .fă-cMîtmmimm , fy in Mmafrudentia;fimtq; pSium' 
pf^epîtiummăimim^Mo^ ^^f "^^ 

k^Tî^^ : Eft fiqyide^b^ietas^oîimâ;^ 

Dialog, ^^^cHM^y^Qm^^ 

Rr 2 nac 

Digitized by 


.^x6 mFFocRATis m/m.mmc.m 

Bbtiem eft ^'^•^iŞ4il?*'i4'^?p-2?.;IucuIenter pro moţe loeutus foicPr^e 
voiunaaiia caeţeţişa iaquaaî, maliş j Cholerîcos- etiara pla-aniquc exci- 
«&wi- tac a&aiis , vtpatet C3£ Jih. de afe<a. > vhi prafotim â vcm- «a»»»' 
vinumcho, ;ft^e caKdius.KH^iiufque Yimmred^ţum eft : nam non mo- 
J'r41-~ ^o/aiîg"^i^-eiH-afl"an<lp ,: jn acerriinam bHem vertit,.fed prauis 
ctus. "^'^^> «^^tîiqueedulijş.c«)inmixţuni,pirigmbasj,3€ribus:, 
faeikqî; carruptilibuŞ;:iVeMrkulum plus quamracis eft;^ one- 
jac,Vâpoakfiquedjftencli£,^, vexat; vcdoemEHip.'y. epid. 
'l^'''^'^' "^'î"* «^^^expcrras eft Biâş iile. pugil, lib. j. e-orumdem. 
.iuj^7. ^ quis ergoE€m«]eHtia vexatoseodem curaret pa6io , atq; 
;. ^^)'Ponte€xcitata,crueiaBEUEi'qmbasvomkus ornai arce 
,1 £4iedaiwi»s;fiqia]jquidiipxijhumorkredundar^dm 
: :. . r .. : P^"^^ <»i.«a'iy0i*D* ftWacIwH nlmis Iaceffeado,m SyDGo- 
■- ^ I^^ W^'^^r^.omftcq- vitaJerob^^^ 

ipqup pra^aucadam, 'peeiiJjâre nuQc iradic pracep 
vîr^îentorâ ^^WCKkiitoţUHij^Qiiutu, qf^i eum â Ventric^iIirepIeâoBe pro- 

opporţuaiuş , m^gjfqu^ przfenţaneum reperias^ remedium 
ipfomgţ .y.oiiw to,-.<3u^ :Y«KŢktUHs^imme'diate âb ^ 
^€;^^uxKap, , Qjiâi© Pi>:;:e^i in ţaîi cafu-non modo-floa fe-' 
daadMs^ verum «Si^iî):,,; &ppus;videafur , ^ţornouendus eft , 
. ^^^vaI2auovoInjtprioexh:-bitp,esAquatepente>.%dre^^^^ 

.-:;;; aut MuîiaT^amvchabemr m. ^. ătî)i^t:-/ay ehrieta^ nu.^ ' 
... •osfnendwn efî . A vomiţu ad aîţernm temufentoram -prxei- 
puumremedium deindeaecedendumî ad fomnamvideti,- 
f^a^S ""!!; °™ ^^îi<^i«x^p£2i^ia^ tota -vinalcBtomm^ curaţip 
vomimfioi ^«fiatur^i debnis itaquc fuerirAeger p.oft muhum vomitum,- 
|n?«oco;.fi lomnp reereandus erit;, âquo, fi quid.reiiquum fîtin Ven-' 
iriculp, autincşk^itc, adquodyiaivappresvbertimfenjn- 
tur, diumamq;.m^ţiş arcem €uerEunt,coquitur, dioeriturq- 
quapropter tumqMieteaJJjcicndus eft >îum ieuiori alîquo na- 
cotico, vt potc coni'erua viplarura^admixta edam fi opus fir, 
... :imonn ppruMn<;uJa,.vt fciupulp vDp. Prgclare interim apud 
■; : AE>ienie.ofesia(aumeft,qudd,yi refec Athen^usDeipnofoph. 
Jit>,a., cum eorumHexAjBphidyoâBaccho didiciffet vini 
îeo)|>.erşadi rwoncia, primUmque diluifîec, acidcirco , qui - 

■'■■ - ■' •"■" fie "' 

Digitized by 


fie mîxtum biberunt homines> ttăi ambulaffent > cum ^ 
tea curuiob meri pot^m incederent , obtanmm beneficium 
Aram Re6to Bacco ^dificaueritin Horarum de lubro , quo* 
Biam Hor;e vicis frudum educant>& proxime illam Nym- 
phisakeramextruxerit^docutiientumbibiturisyb^ K^î>fcţiăc 

pertoăumefle^qiiiaNymphasBaccbinu^^^ cKiNutiices 

2CXVÎÎ. ' Sangîiis €tîiîiînorbiimfacit> doloremexlubet; Pi- 
tuitagrauitâtem vtplurimum. 

SVb Sanguinis nomine Biîis eiîâ intelîigenda efî, & fi qtii b^^^<^^^^c 
aîij funccâlidiincorporehumoresvquemadmoxiiimfiib ^ f^^^m-1 
Biaika^friggidiomncsc^mp^eheiîdvinmr: ConiUemm fîqui. |î^f^ 
dem Hippocrati ejO:>iacomca quadam breuitate > caiidum vei nm^^ţr 
friaaidum aHquemhumorem y^^^ 
nua. de morb.> & lib*dc affeCt.>dum morbos omncs ab intriafeca 
nu.2^ cauia prouementes, â Bilc> ^ a Pituita fieri afferuic 4& lib. de 
^-,i6>^t@i. docens humores tune laborem & dolorem exhibare ^: 

cum in parce aliquapecyIiaritercoaceriiarar> ^ ^^^F^^^^^ ^j^,^^» 
air;i ac proindeţepefaapriis efle difli^Mcdo^, -P^^^^^^> i^ui^^ariumLe: 

ţmsmrtm^i^f^^ ^W ^^^ vari^imt iife- t^"^^ 

xenti^jpro cauiarum> ac dolenciumpartium diucrfitateyTt vi- a&a«n. 
dere eft apud GaI.Iib.2;dc ioc.a€ cap. i. & 2* Alius fiquidem^î^j ^^ 
acutus eft > pungen$-> & raordix;anş j qui morbifîci bum.oris.gens. 
caîorem , acrim oaiam , teauitaţemq; atţeftamr , ac mcmbrsb-: 
lurum proprius efî . Alias dolor puiikilis dicitur , pblegmo-. Boîor tea^ 
noiis aâedibus fuperuemens, ixî parnbus :ţfidelicet ieiiiii prae- ^^^? 
ditiş, vbi arteri^ cxutcrinq hse namque ab infari^is dum prs^ 
muntur bumoribus > mokftam emcumţ puUadonem .^ Abus 
teniiuus appeliatur, qui â parte primario ^e<5ia> veluti a rădi- 
ce incipiens^celerixer in admcenţeşparţes îranskrtur ,& a ^ 
tuofo pîetumque prouenic fpiritu.AEque tr;eş hi ob vehemen- 
tLâoi, ddoriş nomen veremeren videntur. Quartusd^ni- ^ 
qiie dolor «rauiş dicitur ; eo quod veluc cuiuidam ponderis nomine non 
locoincumbentis inuehat ienium î atquehi^; materia potiu$ ţ^^^^^ 



Digitized by 


jiS memcRjns lis.Jii. ss loc. in hom. 

. n^tttudiDe^My<julmaIia:mqua!iîatemoftcnditî oiMiîiitJiîn. 
minimus & hebtdot eft : rade , quafl âolom noxnmeitm 
gnusfît, grauitatem firapliciter in feoc texcu eui» ^sellat 

J%pocrates . TaîeiB a Pimha n plurimitai Ieri aâetft : Mi» 
fekbumor, ceh friggidus natura foa fit ; atftmettvix ^^ 

vmquamedfriggidicadsTica fupcrftice afcepdere, n. <fc^Q. 
do dmellat, mtcniumque fie excitet dolorem , fed foia copia. 

duingtauitat^obtufam'faatîcdoloris fpecieminducittiis ^ ^ 
prxfertim in partibus, qi,$ nullo pr$dit« fenfu , feniientibi 
camen membranis circumueftiuntur, vc Hapar, PulmoTca-„isp«^ lauicRenis dolorem îib.5.«pid.fec.i.Saiiguis,e con«a,mode- 

fedabinflue ^alidus aflecituE îifecUo de Gordc- i influenteta-TiPn ,-rX; 
g^^ «-fbcaMffi.u..xiftic^reen:S;jSSS^ """^ 

teiores, vbx nacur^lege. cceiTerfet, modoiu^^^ - - 

f»^*^^^ 3^^- d^^«ndit>^c raîefatithunwres , â «u^^ 
borantesparticul^ ««^niagifqu^-diîamatur. &â1ompr*fr 

(»^m/?fr.SedeurdiximpIurimdm grauicatem â Pkmra e7 
ctS.dod ^'=^^^ţ*«p6«S'«* & Vewriculum con. 



Digitized by 


avin Morbîimfîquisnoiî CQgnofcat, medicameiitum^ 

bibendum pra^beat non forte ; fîîtaquc leuîor îndei ^^^^^^ ^ 
fiat; demonftrata via eft,quod gracilitatem indu- *^^^ 
cendo curandiis eft . Si vero non leuior reddatur > x^oisunL 
fedpeiusiiabeat, contraria facîenda funt. Si non 
profoeritgracilem facere , txînndum facere condu- 
cit>&frequenter permiitare>itâ Yt lioc coiniovtaris. 

PRofîcuumfancnunetradkurconfiliiîm, quo hsefitintîs 
Medici mens dirigitur in ea perplexitate, dum vidcîket 
morbusadeoinintimioricorporelatitat, vt nU certe vel de 
eius natura, vel de caufîş^neque ab ijs^qux pr^ceffere,neqiab 
adtionibus laefîs, neque â qualitate immuraa , aut ab excretis 
iiefumiJ&s fit : ex quo neque certa inftitui poteft curatio ; ^^'^j^^^^ 
nam cwîKX reinm eftcerU notitliL^nc^xit Celfus , eius opinw cer- tam oâedit 
tMmrepmreremeSumnonţotefl. Talesiumij morbi,exHip ^g^^^f^^^ 
nu.17. poc. bb» de arte, qui ad os, 5: qui ad ventricuiutn funt coi^ pr6oeiun.i7 
uerfiîhoceft, quipouad fuperiiciem,fedadinternâ,ytfunt f^^^^^^^ 
nu. 15. oflia 56cauitateş,vertuniur : vnde, qu^un^ue , pergit ibidcm^ Hippocr. 
(^idr,qmâ,nmJhtU7tcfianmry Aeffrifmdaţerpmmam'reanou 
odM^cdxjmmrâQS ipfis , tmquam adipfirum authoresj nferen-- 
dmfiMsfi^^n^^^urmiipfi^s Aegri, itidmiqueiţfius imrli .Hi 
er^o ioh r^tiocişacione obtineniur ; ac proindeâ iuuancibus ^^^^^^^ ^ 
^utlxdeutibus argumentum aîiquod, & certitudinem erucre i^dentiL 
temandutu;C&,vt dictam alias tuit tex- 11. iib. 2.,vbi hoc ^^^^ 
idem documentum regiftratum reperitur . Caute tamenle^ ganu 
uiaribu$ aiedicameniis cxplormdum efl: , mcmor alterius 
confilij I • epid. feS* 2 • Exerceto drca tnorhos âuo^ 'vt iuueSymit 
' fikemnmnoceas ; Ciimque omnis curatio in additione > aut 
ablatione conhftat;, ab alîxro iftorum exordiendum , prout 
hanc magis, auc iUam naorbus expetcre, aut indicare videbi- 
tur ; hoc tamen ieruato ordine, vt fi profiierit > iam moaftra- 
laât curatioms yia,cui infiftere debcs; h vero l^ferit , ad 
contraria ftatimtranleundum, Auicennaintalicatuficcon-. 
fiilit . Citm ipioraueris ^gtntuMnem yrdinque mm naturi, qtdx Auîcen. 4. 
^Jiţfacur^team^OHtmanifepahiteam* Ec alibi ^P^^igna- ^ci^'i^x- 


Digitized by 


qmdem ^groto, debili autem morbo; timc aui: 
a^t^,;^^!?' d-^confidenterfortiore, guâmmorbus^A.mldi: 
^^^l^.:r Jf:î^f ^ vtendum eft: „am etiam iî guid flS 

raâ of? '"^^"P^"^' ciebiiibHs phamaci. cii- 

A î^a^tierfîo h^c, qy^ tota ad Thmupeticam 4^ 

Qui nrS„ f""^' P^"'^'"^ oiFenditrnantalio. 

«-«- cundaveromS^Sf'f'^'^'^^f^.^^i^^ 

tcroj nuiuslijjri expoluimus : namidemeft^i^ere. 

Digitized by 


"Oportet ettam dehiks fortîa meăk^mmîA ţkare ? fi fof ti fcilicet 
corripiatur morbo ^f^â fimU$tr > hoc eft y aliqua tamen ad- 
hibka fimiiitudine & propomoGe iarerdebiiem Aegram, & 
force îBedicameatum , itâ vt intet foîtia xmnus forte cligatur; 
<jaod fi noniUico to turn deieat morbum , xrito tamen cxcia- 
<mere apmn>fit^ vt iam facis ibi dcclarauknus ; ac ăictxc • Si 
morhum fortiorem ; Aegrotum autem debilem acc^eris , dehiUhns 
pharmacîs eurabis > 4«^ ipfim morlum juţsrent ^fed Aegrotum 
TîM^deWkrâtnreddant. Debile Qnkri^hs^mzKMmfort^^ 
morbumfuperans^tîonpotcft debile fimpîiciter eife ; nam 
ki haud noiTec iuperar^; ied compatatioxic fordoris:erk crg<> 
iriter fortia mitius forte ; niiî dicerepiaccat > ided debîîibus 
phamiac js, piuraîi-nu4:n«ro*fagaciiîinmnrSenem proziancia^^ 
fe j ^t if^icĂf et , d^biiioîî pharmaco j^pîarks taiBcn adh^^^ 
perintefpoîâ^sviccsi fortcm morbum in debili Acjracife 
curaadum ^ qu^ediciturpurgatioperepicrâfimjcuiiisreira- 
dones ex citaco tex, î2. iib. g.^rea&inierciicebicci^^iî^ 
' tnhnejîy inquicAiexand* Tîall. pauîatim y ^ tuto ^uăaiar^; %^iex^lih^ 
quamfifiinamdoj-ţ^urhanâc^uey ^nkţtm^^^^o^ Aeg^-^m^ ^^*^* 

XXX. - Ars exerGltandi corpora, ac Medicina contraria Gf&m^i^^ 
limt:ars enim ^xerccndi corpora^Gymnaftice Gra^ ^^^^ 
cis appeliata^non opus Jiabet pcrmutaaone > ied 
Medicina: Sanoenim non atfxiîiatur tranfmutatio 
ex pr^îentx ftato ,Temm j€^oto - 

Ymnafticse latriceiii oppcmît ^ quafi tota ars , quse lut. 
[manopT^eficorporijiniduashaspartesa^ * 

dacur , quod pari cer iiHtatuseft Plato in <k)rgiâ , vt aanota? 
iiit GaleaiJS ad T}>rafy.cap .3 5.mquit enim Piato*Cif?2 res dna 
fintsărtes ejje gemitias arbîtif^r^^ arîem ^uidemad ănimsmif£rţi^ 
nentem ,duil&m mmcufc % ^am^er^y €ju^ ad corpus , nomine vn^ 
nomînar^-no pojfmnyfid^usărtis^mmq^ 
pono pcmticulAs^i nlt^^^ipddem Gymna^^mt ^dt^rmn Mmich- 
namXlmxis reiratio vtinteEîgacur^fciecKkaîiefljtîimGymBa- 
fticam, turn Medicinam dppiiciter accipi pofle, prcls€ , •& la- 

S s te* 


Digitized by 


52*: nmocRĂTis ub. iii. m loc. in hom. 

oţSfo .7 "^"T ^ontempIa«s.eommque varictates 
gSf H±^K"'^'"^^Sratia .aietudiAis cppferuaBd^; vel 
Gy«aafiaa » ' " ' **P^"»i habitus corpons acouirendi , atoue tuendi • Vn 
^^^ tSS^ ^^f-'^ocuslag.^ficVSSTt^^^^ 

cap „ «. '°'ff°^"^^' ^^^^^-î^ G.^î- adTfarasyb: 

cym^afiic* eif;^^/ ' 2 q"a: paulo ante Piaconjs, cemp.ora cxorta eft j 

v.inii,r, modo mubrcs^ '"od<iinfalubresreddi:quaoroDtef 
aliqua indigere facultate vidcntur ,. oua; eas in m?dSf ' 

vîxfea^^ ^-;« - o^^s Somnus & Vigiha, j^otus & Quies, Animi 

TWb ţt"^ """ '^ ' ''"'"^ ' vt docet Gal. cap. 3 5. ad 
£»«cit.tio citaţia hen/^JJ î^^^^*^"*-*l"^ ^PPellans, tuin quiacxer. 

te fmens corpus ,n.aturalibus appetitionibus vtens;neqi.e ir 



Digitized by 

ve^e<^>ciBa eft pars, qu^^^maleAabentia.corporacumt^ac 
" "" proiîide cutătrix 6id:^y Gxxck. latrices , Yel Therapeurica * 
e^^iparatkaq; Hippoaratesinţpi^fe^^ 

hte^cceptam, prouttocamtucncisevţ^ &-^^^^ 

M>r«m -dictam ? coînprehen<lit> cum Medicina proprie arcte- ^^ «^^ «g^t* 
qiie accepta >: nimiriim curatrice j iliam^e permutatimie nou 
âfgere a&Ht; Sasiis fi^uidem , cui iliaînferuii , non quserit â 
pr^fentiftatU'dctiKbâri, led^ decinenqHe^ 

contra iac itiadicatrix Ikyukas > qp2e^ niarbofb ftaoi ad iaîubre 
dediicere firudet; quod vtiqi^ ficpcr coiitraria tranfmuraado, 
Quod iî vtraquc pars , tam fakbris fcilicet , quâm curatiua ^ 
addendo > decrâheadoque operatur; iUatamen minima quse- 
dam-vidacorrigk, quse fenfumpene fubcerfugiunt; ncquc 
dum actioilum integricaci dctrahunt.: quapropter abique prse- 
fenns ftajcVfS tranfmiiiationc corriguatur ;. fecus quam Thera- 
peutica; vtoptimcespr-effitGaknuscap.j^. &4c*adThră?w 
lyb. Ars<orţoi'ns£uramhabens yâfnendatnxcufn^t^inc^dk^^^^^ 

^,^. twr; qua'uero exiguăsmxas tiMt^^i^fiyiŞimJu^ c(m^ 

XXXI MorMqm 

taine ciirare oportet , 

ţ? ^ Ippocratc^m pr^^itestu eos Eefpe^Me^idemr , mii Morbiaia- 
£^ moxhos oaincs ^îceraei&putabantî.quonim opinio^ Snt&! 
îxeî2î.y A^ non pciikîis nnpr<Aabi!em.,:rei^îitlib^ciraâ, ner ^^ -'^^^- ■ 
«^' 33^ h^c verba . Nifrjpiisdicat alic^^uo^ie'^mm'h^ hahet 

tmTnif hicfermo aliqnam verifimilitudinem . Vbi Galenus , Gaî.!ib,s. 
. vmfîwâe âmt , ^uixfi frohaUU ^. id autem proptereâ poQăî , ^^^^^'^^-^ 
qulanonmMaâ ratione prorsus ahhorrent; nam morhi tanturn^ ^t 
mii dular^n affenmt, ţmhabilitmMdimdMm cmmmerari ^ukenhiS 
fo§mt ^c. Dicic kaque Hippocrates Morbi qui vkera func ^ 
ţoc eft, qui ^ere proprieque funt vfccra , non redeSiue &> ' 
kBpropric , vt cereri morbk î|^c , inquam, vkera fecundam 
varias dimenfiones & vias; pro varia mm aftect^ partis^, mm 
moibiixcibumGris difpofîtionc, fepe^geq|uryfipluribus, 

^ i ^ aut 

Digitized by 


3H mFFQCRAm LiM. im m ioc. mnoM. 

aut vitiofis escdeatibufque fcateac tumkiiQabus , vc alws 
cx HippocratcdiâumeftliLdeMedico»vbiF/c«-d,inquit, flt^. 

^''^^''»J't^iim,q}iavi4e^!kst carne pipercrefimt^Tertia via ^m 

mtitdmem; asquelMcftmt ^qua agpdlanUir firţimnofai Quar. 

vjceribus ^ ^M nt > qu<£fiLtfiair.Âtzm naturam ,^e -ouktur " 

periic:em adsquat^ verikneciam fijperemineti fîuefoLda, 
. atque opnma^h^c fe ob optimi ânguinis redundantiamjfiue 
ipongîola & iiaccida ob cscreuicaca , qus redundatu eo 
quoa miniis quam par ' ciTec â debiuon medicamenco cxiîc- 
Y"'"r^^™' vtkgicur iibio devlceribasnumero 5. & de' 
vinenb.Capit.aum.23 . VJcaraqtuaiiiquefrchef&frautopertet,', 
piirgatapint , fempsr^âficchremitadumgerminatknemfaciura : 

ăii%>c!^;. yr'^^"» non modo medicamentis curare oportet, qua'fci- 
^,. n^m diuoluendi , abfumendique ; ciMufiţiadMlltid cft, quod 

todenutor ? ^^-i^ty^ î«»2Kw^£ir"; eOaV etiara^purganditotumcorpus- 
»6 Hippocr. h opus vidcatur , adhibiw pariter vtnx fcSidne , iî e^beret 
ungujsj ventoletiam feroe ; Inediar £qaid£m corpus -â fit,- 
peruacancis ompibBS,«xiîaurit.„duffl cajor confueds aJiaie,^ 

tis dcirâudâ^!s,inidiqyăs_qu^Î3«îqite .fauisiditates vim cxer- 
XXXII *^"'^^^"^*^%^«îevcognui. y^^^ 

«So'n^Ss ^^"^^^^- ;CX capite. iiiiente^. vomitus condacit 
VC...SV.. 1 pecuiiarkerâ qu^rid^ank crodkadbu er.!^."? " ? 

irStS f P^^"i^^^-ra q..K.«dian:s croditadbus expiandoi fii«in 
^^;, 'T ^.P"'g*^^^.'^ ccipore, H critice in morbis:; a«f ar« 
âf SvS ^^'^'^'^^l^^^ confouaad^ grada, cxcitemr: quapro^rer .£^1*: 
JS dl Z^^P""'^ vno hoc pr^Mo^ , "& ^cnbu^, 

rodctws : 

Digitized by 



rodotus : maiora tamen ablcmc dubio înde proueniummalâ * -^^f^^P^^^ 
li <5Uis incâute , nec prout dccet> co vtaturi hzhxtz vid^jce^ opere <i«-> 
latione cum ingcnita^ , turn âdfcidMînatu^ > partis âffc(a^^^^^^*J^| 
fiaprbifici humoris , necuon > dccuxttnm tempeftatis ; adeo repicHexidtt 
vt non improbabiîiter Aidcpiades mm penitiis reiecerit^ Cel- qu^rjS^n 
fufquemonuerjt > ne quis> qui yaîere> & f^nefcere voîeţ> hcc/^^'^^^;f 5'f^* 
qttotidiatottm habeat * At qiîemadmodum priicis ijş tempo- Sn'ol4irr& 
ribi^ &mMiaril£muo>^iiiit iiocprieiîdi^ complura f^,-^!tj 

de eo documenta apud măgnatcs Au chores , Hippocraţcm ^ ^.tr.x*. 
preferam , regiftraapaffim reperimus ; ex quorum iimuî ^^J^^^ţ?^^ 
; coîlatione auxiîij huius vim , reiluinque yfum cxqc^irere ctiuc^^p.z- 
operş pretium erit . Et primo de naiura quidem ad euacua- Afcieciade! 
tione hanc magis opponuna ; de humore paricer > aţque tem- <^i:>Wce • 
pore , facis videtur decreuiiîe Hippocrates aphorixiriis ijs. ttdîi^o^'t^'i 
Graciles,- ^ facila 'uomenîes Jiirsîrm ptvgaTA C'pxX^t , "oitantss ^^^^ ^^^.^" 

îanta ^jîatmn . IAeâicas72crais:ţurgare opcrîeţ ^ Ajiaţ^ q^iid^^^jli' k?^âd vo- 
feriorcs magis ; Hycme v^ro infiriir^n » eKquibus Kcdici fere men^*.x^^ \ 
omnespoft Gaienum^grâcilem habitum>bjHofumhumoreni3^ ^*''^** 
sefliuum t€mpus,pro hac admiiiiflranda ^uacuatipne oiBniuîB 
maşime prob^arunt^ V^nim. vi%ac^buic opinioni aduerfacur 

^'-u ift primisfiipfemet Hipp • lib. di^t., vbi seftace vomitibus 
vtJendiinpQefîeaiferuicjiiifialiquarepIetio contingar^ ventri- 

T^n*s* culinimimm^obaîiqAioderratumviau^Etîib.d 

(. quamuis Polipus Ubri huius Author a nonnujlis peribeatyr: 
fektameiî bic Hippocratis di£cipuîi^ ; 5c iPr^ceptoris dog-- |^f^ 
maţibuseum numquam difceffiiTe teftisefl ipfemet Calenus îfipiiM*^^ 
iti'prarfaî.commeQtiiilib. dt{kLâl;^z^) hckptur Je^men^ ^s^M^ulm 
Jhh/hemcs '■aomendîimM:^lwc mimtemptis midiciuis efi ^fliuo, f""^^- 
&monbi arca Căţut pmt^ ^icegion^u ^m 3 c^t^ efl Jup-raje^ vomâdd fir* 
tumtranfii^Jum^ Ciim ^v&rQM^s fy cd^r fiierit^ infiijisxftm'- 
ium 4^ : hora mim h^c ^fluopi efi , if corp^is hilicpm , & LkmU 
if Germagrazianturyiî.cdxtr£s^hQtiurdury^in V^re termina 
fiunt; quaprm^r sorpm refrigerare Qprta i ifqu^infullim^ 
eleimîtj^ , infmne Julduc^es^his hcisy Vbi clare patet.Hip- 
j^ocratem^eîlc biBofum humorcm , seftiuo e^uberajitem 
s^oiporeycum â naturali îcuitatc nunqîiâm nou fursiim fer^- 


Digitized by 



tur , deorsiim effc trahendum y . ne nobilibus vjm inferat par- 
tibus: repencîs ctcniin humoris propria medela reuuliîo eft^ 
atque retratâio » Pituitam c contra;, in Cerebro, Venai^u- 
loque ftagnantem ^ hyemali tempore, cum fciîicct plurimiifîi 
abundat ^ iursum cfle eijciendam ; breuiori lidelicct yia .:; 
neque reuulhonem prsefcrihic humori ftâbili per ie> atq, im- 
Anai dhiU m oto;Vbi obitcr notandu cft Annum in duas diuiftfepartess 
^$?' poftremam Auctimni , & primam Veris partem cum Hyeme 

coniung€:ns ; quemadmodum Veris poftremam^primamque. 
^3. d<uj Autumni cum Aeftate ; quod aUâs eu lecilfe ccrtiffimu cft. E e 
i?Un.itidem pauîo inferiiis ibid^m uim piiiguibus ^ tum gracilibus pecu- 
- hk'Ăpr^^: ^^^^^ vomendi modum pfsfcribic , aullo.iacto verbo de iii-^ ^''*^* 
eptitudinc craffitiei , aut gracUirads promptitudine a d flipcr- 
namhanc cuacyationem, quafimcrquehichabicus&aptus 
Ceifjib.i. Siineptiis efle poffit ad faune motum : quinimmd Celfus^qui 
*=ap. 3- exHîppocratico tonte onmiafelicitcrdclibauitjgracilibusia^ 
GracjHjâtJs utUcn^ dixlt căc vomitum ; cui neque ipSt deeft racio: ciraci- 
cauik. H^âsnâque,vndecimquceaproueniatyfiuc ex^im^enti^^^^ 

Chiy vei prauitate ,<juo membra nutriri auerfantur^yadc pro- ' 
prie prouenic extcnuatioj fiue â caîidiori natura* in qua pîura 
refoluuntur^quâm nutridonc rcftituantur > vc proprie eft gra- 
Graciiitatis ^^^^^^ habitus , femper ex lui natura inepdffimaeftad vomi. 
Habku5in- turn i cum perpetiio comitembabeatfîccitâtem^quae aoii 
^^^^- moddfaun^resquoslibet.âbfompta ferolîoriparte,incî^^ 
lat, expuWonique minus obfequences plerumque reddit ; 
venim ctiam Corpus obdiiraţ yoexusque , qui thoracis corn. 
pagem detineat ^ vt vaîidiores redd it , iti mimis aptos , qup 
in vomitu îaxentur> vt Veatricido fe ie inuertenti îocum p^ 
beanr: vndc vaiad^rioraaim fin t in his naturis^fâcilius eiiam 
dirumpuntur ^ fanguinifque pro&lionts exinde adueniuntj 
non mimis , quam in AquUonaribus conftituuonibus^vbi ftc^ 
cîtates hae, atque duricies vigcnc. Hinc cft , quddHippocra^ 
^sî Veratrivfu,&r3.aph.feci4.,&d. epid!feci5. 
balneis,<opiofifque potionibus & alimentis gracHes prsehu- 
mediando prarpara: ad vomitam . Neque ktuit Galenum 
h^ctextuum difcrepantiaf quinimmoeos conciHauit corn- 
mentano jneundemlibrnmde fal.dixt. tex. i5.inquiensin 


Digitized by 


.^ COMMimMHS liiySTRATVS. 327 

aphoîifoao Hippoccatcmioqbi devmueriâîi totiuf corporîs *î»^^^^-4 
euacuatione facienda per vomkmtiiquie asftiuo^non hyemali 
teropore ternari debet;libroautem de falub. diset. > verba 
fecere de peculiari ipfius Ventriculi euacuatione, in quo mul- 
ta? byemalite^pore coaceruantur cruditates ob pîurima ali- 
menta > quse tune temporis abfumiîiitur i qu^eque per vcmi* 
turn ^pedîte e^âciiari pofîbnt . 'Weinm obftatxatic ab ipfb- 
met Hippoerate ad fuam probandam intenfîonem bb. de far 
lub. diast, addudâ : vi>i vuit Hyeme efle vomendum > quod 
boc tempus pituitofius fit ^ftiuo ; & morbi circa caput Sânt, 
&regionem fuprâfeptymtranfuerfum; Aeftate vcroin&iîs 
effevî^adum, quod tune temporis cotpus bilioiius fitrergo 
je^ euacuationes>non pro venmculo peculiariter expiădojl'ed 
-^pra toto.emwndando corpore, prseferuationis gratia , propo- 
xm^ţwr>Q^d ergo dicemus in hac tcxmum conrrarietace . ^^^^^ 
Seniiendiim putamus , neque graciles, 6b aiîatas aurhontatcs 
& rationcs]neq. pingucs nimiiim Se oba^fos ^ 6b carnis mole 
qua grauataî oppref&q; thoracis.partes nequeut expcdiie eler 
uarj,dilaîarique,vt; Yentriculo cedam , ex fui natura ap tos c£r 
le. ad vpm^oncş > quatmuis confâetudo > â tcneris pjrselerdm 
Tfquejnnis ipi<aj iiabitium quendam bis, etîam namris indu- 
.ce:reppffit>quovornendiiaciRtatem>prompticudinemq; adi- 
©ifcantur • Sed mediocriter carnofum pxx c^teris efie ad vo- ^.^ 
mitiisaptiinmum dicsmus j quippe cm vtplurtmumneque iavcmccn- 
.defit partium amplitudo ^ nequc mufculorum robur , neque ^-^^|^^ 
moderata hymiditas j qu5e apprimd x^eceflaria iun 
culuscommodeinuertiymox valide comprimi, & Thorax 
yi magna cpmnioueri in yioknţo hoc mom qucaii t;Cum his 
tamen, fîlonga adfit diCuetudo , itâftabiiiuncur hx parces^vt 
eîiam mediocriter carnofi , qui alioqui cx naiurafuaaptiffi" 
mi funt ad vomendum 5 difficiilime tamen vcmant ; tsncam 
vim habet confuetudo in hoc motu ciendo . Tempus pr^ccr ^cm^nsvc- 
rea neque prsefrigidum,vtfumma Hyems ; neque pr^rcaJi- aicnco cp 
dum , vt fumma £&zs y opportunum eft ad v<ymitum corn- ^^^^^ 
mouenauni : huiU5 namque cxcefl'us rum in frigore , turn In 
calore, femperineptuseft ad euacuationem; ac proindc tune 
aumquamprouocanduSâ nifîpeculiarisaliqua Veneric uli re- 

Digitized by 


fedj vt iubec Eryiipclate Puimanum > 

tatioaibus cemporum vomitibus ^ti-o^oxttt? An y fubdit, 
^^ ^^ conturhatîo Darys gmitîsexcremmfis in 7m4ta£iime}Snmp' 
XI ctgo primam indkadoneâcouiuemdinc, deindc.ab hu- 
more . Si qois propeiifus &t ad vomitum y qumimmo hoc 
rno promptius , quam per feceflfum cuacuetur y a totius 
corporis impiiritatibus > ( cuiufmodi aon paocos prifcis ijs 
temporibus extitiiTe in tanta Vomenrium frequentiacro- 
dcadum că; graciles prsfettim biliofos,;quibiîs ob pr^e- 
calidum bepac , iafimms^raiter , & cum boc yfoeces aC- 
iîdue torrenrur > ex quo ad deijciendum 
gSciîibLs^ maces âunij^ fi b'dis quidctn abundct, Tt in gr^ciîibusqiîi- 
qiiando vo- feufdam feruidioribus ;canc velinvidma Veris parte j&: iu 
m a a i. ^^laiz aîftate prouocaadus efl: vomiţus, ne veceri biUofb 
iiuniori, ^etm .aefl^iante fiimrateii3peftategi^endus,a^ 
dacur , augeacurque iiimis ; velin vîdmaiEftatc, & primo 
Autamno , ne copioGibiUsâ pr^reriris fctuotîhus genita, â 
fupcraenienie Autumni ^ aut Hyemisirigore moxcoaâa , 
pimitoiîs -ex^Eftuet^&ardentes pariat afe<âaones, Siveropituitse* fc^ 
l'lrai^air ^^ natura fit j ca aut poftrcmâAutumm parte, Şc prima 
Hyeme ; aut poftrema Hyemiş parte, & incfîoata Vere ob 
^ eafdem rationes vomitu ^ijcienda erit , ne iciîicet îmmod^ 
cum angcamr , duplicata ab Hyeme ; aut fluat > & putrefcat , 
îiquâta â leernis te|K>ribns ^ V ertim boc &r uandi3^^^ 
qui, vt diânm fiiiţ^ propeafîadeo funtad vomitum>ob con- 
trădam did confuetudinem :, vt faciîiiisquodasimodo per 
os>quam per aluuinyniuerfo corporeeuacuentur : nam iî 
âequaîker diipofiti iînt ad voramque cuacuacionem; tut>c aii- 
ter procedendum crit;]iemandus icilicetiaftitutus libri de 
faîub. di^t. , modo fupenuscxplicato : Pituita viddicet^quae 
fuperioribusin partibus plerumq; detinetur > capite niinkum 
&raitricuro; ibiqrmorbos părere con&euit^' vomita fex 
nieafibus hycmaliSus :, qao tempore plurimum abundat , vt 
docetur Jib. de nau human. , ,euacuaada ^& : nam , vt infra 
- ' babe- 


Digitized by 


-oetque 4n iaferipti regione 4£ m&U^^xyâi , mori>oiquc.ob ^^v^' 
iia^nîtuiEatem ^ fuţeriooims 4>artibus i^^ 
deorsumpotkkfiuacuaadadir, ca^yîmiî»^I»a^^^edJ- 
CîEeitandim tranfeiai ibktri5Ltmqub¥Vihabetmfib.%nat. 

qaafcumquej .qtam lon^Ş»^ â.lods facumus , cl^ iiW pen. 
t^mJmuenmP ■; fie enim muuaio. minime maţna iereţmte fia. 
^'xmfi^im$in^'r^mm^^ , ta vmmjţBiu h% mnâmlscim 
c«z/i<J4/a}'. iîeque-ckatiaphoaimi, ilatceme perpeadantw^ 
alicit ,dceem«Wi natn: ia 6. Scy. fcâ^ HippoeraKs , vt 
ot«îiâa£ «piaâEifacienda & indicado â cotoemdme dfiCuoip- 
ta,duoş<ompar^tîiabims, guoiumaicet mepwş adyoraicu 
fit ,-vt-eft ^tadâ^ ; peculiati tamen coniociudinss bencficio , 
prorapce-ffataaqae vomat ^itayt&dI^«sf^^^ 

oietur, ««o mod® căiiaciones iam Jbfj:^ aSacas, fcd «iwn 
quiainfiaii ventds-gtacilitas, exaph. jsie^. 2«,i«ep» &; 
periculolâ eftadinfernas pnrgatioafâ: aiq. hasvQcat gracUes 
difieile vomeatcs.Alcer yerc^dirpoficus quide fit ex fui natura 
ad v<>midonem , vc«ft mediocăar camofuş j mpdo iupţrius 
exdicatoi diffieultej- tamen aiQmacmqttodnoa^ftueue- 
ritvvel-ob alianţ peculiarenî-,aobisq; igttcuam caylÂm,quc 
îblappctat iBcdiocnter ci»âiiţn dtficidter^^^^^ 
qtio\jio4d m namris ijs expQ^aadis.gererc fe debţatMe^-, 
cus, decemunt aphpriimi ,duminquiunt.GrâCilestâca^vo- . .^^ 
metttesiursumpurgat^ opotcct ,;ViKuices Hy^inens »hoc cit, tcrgaciief 
nonexpe^ata Hy€me,âcuiuşaigoribas.bikoiiJiuroQiC€ş, qui °^^^=/«- 
îtj caaciiiUB «atu-fapluriraufli abundate îblettE,«icviS coarcţa- voalat , fiit- 
6 iţqtre&unt, exquo^rdciicesfeWsledialittt accendi ^^oa- ',^|^ 
fiicuerimtv Dîfficulier voinemcsmodaate. carnolos decr-.âu^^^ 
sttmVsitanEcs Aeâaeemj hoc«fi,npn;Cspjc^taAeftate,Be ab ^j'|''J^.-|; 
. Te eius 

Digitized by 


xime congrua ; id ^mimes; fobutdiŞScu^ eos 

Qux iiârţes iochsk r qnx fimul piîgnare viâchmtut, : Ap hojdimuş ^nim 
Kycmc,qu« quattus ciuf^em. feciionisv* fmgăm ^^âU qHidm^;04pmm$ 
tizjdlkmi ma^SyHyeme'aemmfhiQres.* certam dl i€>qui de partibuş^j 
quar K^j^eme^ autiSâb^^eimtidebem 5 npn 2\mmÂ^i)h 
pcE quas fedenda^ fit euacuauo > vtpra:ckre annoţ^^^ 
€ommcntario ia eum apliorifeium : loqahur cnim pîuraîi 
mmot V0-; aumero , aoa fîngtîlari ^ Humot denique^y omcndus, quâlis 
SSk^^^' €ff^debeat,comgimrparitercxeQdemUb*de fa^^^ ^^-7. 

neque cnim eraffiim laimis eiim ejOTe ©portet^^qu^que talis 
t& , vt ia craffis. corporibjus efle co^fiieuit >. curgbus^ citifq; 
in meridie ambuIa4oaibus prius cucmzxp tentat : Hy {fopi 
itidem deeodo , Ac^o >.ă^ Sale; Neque teiiuio^em 1 quem 
proin(^ in graciiiibu& inctafiSit cibp & p<^ţp:praşaffuinptQ.14f r 
dioGris ergain temîâite &cfaffitudin^agty&^^ 
'ţ^ojjj^^g h«ec dcNaturaquo ad habitum ccîporis>4?3Hp^oîje>Âc Te* 
^uibus mor porc magis pro rowidbus pro bato>iatis crunt; rjapereft iam/ 
hi$ ^ccum ^^ p^trtîîjţjs agere r qmbtis. male afFe^s. ^amitus foccurrere^ 
aptus^eft^quod ad propofiti texj us^dilucidatio^^m potiffimu ^ 
fecit,.At queadmodu£eueliendQ> amor bis omnifeus pr^ta- 
nare poteft> quiininfernis procreantur pariibus^ ka i)ş euo^ 
i^omîttis re- euando medctur^ qni humorales cmn iîat ^ fuperiora aciu in-. nu*i2. 
SbusLf-'^' fefi^itIocba5Pai:eti<i^x Hb^e.Ixifomnij$>Ybi yomiţu vţju^^^^^^ 
xioiib;i&. rcucUcnd^mâ cruribiis,&aph*i 5>iet*^.>& î. 4^ ^"'^" 
fmorb,^ p-mfluuh dtd catir^pu>fV(mtitmJupmi0m^mhonumiquB^ 
admodam ^h.&i^cxmsăi2LXx>*Dohres^iprafeptu îrmfii&rfitm^ 
^ipirgaticue-opus habent^fiiTsum versusţurgaţioneindig^^^Ji' 
ţmficaT^.Etkh, âcycxziMu^Sc aph. I7.iec.4,.fic îegitUTvPîir-r 
. lătioCursum'oer$us^commodatd:inăm{imfe^ 
mcdu* cit mt pmtacmpmcm^ai- aut vevîtgo > aut as mmmm V & ^^ p^' 

Digitized by 


aa.15. confiiiit^ life.^-4e>morb.>.cc^rum^ua repkojm vomicu 

Phenicis afFe^ioni vomitus fuccHrirebat , aufer^do, lenien- 
aoattedotores capicis , dextri t^iiporis , &^olIi squi calus 

m^^ receîifcair€ti2m7.^pid.HnKA€gineta iih.i.czi^^2. Vornic 
tuspituitam expurgat, caput rekuat ^c. Etenim alaus vtcuBo; 
exki:mitatrahititotocorpote2^_&|f5cipuaâcapit^^ & vr 

^^* aocecurdib.4^e morb* , qu^madmodum dum pîenus; eft 
-^^ntrkiite dac ommbirs parnbus,. itadum vaeu^iseft^ ab 
TOiutrib corpoce repetit; & quodco^iĂiîe^, in vnfem de- 
ducic fubftandam; qui^ veroprauum onvim^â cijcic/Id 

ipsu imbili m^aphora îK>s dbctiic idem 
im.12, di3Et.jdiiirmatixalorisc^eramagQUoqueextQmt, 

ţromftuarimnt^tdetiommhm^ â ampiat ăb ofmihis ^ iuxtâ 
Marisfacukătemy quodefi animalmmm ipfimtritonim , acnw 
mripitonm aUmmtfm ^Jifcordium ^w femicies : Ergo vc 
Mare ingenica anim^ntiafemiliaria confcriiat, & nuqrk, con- 
traria ^rd ^ringuit4 ita & VenakulusingcnitQş quidem , 
awtaduemcntes cognato§ :huniorc5, ampkxatur^ fouet, vt 
i)s4einde partes on^esfry^ţntur ^ prauosautem^ & infeftos 
aliunde aducixienteSjYQîîiilil-eijciţ^atq^actermi^at- Sed cere- vomitîssci^ 
bralibusâuxionibusfecMliariquadam etiam ratione prodcft ^ţ^;fj^^^ 
h^ceuacu2^io,nonmodoqiiddeâVaricuîusexpur^etMr,q^^ proOc* ^ 
diftillaotis dcorsum humoris partem femper fcr^ excipit^ in- 
deque chiîofis labâtaâamur ; vnde nouas celebre rcdun- 
dantias'fiippedicat.;; rm^m etiam quia in hac fluxipne cxcr«- 
mcnumis humor ad fehiea^ parceş toţus ^xcurrit > ita vt pa* 
rumautnihiladpro^imas, atque cofpicuas vias Narium aut 
Ocuiocum tranfmiraturj pr^exUm iî â frigore defcei^us hic ^ 

Digitized by 


exckctur , â quaexter&is aiHnîbîis c^ids partiljus âtsa&mi 
mm omnia, ac dcorsikn exprimuntur ; ex qud cjums iUos 
exficcatos confpicimui. In vorniwigiairi. duai violemo «llo 
motu plurimi vapotcs . %irkQ*, tenukaqoc iai^is^fum 
affi£traferunmr;yadetuactetftparJ&€apatr^lm, iaciem 
f ubore difFundi ;Ocuîos pfpfiîire obrecimntis, vena «mncs 
in capite quaque verfus intumefcuBt, Se dilatantur; yjaque. 
quseoceluise crant,aperi«ntur, k cerca certiusp^etex vo- 
mentiutn îacrymis , nec non ftillantibus naribus :: hinc iiu- 
sio in voraitu , nonfoluia concrario motu fiirfum propdli- 
turUcvetus iiatur» tnos ad infera trantmittendi quodam 
modo fran^ixur.vt alio tranfmittere afFuefcat;fed ad proximas 
ctiamoartSderiuatur, &apaorcsei paanturvia ad nares 
autalias huiuimodi partes, pKentes , atque cofpicuas.; quo 
pa6io,vt vidimuî tex.^ 5.-Jib.2. ,in fluxioneadfpîeaiiJ,pii:uţ- 

vomicus ns tofiiTioia , vcl Optime nutRentiaionlulitalimcJita, quo auCtis 
tcMidus vai humoribus ia cerebro , occluâque poftîcarum partium via 
^u^nZ ab vftionibus , ftuxionuo* nteatus ia anteriori capitis parte 
ne difpofia ij^jarentur . C^<>dq'tBdefft>ttoaaHascem:m<iusa cţit, quam; 
"^ ' cum fenforia bene aifpofîtafuef tot ximUoqtie pcculîMiaffe- 
a» laborarinc i ne&sflataqueeffct per afedam tune partcm 
euaeuationem moIM i:*ftde , vt %râ vidimas , iaboramibus 
Oculis,aut Aurrbusvomkum Hjppocratcsinterdixit . Quod 
ii lib. de artic., in Aurisfradione eum a<biifit, praetcrquam ,«.33,, 
quadmoderateMfacitîaffeausiileJâtis extamiseft: hinc 
prseferaarionîs gratia ^cuft in vomita obiieîantiH:y&conâri.D* - 
<nimur. Qwamuisauteai in V^ymidi'otais^aâaicaputrcpkdap.- 
pireat; fuşax tamen plerumque €ft€a;:i^îio,vtqual va^^ 
ribus, fpiritibufque m^nâ ex parte pendeai^ quibceui diffok 
îuî^De,& uuntur . Ad hsc PulmonesSc Thorax, quiâfluxionibus aded 
"^^J^, ""T infeftari cosfueuerunt , vomitu ita iuuairi foienc , vt Hippo- 
micdiaaaa- ^_^^^^ pjoXabidiscxpurgandiS,.vixaIia-vUa euacuationc vfus 

b^dtfJ^. ^«' vt patet decurtentibuslib. nio«b; ,-& deintcE. A& , 
pur/a:Hxpp. fed.jVade aph,8. {eă.^.j vbi vomitusTăb"efceniibusintcr<fe, 
citur , explitatione aIiqu*He€cfibi<>indigereapparet j ita. v£ ■ 
vei devoinitibus tanEiimjqaivaolenterfittntjintelîigendus iir,^ 

â quibas Pulnioauaa yeflaî&âBgiafifcruitlib. de^inter. afiea, 2^.1 

"^'^'V : vei 

Digitized by 



vcî de naturis ibi loquitur ad Tabcm propenlls , quas > dum 
Pulmones acThoracis vafa mulm adhuc diftcnduntur lucci^ 
partcfqucillasfiaccidas cx natura,imbccillimafquc obtiacnr, 
non âb re eft > in concuffionibus illis periclitări , ne quid ab- 
nimpatur ;At qui de fa<5io Tabidi funt,exţenuatique> Pulmo* 
nes graciks acq;exfuccos habenc , itâ vt poft obicum diiTccii^ 
^idi rep€riantur,& coriacei^mcmbrans fpeciem pergament 
pi^ fe ferenres . Horum icaque cMiit^ZQsvomitotîjs non aă- 
modum validis apte cxpediteque purgantur in celeri illa vo- 
menuiim Thoracis conftndioae. Aptiffimum cft iîkd:, quod 
^^•7- lib. de inter. afieCt regiftratum eft > prseter c^tera > qu^ aii- 
bi habentur > ex Melie> LaCîe > Aceto , ce A qua ; ommbus ia 
oîla cepefadis, capitauque Origani ramuîo agitatis. Diximus 
quidde Natura advomendum apciori^ de Tcmpore, de Hu- 
ni ore, deque morbisv quibiîsVomiiios fuccurrit^» lecundiim' 
Hippocracem ex varijs hinc inde conquifitis dccumentis kn" 
tiendum videatur . Cseterum apud plerofqae religio eft,quid 
contra hodie pradicantium opinioneni pronunciare; vt qui- 
bus cordi magis iu vulgatis quibufdam infîâere opinionibus, 
qnâm veriţatxm medicandd y explorandoque ycnari ♦ 
■v, ■"■•.*■• '.^ .., .■ ■ '- ■ -..-.■. '^ - ■■■ ' 
XXX. ^ Antiqiii morbî diffixrilius curantui% qiiâm recen- Annqaimor 
tes. Veriiffî morbos antîquos primum xcccntcs face- i>i^cnouădi, 
reoportet. . 

Qrbi>:fiue fîmrîares fer ^fîoe organici , iiue comrnu- 
_ ^ nes 5 vbi confenucrint > curajf difficilioresjemper vcmftio^ed 
eifâdunţ»Nequeobijcias^Ceiliim> qui iib.3.'cap^ir J^^x^Hf?^^*^^- 
quiâem: fnorhm > inquit , qm ^stiifim^ep; tongus autem^ quo 
recmtioT ^ eofacilitis curaturi ibi enim nbn de ea loquitur ve- 
vetufl:âte>.,qua? in habîtum pene morbos vertit , redditquc 
cont umaciflîmos; fed acutorum potius quaiidam declinatio* 
nera %nificamts cuna icîlicecfedatis qij 
bus accidentibus^ morbique traiţfaâo i^n vigore ^ quo tem- 
porc a curatione omnino ceiîândum fuitj^xaphoriiîni decre* 
to , Vigmîihus mmiis ^uisfcere mehuse^ > & ex Hb. 3 . de morb^ A^h,2s.k^ 
CMmimţmfi^urmorhus,^ Aegmm^ ^Medkmn â cyratimihit •• 


Digitized by 



Saeftî ^';"*^'^°'^^^^^ţ'-e^^t"f-q«aetiam ratione alias dixmt'. 

«umm temponspardum difoa/ia fuum contrarkmTn S 

in afFecta particula itâ conculcacur . vt inde poftmodumauem 

bo^ D Jr^g ?"S^"'"^qî^«^^^^«"V ncq; vniri fine magno la- 
bore po/Tk:. nuc accedit, quod Natura poftQuâpluri4mc,r 

^a vcrahtmorboructiratnKîfed afFedtam defcricpartem fuh 
^eâionis impeno^cs: quo non modo valida oSiS? fed 

ram haud adminicuiantem nancifcantur Hinc?^ oua/ 
tommotamorbifca mama, auînrius m»rA„. , 

-'^"«^«"tas. Vi minus i-eftitiijjjQ/ii j«,„„j- u 
mr; quod in v.ulA.erib^ pr^rdai itSr^ '«"peaieba^. 

«««'«J^^^^^fyS^T^^^ "^^^^"^> fie loq«i:ur. 

eixc aixzt, quod id, noiueznera , fcd aute adme. 



Digitized by ^ 


dum praftândum fit; mem©r eonfîlij illius ţtimUfi(L Exer- J'J?'*?''*' 

xxxir Vkuscaliofumfaaum^eieaa primam duritie per ^^asc 
putrefa<aorium medicam^ntum, conftringere dein- ^^^?^ 
deoportet.Piiarniaca, qox tumefacere maxime fcm. 
foknt , ea pura vlcera adftnngunt; Qu^ vero atte.- 

I ^yant.eaptirgaîit, Sivero quis conftriiigit vlcera 

' nondum maturai corpus segrotum nutrit, quod vi- 

Gus habuerit r & fîquidem oporteat adftringere yj- 
cus , ac implere , tumefacere oportet ; etiamfî in că- 
piţe carnem velis ; renutrita enim â cibis caro , pro- 

s puliat eam , qtwe â medicamente putrefacfla eft , & 
fimul cum natura debellat. Verumeleuatam,autlc- 
uem carnem cibis gracilem reddere oportet . 


Nueteratos affeâus > ad hoc , vt curari poffint > noiiandcs 
. priusefle^ iam fuprâ docuic. M calkfî vkeris cxempîo 
nune comprobat > cuius curatiua mechodus liquido hic con- 
fcriptaj^ft rPrimariâ namque vkeris indicatio y vnio €xjftit , 
nur ramen nequicquam tentatur^niiî cauitas> regenerată cat- 
ne ^ prius exsequata fiierit : neque ilîa potcft reftitui > jiifî 
caUafadurides, quse ercraffiori materia intra poros infaret^ 
e^ccataque , coagmentata eft, ante eximaiur ; quod vt nam 
grsftandum fit , fie diflerit • v \r 

., _, .' \ r n ob humores nîmirilm crano^, 

-; ¥icus calîolum i^ctum. pj^^-^^fi^s^^el melancholicos , ^^^; 
/quodcamcoIorediIcermtur)j ^''''''' ^"** 

ibique temporis diuturnitate â naturali extraneoqiie caîore > 
tcnuiorem partem difloluente ;exficcâtos ;quodfiftulani^ 
vlccye coatingere potifîîmum confueuk • 
^ Eieda primum dtirine per putrefaacmm me- 

dicanientum. quod fciîicet> vim habeat, cmofficndi, difloî- 
^^^3^ ueadi,refoluediqi>dequo morbJvuuLQl^ 


Digitized by 


55^ m?20CKAns m.nLDS lociuhom: 

' 1 Iompa6iosUquenthutnores,atque diffoluant; nam 

t %î^- <|u^medKamci«a,<îuonainyaldeet^defîc. 
Skntibus acria iUamre;opâmo admifc.mur i r^y^ 

iriiditaten. abiumunc, ^^^^> "^^^^^^^^^t -^ 
nria uviiDlicker , qu2 , vc tex.citato aniiotauimus , px iiD. ae 

«^^ 2=^'- cum aummls , csteraque huiuicemodi, qu^ exiguos callos , 
& in moîli corporc , auferre valcnt . Csterum h magm , plu- 
rimumquc inueterau hi călii fuerint , caufticis panter mecu- 
camentisvfeno, atquc ignc indigene . ^ 

ad vmonem iciUcet 

Conftringere deiiiae oportet . ^gjjjcere . 

' Pharmaca> qu« tumefacere maxime folenr. 

fuccipîenamnimirum, vtifiq«<=h^^otetn^idam teddere, 

-cituefoîent,parteni. Eadefctipfit Hipp. liî>. ^„^^^ 

. quiens . FJ-f carnemproincere voles, fingiăa ^ cnhda mtps cm- 

î^,â2^Ammnahhismimc^opMat. moderato e:cmnu:alorc co- 

turiavkcii piofiushsecattrahunt alimentum; aetcoaiftem hutOKloW.- 


= ncmm^agdutiiîari poffit; immuni enim reddito v.cerea 
-callofâ duririe , omniqiae afioprseter rmurali aftedtu ; iutre, 
^aaqueidaneamateria, naturapoamoâumneceflariam car- 

*nem aggcnerat. 

°° ■■ . . NamvlccTumîatera,cum 

Eapurâvlceraadftnngunt. neque âîcijs , nequc fî- 

bulis, nequefumraadducipoffintvtvniancur, quemadmo- 

aumfîcinpinnbus^ulncribus ; idque obaropium, quod m- 

tcriacet, fpacitrm , amiffacarnisparrei reliquumcft. vcrege- 

. narata 

Digitized by 



iierâta carne illud expleatur j fie erum, meaiaJiaciiibfîâatia, 

. . . . • y-îdetur Hippo- 

' Qu« yero attenuant, ea ţsurgant . ^^^^^^ yerbis his Attenasus' 

fefponiere tacita cuidam interogatîomT<ur kilicetacaJo «juomod» 
confumpto flatim ad vkeris vnionem accedat, nulia facta p'^-^- 
mentioîie de abftergentibus ; qusE amen neceflanoprsmi:- 
tcnda vîdetitur , qu6 vlcus «inundări , omniqtiea^orde ex- 
piatum reddîqueatrnam^iâsBoncoaîefcerer. Relponaer 
ctoo medicamenta, qusattenuaiK ,ea etjam purgant; quafî 
dkac-eoipfo, quod adc^umatterendum arcenuaanbus 
vfi futiuis., .calidis iciiicet ^ tenuiJiufque , vlcus ^tiampuruns 
seddkiimtîs:H§c«tenim medicamentajexcrementiuas etxain 
îiumiditates, fi qus fint, esfiarando ablumuni . Quodfî j.bâerŞuâ^ 
terreaemtnfuerincitâvteorumtenuirasinterKoattenua- ^"^^ 
£o confifet, vtfuntamarâ, nitrofa, & Mfa j vere etiam ,pro- 
priequeabftergent. Hmc refeHitur Maitianiannotado, afle- J^r^^^ 
eentis Hipptieraiemidco ab abftergencibus abftiniufleîqtrod «iioa.v:ce- 
h2ccaUofismvkeribus&fpe(aâ.fint6b.riccitâtem:feruida '-^'^' °' 
^cninv«mii^*cu^aAd calU-durkiem^ilftyidendasî adiybeii . 
„on pc^Ebntnpn^fian skficcare. Aâfeut pmerea hanc -cu- 
randoîtmi.'vlcemm meihodiim EcmJnemokecHfe ; quş ta- ^^^^. ,,^^^ 
menQequc©aulum:pE2:terJît,:quififtuîaş^Jlimi elidemibus, căpXo"" ' 
gîutinaubufque cutat.;. nequeCelfum, quiab exefo cailo f^J^r'^' 
adcicatriceînfuperinducendamiUkQ accedit. . * 

.. Si verd.qaiscâiftrîn^tvleerajiOR. du matura 

hoc eft > fi carnem gignereftudeat yOptimuîîi trahens.&hgur . ; 

nem ad «o^riinfarteraxallo lion dum emollito ; iHC<^iideja 

nil aliadĂcit, quâm.qud^dafeiiaai.p*ctjem cqpioşejî^ric; ,: , 

qu£ debUis eunv fit, . excremesita ada«geţ , kd icque ; cum . . . . 

Kon puia corpora quoplus nupămitur j eo magis ladaDtur.ex 

aph. i.o..fee.2..:, - ■. -^ .:;,...■,■.■-:. ■, 

' fEţ£qw(ieadftringereo|>oxtcat\^cus^c-lmpfo^ Adftt-âk.. 

Vii i^erdi- 

Digitized by 


perditum fit 3 noua? fubftantiaî produ^one , dum quodaÎH 
îamm eft reftituitur,ad vnioncm pariccr deducimr^vî diâum 
foit; quodmmcfaciendo ficleu turgidiorcm reddenda par* 
tem y vbcriori ictraâo atimcnro i eiiatn in ipfomet Capicc , 
vbi cum paticiiîîma lîc caro;accâmeaao nifi ex mmcâclionc, 
^jj^^^:^ fcu nouialimenti attraciioae regenerări poceft , fiue ad câni* 
ac nouiaîi. tâtcm expfendam>fîue vt quid^cutis vice gerens> oroduc^ur, 

meati ama-. ^ ■ t rt • 

ap^ m^^. iS^enutrita enim a cidiş caro ccc.^^^^ ^^y.^ ^^^ 

affecSus cuiufque cxpersj dmia a copiofb siiaieiito , â farcoti- 
cis attrâ6lo>augemr,adiutaa natuntli expuîfiua ikcultare cal* 
lofam fubftantiam medicamcnti vi putrelaclam , atque 
emolliiăm , exctitit , vdi^ efcaram & croftas , vbi fubiecîa 
pars ia incegrum rcftitmaudi,. 

. Verum eieuatam > aiitleuem carnem &c. ^„ JJ*l^^ 

etcmai aa- 

dieâto eft , Se ablado ; hifqîie fiias omnes molitar opei^ 

tiones: crgo quemadmodiim.vî>eriori attraâo aliinento* 

quod vkeri praîtcrnataxalitet:d«erat , j:eftitak;i ficvbica» 

xo nimiiim fupta viceris iiipcrficiem excrcuerit-;; autgeBita 

caro leuis > hoc eft inanis > ipongkiiâqite fiieri t ^iUstXîi > âQxxzr 

&.0 âlimento >graciicmre<kiit> atque extenuat . Alimentum 

verd tune ctiam detrahitury cum acribus cxlîccamibus me-? 

dicamentis abfiimitur» Hsec iepdcafeucarnemminuentia^ 

medicamenta ^communiterBiincupamus* 

Triftes , anxios , & ^grotos , ac fe ftran^îare vo- 

ÎJr^.^i^?;^ lentes. Mandragora rădice maneinpotu data mi- 

»^* Bore pondere > quam quod infanire facit, curabiş , 

Maniacgco» II ^ Aniacis pr^fenîi hoc textu confuEtar > qui animaîibus 

fîdcxaria. | ^ J^ Ipiritibm ab atraferuidaque aduftihumoris vel malenf 

cholici, vel bilialî cal igine obtenebrati% commotifque,men* 

te percelluntur , imaginantur horrenda, â quibus mastent., ti^i 

HJentque , anxij & inquieci efFerantur > in obuium quemquc 

immaniter irruunt,iîbiquemet ipfis vefani manus ini jccie noji 

yercntur . Appo&it^tem Vdcem illan3>^^£^x> vteos^^^ 

âe^c, qui vlk abfque cc^rppris ââfe<^bac^ ob 



Digitized by 


«octâ caras , aliaquc pithcmata, brcui tcmporc quandoquc 
iti %ârem aguntut . His it8q;opamum praîfcnbit prxfidium 
Hippoc. cxMandragof 2 rădice; qua;ipaoacacumiîc,na&. Maa(i»s<«î 
couczq'^Cyadetc&itDiokot.ScVlm.mynDiiOos ciusdsco- '"«' 
aoio vinoad.cyathumvaiadoIoribus, & .ante feaiones , ,^^^!fi;: 
vfiione%ie,ocfeaiîanwr)n<miuodofoiîmumconciliar€, j^JJi^=«- 
fed dclkantibus omnibusfurameprpficua ejdftitjdum iafa> „^.'jj/^* 
fiidaado, incrairandoque, commotos feruidofque ipiricus 
icdarcacqueâttempcrareapiâcft: vt emm îegttur Iib. de 
5î* affec. Qri^fotaaumfaciuat, ea4M^emfmgumexhibere nţtsmt. 

Sed quoniam radix hf c imtaodka fuiiriggidiţate, quam leruj soaaifot 
cffeordinisteftaturGaLUb. 7. dcfimpU med. iac., narcoa- ^f^J^^: 
caquevi aoo modo foipcfaccre» reddereque amecrem po- 
teft.animales fpiritus immobiles ^ciens î fcd afe interiium 
vfque 4ţ;ducil: , fi copiose Himis cxliibeatur ; quantitatc 
€aitn folummodo dcleteriaeft j Deletmatmtm , ^.^u^upue reietai^câ 

(inquitGaI.a.dcvia.acut.t.iîOj»««>»«**'l«*'T«*^^.* tÂ^ot 
ma^am perc^muf£ommodita£em'. Qua|>ropternoxiaquanti- ^^iiitatenj. 

«as minuenda crit> atque intra fahitis cancdlos^ietinemla. Ad 
^obuktmtatd dări j^sffeautfaoreâDiofcoHdcs loccic, eiu£- 
aue vires impenfius peifcrutatus e& Mamanus annctat., ad 

Contitdfîoîii fîc mederi oportet . îgnk ab vtraq«€ o^Lo- 
ledi parte-âiccendatiir , & Mandragora radix in 
pQtu prsebeatur minori pondere , quani quod in- 
faniam &cit, & ad tendines poileriores facciilica- 
lidi impoiiaatux . 



OnuulSo, hoceft , mufciâiadfuQmpîincipmmiîHîo- 
V jtonaaria contrazic cumes Hippoaated.aph.39., 
jibtoanitione . aut-xepîetioue neruofarum parnum h« ; cer. 
îuin eft in prifenti textu eiusicfti'.ui curationem,q«£ a crafh. 
olutinoEque humoris repletione prouenit; cuius conuuiii- 
&Siam.d.ffolaerl, tenuare, diffipareque^ ^r^ 
ccnfo primiim igae âbvxraquekdi parte , aquo noa nvodo ^^ £,. 
* V « * *cr> 

Digitized by 


j4^ Hu^mcRJTU UB. III. im loc. m hom, 

Aer, qui intima fijbit corpom^^incalefcat^/fed totum etiam 
corpus > vcităinmîgi>foueri<juevtilius poffit,. Sic & 
inter» z&ă^Hunc ,cumfic kahuerityfQuere cportet ^ifpnguiter ^^' ^5- 
^nBum , ai ignem , mn itiţrope , calefacer^-^ ^ t^^a£faria iilito 
corpori exhihere ^ jhffnîhiumy âMLcnm^^£Lymî$ Hyafciami 
Jemm^ Thus îmîa^ ddndevmo dho diluto inolhmnmamiTifiin'- 
diîQ > ^ oleum pam cum vino menjura affundita > ^cumlm cde-- 
faUis-large calidîs corpus, ac căput illmta , pojieâ Juper peUicmin. 
indHfnmtum recUnatum , moUihuSyacpuris^rapdii cmUgiîo'% ^m 
€eir.ab,4. "oehementerfiidavâpofjît* Celiiis icidem . Ineaconchui > inquit , 
^ 5- in quQ mhahit Aeger conuulfiis y ipus continum ejjedehhit , maxi- 

me^uetempore anulucam yquQpr<sedpu}f^igusinten^ ^'^*^* ^^' 

autcm de morb» aon moda proximam^ jrefpicit m^tcriam ^ 
piagues. adhibens vmîtianes & fotua,.; a<juîbu^& lîoxiiîs di& 

dolores^i fed antecedemem etiam iţîgro veratrapurgât in* 
_ quieas-in cura Xeicaui., Smccataptia m Fipp'Âx & YM^tro nigro 
. .y \ ^momndădătCy ^iufmlum,^^^^ 

Cum auimtfommtiS' nonfotitur: > cai^^^ori^^ hmHâ4 ă^pwgi^ 

ăâparţ^s dolmUs X & cAÎiâQ,oleoinulîOy. mJ^philUnmtur: •; Hac 
pariter ÎBtenfione feccuîos nori mod© caientes ^Ctu, fed cale- 
âciemibus eîiam esficcantibufqi^e repletos , vt torretaCto 
Milia» fiiifur-e , âîe , Chaqîa^meio^ ;%lui3 5 Bet^ 
no>. c^terifquc huius c^nfus^a; polkrioribas coHij^artibu^ 
|>onic> Neruorurîtniminkii exormi, Spins(|ue principio, 
afteâio bsEc plnrimum viget > abteridines compîures &ner- 
Miavsgoîâ uosibidcmiâtiranîes* SedcurMatîdragoramexhibec, quam 
eouuSsopi fs^iggidiiîimam efe pauîo ante diximus ? friggidum verdcon^ 
îkicîur, u4UliOiieamouet;>,,&:n€ruisinim^^ exaph. i^.&.xS. 

fee. J-C^irAoirndmorbificammateriam augere> aut rebela 
lem magis redder^ apta exiftit . An ifla doloies fedaty qm afc 
- fedum hune acerbilîîmipleru'inqne comitantur ^ ob diftentos 

xnufcuîos > qui partes diueîlunt , & ob friggidam neruorum 
iiîteîBperieiîi; indegueYigilisepîurimumaugencur^ virefque 
- diilipâutur? Immd> sih§bmxt^^zQm.^inconuulJifico Tnorh zm,^^, 

Digitized by 


.: -, COjy.MENrAKilS IZLVSrRATVS. 54t 

xnntâohres ăcceffmnt ^ aîr^Ulis^ âtriumfluxkmr/n^^ffiii^ciîs . 

jmnt* InvehemeiKieîienim dpîore, vigHijfque c^rrumpicur doioifb^ax^l 
fanguis , humoresplurimum aduruntur , fluxionrefque ad do- ^s cumu- 
lencem concîtanţur partem : hinc $. epid, icc* i . in nepir/itids 
.cum7^ămi(mşţ-M euammtur : vnde & hb. de 

^**®^^* liumi4 rfMf^ Somniferumi^ in cMputt & in alia . Cmnulfionum ^ 
i ' tmjhmm mitigăUmm ; dolcresjhfsfacit ifc, Pr^ftax igiiur do- 
^ Ip^îîiVîxuaquequamcitiusie ad qijpâ narcojiicis criam 

h^dauacrantiquiţas via€ft> q^ & prudenna no- 

xia etiamjfciuk ad hominis vfum reuocâre ; iaîucaria auxilia ab 
exiciofis aon minus , quam âialubribus colligens * prster- 
quam quod non adeo certum pleriique eft num itupefâcienna 
ift4inc€nse fim ftiggida^ eaque friggiditâte opereRtur* dum 
ienfum âdimunt> auc inuehunc fomnum i an pecuîiari potius 
|iarcoticaviammakni£pirkumfigente> reddencequei^ 
bikip ; cum fomnifera pleraque non pariîm calida depreben- 
dantura vtViaum>Styrax,Nux myriftica, atque Opium ipfum 
amarore, acredme , faucium ardore , atque fiţi > quam allum- 
ptum excitat; infiammabiîitate prsetcreâ^grauique odore> noii 
Jcuem caîiditacem pr^ fe ferat , vt ex Doxmgio probat Scnnci:- 
tus^pracl. iib • i> part» :2. cap. i . q* i* ' S 

. ^ A coîiuulfione fîfebris îniiadat , l^datureadeni xxxvil. 
^die> aut fequenti , aut omnino tertia .. - - ^ ~ ^ 

GOmmliioni, repîecionîs coniecîanese , vtaam exarte 
mederioportear^iamuipraexpofitumefi^ etfi concise 
admodura : Nune vero fpomaneum psoponitur pr^kdium > 
Febris nimirum^qu^e fiue a Natura intra CordisIacebrasfaiVi 
guinem &c ipiricumreuocantc,vtinfluentcmcaloremrcborev 
atque ad noxiumdeinde euinccndum , quod fun^iombus 
impedimento efl^per totum corpus tranfmittat, iuxtâ dottri- 
namluprâ allatamde kbrihus; fiae^bhumorum omnium, 
fpirituumque commotione excitctur;n€C non a magno biliofi ?5^^^^/^^^-^ 
pumoiiâ prouentu ^ doloribus,atquc vigiliis geniti, Conuuliis ^^^^r;';;^. 
^aduenu-e iolet ; cuius igneus calorconuuliificam materiam ^lo^u 
exLcnuare > atque difcutere ^ &iggidaiiique neruorarum par^ 
' ' *' iium,~ 

Digitized by 



tium difcrafiam attempcrare perbellepoteft. Quod vtîque 
tuxilium , vt mire proficaum eft , vnde locis compluribus rc« 
gjftratum reperitursVt i . de Morb.>in Aphorifmis,in^Coacis, 
alibique, itâ ad hcc vt affeâio adeo Humana: natura? exiriofâ> 
cuîufmodi eft ftbris^ conuiiîiioni vtjîk ej0fe poffit > non Rulli 
requiriHîturj quse opera^preţium crit mmc paula âccuţatius 
"Bchzkvz inquirere . Nec^^crgocUprinio, vtfcbris conuuîfidnem 
^^^^^|. fcquatur, nonaucem precedat 3 iuxtâaphorifirium 2^. fedw 
fc*iriai^ F^^r^î» in Comuîfîomfimr metim ^ , quâm€mmlfionem infehf^^ 
wlc dcbc^r I^ixit j melius ejî , quia vt plurimum ita folec : contingie nihii* 
ominus im^dum > vcfebrilis ajateriae venis ad neruofas par- 
t^Sy au£ coca , aut maiori €x parte traflfpoiîta, excicataque iad^ 
Fcfedsquan concuiîioBe , excutîâcur dilîîpeturqueţ quapfopccr febris aut 
aXnc fc- ^"^^^^ ^^ exdnguetuc > awfî quid refîduieft febrilis materiei 
aatiu. in venis 3 poftridxe , aut die tertîa ; ab ip/âmetuaturâ peniais 
commo ^^^^^ »/^f^î^^^q^^ morbofa materia ; vnde cxcat Coacă ii- 
in febre fics, ^^ *<^<>^^itiIj2<)infehremota y fehem foluit codem aut altera^ 
t^^ Wcer^^^erti^; Quod ft tempus trm^rediatur y quo ah initîote^ 
boaacâ^ * nă^at y mc acqmefcat ymdwn\ Fugâxitaqiîeconu4ilfio,iriixâ 
fearam defîneiîs, etfiplades repetat, falutaxis in febreefle po- 
terit; Quod fi perfeueret, materia: comumzcl^^m fîgniiîcabir, 
qu^ iam obiîrmata in neruis ell> ac proinde in malis annu* 
^^rari deb^* Vtplurimum tamoi, c^nuulfio msgnarum 
fe-brium&quax, Bemofanîm partium exfîccatioiiem dcnim- 
ciât, qu^iieque pric^emfaluitmorlxam^ neque ipfajfana* 
biîiseft j vnde plurrbus nomiuyîus exitiofaerk 5 vt confiat ex 
iec.f4.apL49.&^.&aph. i^/^c 73. lec. y.&alibi. Atfî 
febns pr^ceifcdt, nequc ^ hukis exAccatioiie . kă ab alia 
canfa conuulfio fupemeaent^ tune focundum requifitam erii^ 
vtf^oft coHUiHfionem febris^ qu^prseextiterac, exacerbetur, 
vimm concuffione , turn adauao c^ore conuul/îficam ma* 
teriam refoluat ; iuxtâ Coacam ilhmXonmilfionem fanat exorîa 
fihns^ay qu^ţrins nonfuitiquodfîţnusfH&riîy exacerbata ifyc. 
Tertmm requiiitumeft, vtexorta febril magnaiît făcuta s 
aîioqui non refoluit^ fedexsgitat pocius, magîfque impingit, 

tffHperjehrienti (ialute, idet^ kuerpolace} diutine^ţ^rnidos^, ^ 

Digitized by 



Uumen^fiHoft qmm prorrheticam animaduerfîonem fie tra- ^^^^.^^^ 
AnyixY>nttms. SafmUHs aîioqmAţoţlexU picxi« q^ă. 

$imimtelmtafehre,madiţmortifera,6€. Teraumrcquifîtum^«<*3da- 
cft>qaodcumComiulfîo triplicitcr exolui poffit > niminim commiiîQ» 
autconfumptofriggido acglutinofohumore, vtficexortafe- ^^^^f^ 
bre ; aut eodem fcnfibiliter euacuato per Aluum^Vciicam , 
autVterum; vt patet ex Coacă modo citata in 2 . requifico : 
additur enim . Quin eîiatn ţrodef^vrimm fmere dhumineătn > 
ahmn fern, ^fomnos inire ; aut dcnique eodem conuuliiiico conuuifio 
humore ad co^ione redaCto â naturasqnod m coudliorabus ^^^ 
abinflammationeexortisprîecipueDeceffariueft;exfoIuendi ^^ f^xxn 
modus morbific^ caa& proporţionări debet ; ita vt fi ab in- coaione. 
fiammatione morbus excitatus fit, non per febrem diiîîpano 
quseratur: nam tune perniciolapotiusfebris cenlenda eft, 

ţrimum , mî fiatimaţparmn atque id fine febre . Ex qua coa- 
că quinda colligitur , atque vltima conditio s nenipe , quod 
modi hi omnes ianandi conuulfionem , ftatim poft ipiam tot^JiKi, 
exortam aduenire debent, ante quâm conuulfio obfirmetur: 
nam vt alias diaum fiiit ^ morbus, qui in iîcco eft , vt fuaţ 
ncrttofae partes , ftabilitur , 8c non ce.dit ; hinc dixit Senex 
ntuUebria ^quj: ţrimum,autfiatîmScă quonizm febris^fquod -^ 
maxim e mira m videri-poflet)fepe praehdioeft iamorbis^ JAud^ 
fopereftTâm^vîîendunî , an iUam liceat Medico , ad naturaj jj^^^^ 
immitationem excitare in Conuulfis . Temeraria certe vide- ^^ 
tur bsec medicina , quam vix vmquam itâ aptaueris morbo j 
quin aut vehementior fit , & -^grum perimat^ aut leuior 
quâm par effet ; & nosium humorem irrito niotu nequic- 
quam exagi tet , impingatque , non concoquat , aut refoîuat: 
bine Hippocraiem earn num quam exciafle legimus , quafî 
prsefidium hoc vni mmtx reUqucrit • Ar quia fepe temeritas 
adiuuat, quosratio nonrcftuuit; ide6Celius,& <;umeo 
aii] nonnuUi, baudai^erid coniulunti vbimagnaad&frig- 
gidiorum humorum vbertas , naturaq; fegniox fit adpraeter^ 
liamralem hune calorem exciatndam,iieque alia? cuacuatio-- 
nes profuerint: cum hoc ţamen > vt fi id quandoq; tentare h^ 
beat , quâm ocy us id efiiciamus ; videlicec prius quâm mor^r 


Digitized by 



a^&«- ^"so^^'^î"^^"'^' l^24^"«?q^i«c^rabiîis*Scr^bunca/iq^ifca- 
itetuxin-, rabcos cant^ eiTc pocencis, vtfi îii oleo ciecoquamur,ilIoq; 
c«d^S". feracchiaîis araria inungatur , confeftinj fcbrem.accendi, 
, Hac ipfum prf ftant aiij exhjbito Caftorp^aut.Sagapetto,aut 
^^'^ -opoponace cy m melle a4 aucllansE xn,a.^aiaiâmtm ♦ 

xxxvnr- a ruptura febrismon corripit amplitts, qu^am 
tres, aut quatuor dies; /î verocorripiat, & guis 
putatfeâ ruptura habere;âb aJia fana quapiam cau- 

facorripitiîr;& nonoportetipfam velutâruptur;^ 

curare . . ' ' 

QVîdficruptBra, qiiam-Grfd, V»?'.'-'*» spFÎ^3Kt.aocuk 
^ morb. mqaiens .'Qtijh^am aim 110.16. 
r^^^^^a. : "^ <ie^3/5^ fam fiierinttraShtsin camibus aut -venis , 

I^T^^'I j doIonSc? difporicisnis Botn«i.aptauitdblGri,<wem- 
* admodum 6c 6. aph. 32. Q2*c««^« w^tia «c d<>rfoadaâituvt 
^fiendmt y-oen^fiaio filmt. RHptutnTiquidem, & trauma 
defceH<kre, vnuro eft impoffibilium , inguk Gaien. ia corn.; 
vt qui afFeâg parti indiuifîfaMicer affisus eft, fed tenuis potius 
aliquis humor flâtuofo fpidtu non raro aflociatus , d«i ia 
. -rupmra<Glleaaserat,aîJo defer£ur,ibiq;d<)lorem€xckâs, 

fupwraî<jHafitranfmigrantisfpeciem prxfefm. Erkitaq! 
ruptura carnoff partis atfeaio ^ occKka fcUicet vnkatis foia- 
tio, vtq. dicit<îa|en. .3. meţh. cap.i . , citrâ v^ilnus, eo wor- 
susmodo,quo& conuuIfîGneruofi generis coafitoiiis eft af- 
ie<dio. ar^«.,^teodem i. de morb. ;legkur ,.i MoHfeij „u.,7. 

4 caS ^.^^^fi^ns ^ ^kaîa^^abhumfmodiomnbus, queyiddkeî 

aguibaifiat vim carnof§ fHbftaBtiş k>ferre.x}ueunt , ^asiq; diftendendo, 

contranas in partes iUico diftrahendo, diuelJere, atque ad ta* 

iem demq; rackatem deducere , vc infenlibiliter dehifcat ^ 

indeq;:cenu^salxguisrefudetcruor,autfaagumo]encusiclîor • 
qurm porofitatibiK poamodum ]adtans,atq. incandefceas! 

. ^^■[i^s.exaterdolorplâsaiFeâiones.ycIat^docuirHippocr! 
Joc. ac quui eîamficopiofior & craffiorguandoquStcf:. 

fufus • 

Digitized by 


tkxn^ymic^^y^t: nacujrf câlii^ţen ^geie Qâus 2m fcritis 

peruemm, jţ^iamcoî4ijj:iea<iumfi a xiipmr a ea pen<k% 

ipâsn aicaţam in r^zxi poxius aex^lia -caul'^ ^i^ciofa fuerie , ac 
pari^ curari-pQftu1cî./JSIâm-fi zntttm^mt quatuor dies ex^ 
ar&rit 1 ceraim c&,^i noa â rupîdaii^^dab alia caufa ondine 
duxiflfe ob alîaras rationes. Qae planeanimadu^rfio iu amnir 
bus ettaai vulncribus^ quibusAbris aflaciata iii^complurimi 
vIlîs:^po4i€fit-^: . ... ^rrr:''^^ - -^ ;^ 

ZX2ÎX ^ Cumiionib inanîbus'Sc pedibns'dill^^ 

txxrtus fiieritjnfariîam fîbi îpfî facit , « <i*^^.tn?a: 

HOc logucndi geaeW-, ^nil alkid, npuco .> fîbi voluk 
Jîippocr^^:, -guam -figQQm qm^dpiam propcaiprc , 
qui% ik^^oţafiţ^-a!^pie^o,q«o4^ig«id!5îîep|:€ aiit »^ţi<?ci» 

uenf ur^auuma^Ciîm^ îiichoaiam iiuia iQiâaiâm.dei:e^u^^^ 
fe^u^ amcntes iam -pawfeftc ;pr<^alant.s atqu? itdiafaaiam 
qaoăammodo fît>iipiişJSiciuriQ .non vtique quicquaui întrin* 
fecus mpuendo , ^id namque inrationabiîepeainisTkiccur^ 
fedtn conttpmikăunmîptioadftan , qui cos prudente* 
prlus «sătlimabaâît ^ yncK]p^x &oc4î^o caj^os £am meâce iîv 
tcfligimt rBam jqiiid:aluidl erkiuianiâmiîbiipfîiacgre in £ac 
cafy ?- ^^y|îj:^^fe^i^4«|S 1 |p^4biai<p .^âeadi a:t:^4iăori^i^^ 
plurifariam contmgaî: num aat pr^ter volundatem idiic^ve- 
luc in conuulîionibusjaiiC xplMnâ^rîc^quid^m; prajietcaiiaraii 
tamen cairfa^liqusi adi4 pxppenfioric exhibcate , vt ia Qici- 
Unribus pîpfuuiq; gc,vţ>iiCs:^us ac Şamleiicus aliqii is ipirims 
tj^iîfcidpş/ipşmpterşş'^^upau^ri^ Voluacxarie pra:t€|:eâ 
quis diftor^i^uii:.itiit obiter , aut tcmporisier^ p^omciico^ vc 
in ia;n:4i^?;-pfcitactiftaej ^ idq^ noa nifi crailiim fpirimm per 
niuC:5*fes pc^rccpaoce.<icnotacj ^c diutiiis iţa dift^ndus per- 
'.'7 ' Xx mânec; 

Digitized by 


' ^anctjac^mac ti^ttcemi0l%^ sii^arii^ân^ 
\&c! obliuifcatiH: ad? n3S5Kalefflf'fetimfo^^ 
aduecut quâm mdeebmm filM ptf mâue^^ac d€f^ 

hoG calaagittarin propofîî^ texto rquo^ 

diudus pcrfîâk 3 figmm 4at ^ mm32^ 
ladtaîc^qB^ sd htiiîMiîiodi dificnâionem dedi^a^^^i^ Cere- 
brum ihfaper iam occupafie , menteqiie îiirtoi . Si quisfeaţ 
fum îîiagis congruum tcxîuihuic aptauer>it>liab.£nâilime ei 
acquie£ccmus-». ...... 

^ j^ Venam porro fie vrere conuenit cBmmodzm ad 
TcBarutL^ moibuîîi ; cx quocHnque tandem qnis xgrotarit , 
^lâiirauo.- ^^^^j^ f^erit iiom(>^& ffiixerîtiangms,; itâ vt hoc 
T ' noRr perie tilofum fitTpfî;' aiiibolisec fac Si 

verd.peruiîeris ip{a3:^uni^dploi^^ gjuiu^g^ 
batitr : noîi coalefcit ^^^erurn JiixiU pr^^deft: fi^îm 
penrfe faerit, nen flmt ^^3^.a^^paâgHam-perufta^ eft, 
extronftas vtraqîreyeif^' recurritr^u^^te per- 
tiftaeit ;&exar elcit .Sryerog^ 
pra^ reE(fţo perffueiite fliatf Ku 
guis.ex ve»afluit>per trangie^S^^ 
son cei^i adiîsec &p|4 (^ p^ 
quQ fanguinis finxus: a^ertator:. dkki^aim^^mim fad'^ 
feis efl: medicamente fedare>quâffîc<^a<:eru«um • ^^ 

Vanr muîtipîex fît com&uffkmum vfus in Medkina ; 

& quâm fepe ad genero&m ho€ praslîdium gra- 

uioribiis, coDtuiiiacioribufqj.m merbîs debellan* 

dis confugerkantiquiras j fatîs patec cniqi^ -Hippeeratis mo-- 

Tâionum ^^i^^^^^y €3£terommq; PrHcGmm decurreîîti, qyî fiuxione^ 

viiisniuiti- pkrafqucy Ventrieuti, aliammqi partium knbeciBîtaces, He« 

pkx. patis Lienifq; turnorc^Eiîipyemau^Hydropem ^ Ifcbiadec% 

Digitized by 


- x--^^- ^mMMEmjRiiş^^mM^?jTr^^:ti 347- 

xlefecit atatte.ex6cca£^indcqae;%gidam lihco comgit m- ^i^ . 
cendo , denfandoqaevJ^Bcata&îcsboratpa^, flaxioxiuroqi^ 

fa . Pcfiremoin al^s fanguinis profuftmihus. Se Hip.p^r^f'^ Ac, 
^ ^ aa.^r.& îoc^e Scytk«:unj natura & monbus verba*ac;^cn£. 

ildsrmt'mU£ora^!t0m.muemaam;i> ât mips rsddmiv^-4rfi- ban- , 
ttionim-^ potetak:^ :& ©iofcbrides . Cmtrâ.vmlenî^f i^us. ^^^ . 
-Dps. sxpeâitifanmm efi asxiliimi, 'Utpgth. cum ignii c^umviri- iib.6,1'?^ 
hus.ţrxpufitml'4uedvirusdoma^ i/femţmitha^nmţati^, 

/ttiie£cki qu<>&io-coating«iasv^tBofi*<>bo.C ^^uo pre<;la?.uia. 
Hludaaxiliam^* oaines*îV«itu:£mdekaiTOiş, ţxpauţlc^rK 

feu qaod.Co?px3Ta Animique defidia atque luxu elangue«nc ; 
fcuMedicoramiiKlîilgeBmidfaelumrît, quos fopiusiu4i^ 
adyIaHdopIacer«,quamiEgrisieueri!:Meprodefle : iicgiUcit &a4ui»uo. 
«diesadubeio, aiitiqpimiQUusOxbj&mslum j omniaque 
vitiat, atq: comimpit . Kt propofitus iam tcxtus n<^ reupsat, 
jn-quatpro yenarum yftiojîibiis docuroen» traduntur , cum 
yiertisîcţiMâlarterîas- inty%ehtes V vt '^iâs didlum 'fuit . v^°»,^A| 
H2cytuyflrafadupIickcr;>dupUciquede<:ay,ravruntur. Du- ^J. 
. - . Y V 1. oli- 

X X a pli- 


Digitized by ^ 


j4* m^^^QKjms^^nmmj^m^^mc. w hom. 

pUcîtcrquidem^quk aucleuket» & fuperficie tcnus; aut pr<î» 
fund£tus»perfitâ:e<jue:pcrumntifi:.» Duplici aucem de caufei 
quia autadflu3ek>at3iim*^Edpieadam^quaîperHia vafa > tan* 
quam pertubosierebaturkdaliquam infeftăd^nj>aruculani; 
aut ad eadem vafa obferanda:,, vbi periciiblâaiiqua hemorw 
rhagia aut excitata eft > ' aue ctocti^-^^^ ptoiadeqja^ efchara 8c 
cicairice obduccnda . Vnde, Re loquimr > . / 

Venam fîc vrere conuemt.^c. ^i^^Ţ^p^^^^.;^^, 

venaeKge. ^3; cKgatur,. cpia^ coiiunodafîtadmo]rbiimcxim,curandam> 
^ia viho- âquo ^geriamdetinetur; itâytnoiîmoddtetSitţjdimem & 
coiifetxfum habeat cum afFeâa parte > fcd eadem praprie fit » 
per quarn.infeftus. humor ad partemkboraotem dedui:iîut> 
idquecomjci indepGtcrir>quddatttr«bemior > aut nigrior 
aut tu midior ^parcbi t Vena illa > ycI fi Arceria fit y plus fo* 
lito pulfabit. . : .' 

Si YftusTuerit honic^>^,& flux?rît'tanguîs^ &c; 

Quod fîgnutn eft Yenam imiâ fuadiţt^.dctîfîam d&> itâ v^ 
tota eius cauitas obcoecata iîr ,ftd fcuiter i&fiiperjScieteiîus » 
^ itâ ut vena? vnitas: fbfuta ab i^e taiitumis^o fit > pec qaam' 
. diuiiîonemfanguisdemdeelmîîditnr;, C^srquîdtmeffuUo:^ 
nilîobfîti quinimmd vtilisiî «nfeacureoquod fanguis co^ 
pioscibi coaceruatusfit^ ada&ci^n parţem confluxurus s 
quem prseftat proinde fie euacuari,quaîn, intercepta pesitus 
via, ad aliam infeftandam p^rtem.<fcferri; tunc^ inqi^^ >Jîiec 
amboiacere licet;iânguirastu"i^i^£cct.^ffimdere^^ 
rationes > & laxamm vrere^esaacfcy^t aEquaiituluiîidetiiitiu5 
& conilringatur , vt eiusxâuitate femiobibucia, i^queâded 
âeiliter^ neque tanm- vbcrtate excurraot bumbresrad:par» 
tem affeâam ; fcd is tantiim deferatur , qui fatis ad aleadum 
fit: <^od fi poftea vddebitimjpoteritdeiiiîopeifedevrijYt 
euacuata iam pecuUaa:! ilîa plenitudiac?, fknguispenitesiiipp 
primatur ;.-- ,■-•._-■ ^ '. :-■'•■;/..:.;: ^::.:. r-:;?^: ..,;-.^ 

Si A^ero perî^Hs îplam îîi 4pIoT^ 

; ^pcofondumvfque^flerh obfedauula»dal^ 


Digitized by 



îdonc exckabatur;mnc itâ fcinăitur in duas partes vcm, vt noir 

amplius coalcfcat> feu reuniantur hse partcs ; fed obcc^caca re- 

manetjnullum poft hac confenfum faabitutafiipcrior pars cum 

parte iiiferioreatquc ipfa affccia particula i. fed fluxul prodeft^ 

quonîam Vena -tali pacio peruâa > nonampEus permeabilii 

cftjfed vtraque cxtrcmitas ia parte perufta vtrimque rcciirrit , 

atque ab igqis vi exarefcit '^ vt fidium chorda obtruBcaf a i cu- 

ivis fîiperior parsadfuperioray inferior ad inferioxa rerrabiturî 

quaj exarefcentia cequaquam fcquiturjfî Ieuiter> imperfeâe^ 

vena vfta fit; nam fluente fluxu, acrecurrente perintaâam 

ab igne partem , icmper humefcunt extremitatcs illse , cffiin- 

duntque fanguinem * At 

r ^*r -0 -^ o^^ eovidelicet^quodinale 
^ Si^^guis ex vena Huit &c..^p^^f^.^^^^^ ^^ . 

quidtuncedt^endum>nfedeturbemorrBtagia? itenimad- 
mouendus ignisqUQufq; pexfeâe vras s^non in longitudiîienij. 
aut oblique^fedper tranfuejcfuinjtVt toţa vena; cauitas repente> 
& tuto prsecludatur : nam fi in longum, vena? laţera apcrta re- 
manerent ; fi pblique , niaior eflet fc6tio > ac proindc minuş^ 
tuta eius per e&bariim obccecaţio» 

5iyero non ceiietocc. ^v^^^^^.^^^g^^^p.^^v 

iiifluit> omnemqiW2 oppoiîtam efebaram deţurbat y oper^ 
pretium erit , ianguinem prim rcucDerCx aut deriuare^ diiîe- 
<^ vena in iaferna aut iupema pan^ > prout vîacbicur : iâcijius 
iiî^que efi faemorrhagtam, obftru^o medicamencis ven^ 
hiam-> fedare > fi ^nguinem piBis jad alias partes deduxcris ^ 
quâm fi iii diffeâ-a parte coaceruatus Jnipetum feciaţ * Quo 
mitem paâ:o &tnc hae vafbrum vftiQneŞjdocuit jEgineta Uh.â, 
iîtt» ti» cap. $.ScHip.2*dcmotbj^ei^aminţîS'oeri/mquimsycmeo vfton/ 

formaparaîis ohliquas ^enăsţmmto, yhi dicit obliquas venas> ^^^*^^^* 
qui^de venispoftauresIoqmtur,qu^ pbliqoe feruntur. Cas- 
terum cuneoli fonnaidferuoiemum hoc perfimilc videtur illi> 
qao agrari) fabri pro aîramentiscommittendis ytuntur , ex am- 
j^OLia anguftum definens, vt cuneus ; faldatore communiter 
s^peHant s aut ad huius fîmilitudincm aptandum erit % 


Digitized by LjOOQ Ic 


XLL Doîoris în capite gratîâ , fanguinem de venîs de- . 
lor^nlb^» trahito :fi vero non fedetur , & diuturnii^ fit; peru- 
tconiaoc^ reYenaSy&ianiiseuadet. Siverocaputpurgaueris; 

EXipîâmet propofîta euacuatîone iâtis clare în^Higitur 
de <juo dolorofo câpkis aiîeâu loquacur Hippocraces; 
de cercbri nimirum replctione ab humoribus , vaporibufquc 
fursum e reîiquo corpore perrcptatibus . Hinc primo fângui-» 
nis miiîioacm PuadetiqusqHîdem initio â bracchijs, vtafcc- 
dences reuelîantiirhumores > minuanturque , iîqtiidpîeai- 
cudinis fubiîtia toto corpore, adminiftrânda eft ; mox etkm 
iacapiccad deriuandum , euacuandiimquc^ vena videîicec 
in naribas , mtmfmnte adaperta . Qtiod vdqnc auxiîium ,^ 
veîut maxime gcneroibm > eon , niii vbi inteniîor , ac moie^ 
ilior iafeftet doîor^ adbibendum eft : de eo namque fie 1^. 
în <Solore,ai quîtur Geîfus hh.^.<:^.z^ îdMoris gemis in copite > quod acu-. 
^J'ăl^nâ ^^^y^^^y^^oâfufri cmfu^idinem intmâ'i^^^^^ iâqnc, quoâ: 
Kiittcadus. exfuhîacaufa^ etjl non pefiiferum^tammz?ehemensejfi, primam 
mrationemhahet^ qtiapingHismitţaUir niji intoleraUlis 

tfi dolar rjupervamum efi ; puhtjque ep aiflinereâ ciho , Jtfim 
poteflyetiamâpotime : SinonpoteJiyaqmmhih^e&c.Vcnimii 
languis nan facis eft/ed contumax adhuc, & vehcmcntiorin- 
ftetdoIor;tuacvquoniam qiîod ferrum non fanat , ignis 
fenat, ad vcnarum in capite dtionem deuenire opoxtebic^ vt 
kumomm > yaporunaque afcenluiintercipiatîir > fique iatu's 
in Cerebroxolk(âmB âliqpiid eit, cuocetinr VHărcxjmni^ 
cxprclîk Hippocraces hb.etiamdeajefea.inido.J^cÂ^^i»d^ 
duntapituiîa.mminmpitemou^cumfilatafum^^ ^^' 

ă vertip in capnt incidm^,proJiinfqmdem ^ h^ adhihita; 
ţrod^etiumfifanguisAnmhiS^^ aut dvemki 

frmUi.Siverodiutiimusiffm^^ ^pirgaîo 

capite non decedat; huic caput aut^fiarificare cportetr ma venas 
in circuitu inurere. Atqui cur fubdicin propoiîto tcxcu . Sicch 
puti^iTgauem, magis afftiges ; cu in cerebrali repietione huia^^ 
purgatio pociifimum qua^rarur ^ eamque fcmpcr îaudauerit 


Digitized by 



Hîppocrates vbicunque de aiFeiâionibus hifce curandis cglt, 
vt lib. de rnorbode Affeâ. , & alibi? An quia doîor hic â fan- 
guiae pendet ^ vt liquec ex ipfomct , quod propoBitur>reme- 
dio,hoceft, feâione venarum: quaprppteralij humor es 
nequicquam purgantibus educerentur? Atqui propoficus do 
Tor diummus eft j proindeque & â Ktuita > & a Melanchoîia 
prouenire poteft; quibus abfque dubio^ purgado coimenren- 
rior eflk. An propolîtus morbus^vt iam didtim eâ>âb afcen- în aifiîUco 
dencibiîsfursumhumoribuspendeî;idedquciî Capuc pur* f:^^,l^^l^^'. 
care ftudeamus ^ quod caiidis £t potiiTimum medicamentis , tîb4s pzcue- 
ctiam elediiue trahentibus, perquenarcs immifî:s, Capuc ^fţ't^SSo 
ma<^iişincâletcet; exquo non modo coaceruad fiinduntur cpc^^cur* 
Kumbres > qui mebranas tnagis diftendânt ^ augencque doîo» 
rem > vt ia. morbi principio > prius quam noxius humor aîi- 
qua ex parte euacuaiusikjpîerumque contingic^veriim etiam 
maior fit humorum atcradiio: quapropter hb.5. epid. Muiieri * 
au.6. j^^ pheris > cui caput cireum circa doîebat ab V$rro, capitis 
pur^atio numquam profiiit ; fcd â menfibus tantumodo pro- 
deuBtibus, &: â fubdititijs odor^cis uibkuabaiur. Hinc tan- 
quam cer turn co}Hgâmu$> morbis ab inferis pardbus prcue- 
: nientibas ;, ţeuuîfic^ibus > iacerceptionique potiiîumum , & 

^ /^ l^ufquam particularibus capitis euaciaaîionibus e&incum*. 
bciidanx..:^ ■ -^ \ 

XOI VMqcIidnam cita difcere non eft poffibilej pro- Kedidî%âci 
pţ(şreâ quodmipoffibile c& ftatam , ac certam do- pt^g/^ 
<îirinâminîpfa£eri,veiHt> verbi gratia, Qui fcri- 
bere di iicit îuxtâ vntim madum , quem omnes do- ^ 
cent , nouit , 4^: fcientes oniîlcsiîmiliter nouerunt , 
proptereâ quod idem>&fîmiiiter fadum & nun Cj& 
non nune > non poteft fieri contrarium ; fed femper 
exade fîmile, el|>&non opus liaBct occalionc . Me- Hcdidrâ> 
dicina vero & nunc,& ftatim non idem facit ; & ad ^^ţ|^f|r 
eumdcm contraria facit, &lx^c etiam contraria lî- ^^cit • 
bî ipfîs:Primum aluum fubduccntia non femper lioc 


Digitized by 



3 5 i niFpQCJiATis L13. nu m ioc. jcw, iîom. 

faciunt, & aluum fubducentia vtruraque faciu^r; 
FortaffisaiieeiTineq; fie fc hâbent alutuii fiibdac^n-* 
tîâ.veiut aluiun îik^nxihus contraria: reilîtanteemm 
alno, propterveJbementeînftabiŞtatcin corpus in^ 
tumeicit , pituîtain veBtxemperiiciiiaîţe ; fie ftab^ 
liras {eceiîum iacit : vbi eiiim ptşlta in ^e^ţrem in- 
greiTaiuerit, euacuatîo contingit . In&peryero al- 
uum fubduceîitiacx natura, ftabîMtatem hcium m 
ventre, îîquidem non &bduccntia feceris ; fi autem 
exoltiatiir, & iîiane<H:etiirid , quodmorbtîmfacit, 
poitguim czokttim foerîtVlanus euadit . Etlîc ven- 
txem IHlentia lubducenti ycntrîs fa- 

dunt; §c ?icifeimlubducdn£ia veBlxem ;,iîf|eni^u^^ 


I Vc accerfendr ^rantMccHcKlicseMedidîîSE ic^t^rcs , 
_ _ quipatîcis quibtîfdam r, ac ^mtterfaîieribiis poikioitîi- 
bus coacenâl^ quas Com^fttmkaces aţjpefi^ant ; oiainiaqiî^ 
£^^^^ :adftrii9^mlaxumque3re<%cntes, «ladicamĂoătatem plst^, 
Medicinam mmzâco^ Aciîe<|ue3c^i|&ijcm conitixuebant, vt&x t^iv. 
^*^^^^ * :^mado ta^afibus ^am le ^4o<â4^s i^oimemur * Jiiţc ^ 
Emppcava Empirkafîmiîia:,. ab cxpericntia fk.nui:iag>âta, qua^'cxpark 
^muxxL "îîiefî^is quibufidani memaTi^coiicredkk >iîue ^a ab alijs ac-- 
'Cepmnc^ fîue propria indaftria, "Vel fotmcio âcquifiuerint:, 
indequciîmilicudiae quaâam adaliala^iâ procedentes'i a 
nioîibo adcoafimflem moîimm>a3>ati^^dC®nfimifoajpaiv; 
iccm» â mcdicameiiţo ad confisrtilc mcdicamaimm^ MedicK. 

îiofqacfere rn omeau , -cu aa difficiîc fit -guod <grcgîţîm j vtq^^ 
Ars5cvimrs fcrip^Ănâot,2. mond.Mcomach. > ^rj iţVmus.^ârmU 
li'vcriift'i ^^^^^î^^^^ ijgue^gm-Dog- 

macici app^ati l'unt ;, guomm jriaceps Hippacratc^ cxricic ; 
mw'^^l*^ (Soriisrunt njitlominus ^tiamante :^&m apiid ■Gnidios, 
tiuisf ' Khodi0s,&Coos, nnariratPIin.fîâckîftlîiS.^ 

liî^ 25rcap.5>.)^^perieîitiam porrâ notncoi^ 

poxiffimum irumpnmr > ac dumiiuniaai carpQriş namraiîv, 


Digitized by 


Mâdittt > admir^ibilem ciu^compofitionein^ muîtiplicefq; 

apţi iuectir^reirc ^akanc, aut illasfii •conlemare; <ium caiâias 
*omncs cokfiâ^mt» quse eademmetauţtederc, aut xumaptg 
fuGts 4ui^ morbpsatque l^mpcomata^eculaatur^ & cura- 
trices in4kammes minabii^ţijrnab ^catc^ C^nfiâtmâine ţ 
Seîca, ab A^e^am Tcmp<3[rc3 R^0ne^ ^^teriiqueiaumfce-r 
mo<iijelid«n^y duna deniq^ Bogroti. 

iMin^aaibu^SciipibuSi A^ Si^m 

remedia > qua? morbis ^x coacrariecaEe oppanac; per h^c -^^UcÂid. 
pmniâxatiocinantur , Scientiamni ofbcm> Phj^Ecam:» Aflro ^^^^^ ^ 
aomicamj Se Rauanatricem Jiuic vni fubĂmulari cogutit , 
omnia ad liamiiiis iaîutem -de4ttca:ites . :Quibus profecio di-- 
fcpîxais&rmams^ iaftfeutij%i^i:adG^a3is Medkiii^ Arriiex^. 
mm^^ Bminus prope fâidtur, vt le^iturlib. de4eceiit.0riî.s ¥ndc, 
•vt iiiquit 4k&îades in conuitiio Platoms^ Hr Mciicusjmuku 
aŞs jequdbitur %)vms ; quod ab fiomcro fortafse -didkerac 4, 
odi&ae V ybi '^ Medkus vnufquifyue^mţus fiţeromnesAixis'hQ^. 
fţmus^ autîib.2.îUadis.M^&îiy€»i?;i_TOr^i^/^i^ -anteponmdus, 
/ri^j^:^axptQ&do ^rnamema&^ic^ Sbi peiv 

fuadQatlarfimaHgBenapoffe adipifci^ jHippx^craies aihiîomi. 
luis noa hiac artiş hums l0^gîcudmem^^Qbaţ ^ cam repedd 
poffic^ rui >ob nagenii feiicicarem 5 fcdulic^cmque laboris^ 
c^tegiQSpr^tereâGaâas Pr^ceptores ,ădh::^c oînnia breui 
perueake datam fit . Sed aliam aftcrcTatiaaeni ex mutabiîi- Me^ticîna: 
tatc pecitam , & ^xaccideatibus . ^ quibus 33iaceriale ^iutdem ^^^'^^ 
Medicina obiccium, fcii maireria jCirca<}uamTeriacur^ qtîos mac, / ^'^ 
corpus liuaianum eâ ^prâ^rerdm âusxx morbom m tempefta- 
tibus impeHiîur, obrioxia esiâit ; xjaas quidem muiaâo- 
ncs & accideada non niii ex iî^nis > conieCiiirifque per- 
cipere pareti; ; knCn aamque ininiine aăequmicur, Acquc cx 
ea mucabilkâce fie ¥t yariaiubmde , acque varia exigat,S:.qu| /^^Milt^ *^ 
modo iadicabantur xcmedia, paulo deinde Yciuc noxia rei^ ^«Ucim . 
puaamn praeî^rqiîamqtiodaccidcntia, qnae circa obieCkjm 
concingua:, icaremedioriim operatioues quandoque impe- 
diunt , variancque .3 vi vel iiihil, vel contraria , vei immodice 
non raroopereucur > vxinfrâ Yidebiams-: Ars <tesîai, qua: ^^^^ ^^^ 

Yy Babitus 

Digitized by 


^54 nr^PQCKjkJS'Lm.nL m wc. m nou. 

babituseft vrerea ratîone {a6tiims^ quantum €ft ess fe, tztt^ 
tudine operationem dlrigit ad opusab Artificeinccfîtîiiii, yc 
aîud fempcr 3 infMIibiliterque âlîequaEur > nifi aliquidextrin* 
fecus accidat , impcdiens : quemadmodum Scriptor ^fiapta- 
tiimrit^ caîammB ^ atramenţoque infccîum tâli paâo per 
papyrum deducat , yt redtafcnbendi rario praîcipitr fcmper 
indubitantcr, atque infallifaiiicer fcripturam p^^^ itâ yt 

vno hoc cerro ac determinato operandi modo , femper , & 
vbicunque fuum opus affecuturus fit t materia ctiam , eir* 
caquam operatur, neque momentaneis muutiombns ob* 
noxia eft^itâ ve fubinde varianda fintfcribedi prş cepta,neq; y 
mfiperraroy aliquid fiiperucnit impediens * gk prorsiis & 
Faber ligiiarius^ quidumiuxtafua: artisleges circa lignum 
operetur, Cathedram , quam animo inteadic, quandocunq; 
&inîa!iibiliterproducet. Atfi ligniim eius clfet natura, vs. 
temporis momento varie atque varie immutaretur 5 ita, vc 
modo vclut marmor obdurefceret , modo vt c^ra emollire- 
tur ; eafque mutătibnes inftantaneasfcrey hon nifîeonicâu-» 
raliterexaîiquot fîgnisintelligere poffet ; iuxtâq; iUas variau*, 
da eiTentinftrumenta, temperandique Afcig iâus^ne^iîJeuior 
îuprânimis obduraţum cădere t, nHhil penicuseâicerety.vel 
fivalidiorfuprâtcnerrimum^profcinderet , non leuigaret. 
Sipr^tereaaduenientes h^ qualitates adeoquandoqs inteii- 
derentur, vc minime polfentab arte proprijs inftrumentis 
iuperariitunc proculdubio Artifex requireretur fu^ artis pra:- 
cepcionibus non modo qnam optime inftitutus, fedadmo- 
dum etiam expertus > quique Jongo operandi vfu didiciflet 
agendi opportunitatem, quam occafionem dicunt, & cogno- 
fcere, & arripere; iuxtaque materialis obieâi mutationes va- 
rie 3 varijfquc inftrumentis operări ; qui , fi quando pr^eten-^ 
fum fînem, Cathedram nempe^ non affequeretur ; modo vt 
reâa fu^ artis ratio pr^fcribit , operatusfuerit , neque ipfe , 
neque eius ars cuipanda atque improbanda eflet; quandcK 
quidem Artifex hic haberet tantiim in fua poteftate poffe fac* 
ne operări, non f au tem line m aiTequi, cum materia , circa 
quam operatur, poffet taiis euadere, vt introducend^ formaî 
încape omninoKdderetur.HuiusprofeClo naturg vere^pro^» 
* prieque 

Digitized by 



1 -CimMEmARns iiJJ^STSjm^s: 355 

^ric<îue font Belîatrix, Naui^ Btiktrk, 

Medicina, & Equse^aîisî coms<&mric^ esd&mt : Ha^ fîqui- Naai^Wia 
demomnescircâ materiâm a^nt variabilem adeo, & a<:c> ^f^|^ 
dtntibus itâ obnoxiam, videlicet circa Hoftcs pugnandi gftu- aiEaiiianmr 
Ducis coafiliOi^tâfupcruenientibiis Imbribus>Ventis> Sa- ^^^^, 
îaribusradijs> numquam eod^m in ftacu permanentes ; circa ^rxwcs. 
Mare Vcntorumhîipetu mire agitacum; circ 
tioaibas pr: marura qualitatumnumquam non expofiram; cir- 
ca Humanum Corpus iegrocansjâfurcntibiis, noxijiqueJiu^ 
moribus varie indefineiiterafFeâum^vtfinguIis fere m 
tis varie operări coganmr; nequeenimcertumhabent 3 ac 
definimm ageadi modum ;* fcd pro varijs macerîaîis obiecîi 
conditionimiSy varijfque acci^entibus ,- varie ex occafione ^ 
atqueopp^tuîikâte^o^ coguru:ur. Quinimîiîo earui» Arris^roniâ. 
iaftmmenta^ticet^opu^reâ-aratione directa iînt;condn^ auraiis i^. 
cimeQ , aut finem ^quaadoque «on aiiequi , aut conrranoş^ comrint; 
producere effeâus/propcer eafdem varias materiei conditio- ^^^^^^^P] 
uts 3c accideatia^' qiisrneque euiairi , neque cerr^ pr^uide- ^^^J^'^ 
' ri abartis pTiidentia queunt: Quapropter nec rudiormili*^ 
ntridifciplinar »ec minorit ibrtimdinisceiifendus ell Dur 
ifiei q^, eîfi ¥icîoriam non adeptus iuerit , omnes tamem 
opmHiDiicis partes^xpîeueric, itavt ex artis iuftiaito exer-a 
i:imm4axerit5 aptiori ioco baie^diipoliîerit j pugnandii^nai 
opportune deferit. Sic Nautajfîc Agricola, fie Medicus ;^^^^ 
fifiioruminflrumeniorwnjucceffîimm inquic Hip* 

pofliiticerenim bi omnes opdma ratioae conîîlioq; operări, 
neq;tamen prsetenfum opus^ttingerervnde Ariftot, i*^hecor^ _ 
ad Theodaâem c^.^4^,IsPmefijmsJid^^ - Meiidxî^ 

îemintroâucereffiâ ^K<}*i/^^î^î&^^>^Şfi^ }c24n3»v^ > ^ursQet ^i^noxi t& 
curamus etiam inpmaUles ingqueRhethoris fnh efi ^tad^pe^^ fii. hcnc ciiafc, 

inuenivâ m^dum, ^iwpojjtmîis Vortu adi0fiuliinQ Ouid,epift-i • â'afiiq^a^ 

Hcroid* • :..... . ^nem, aoa 

■V Yy 2 Aue1^- 

Digitized by 


c^^ratîoiît HaBcdQCirmampraecEredocukGy.coma.iî>aph.r^ 
ftânm mc- î^t 'D^kî^fam /mc^it ^ bac rmwm ^i^Mtmrhngamem^nmTe^^ 
eaSTom'^ ^<miim mm^mfi^A operaticmm ^fti^mii^ oca^tmmk hx-^. 
touea eâ . heat mQTmntamcmty ^ eh iddifficult^ficmp'ehmfiMem^'otnemo. 

eam ţcffitapiQfierey nifi ^ui Mk m hac^mit ex^^cimm^c. Efl 
Qccafio^cnr ^p^^^ <^^^(^p^<)^cj^sohmmm4es, circ quam verfimrarsyflu- 
F2cq>siir. xiUltUtem;. Cor^sjtquidem m^mm.vM^: mtmtmihHS olnc^ - 

xi um e§ :. mque icmiŞs extâmis îanţum^Jedahintemu etiamfa-^ 

r:enata;coBfifiuiaopt re dSfc^tit> operand] oppOTtunir^^^^ 

^- qu^udQquidecailla iugax ac pr^^epseft, eaque; cranfaCta^auc 

irrita^^ui: no:s;ia€Oî^meuadir:ppemia> ExqiK>KippQc^Ii&^ 
de decent- orn. Medieum monezi, V4; &eqiiemi y t^^it: n^'r^fîk «"'^^^ 
a^ kSxmoşy viiitetque M^niîiî^ i Mabifia ecHni&ncrquşr 
ifx husnid^. confiâuiit;. qii^<^ţereaîaiîi acilea jjâtu^, ^ a 

hŢs:£ifsmcrthis rjmp^r enimMyj^am^e {ank qms iiptîdcţur 
cmaz'ionh: ^pTe^> cxMccaj^omo^tukmr^ vade in epift^.ad CxuQmm^cu-^ ^ 9 
^S^^^ mioni^aaiaîam ^ teîpţ>o33^m opporcuiîiţateş etfe WlerMk. 

Mf dici nen 

îihus m^ia]uni: . Se qu^ Hipp.iih- de pr^cepuon. hoi^ca* 
tur: Medicos , vt c6mmo<!am hm^mt c^exciracionem > poft 


€xrrdmiomscopMîiăm}Q^^ hocaimancQy^tdkentilus 

quencix Pater lib. i. de o^^\M^M^Îmm^^^^:^i^^^^^ 

Digitized by 



j^mm 4rţis pr^cepta ţ^cepmnt, nihiî magnet laude dipmm 
fine vfii & exercit atione confeqm pojjunt : mm exercitaţi o fila , 
m -i* inquit Galeo. i . 4e alim. faculr. , i? doifrina > qu^ţtr difujam 
0%arrati<mefn tradiiun nos artifices reddit . Satis huc vfque cla- 
ret cur Mcdicam âculcatem breui aequaquam adipifci âs fit. 
lam fupereft p€culiariter videadum > vt nam ex medicam en* 
rorumincemtiidineiaopcraBdo,exeinpîis compluribus id 
probat Hippocrates • 

■ Medicinaver6 & nune, &ftatîmRon idem facle . 

ţMedica Icilicet Se^tas finguHs fere momentis cperandimo- 

dum variare wgitur ^ prouc obieâiuaeius maccna varieim- 

muiatur X variamq; agcndi opportunitatem oficndit: attende-' 

^«i.3* ^reipturcprm^mqmtBs^fOJC.hhAc ţtxcc^tion.^ firtuit^ oc^ 


■, , , . r • in eodexn fubieâo 

l Etad eundem contram tacit . ^^^^j^^. in morbo 

x:urando contraria operatur : nam modo aluum mouct , & 
pâîilQ poft adftringit > modo calcfacit > modo refrigerat , fe- 
<uadum quod cadcm ^gritudo exigere videtnr ^ qiiorwm ' 
aaendomm oppojrţuait^^ experto artificc cognolcedaeft. 
,^^ i . . ri ^ * r ^^ cciam opera* 

Eth^cetiam contraria iibiiplis. aones^quas modd 
Xîeceniiumus,t^i pacîo quandoq;efEciuntur â medicametis> 
vt canuarias: Cnt fibimetipfis quo ad modum o|>erandî:s folu- 
ţdoyiddicet£QÎutiom,adrtri:clio adftridtionis&c, Quadindc ^^^^^^^^^^ 
contingit, quod medicamenta muîtavariaqîopcrantur per taeompiLra 
accidens , Vt iam iam videbimus;idq;obvarias materiei di- l^^^^f^ 
fpofitioixe$ » Probat id primo cx medicamentk purgantibus» 

au.i. Primum aluiim fiibducentia no fcmper lioc faciut. 

ita S^ lib* de medic puî^.> EQiâm,mq^i^> medicamentaţurgm* 
tm^ ăm^ ţurgantw ; qnarJo^u n^odix pirgaty- quâm qu^ 
ţm^y^ J^^t' \ aH^mnia mmum purgat ; nliquandaea > ^u^ de^ 
hetifi^cit y Non purgat autem vei qudd debilius fit , quam vc p^^y^^jj^jj^ 
pji^iţ^apiplamvautcraffiorem ducere materiam^ vel quod mcicami- 
iiiabccMlioxis VcntricuUcalor iîlud alterne > & ad aâum de- jţ^^cIS" 


Digitized by LjOOQIC 


^^r^fcSal- <i^ccre non vaîcat; vel quod ipfommetmedicamentumdu* 
tmiao£ae» rum nimisjatque inalterabile ixc* 

& diiml etiam adftringuat; idque multifariam , vel dedufta 

adinSmam aliium copiola, craflaq; Pimita> quina deinde, fi 

cxtmdere nequeat^nin in exigua admodu quanticace;quod ibî 

remanet , vclut glutinum, foeces implicat, atqqeitâ adftrin- 

git ; vel eadcm Picuita ibidem detenta ,incakfcit /vertlturq; 

ia flatulentum fpiritum, qui alui fubduSionemimpediî:: 

ccenim^vt inferius habebitur, aîmm fifie^ia Junf, qu/fiatum 

exhibent; humida autemrepccafafiatumfacimt:. Eademmec 

pariter cathartica medicamenta , vbi aîiqua ex caufa non illi- 

c6 extra aluum emituntur , inteftina & foeces calefaciunr, 

^ cxficcaatque : AdJiringHnt Jtamdent,vtcodcm loco inferius di- 

cit Hippoc. 3 qu^â câlore compafîajunt, fralili^^^Jicca.Ncqxxc 

^ defuntmedicamentâ,quseadftringendo euacuant,vtMiroba-. 

iâuiyTamaiindi:»Cydonia,aiiaq; huius generis . Aliqua sut rur^ 

siîs , qu^ vna cum cathartica vi.quam tenuioribus in parribus 

poffident > ftipticam eriam , & adftri<aoriam habent in ter- 

xeiiriori parce>vtRfeabârbariim , qiiod poft euacuationem ţn^ 

teftina roborat , atque adftringit ; vnde exiraium in dyfrcnte- 

ricis pr^eftat auxilium : verum de prioribus dumtaxat hic Io- 

quitur Hippocrates : aşit namq; de effedibus , qui per acei-. 

4ens , cicrâq; operantis Jpem eueniunt , vt inde oftendat 

quantafolerda^prudetiaq; opus fîtin medicinaadminiftrâda^ 

Fortafte autem neqxie fie i^ iabent aluum ^p 
ceiîtia , Ychit aluum îfiftentibus contraria, &CJ 
hsc etenim aluum interdum fubducunt^ed quia adftrWunt; 
quapropter fubduclio tune haud erit contratia adftridioni : 
probat id exemplo ; nam ii aluus fiftatur ab aliquo fubducen* 
ce medicaii:iento, iiequaquam tamenfuam operationem ex- 

^lente obaiiquam exiamallatiscaufis^cuncventerintumc- 
ici tob pituitoĂ excrementa eo deduCia , qu^ exicum noit 
hzbent; H^cergopituita fîincalefcat, itâ vtcoUiQuetufi aut 
^ctcdmcm acquxrac; aluum exturbat l uqmfx medicam^n^ 


Digitized by 



turn tune aluum mouet , quia adftringit . Qui fane <îâfuS;,no3 

modo impoflibilis non eit^fed non raro etiam acciderc cxifti- 

maiidumietenim^vcdocuk Ceîf. îib. 2.c.y, ^vU plurihis âie- 

hm nondefcmditalHUSydocet autfulitamMeEUommyautfebricîiîcL 

»«^* in^4r^;quod fortafle ab ipfomet didicerat Hippoc. 2 ^prsedx. 

Si tsrtio quoq; Me,aHt ^artOpata ex ISgiori intmmllo alta egc^ioncs 

noprodierinţ ypmculu eflfehre^ aut alui ţrofiuuio ccrripiâdcs effe. 

Iniuper âlutîin iiîbducentia ex natura ftabilitatem 

- . « / r 1 1 • r • fiuntaute 

faciunt , Cqmdem non jubducentia teceris. f^^^^^^. 

tîa > hoc eft , naturalem vim exferent^fî iion exoîuta {>îit> inq; 
debita exhibueris quantitate , habita ratione nzviixx ipfîus 
A egrotantis * Quod fi incerdum nihil ea mouere conting^K;, 
fuppofîtorijs , atq.cnematibus aluustunc fcllicitanda eric, 
& diffokenda , humeâandaq; materia ilîa , qua^ craffioribus 
in intcftinis hserct ; fie cnim ventris tumefccntia euanefcct & 
fahus fiet , Curandum itaq. eft, vt omnino fcquatur euacua- 
tio ; alioqui vel medicamenmm in familiarem hbi humorem 
. tranfmutabitur y morbumq; aygebit ; aut aîuum , modo ha- 
^enus cxplicato, adftringet> kdetqse^ vtpatetex6. cpid. 
fta. 7vţeK.28. > vbi Vallefius . Sed de hae re videndus etiam 
Gâlen. 5 . de fimpl. med, facul. cap. 24. 

^ r rn ^- Q. Itâappellatea.quaîexfui 

Et fie Yentrem filtentia &c. qu^aern natura ioluemia 

funt; fiunttamen fiftentia per accidens > vtdidumfuic; aut 
quia exoluta ^ aut quianon in ea dofî > quas in tali corpore rc- 
quiritur 3 exhibcntur ; aut quia multa & craffa adeft pituita * 
Hxc igitur fiftentia , fubducentibus > hoe eft , fubducenti vi , 
qua mulţam pituitam adinteftinadeduxit, ventris ftabilita^ 
tem cfficit: pituita fiquidem> glutxnisinftar implicat fceces» 
detinctque ne exeant . 

Etviciffim fubduccntîa ventrem&c. ^^^ medica» 
menta , quas fiftemia modo appellauit > eo quia pituitam ad 
inteftina deducendo , adftringunt ; lUamct , inquam > fubdi^ 
centiadici poffunt, quacenus fiftendo aluum per pituitam, 
in caufa funt vt cădem pituita incalefcat, ac niuoficatem ac- 


Digitized by 


quirat , aut diquecur atque fic aluum moueat : tdliqnc paSo • 
veriiîîmucn erit, Vencrein fîftentia fubdncendo > idcft , deor- 
sumcrahendopituicam > aluum fîftcre; vtvice vcria> Aluum 
moucnriâ fificndo aluum moucre : moueut mim aluum^quia ^ 
pîcuitam coarctant in inteftinis , quse dcindc iucalefcit, & eli* 
. qiiatur ; Paţetprae cerea quo pacio fubduceîidamî^rdumope^i 
rentur, non vc contraria fiftentibus; vtq; agant qnanâoquc; 
velur contraria iîbi ipfis^fiibduâione niminim contraria fub- 
duâionij &adftri<âione contraria adilriclioni, eo quiaad^ 
ftriâione fubducunt, fubduâ:ionc adftringunt, vt explica- 

XLIII* Eodcm modo res fe îiaBet cîix:a rubicundos & 
paîiidos : nam &pitmtofa & tumefacientia &palli- 
dos faciuîit , & boni coJoris; itemquc attenuantia r 
. vtriufque aatem medicamentum funt contraria con- ; 
trario . Verbi caufa . Cum intumuerit paUidum exî-^ 
ftens , exoliiîtur fane ^ fi quod medicamentum atte- : 
nuans'adlîibitum fuerit; atque liic tnmcntx attenuansv 
opitulatur . Rursus au tem, quod aJiqiiando vtUita- 
tcm cepit , nune hîc opituknti opitulatur , cumfz^ 
ne pr^ gracilitate'decolor & pallidus fa<flus fuerît : 
Si quis enim pituitofum, ac tumefaciens medicamen- 
tum exMbuerit,pallor fedatur. 

EAndem medicamentorum incertltudinem in operando j 
quam haClenusin aluum fubducentibusconteniplatus 
left y m rubicundis, 8c paJlidis , feu , in medicamcntis ijs > qua; 
tales hâbitus gignere apta funt, iam nqbis proponir . VocaC 
vero rubicuados eos , quifuccipleniiunt, habitulquc p^ne 
uthletki , boniquecoloris ; quemadmodum paîîidos dicit, 
quî biîiofi â^it,&graciîes xx«i»/>oV. etenim, ideni> quod c^xP^^- 
boc eft, pâlîido jbiliofoque colore infeCium quaudoq; figni^ 
ficari, fatis^docuit FoeC in Occonom. Rursus medicamemsi 
^Ae^fc^ToVe^Cpituitoia vcrtic Interpret &:veTius tume facicaT.. 


Digitized by 



tkjlbâf pdiac ea y qu^ coi^pris habiţum iuccolum > optimiiq; 
hiimOJcibiis mrgiduiii red4ere vaîcîit ^ fiiie h^îc dimen ta fint 
eiiciiiîPâ > opcimi ^ miiltique humoris ; iîue rnedicamenra ^ 
<ju5e extrinfecus a^ibita , copiofiim humoreiii ad corpbris 
Hafcimm trah^re apta fiinţa Quemadmoduin^atrenuantia â\^ 
ctmturilby ^use difcutîendo^ exikca^ 
bitum ^ aş^gye es&ccu m rcddun^<jualis pracipue eâ tiliofus, 
P-ojfmic icaquc xam pituitofa & tumefacieritia me^kamen ta > J'^^'^^e^f 
auam attenitantia, i^allidos non min-ăs acq^egradks ^^luâm a^rcnţ^aa^j; 
athlecicos bonique xoloris efficere ; oc tameii adeo canirarif ton^rr. ce-. 
funtiBter fe duo hi habitus , vc vtriufque m^dicamentum |^^i^ ^^- 
contraria fim comrario , mmefackntia fcilicec âtteriuato i at- 
teniia^tiive^ rubi<:Hndo , eiqiK ^ qui boni fit coieris ; & e 
coritrâ :; <|î3^^CKi expîicât planis verbis î^ tcxtu excmpk) 4:umîdi 
& fucs:ipleBiVqm aVa^iîuantibus diifoku 
&^paîiidi atqiie ^scenuatij-qui pituitofo > tumdaceaciqoe mc- 
dîcâm^Btoipaliofe^indicatiir. Arnon expJicac qiropacio 
tumefacientia extenuare interdiim ; &attenuancia tu mc tăcere 
&cufar£Gn-hâbituîîîquandoque prod4icere valeânt:Suppo^ 
îîendum j^oinde efl peraccideiis idiieriob pee<iliarcm obie- 
^ijasmaterlstC0ndi<?ioR€«î:vtiî habitus aliquisadeoîîumi' 
dus-fît 5 atque itâ ex-uberans humidiras, vc naciims eius calor 
penâobruatur; atque ka , îabelâCiata^urricione» cat^ola liib-- 
itandaattemieturs tUBCi^ atten-uanda adhibcaiîiur, qua; fu^ 
pei'uacaaeum abfumant humoren-i 5 quiquc iatis iir^id optinac 
&.copiose'alefldum i*eiinquatur j vtique inxali caiu attenuan- 
tia optimum corporis habitum produce vaiebunt : mre ipia 
videtnus^norinullos a Chinaruirt radicis decoCto > ^i4od ta- 
menartemiaîîs ^exiiccafis cft, bonimi 4iabitum accjuirexe^ ; 
atque iiBpinguari^-qj^^^admpdCijC con.tra^gracius teiiuiique 
oignixur â tumefacientibus , ii alimenticij humores vlq; aded 
quaiidoq, augeantur , vc ob-ruto pciie x:alore j nutrido impe- 
diatur,vtxlictumâiit-- - ^ 

iii^ Iniuper Yero etiam dolar & propţer îHggîditâr 

tem £iy & propter caiiditacem , & „propter vald-r so^ tjid* 
efuperans> & prop ter iiiiriiinutUiii . Et iii Ptrfirigera- **^ 

Z 2 n$ 

Digitized by 



f tis quidem natura extra eorpus ad cutcm calfecî^Eis 

t valdedolorfît .In calidisvero natura propterix%* 

I gidiim ; Etin iîccis natura fi humed:entur ; 5c in Jiu* 

l Do!or£rvbî mîdls natura fi refîccentur : In fîngulis enim>quQ- 

I ^î^^ rum natura permutatur Sc^corruippitur > d#^ 

îusipicm. g^nf j f^nanturque dolorcs contrarijs ; idque etiam 
vnicuiquc morbo proprium eft ; naiii in calidis na- 
tura propter friggiditatemaegrotantibus, dolores 
caiefiunt>& reliqua iuxtâ hanc rationemfîunt . 

PErgit adhuc cxemplis oftenderc Medica? artis diificults- 
tem & longitudinem > ob yariumjmuluplkemq; agcndi 
modum in ipfa, ctiam pro eodem obcinendo fin^>aut curan* 
do âiFc<ftu : Ereiîim dolor vc mulceatur, aut fcdecur, non vnă 
habetftatam certamq; curacioncm, qua peq>ctud abolcri 
poiTit ; fed. multipîicem , iuxtâ varias cau6s , â quibus pro-* 
creări potuit , nam vt dociiit G^len. de opt. fcd. ad f rafyb. 
îdcm^^cĂ» cap. 23. SvudemaffeBus Gnt B^^ 

tursrioDc-^ curattonem âdtmmmus . Xplc igitur & proprer irigiaitatem fit , 

^^iS^^^' & propter caîidiîatem > & propter valde exuperans , & prop»^ 

iau , ^^ tcr imminutum^propter humiditatem fcJicct>vcl ficcitatem ; 

& per horum contraria fanatur , vt in vnoquoq; morbo fieri 

folct: quod docuit etiam Gâlen. 2. .medic, local.cap. i., 

vcque habetur lib» de nat. 'vnum effk , qiiod dolari m* 

ăireiur , vnum etiam ejjethopzo; navz 'ani vnum qţţoniît^i nune 

'vero plhrAJmt., vbiprodolore dolorificum incelli^it affe- 

Cium > vt faepe aîias > turn in pr^efenti tcxtu , dum prppter&i* 

giditatem ^grotantibus dolores caleficri afleruit;tum alibî>vt 

d. cpid. fed. I . In Cranone antiqui dolotes friggidi; recentes 

autem calidi ; doloi fiquidcm neque frigidus cft,nequc cura» 

tur ; fed affccaio, â qua pendet . Cit tcrum Hippocmes occa- 

fionc hac^auream protulic fententiam , quâ dolorificse cuius- 

liber cau& rationem pra^clare expreffit ; infignis proinde hic 

contcxtus eft , plurics â Galeno ad fuas finnandas pofitiones 

Yti^cauC ??"^ '^^^- ^^ P^^^^^* ^^^' 6., ude fympt. cauf.cap. 6. & 

^mpt-^/ ^^^* I^qî^titaque Infmpdis quoînmmîuYA yţmnumut 



Digitized by 


^^c6rrHmpîtJ4r,d6hresfim^:qa^{i proxima dolork cm{zqnod^ imiSSlf * 
cunq; fenlibile obicciumiît , quod tali ^ cant^; viia fenfum 4* trem,ac 
agit, <?t iliîus naruram difîbfeat, atq; comimpat : pudcnim> B^pi=-«-^ 
corrumfitur^^vt aotat Gd. lib. i. dc^atifiiymptoiii. cap* 5. , 
macrnitudineis^mutâtiomsindicât, & ccferitatcm îqiiam pa^ 
rk^rfcutentiam mumams vidctur ctiam Plato ia Phylcbo ''_JJ.'' 
fcu de fumino Bono; Harmonia foluta ia animalibus, vnaaa^ 
tur^B foîutioncmygcacrarioacmq;doIomm ia eo tcaaparc 
jgeri affercns î^ia Timfo aucem, feu de Natura , dum conâi- 
tiones explicat > quibus dolor^cam iafignxri aâioaeni ne- 
cefsc eft* P^^cinquît, violenter pvjeterq; numirăm ăhrnde ^g^*f^£ 
Jmulque nohis ill'ata -molefla fit , ifc. Atqui fcaforij cuiuslibo:, tio « pi*. 
c^tcrarumq5i partium Necurat», ex congtuo primarum qiiaii- 
tatu-m mixtione >.& fubiJâatiac vnitace couftioii ccrtum^ cfl: : 
cx quo:GaIcn. de iagq. iatcm. cap^g • AlteTaSi4r^m^x^ cor- \ff^^^ 
rtmipitur 'cmufiuena(urax:u7n vel adefityvdjrigefit^ii^dficce^ coaMar. 
Jciţ y^^lhumefcityvel dus vnkas dijjokitur: qug aîcerationes ; 
cWinfigicsfanCjacvioIeatgadmodimieirexiebeaatadî^ ^ - 
vt doloret» producere poflîat ; earum cxccffus quoufqye ia- 
teadi^ebeat > iadicauic idem Galea* rum 4. de £mpL med. 
facwcapv2^. >OLiinhb, deinş^ cap.^., dum iealocu^ B î ^ 

jXis^^^rlfnmoâimiTferoxalorac frigus proxime ^cedimt , vt cau{x<îuo« 


40ytufn introrsus ţaritertrudendo , quadam exprimît ,^^u^edam 
au4(faP:^m hunc^ui^âmimtmMdcahrisacfng^ termnum 
ffatm^ yprtâfse nmin€<mmQdeJenfiâţ.Ex qmbus patet ai vfq; 
primas ha^quaUfâccs iai^adijdebere ia doloribus, vc vnitace 
* fokianri^taac caim iufigaeţexuatv, vioîea«que , quaîes ad 
dolorempix>cceandam reqînruatur^ Sedxut^dixitvfmsomf 

lâteds eft,foK<ţ cpgaitarationi ; alia.verd cuideas &iaattife- 
iîa ; quarfem^primam taatummodo fam eft ^ vc hx alceratâc^ ^ ^^ ^ 
aes tâ€xcefl£iattincfaj^,:aoa autcmie a i a da ii i»ad quampto- ti» ^^^*>, 

cpitWj ^iiibtâuais ^ Ârd&xr^ieuykGtem ta^^ 
ftalibiilq; con%kwam -«ontmuitat^i&îaEWMe^ 

Z z z agno- 

Digitized by 


5% mFmcKJTis Lis.m.m ^xm^m noM. 

agnofcit, tâikîUjC tiatiaine digptmaiv^c^c^tdtam vci^ 

modo alte- opcribus >âker^oiî€m:Boaminus.Quăm:c6tinui|^ta^ 

€16 continui VI: proximam doloris camam agnoteât: fcnfiim cnxmiequjh. 

^sl%^tS *w^;» qui^i^e^^o^ modo âfeamdii<jualiiaubî%;4^^ 
doioriscâu^ acutD>^aî^ri%huiuJîaodidi&â:^fiîi^ 

A^m coatinuitâtis foîutiDiîejdale^ ^ ijfqp^ ibkînimQdâ afc. 

t^atiominir occcrrere delmt ^ Vt dcloremadis:^^>^ fi eoîitin 
- ' BuilbliitioocctdcâiîtîquaprQpterMiedki, (^ibiisfe^ 

părere tantummodo cordi efl^ »uih habitaratioiie ©cfuk^ 

kuli^iolutioais > manifeftas taatdm , & doiorifîcasrak^ai^ . 

nes CQttfidecant, Scvfiv&^orxm2&^^ 
^ Rammitaquefitinquoi^ ibnibdo, ^^^/^ 
/. . i Viaoquoq;£erfutriffisfenfeti0^:qua;d^ 
?afa?!S*^' bilibus, iî excellenda iuerint/accidere potcft j. v*vJ0€PCs. a, 
«i^oiibet £c^ iplei^ore.^^ Jy^îbi^ab;horriHUi^ 01|a<âîîia:^uk#*^' 
'^^ oM^ ubus> GoiflaOM demiim ab Acidis , Acerbis, Amaj^^^^^O^ 
^eccciii. fi^d&^quse^oiimiaobieciâienibj^ijcoHUjm 
ueaitercrm, ^ocuic ©al» cap* d", lib. i. de fympu czuC ytcB Xaâu^^ytpoţe 

; ; ; craffior>magi%padaatws>p^arterieniiisc^te^ 
^jJ^îor^. îioe f^aptoma patiamr ^ proixKkqr dolor ai^ancOT2^î9e 
ccdefcnfu^' & potiffimutdiciturea^jqi^inTaducont^ 
-^m^Tz^is. ikic^yf^ceur dife fynipt.c»j»)Ra£um,Jnquam5., 

îit iafe^orio quouis tune partiiim namiam dolQri&exprrii. 

piicaa^ieixfîbiîia obkiSia ( ta^ilespteferumqualim^ş )taiafiav 

n aî&tim:> uqxxQ rcpem:e.xn fei^um^^iit, vt triade lequa- 

tar vniai;UsfolutiQj.cui âdca^efi^^ 

iymptoşiateiuamjîîokfliam decegat ^quedeaimckt: pu^ 
?atte5 gtu- dmî fîquidcmpaî^es muo^ meaquevnîon&i 3i 

^^^1^ ^^<>^^perfîftcrcqtîampliirimuniexpetîi 
^%^ rii^^nonmodgiMQftmiuatGo^ 
4aî^îît a J rii^cr directae Jimt>^ fâdja^ 
scfumai^s âQgmti^*&doîcMî (^ainmdibîfus^^^ pe»iS* 

Digitized by 



pmpoHUw;, qui ir4c a{sadappeteiî.dum,- a^f adfug^ 

«wmnJXiÂ?«î ej3;î«e^wM^, ^î#«^>^iiî^9?-PW 

i4£gţ}i%auic'Hipp.fec^,ş..;^pij> tf,.m«?«?5î^%'^.^««^^'^«^^<'*' ; :• : 

occupat;9ÎrC«;emi Seof^is :pr<şpna obie.da non p^j^ 

e^3l^ 0fteraiuur.--:VerujA fi mfîari naturaliter sQM«?giîyP: "t"' :}r^* 
fcafih«^»camfer^e^defe«Mtq«ipdnaWx?cpq^^^^ . .■ -. . -^ 

l^^^^ al#-c«itar%eirif iseHF.işolefta h^c fpnfaţm fj^pso- ; . ; ^: 

i^KEş #^ieIiQeţ-fea.&§;a<Sipn€a c An fic deţşi \eî?fesirîOlc-;,Aiţu» fe. 
feanJolîi€<aumfeni4ref,; Y!cii]p.d Jtadmaufugcrt ,. aîque,€.ui-?^ti-^^ 

^t^iir.mQrfe.iffie/fd^)^^¥JiSP"J^.qy^4.^'P'P^"J^->.^ţ^H«^ • 

aJît4tefi4J%P«^»^E*^l»^lţW?il«iH^i%î iunq Cc^ui^iş q»ialj»r.' 
tib%$ 'doj^m? ^Piiifi ^^^y?^^^-'^^'^*^sa-^Q 


meţfe ix3,e|a;%^a»qiişWWvdic^nd?k:^;a.£^ a<^îeiir.qHod;. 
fenfatio no» fi«ţ ^-condmpff.e-j.qug^g^^ 
cuaţ'ddbeatijinpxia p«?<^|>eţe>,yf iîlibu^^^^ abiis -ftaţim de-; 
flsăsrVpoitit 3 p^iaj#qiiş:cjinp ia^tuguyjies l^dit, .jaiaqu^.. 
iiin^U.maljţxM .§c^i^u§aiţţŞf<KSni^p.p% cqqu^ ,4feaiiS 
nîJgiţaţ iB<:90^yuţn:fid^i^»ifgttgjiaţHţ?dilîî.n}iJin cii^,, Ac . 



Digitized by 



non valcat ; prseternaturaîem , morbofâmque tune fe^ui coîw „ 
poris difpofitionem indicium cfti eic qua appctentkm de* : 
Doîoriftc» ftruiCjIa^dicque codionem . Cum vero in iiibka vicJeataquc* 
S*^fabSu ^^^^trionedolorificaîcaufaî rado confiftac^ mutatio aut^m- 
matţtione inter contraria fiat ; hinc eft ^ quod -maximas- contrariei^es , - 
coaiifti^. qu« humano in corpore effe poffint, extr^mas nhîiirum , in 
exemplum.adducit Hippocrates j vt doloris gerteraticHi^^ 
> oftcndac : vnde dicit iniis , qui externam cucem fiiggidio*- 
rem a natura habcnt, propter-caîcfaciens valde dolojf ex:oricur;"^ 
fcilicec, quod in his fubica fiatyingenfque miiatio4b extrema 
in extremura , â frigido ad calidum . E odem paâo in ijs , qui . 
calidius obtinucrc temperamentum, ob fubitum veliemcnîq; 
frigus dolor potiffimum excitatur ; & fîc in reliqui^contraric- 
Sucraton^c tacibus : quafi ij , qui cucratoncorpus â natura âaâî funt, in-* 
comSdSo- ^^^'^^ doloribus niinus obnoxij exiftanr, cum non adeo ingens 
riif magnis d naturali ftatu receflus in ijs fieri poffit . Ad h^c Galehus î2* 
^nSnâ- ">^^* C2^P* <^- > corpora non modo cum extrâ naturatn confer- 
tim aguntur , dolore cruciari afferuit , fed in ipfomcDad 6atu* 
?®J^^5^ralemftatum reditu> nifieumpaulatimaccipianti^ofqucia 
ditu adna- excmplum adducit , qui in vehementi frigore iter fecerunt-: 
^^5cS!l' ij cnim d molefta qualitate quamprimum;ic fe vind&are cupi*^ 
tm» 5c <m. cntes,n6n fenfimjpauîatimq; jfed aifetim atq;femetcalefa?cfer«^ 
fepropcrant,ac dolore circa Vng^um radices aded^ veh^nen- 
ti aificiuntur, vt ferre'non poffint î de quibus locutus eft etiam lib. de vet» med. Cuicypinioni-i^fragatur- Diu3iisf^*«î» î^ 
Plato , qui contrarium dare decreuk turn ia Philebo , mttkt- 
JTimaco , locis (uprâr cicatis , vbifemîonia coj^Demp^a^ly-^ 
in fui naturam protinus reftituta ,^v6!uptâtem fieriaflerirj paf^ 
fiohemquc, quar in naturam abun^îe^mulque reuejtitup, di^-- 
camtQuinimmo iplcmdtGalefiUsfententias iuicfe Fiibfcrit^' 
cap. ^. lib* i.delympt.'Cauf./&--rţKriturR arfnattipani-fîmul; 
âcceleritcr faclum, voluptuoitKît^ffe manifcfte aflcruitV ac' 
proinde fîbimet palâm adueriatiir. At-fi impenfîus îhtueamur, 
jiatoms& nequaquam pugaaritia^ locittus eft fummus îjic Vir , «ec^â^ 
Gaieni con- pTâtoftC V qucm pluthiji Tef&pef fectraitc;, diflTentit H etenim - 
Şiim* par- lib'. Hieth. non âbioI(itel4ikiEV^cbrp6ra^'ipf6;^dHaturăktn;- 
^^^ Sal ft^^^îi^^M^ redittt > iriireum^î^din accipia»^, trijciarisfed 
''^y-<' addidtc 

Digitized by 


^ , '^0MMEUTM.I1S IIMSTBJTYS'. 1^7 - 

rtSriequeaoa idres fe l«beac vnam fijbitas ad ^ gc« .oj^ 
mAiemftawm reditus,licctex fenon mfî voluptuofus ei- i „«&, 
S^Xr^m ad terminam coBnat^emJ^t,^^^^^^ 

inipfîseriaminammatis. vialiquacxtra propnumlociftifc^ 
t>ofias,ngauUv&lcuia,qua:, extrinferofummoto mipe- 
limento,quâmcelerrime adnatualcm ferunturlocum, m 
<mo quiefcant : per accidens tamen fubitam adeo mumio 
nem in animantibus complura {xp^ comitantm , <i^^f^<^ 
rcm queunr^aliofue noa paucos morboios affedus procreare, 
velutin propofuo cafu>: quisambigat frigentesprasrernattaa- 
liter^eicos, quamprimdm calefieri exoptarej eaque m caiCT 
faaione, quancum cft ex fe , voluptuosâadmodum eos afficiî 
At puanammtet maxime aiStiuas, conttariafq«ehas quaUta- 
tesLSriri , quatum akera cogat , altera fundai; complures 
MîEtercâ cleuari , agitarique fpiritus , qui huc illuc conieitii» 
nino e^ : Sic & qu«pr«ternaiuraliter replerafum> qaam C*s 
tiusexinaniri;^a: nimium funtexhauftayVtfîtiente%efuqpi- 
tefqueiquâiB primam replericxoptant, in eoquexadîilaraaic 
natura ; res tamen plena periculi dft ne quid innQuetur in cof-r 
pore ab ca peraşutatione j cx quo Hipp. aph. 5 1 . fee- 2. Fiu* 

mimte^ncmr^mTmam^Seiqwdpmdatimj^ Dolotmm 

▼idete, num abhumidiatc fieri pcfiîtdolor, ¥tin propo&o **" °*** 
texotaffîrmaţHippocratesîIncts cnim omţiit eaqualiţaSjttaK 
iraec paffiuas ţiotius enunoercturapcripateticis j haudtanc» 
pocerit celeritate agere, quanta opus eftad excitandum dolo- 
rena :' C^ocirca Galenos abca auUam excitări docuit i. de 
cauf, fympt. cap. <î. , & 2.-de£ompoiC med,; îoc-£ap;-i. Dbdt 
tamen non raro etiam^ humidd-procrcari, vt a. de viâ.acut. 
1. 1. ,ita vt varius atque incoftans Jiaoiîijcc vidcaiui, Ignaua 
pono qiiaiiias humidias cft î & quanrujn cft cx fe , doJores 



Digitized by ^ 


3^8 ' HXFPPmmiS LIB.aiL m'ZOCMNxnOM. 

minqaain,proiiik^re nara ; quippe^auîatîm agm y vmcacilque ^ 
. (oiimQnQmmxtms^abdiyqî^^ 

prasferuet > ac dHîecla vjxizt : nihilomiaus cum aitard perpjs? : 
taiofo^iatur, quodd^endemîo continuum y^iaiimV 

corpoic. i£aqi^ vnâ cumfiAiedi corpdentia ingreditur ,- p^riumqueJ 
poroficatcs {uliit,ai;que penetrat , quas idiibisieB^» di^iit^. { 
diianiatque . Hippocrattautonpqiii vtMc<iicur>;m3ais?^ 
lofophus loqukur, iâizm că > cum catcnus prxteammraliua» 
stfe^uum caulas inquirat, quacenusijs occurrercpoffic : Itâ 
& Gsdeaus > snodd Pkii<rfopM ^cr&namagtt > Imtisidi 
proprie ac pct fedoioîificam^râii^epegat^ 
ab ea<iei:nînet3cxcitari pofle &€ttir ;:^&năi^t€mm paiam eft t ' 
Vtque docctur lib* deaat. hum. CumhmrîorHm al^uis alndysz ^"* " 
fecretmfuerit , ^ferfefaeriţimnfilîmtmmlammy*^ 

Sf^mnt* jt^qi^ omniaiii vnumcolUgei&es, dkemus Doto «iîcu 
Oiia cpiîo* ^^^.^^{j^ omnkxn fenfmihi, Ta6ius px^fertim pr^ipue^;; 

ob fcriiEae CQnfeftim iace0fequea<k6.agens^|i^illoxum ji^ 
curamakcret >itâA^4ceanmQîâi:vnitatern ibluenda;- Fie dum^ 
fenfbriî natura alceratur & comioapicurj non poftquam cor* 7 
î^pta eft :4îam ab illfiisirq:i:pendetb & ab alteranti^ ydbcmeiH . 
cer obic<ai momdifiţcam^ 5^ 

fcquaiur^^ eft figiplex camummpdapâffia^y obiecţii incon* ■ 
î ^'- ri ^euieatiamiHdicaa€feB>aîlamiad^ 
.: .: ^-. â;^î^obie<5tod^ehdeaft»<pitnon3îodo ifecundis.quali*? 

ibhmnc ; Sc4 ctiamâ^pitiDâs^calidicate^ ftigidkaie., ficcitarcî? 
& hiîtniditatc ir iHasrtamcn ikhncuvL Hippocrates tanquam- 
aimis maiiifeâe doiorificas ; bas^iiumetâuk, quia occult€ di^ i 
Jfeet^u^4ii64;id^is4^Hippoi:r^:, qui^n^^ ^XLpJ^K:^ 

feiib de dolodt^k:^ vifed^accidec^ 
auor coi^m:^^ iîicQi^feâUî^uanes^ aliaş:acquc aBs curari ex^; 
-. >., ^ pofcat 

Digitized by 



pofcatâororMediC2feu|taci« i<>ngi£u<i»eiQ doidris ec^ 
cxempio patetaciat &C. - 

• Alias porro modus hic eft. Pcrfimiiia morbiis iîţ,- a^/iuă^ 
& per'fimilia adhibită exmorbo fanăîor,. Vekt vri--^'-^^^--" 
n/ftillicidam idemfacir, fi non £t :; ^c^ fe; fqem -^p«^, 
{bdat, Et tiifîis e^dexn inodp veiiit vnn^itiliicicîiuiîî; î'5«&^^if» 

' ab iifdcm fit, & fedatur . Aliiis rursiis modiis hic cit ..'^:;r'"- 
Febns, quseper tumefadionem expituita£t; aîi-. 
quando quidemabiifdemfit, acfedatur.aMquand® 
autem â contrariis: Âiiquando -enim fi qttis^iîlt agiKL ; 
caiidaîauare , & midtum potum exiiibere, lairus _ . 

tis &adlîibitis , fanefcit; &fi qiOs vuit mediCâîŢaen- 
ttttnbibendum dare aluum fubducens . It vomito- 
riumeodemmodo , & âfacientibws fedatur &afe- 
dantibtis fit: nani fi quis homim vxnnenti aquai« mul-, 
tam bibendam daă^e veîit, ehientur ea, propter qu» 
pornit Wâ cum vcmiitu ;& fîc qiîidem per Yomitum 

.quodintiîseft , voimtiun facit , &aiT!ibabus<:ontra- 
xiis raodis homo fanusfit . Etfiquidemîkin omni. 
bus iaberet, ftată fanc, ac certa Medicina «ffet. 
Iti aiia Quidem -conti-ariis cirrari oportet , qiiaiia- 
tandem fînt, &â qua Câufafiant; aliavcro fmiilibus, 
<paliataiidan, &âqua caufa fiant. 


tiambreuitempore inacquifibilem :cum ibpenus pro^ , 

baffet , primo ex remediomm kiâabiliutc iii operando prop- 
«cc obiecîi,circâ^ueda°ic ,Bicofîantiamj J^ox€XIîlorbo- 

A a a rmn 


Digitized by ^ 

5^ mp?QGRMt&MB.Ju.m ju;^. m noM. 

rum s irel fymptomâţum yari;a ,^ g^^ 
ne y vcdcleantur , cum dolar modo 4 f^frigerantibus^» mo^ 
doâ calefacientibus t nune ab cxfîccantibus, nune ab hu- 
meâantibus > per coatraria aboleri nşms fit? iatn' dcni<« 

demquf co inftabUitatişfk^ultatemRa^ 

oftendic^^ vt , axui omnium ponlenfu ftatutum fit > ciiratîo* 

Cuzztcqoli ncm per contraria fieri (curare enim niîaîiud efl: , quâm mor- 

^ • ^m deftruere ac dcmoîiri ; deftruciio veroa contrarijs fit, 

quemadmodum conferuatio & produ^io a fîtBiilibus ) nihi-* 

lominus â fimilibus ctiam morbos quandoque > & fympto* 

mzm fuperari pofle,varijs iam cxempliş demonftrat; interdum 

straagarîa ^^^^ tum a fimilibus, tum âcoatrarijs,: fiquidem , Vrinşe ftil- 

^^r*^&&^ licidîim , cum videliceţ guttatim vrîm excernitur , quem af- 
^ ''fe#umŞtrânguriamGrarcia^pdIant,duf^ 

& omnigeiK>s effe dixitlib. de affed:., cum fieri poffittum °^* ^^* 
rationc veficx , proximarumque partium inflammatioue a& 
fe<9:arumj turn ratione aliorum humorum> quilotiocom- 
mifcentiîr,ek[ue irricaadivim iugiter impertiumur. Poteft 
itaque â diuxetico ac coUiquatiuo medicamciito intcrdiim 
procreări 5 fi non adfît > vr de Nafturdo , 5c Sinapi peribetur ^^ 14- 
lib> 2. de^diast. , quddcalidum cum ilhid fit ;► carnemiiguat, 
albampituitam curat > &vrinaîliillicidiuminducit,C^^ pa- 
riter medicamenta ftiUicidium, fi adfit, curant , dumcrat 
fam , morboiâmque materiam extenuant , ac per vrinain co- 
Tuflîs abpiofiuseuacuant, penitiîfq; abfumunt» Tuffis itidern. â PuJ- 

tlî^^fcdt nionum.expuîiîuanxirritancîbusj7ţ Oximeike>je3u:itâripotefl; 

ripQtcâ . & ab ijfdem irricantibus mcdicamentis poteit etiam fedari ; 
nîmirdm promota per tuifim anacadiarfi > penitufq^e expur- - 
gata vitalium p<irtîum excrementitia materia . Alia adhuc cu- 
randi ratio eft> qux interdum fit â fimilibus, interdum a con- 
trarijs: vtfebris, quaîâtumeâdioncprauorumque humo- 
rum repletiorie accenditur, quandoq; a tumefacientibus (ita 
enim vocarc quf cunq;humores in corpore vberius ad âugenti 
pluries^a4inckauî^u^&bcrefcit , & cur^ur quandoq^ 
ct^âuir â contrarijs: Ab ijfflem quîdem curatul fi quis muica 
calem^ aqua febricitantcm Eunc lâuer>vel copiofum exhibeat 
potumt fecetemmmcdicameiitâ exmmefacieatibusfunt, 
- " "^ "- " „ " , cum 

Digitized by 



eum miflcas fiipetuâcaneas hutnidîtiţesrin comore ex fîiî m. 

^curaaucrete apta fint r & fâmen copioĂ h^c; totio humores 
^raerefc , habitumquecorporis aperîre poteft :-quemadmo- 

^^um & potio vberior vel vomîtnm , vrf alui fi 1^^ 
piofum fodorcm commouere . Etficfebricitanspertumc- 
ikâionem , a tumcfacknribus per fc ^^xtenuantibus vc- 
rd ,atquceua<^aunl5Usperaccid€nsîanaripoterit. Sanabi- 
tur per conorariâ paritor h^c febris, â qnisiubâuctns^ me- 
dicamentum propinare vdk; ita namqucquarârepiedo- 
lae pendebat^, ab aiacuatione ciarabitur . idem prorsus 
accidî^ia yomitQriopharmaco^âquo vormois^fî nomdCiu ^^^^ 
commouetur ; fivero adiiu fedamr euacuaus, pervomi- ^^^5^0- 
cum prauis humoribus , qui eum cxcicaucraat * .îî^^^as a vo; ^r & &• 
mitum fupprimcnubus idem hic faaari poteft âfteCtus , fi ip- 
fem fedantia medicameata morbificam matcriam , qu^ ia 
ventricul! cauitate ftagnabat, deorsum ad infimam aluuta 
detruferint, &exptirgauerint diarc^ 
Vmtrm compaBum^mitus. folmtj i; egermtemmâp^^ quam vomîmsir^, 
0porteuftfiit;z^^ fic per familia, & per contrariaivomku l^^îf&lt 
^uis viîidicari poterit* Şiibdit demum* Si morbuşquiuis ittiumiiâiu 
Scfo- fisiilia ydc per ^r^ncraria curari poffet t vdq; Medicina 
ftatum^certumq; agendimodumhaber^t; proiadeq; faci- 
îius eius co^^nicio parări poffet : venim non ita fe res habet: 
alîâ ccetaim â fimiîibus curari expoftidant ; alia â contrarijs, i 
quacunq; tandem caufa excitata iiierint : qusc omnia ab oc- 
cafione, & opporcumtatc abfque dubio pendeat , quam noa 
nifi expertus Artifcx agaofcere poteft: N^tiura nam^ue â morh^ Ub* dc«c* 
pmulciSeL & imptilfr. yOrtis peritis ţt^ăgeidafunt^ dmojirat^ 
Oecerum etfî â fimiUbus morbos interdum curari apporeat ^ 
non inde tamen minus incoQCuffum remanet cathoîioim ii- 
lud Theorema in lib.dc flatib^regiftratum . Contraria contra^ f^^^<^ 
**-3* riorum fum remedia . nam vt late docet Galen^ ^Sati» ţcc 
part.9- in iUa verba . Facere fimle,^t Mor doloremfedat . iîmi- ^\,tL 
lia â fîmilibus aon primario perfe> fed fecundând Se per acei- reducitu^ 
dens curantur, quatenu^ h^c operationem aliquam adnexam ^^^ 
habent, q\$x affcâaiilli primario adueî&turs omnis cnim ducimr ad 
effeâ^ per accidenta ^^^<^i^^ ^^ caufam per fc • Sic neuti- ^f^ -?*^ 

Aaa % quam 

Digitized by 


572 SIP^OCKATULIB. III. BB wa, i^ jjQjil^ 

quatn doferdolorem curat; fcd remedium , quod cam doloi 
re aftecliim doloris auchorem delet ♦ Sic nemorum difteri- 

^dtionera per accideas mneadocxam iiabet. Et^omitus 
yoniiwm, & fluxus fluxum amouent, quia vterq; euacuaa- 
do^prater naturali repktioni contrarii&nti caufîfq: fym. 
pcomşahacgeneramibasaduerfkntur» ^ " 

Xm Huîusautemreicâufa corporis debilitasexmit; 
Corpus enim â cibis aequalibus, ^qiiaiiter nutritur , 
acorpore vero cibi fuperantur . Poilquam vero 

tem cibi . £ tc«mfanafuperaturcorpii5 ahhis,qii3& 
iPxx offeruntur,iÎQrere ixaecipfafacit^&fuperant 
hsecfimuî corpus, & contraria ipiîfacitunt.£t ca- 
Makuari.aoiiec9ttidem corpus fup^rateius cyââ^ 
bitioiiem,florere corpus facit ,- cum verofupera- 

turn foit ,graciîe corpus facit. Ft conuiuari fiaiilitcr 
vt lauari tacit . Haec enim donec fuperantur, florerc 
corpus faciuntf vbi vero fuperauerint , & alui fe- 

cfrcrtur.tranrmutatur,- necefse eft acid-cuioiFer- 
tur , t^anfemtare : £tenim corpus tranfinutatum, 
parum efficaxacpotens eft, &âqiiottis-^oleflias, 
iioaas,&^reerudefcentes Mcipit. Hoca^em fa- 
ciunt 3c aluunr fubducentîa,& fiorere ipfum facien- 
tia, gracile corpus Ikciuntiac reliqua omnia contra. 

eOrtttâriorum effeauum,qui aîx Iffdcm tum âîimentxs,râ 
miul 5u ^•=*?» 'iiwc Hippocrates ipiiusmct coiporis,fcuhumaQa; natu- 


Digitized by 




cas in5bcciliitatcn3: turn fcilicet inHsrefiftendo>qug ipfamal- ^K ^^«^s 
terânt ; tnm in agerî(do eircâ e2> quf aîrerare atque immutare ail^pfod^ 
^ebet j vnd^ eft, qiiod valde f:uxilis fit, atque atcerabiîis* ^^^^ 
Etenim cuni ex quadam contrarierum mixtura hf c conftim- 
ta fit, in quâ calidum prţuaîet & humidum; ab humido quî- Kamamcor 
demhabet, vtâquouis ncn naturaliumrerumexcefliifecile W^s^âl 
immutetur, rcfoluaturque; cum humidum paucifTime rcfr Foucniat . 
ftat, i^^lutecontra pîuîimum quod iîccum cft: â calido verd, 
magiter innatâcius humiditas rcfoluatur, atque atte^iUetur . 

«tu-Ă^ ^^ ănim^Câliăiîăîcfn^ inquit lib. 2. de dif t. humiditas ex 'ue^ 
treif carne conjurmiur. Eam proptereâ reparare opus babet , 
ne citius , quâm par c% exficcetur abiomaturque : quaprop- 
ttJL aîimentis indiget, qu§ in deperditam iui fubftandam trâf- 
mutet ,ad quod periîciendum imbeciilis plane efi; hnmana 
m^f, §, natura îpropterca, vt habetur Ub* de vet» med. , Hcmines hac 
necefptdte ccmpulfi yalimmta omnia ^nxerunt iuxtâhcmirdsna^ 
' UiTăfn^iţvms y âu^e quidem fortiora ejfmt , ah ippt natura ncn 
pcQeJhţerari Jiingeflă ejjenty exiflinmrJes : ah his ifps quCfquâ 
ăolwes i^morlos , ac morUs oriri iudicantes ; contra s^Jj his » qaa 
nâturadomarâ p^ff^tp alimenîum , ^ augmmtiim , ^ fanitat&m^ 
Acquemadmodum nonomnium cfdcm fiiat viresj fie non 
omnibus eadem vl^us ratio conuenit/ed ad Aetatem^ad Tem- vicfeisratî» 
fus anni ; ad Corporis fţecîes ^ hahitus conptuenda efl , itâ ^vt ce» ^^li^^^l 

»U'i- Jfficntiius cabrihus , ăutfrigorihus nos cfpOTtamm , ex iib. de iâl. ramemaco. 
digt. ; eiufque menfurâ conieâanda cft,non ex pondere , aut t^lT^^ 
Dumcro , fed certitudinem exaBam non reperies ^*^î0,inquit Jib. fiiiafenik 

mh-se^ de vet. .med. , qtiam corporis fenjum : quaprapter operafum efi ^^^^^*^ * 
itâexaBe condifcere , vt ţarum inaîîerutram tartan ddin^as. 
Ad corporis igitur vircs turn alimenta, turn medicamenta 
aptanda temperandaq; funt, vt illa facile immutentur ; hec 
¥erd>iion plus quam fatis cft> corpus aîterent,atq^immutenc* 

^ Gorpus â cibis ^qualibus, ace. ^^^"^^^;^ 
- * ^ ^ ■ tur^ propoxuonatis ^ 

proporţionali ctiam ,:atprottt decct nutritur ; fuperantur fi* 

^^nuunc cbi a ©atiijaU calore^inqi innutriâ corporis ilib^ 


Digitized by 




Poft quam vero plus > aut mînus^aut alia quaspiam 

_ mutatio fadîa cft, vbi fcilîcct quid errorîs'perpetratum ifiie- 
Irit in cibo , auc circa quantitatem> auc qualitaccm, ordincni, 
& tcmptis ; tune ytique ipfum corpus fupcratur ; atque aIcc-« 
ratur â cibis; ijque florcnt & dcbaccantur priiiinam nauiram 
retincntcs* omnemquenatursececonomiameuertutit, pro 
nucricionc augmentoque, dolorem> & morbum cxhibenţes ; 
vc enira legicur lih.6. £pid. (ccLj. , ViSîus rmonem nm m^c, 
multârum cakmtaiiim ejî caufa • 

Et calida lauari , donec quîdem corpus fuperet , 

fîorere corpus facit ; vbi yero fuperauerît &c* 

nam eadem cautio , & fortafee maior adhibcnda eft înMcdi- 
camencis> quam in Alimentis neceffariam dixiraus , cum AU- 
maita immticari dcbeant , t'uperariquc â corpore ; Medi- 
camenta ^ contra ipfum corpus immutare nata fînt : itaque 
&in his aîiqua qusercnda eft proporţie & mcnfura ad hoc , 
Vt quod facis' eft immutent; non amemdiflbîuattî:, ac p^ 
nituseuincant. ^^i^ c<:|?î^^ > inquir Hippocr,lib. dcofficu 
med. 9 *vîfirelaxandum > extenuanîumque^efl; ^Jp connmit mo," 
^mmn ; vhi carofroâucenda e^^aut molliendum , modica . Ibiq; 
Fotîttceaa- Gâknus fîc commentatur. Aqu^cdid^y i; oh corporis mo^ 
tij^c^mr ămt, ^ oh diuîumiorem ^ & hremorem vfum conîraru effh ef> 
cu£moî,aut jcrtus vtdmtur : quonzam toto corpore inamîo^ âigent magts^ 
^^^^^ quammocet; cmtrar^UtQ, ma^semcatj quamdigmt; Turn 
^aru^ tempore admota , impkt magis , quam detrabat ; Jedjt 
Umporm^a inperfujwnejtt ^ digermdoplmpotejiyquam implm-- 
do îiureigiturdixit^c. &:lib.2. delaiiic. tucnd, cz^.j^Sicdi- 
dam infundas ; primim ^mdem corpus inîumefiit; Si ikrgiusin- 
Aqax câîett fimdaSi decHmUu Aqua igitur calida primo humecăat , cale&* 
^^contrar^ ci^ndoque humorcs attrahit, atque ici corpus rurgidum rcd- 
dit ^ & florerc facit ; mox humiditates , qus in vafis , alijfquc 
inanibuslpatiisfuat,^ attenuat & digerit . Venim deiioc vi* 
dcndusetiamHipp.Iib.2.dedia;* ' / 

Etconuiuarifîmiiitet,vtJauari facit. ^^-^^ 



Digitized by 



ralitcr vu: A-imcma igiwr, vt di^um eft ,eĂ vfque nutrimcn* 
mm. &au<^memm aftermît,quoufquecalia,accaiica focnnţ.vţ 
furcmi qucant ; alias naturalem potius omncm occonomu 

meth cap.i 5- nam quod paulaam, & frcqueixtec extiioetur , ^^^.„,. 

fuanefci?. Sicuc terra , qu^âlongatenuiquepIumair.a|S, 
madefcic, quam â largo imbre, qu. pr.tcrflmt ^^ ^"^ 
fe in tcrrs poros infmuet , vt ai^notamt Ariftot. probiem.5<?. 
fca.primf. ^^ ^ 

Cum autem quod offertur tran&iutatur &c. ^„^„^ 
mm- nuodâlicui offertur, cranfmutatur ; neceffeefthuma- 
num âr?usTcui offertur , effe id , :quod fupctac S: tranimu- 
mt SL co fcilicct^, quod :pium,ne a ptopna 
natmadU-cedens, imbecUIe reddatur & morboi«m . <^oă 
STorpore intra fanitatis exiftente intelbsendum 
eft • nam aliâs fi morbofum fit corpus , quod nutruur ; hcet 
vbiaue tale exhibere alimcntum , quod dum immu»tur,mii. 
tua reaaione ipfum corpus altcret , contrario videhcet mor. 
Kn Mufiibue cius, vt docetur infra ijs veî:b3S.I:«/ îranjmutJt' AKjn«ito 

*"•*• Tale i-^itur alimcntum propinandumeit , quod a natuiaia- 

nox.a!uperariqueat. ^ si etenim corpus in 

Etenim corpus tranfciîtatum- farâtate confiitutm»i 

icibarijs alteretur, quxfuperare nequiiut, if^^ecaimu^ 

redditur, & â contranjs pati aptum : vndc morb)S qu.bufque 

„ obnoxium fit . mturas , mquit Hipp. Ub. de vet. n^ed. , 4«^ 

Hoc auteiîi faciunt , & aluum fubducenna &c. 
' noa modo cibaria, fed qusuis cEiam medicamenta, iiuc cua« 

Digitized by 


cuatiua fimt , fîue repkmia , fîue attenuantia , vel quomodo* 
libet corporis immutauuâyimbeciîle reddere pofliinţ cor- 
pus , âb omnique contrario offendi paratum , nifî ea men- 
Zura illâ adminilîreiitur> vt huius vircş nequaquam {hpctaiU^ 
auc deijciaut. Omnia igipurj qua^cunqu^ ^ircâ humanum 
corpus iîunt, maxima indîgem cautione & confîlioj cum im'* 
beciUis adco fir humana natura^ vt neque contrari js refiftcre^ 
/ neque eâ^qu5eiâmiIiariafuar,immutarevaîdepoiEt:esquo 

fit vc mucacionibus iîr jJerumquc obnosia • 

LXIL At yero Medicina breuem occaîîoîiem îiabet : & 

Mediciax q^î ^oc Hotiit, ilia ftatâ> &€ertalîabet, &fcit/ 

cSa^q^ q^^ confueta fînt> &qu^ non confueta ; ad qu^ 

^Îm^c* ^^g^^ofcenda non eft cccafîo in Medicina ; & qaod 

pnidetiâco. aluum fuhduccntm non fiibâuccntm £unt , & reîi- 

qua , qiia^ contraria iiint; 6c contrariiflîma non con- 


HJEc yctborum fyathaxis fubofcora eft ^ & aîiqiud for- 
raiîe iiib eaîatec mcndi ^ vt conijci potefi cx yaria In- 
cerpretum kd^one t aii j enim aîiter legunt i hic tamen fenfus 
vîdetur iis aptari poffeî quddctim Hippocrates parriculârium 
epcrarioaum incertimdinem in medicina variis hiic vfquc 
Oicmplis ofieadiiTet ; iam vniuerfaJiter concliidit n^edicam 
Ăcultatem momentaneam omnino faabere o ccafionem , Se 
oppor£unit2^em operandi j quiquc veritatem iianc neuit « 
souit id, quod certum & deănitum eâîn hacdifciplina* 
fcicnsea, quseacciderc, vel non accidere confueuerunt : 
qmCi hoc vaum in Me4icîna certo fciamr^quod nifail certum 
ac determinatum fit circa panicukr^s operariones : Qnx fz^ 
ne cognitio, iK>n, vt operario ab occafîone pcnde t , fed certa 
dkydc infaUibilis , cum ipiîfmet (mf^hus pateat, quod aluum 
fiibiucemia euadunt aluum nonfubdacentia^& reliqua^ quse 
contraria fimt^ yt adftrkigentia , euadunc non adftringcîitia^ 
tumefacientia non cumefacientia &c. Quinimmo contrariif. 
Urna 5 vc calor 2c frigus^ euadunt non contrariilîima , ied vt . 


Digitized by 


Ricina faciend.. Ad qtiod v"q"^^XS^Sonc,& mo- 

. fopmuent. corpus Mmcunvbn,^^ 

Bigitized by 


contraria feciunt. ? . '::.-..■— -■-^.^■i.-..^!:-.:-^ 

OCcafioîtem tami fci^t Hippocra^e^ in;^^ 
piurks i-pkDb.uique i,. 

occj^Cia ^d pra^cipue: dicaxur de temgo^e sid agedi^rg pppominix>rc> vt K-^ 

iicpziefîî» qaetexIiUde' Precept. ^vbi^T^w^f^^^ nn.i. 

efijlaccafiavhmrkquatemfp^nmmuh^ r. d^ aiarb. , nu.6Â 

inuîier.. Occafia oj^tima efl^^ £ 1 o quicuc de varijş reiaediis ia affe- 

faciendi ^pimmfatefpj^inquhC^^^ dcJnjaQnt^^idgk^^^ 
îiaresrquajdam-.Qircumff.mtias^ qu^in ea tpnfqriş^ tarte incăunU 

înoiiisacci- ni&ixoiixeaextenditur » caufas quafcuiique primiuuas atquc 
foaarev^- euidehces iipiimoddcampîeâeiis, quaraficut 

deriar ; ^^ noratCalen* lAv^I epidtcom. ^.^^rtid Ş. ; în* 

îas pdmitK Meditl:^4>fmem£d'ma£mam:j^ £^^mWimM0^i,^Je/pmtes^ 
aBîmm'pro£tŞtâ^cnS:^mpo€ ab 

Hippo<^at!:e> (vtfci^k%îa 
p^u^ <î^^daniaî(jueeuideQCes mprBcrtrmmcau& : Q^ 

adcbrpîu^acce^nfm^ (yppprtunmn^o^ 
piTTzantî^^fiimr^zc^^^ Epi(tfec^, lOccaJî^ 

juentddcr^Jiue^Auns^Etz^dc moi^.m^^Onmisoccapa vteros ' 
propdlerepotefi,Jiqmdmli kSeaU Eţ iib^dc Medico . Qmnis ''''''^* 

Occaii©Cg3i; occ^Ho medicarurhroninium qperâtîoniiîîî conuenieniem, 
r^'4'o^la! )f^^«^^i^/ aqueopporrtrhuniVfmn,£ucdbie%W^^^^^ 
ticcmiiop.- nuc nxedicanxend cmu{uis aclmmiftrandi jfqiii cumqua- 


Digitized by 


«jloiii ae&mtns ad iooeii<iam in:;:qi*o«tiam £onfiftat<>pe. 
xandi occafio> h<K 'Cft j reiausyfus-^ idoncus, comjfiaiie^ 
atq oppottiăws inMediekîai cibi.ei^Bim-occafio^icu.cQa- 
ipfa quanritâtc, tempusparker^<>rdiaeiB,aap»oik«n4iaiislt 
telP^ens^-namricrircadminiaratus.,.quoxies mter alunen- 

tuhf, -vel medkameittum , ip^mig; naturatn a<;bitaiatctce- 
,<iîtpraportioiomwayrQiitdecet,«uenmnţ, &.vnumquodq; 
juxâpropriam naturam .«pmau:, dcbitum producem effe- 
aiit4>ajbiiK:eDtia/£«b4uc£nE plcruoague^ piruiţofa^eupo- 
ihis.'"ă£Caiumlondutnque'c6rpus .îeddentia , fuccafum 
reădctic-ralîăs, Vt.€X«npris pluries fuprapatefaCîam dt.con- 
^xzAjc^&iMtt,£cav^^^xzm ^dcUcetaut^uarmtatem, aut 
.quâlicatem,tempus. & modumprastergrediantup iicq.pnus 
2mis,fen-riet fe£iuantitateexceaiffe,vel cibommi-uamtate, vel 
.3ia ca«fa îflea^ds,%uâ.m^m Vienîrkiilusillomm.-anere^r^ 
«atiK^bbfJ^Virigemifcit-acdum^dţkm ibperare^rpnte- ^^^^ 
âit mm««K€S j>a«eac<ai^r.ruiMfpiaaisfu^keciasiatuni te aifumaa. 

îtidetttfflfimaes ,dl>i .featictoein ănterJionoîKa^exatâua: -^^ 9^'f 
sieccfe-eftv'Sitiqî |«eKiatair;lke£poâa^ iDgeâoiui&cru^ 
iditatevidus yencrioiks >ff^eat .,imaxleatque . =QtunfiUam 
li adeo vexcedam^- ^ţ -liuUacerms autimmija4aut<xpellia 
iii«ura\qucMit,'p«wefcunt, acfehtibus nonieuftnprşbenc 
<.ccaficxnefti,--vt€b.dcAEeE.ined.ânu. jg. & ddnceps ha- 
xulkter expreirttm;«pefkar:: Sic magnafepe^nolefîia xor» ^„^^^-^ 
iqtienc,qyriuoimda«ffrsBaK^î;¥duptatefueaincaUumpîa, iua«ismot 
.vtf,iure dixcrii: Jîe-- ^ui^U'ciA'-^aoirU'mM^ At iiscpropouio ţ^;^^^ j_ ^^^ 
ctrm ab cxaaa mtura: -cotpoas^o^monc^epeiideat;, quş «jiâ.!. 
4b jEtate^banni Tepore^â fi.cgtone, â ecniuetLidin«,â-inor|- 
i)i Tempocibus varie m^mutatur,; iiinc:dîfficilliauimjac pene 

««.16 &Hîppo.deV4et.«îedvOJ&er4?<w«^it4'«*«i^ 

"* -:> " JBbb 2 rum 


Digitized by 



tmiinalfenor/mi parfum âcHn^HOs ; quam^iom e^ etiamiupi 
^Medicum vâoemmter Imimm , qui ţarim delini^ ; certiîuS^ 
mm miîem e^oBmi.rmrh xndere contingiî. Pru4enteritaque> 
^uoufque Jiccat , iiiquirenda eft » vt non- modd opportunum 
YuUbimiâ €3?toi>endii:cmptisatque modmn,feddGbicamctiam cibo* 
UuAxi ffiâfâ rum quantitatem prsecognofcamus y ne plus ingeratur^ quâm 
^uod â mtura fuperari poffit ; quando vel vtiUbus ikiari ma-* 
;bimeft,i:eft€Ar^t€^,*. , . 

XLIX. •- Medicamenta îunt omnîa , qir^e pr^efentem fta- 
Mcdicaice- ^^^ tranfinoueiît : omnia autem fortiora tranfmo- 
fiSi't^ "^^^ • licet^autem, fi vclîs, medicamento tranfmoue^ 
Saturn mi- Tc j & Hiisus, fî velis> alimcntD & Cifaa . Omniz au- 
tem ex prasfenti ftatu Cranfmouere, Aegrotanti opi- 
tuiaturSi ejiimid,quod morbumiacit^non.tranfmo- 


aeri5,augeicit .. 

CVm ciboram occafionem Kauaiq; yfegi efl£ daiflet^ 
y r ea copia.oâerantur, .'qita.-iînrawari poffintâ natura, 
.cm-arsimiiaii debeat, vtea cQnfcmetur;indcqiobitcr alf- 
^aiiariq; pofsic; De mcdicamentis parkcr .i4 modo explicat , 
<3uorum formaîem rarioneineo pofîcam aflerit, vt corpus 
«oâru immutare valeant ; contraria %uidera duo hac funt , 
^c qucmadmodum nutrimentum eft quicquid poreft fub» 
itâiinam augerc in eam tranfmuwtmn^itâ medicamentu om- 
, ■ -ne jddicimus,<jn"adjiatararHaoftram alterare poteft . Nec 
ymmodâ hzc aîtpratio eftfed,vt doceţur c. u, 
MMKatnoau almareiuitum e^,afa-{m qmţiam qualitatey nem- 
. . f«^^f<^tetido,mtx^igerani0,mhumeamâo^tficcando^ 
mtdiBonim coniugatione quapiam, aut totafuafuhftantia,]îctiti 
S(mp^Jiradelefmorum,fm îethdium medieavmtorum.necţauca 
«ifxamerum,JhtAmuhţmn» ; ţMptpurgautia omma,&pleraqHe 
Aiimead ft f°T^J«^>iM^ eţifţaflisa, ho<^.?fi » attrahmtia tamcupaut.. Hac Ga* 
S«Jf ^^°"^-»^«^5. etiam de temper. cap. 2. hacpeculiarius diftii: 
wt, inquiens . Qg* q^d^^ <^mktaur » mnia mtrimnta 


Digitized by 


dtiple» -y^uiţpe-vel adupnodifimt i^umţiay emfitaMetmnfţpti 
mdmaiaj vincmt , mutmt^ue cmţuşadeum moium , qm idâr 
los\at<m hjecprtyrfwstum vmoiofa, turn natura mnuMs corrup' 
tricia pharmacafmt ; vel mutationU inithm ah aadmdis corpore 
cQnfeattayâdnceţsia.m ţutrefcH«t,ac6omimpmtur;âandecor-. M«ikâ«a- 
pus^mue vna commţunt , ac putrefadmtt ;fmfautem Uc ^«** 

OHoite^enenofa. EjihisetiamatftpliusteTtia.medî(mentorumfp&'_ 

tks^eonmmminm, ipta corpus recalfacimţ^uidem , moli tame» 
nMligmmt. Eflăqmrta eorumfpuies, qm isagmt, ispatiwi^ 

ţorro his .-otummeăicmmtafmt , gmmnutrw^nta,pcntim' 
fimeitaGUcacceptumMedicamentinomen pmma(:oppre- ^^ ^^^^ 

hcfldit » qHxcunque velal&mpta, vel adaic^,i«unanum MiaEma. 
corpus immumeppfruat, fiucinfubftaiitia, fiuei«Krapc, 
ramento, vd quomodoîibef aliter , id ţ^eţiamVenenacom- 
pleaatur; Hippocrates tamen de eo tancum:Ioqui cenţendus 
i£L, quod inagrotantis corporis vtUiţateni.ce^t MBCdica. 
inentl eniro , vthabcturi). meth. cap.i. » eaKpusauxdia dor . 
cuntur , ouatenus profunc . De hoc igimr pîura perpşi.avse|:, 
bis doceotiir io prjBfeoti texm . primp^iridehcei m;qwom£d|. 
cameati mio confiat ptoMcdig«ig.mttîr ab akwmto ■. S^ 
4:undo quam propomanem habere debeat fuprâiuga^ift^ 
torpus, vt illud imniMtct. Tertip quddţranA>>ut:aăo fiejrippi- 
fit non modo â puro medicatnşGt^QjYerum etiam â cibojquo4 
«ledicamentofura fiî^.yel meiUcameîiţg admixt^um kQuarco 
«uod pcdicameBtowm operaţie ^gris tantupmpdoprp^ 
GOZ fw , quippe CM» hi pK«ţeî0^tuîaIiter fe habeant , a pr«- 
«nşawxaliftara IftmwrMem immutari ^cxopţaiit _} iecuş 
ei»m faoirquiferuari, noiiimnuKiwifiupiijiitv Quiiiţ 
niquc Quid fcqBawr, niCrmorb^cas c^6^^ţ«aodq, a« 
«uacuando derooUamur . Ac de primo quidem lam^tiş 4ir 
aumeftcum Gslcno Jpcişcisţjş^feS^MRdqi'lwf^ dJŞWH? 
icx. lî. .& 29' libă -hiiius.ii^M /j^jtevAS.e^|m« 
«ecefTe cft taie effei prpl»ti,a:»i!OTjCşilM:^^^^A»?iî»fft• 
Xum a n««rai qMandoqucţaam dişttuîeiwc K^P*?'^*?^**? 

Digitized by 


^asftât, tjtueiî perfe admoduni validam eflet, vt cituo ttxm 
ia. fuklate^c^^câtum * Quoad tertium. In aUmmtomedicîna 
tpHtmmt^ iiKjuit Hippociib^dc dim. ^ îîz dîment^ meMcmam^ ^^' 4- 
.fol», fubdic ibidem zMdum mm iţ optimum ad diqmd . H^c 
'^ka^^ Hipp0cratcs;0perg.prccium propterea cft mueiîigâre quaadd 
to 45uaado* BoDum fit 5 & quando maUan > medicamemiim cum alimeii« 
dis^i^^ to mifi:^^^; &p£^nendiîmquc Primo plur ifariam id ^ci pof^ 
Xcâncm^ ' fe, iîmpîici lîimînîm aîiguo alimento «xhibito;, ' quod ex M 
aamra aflGmîletur ^uid^m, ac conacrtamr ia aliuftibâtUâîiaaîi 
fed illam^îiquo^tiampaâ:oimmutet.s/quod paiEmiîcri,loa- 
go exemplorum apparam de PIanris,& Ammaîibus> quse Solo 
acquc alimento immutato j ipfapa?mer omnino immutanturj 
-docukGalJib. .j, de fymptom^/'iauf. cap. 2. {^ 
<Mm Ageas<juodlibcc in Ageiidp repatiatişr^vt docec Pbilofo* 
phus 4.dcgea. an.<ap- 3 . :, imtpo^Bbile eft natucam vĂum im- 
mutare aîfmcntum y quin & ipfâ quoguo paâo îmmîiceiur : 
mimmuiri ta^n id cum fit ^ utrila cixxs habeturracio 3 qua- 
propterpuirâreadicuncur alimenta : funttamen alia, xjucCjCum 
manifefte immucent, cuiufmodifuntLens^ BrafficojLaâuca.^ 
citeţ aqr btiius^ijeris j medicamcntcrfa alimeiua îur^appd- 
hLnmxy reî ^ompofito aligiro -^Kmitnmcnto & medicamen- 
tos vt Tipfetta^ ciii Scacaong^anim immixtum fir;- vei^deaic^ 
«rii^itp- ^amknto vaâ cum medicameiito, vel paulo poft me* 
dicamentam^ ^e quibus omnibusdefiniendum exiftimamusj 
xatione h&kz aut cc«:poris ^ aut medicamemi^ Corpus iîqui. 
4em^ veîincâ fanîtatis laritudinem coiiâitutum eft^ vd^^ro- 
îât : Si&nitat^fruimrs velintegrapeni£ufq;incuîpa^^ ^wt 
TOcdmm ot>£iGeat-î)cmperamemum jvelad aliquam vertiîtin^ 
ten^eriem . Qgod igimr ^îimocofîfta?!femperan^Q^^ 
3x>^edâm3ăi:meatb indiget;, <mm fubtftanda opcime affimâe- 
tur ,OTfflopâ^<>^^rans,'v»teod^m in iiatu illudferuari pc^u 
t^odfiadaîiquain^ergatintemperiemi runc cibus exhiben^ 
^?:^ ^'?^*^^ ^*^^^^^^^ gaidcm aiîîmilerur corpori^ in^pia- 
îitâte^itteafciriie^^eţiei ^aduerfetug t ^u^ ^nimaduerfio^Tt 


Digitized by 



mnt$rUs^ ia S. epi<L fee» 8* , primo^autem aph.. itf^î^ifiSK^ fe^ 
ft^^ifiirkitanîîhm otmdhus amj^^^^c^- Si nam^ieCica:pQS 
^^otat ^ dum viribus conftst > purtmi letpârk niedkam^rk 
ttim, ne âcibiadnii3Ctiotte^rcfi:â<Slum>^TOfl3US, quâiaopusefl:» 
agat * Verum> fi debile fucrk, tune bomim eff medicamento 
âEmentiim admi£ca:e i vel paulo poflimedicamcGtmn cibmn 
<^»îxpxapîn^e > Tt Bnc roboram namra >^ medicamentum 
eitius meliufquc adiuare vt imhecilîioreş f^^^^'^^^^^ 
nonnuUisegrotantcs^âprandiomelius, quâm ante prandi'jm h'us > Vzam^ 
purgeiittir, ficatharthicumhaufcnnuAtrationcmcdicamen. ţ^^^'l 
ti» lic determinandum videtur r vel medkaixeîituin Icuc eft > caihâfîkam 
ac cunc noale ei admifcetur ciDus j a quo mcdicamenti Vis iie- 
bei:atur>acf€reeuanefcic,autin3limenriimcedit; vtl eft va- 
lidam* intenfam aliquam obxinens quaîitâtem caiidam > vel j; 
- ficcam y yeîdeleteriam vim > venenofam qqc); veîiniuauifsi- 
mum cft ^ & in hiscafibus alimentum mcdîcamento admlfcc- 
i:ej:>ptimum > ad medicamenti vim hebetaiidaai,auc ad corm 
crendam intemperiem i aut addekteriaîn fecui^acem retua- 
dendam {(\c^iă.tmSurgctnîium omnmm medicaTneraorum nâSu* 

ae:Ut. corn. 2^ x. 12* ) aut âd prauum obujelan&am faporem ; 
vnde iafiiauiora quainpluri£na>Saccaro,ac Meie^qu^ aUmen-^ 
ta funs> condiuntur , vt eorum inioeunditâs horum xiulcedine 
^> ob^mbretur : neque ab re erit Hippocratis psecepaun buc 
a^Iucereî ex lib. de vicL acut.;i^H ^if mcMcammtimi libiSy ţn-- 
(m^mproţmiis Uhmdam ăM0 ^mip4e' h^^m mmort > quam 
(mi04mm efi y qumtitaîe inam ^ ratiom con^tmi^um^ftm^^ 
dmpirgationepirbmiutn nondars^ Naai queixiadmodum .ab 
atccepî:a pharmaco ftatim aliquidforbcndum priberc > rado» ^ 
aabile eft,proficuumque> vtid viddicctabiftergaxur^ aut cor- Ab afam- 
Kigatur y quod â pharmaco ia fupcriore .ventriculi orificio re^ f^ ^^o' 
uium fuit y ycl!kaiis> naufcam^ commjDueEs; ka ii m mei ^^^^f^^ 
dia ^xbibeaaur purg^âcbne , (;vt con^iures pââîm^; nulHs fub» piopii^^ 
mxi rationibus, coniueuerunt> vnicuique indi&rentear âus 
propimntespoftquam euacuatio început ^^,aoîijnodd 14 
ngacoaducit» aiiivbi cath3u:u<:iimibbifcar:ob ţiaturaeia^ 
~ -- - - - beciU 

Digitized by 


beciHîti^emop^ramrifedaoxîum etiameft, cum medical 
mendoperajuo impedfeitu|: â mixtionc hac , dus viliebetau; 
^^atura â nouo cii^o ilkâi% dum hune amplexatur & retine^ 
jfâpulfîom camyacare impoffibile eft .I>e qu5tfco fatis diâum 
fuittexm libxi huius jo^^per vcrbis ijs . S^o enimnonmixilia^ 
tm'franfimactsi69^mm^pi>îo ^ Ncquede quinto atque po^ 
fhremoplura fupcrfumdiccruiaj quipp^ 
" pauca nofais milIud.aîguBi€ntumdiâafint. 

rimbus Medicamenta fortkâ natura in debMibusm^^ 
fomamedi. darc HOH oportet ; ncque paucitate mcdicamenti 
cxha>enaa , debilitas ipiîus facicnda eft , fed fortibus natura for- 
s^i*q«a!S! tibus pharmacis vtenduineft ; debilxbus vero^ 
^*^* macis non Ibitibus . Nequepartiendum eft medica- 
mentam, {câfin^Usîccundum naturam;debilibus 
qmdem debilia â natura , fortibus vero morbis , for- 
tisnaturaepharmacaexhibenda funt. 

^"^ Voniam qua? fbrtîoraiUnr, cranfmoucnt , medîcamca- 
t^J^ tiquc rationem <^plcnt>.\rc iiiperiori contextu aflertum 
^^•^ ., - cftineiadifferenterquibufcunqueia morbis, for- 
tibus quibuicuaquc medicamentis vtcrcmur ( quod nou ab* 
%îcmagao natura? diicrimine fieri poflet^ iam normam tra'« 
ditquam in mcdeudo regulariter feruare debcmustita vt quae 
in hoc contoituxircâpharmacain dehilibus aut fortibus mor- 
bis eschibedâ mandat Hippqcratcs,fincprout ratio di<Sat, non 
proutiâfpeco^t n£cdfitas>pronunciata: nam liceţ verilîîmum 
fît>iuxtaaph» 6. (teu decretum^magnis morbis ma«ynacon- 
uenire remedia, quemadmodum paruis parua , mediocribus 
Hîcdiocria; obâantnihUominus non raro vires;obftat circum- 
iitus aer pîus nimio aeftuans ,; vt tex. 1 2. late explicatum fuit ; 
Jtaque fi nihilrcpugner/orîibus quidem morbus fortia medi^ 
: cameata opponemu%non oauitcM^um mixtione irefraâa; non- 
cximminuta do£ind)eciflia re<klita, aut, câdem integra , in 
pluî^s^ vices di^ţrtka^, ied qu^ integris viribu^ aganf , pro« . 
npornoncq; refpQnâeant morborum. magnitudini ; quemad- 

Digitized by 



modum e contra, leuioribus mcrbis > non nifi îeuiora medî- 
cameîîtaa<&i:bemus.,neque fetim ad mineraîia &metalîicâ 
medicamenta cofu^ieadu, vt pîerumq; Cbymick in mor-eefTe 
notum cft, etfî illa ad omnknodam benignitatem artifkioiâ 
operatione redata pr^edicent; raro tamen id veru experimun 
nam cjuamukfoitia, ceiufmodi apiKi Hippocrate^n f unc Ve« 
ratrum, E!aterium> > J^epkis, aîiaq; idgeniis, ^u^^x innata 
yi â longin^jais partibus .ele6iii^ ^alideq; traliunt- Jî in aiini* 
maexhibeaiitur qaantitate,imbeciJiia prorsiîs euaderequeac t 
quidenim vnum^ aut aicerum Scan^onij granum e^ciat? 
Imbeciiliariîrsik , vt^ft Mercunalis ,, Lac , & Semm ^TiiixnS^ 
aliaq; Hippocraiiviîtata, in^enci-quanticaîe exhibita^ forda 
<;uadeFepoffint; nibiîominus, iilorum natura ignea cam fit ^ 
venenofa , kuman^qi nacnrs adip<^umîcbii^âria^ numquam 
adcQ rfer^icti poterunt^ quin aHquid deleteria fua vioSendăc i 
proindeq; ijs> nifi neceffc valde iît., vtxjoatumacioribus in 
mo^bis iJeaca. friggidaq; piruita prouenientibus,atit a melă- 
cho!îţ5D^umorecrăîfo teireoq; ^ no vtendum;fediuncfoîuoi 
debita ebrum doiîs minucnda , autpîuxes invicesparticnda 
crit , ybi forti cum merbo virium imbecflîitas coniungatur ^^ 
-vrtex^iS* expîicuimiis;: VndcKippoc. lib, acuu inmagno 
morb©, cum ingcncibumerum cuitifq; generiş re^etione^ ia 
q^P de longitudine adnynustisi^ndam erar^prpptcreâquc 
viribus iure eratconIiiIcnduiTijScamoniojnediocHter purga- J^^^ '^' 
^€ pr^cţpiulmbeciliia vero^fi eo yfque au^eridebeant, vtior- fiue^^S, 
tium vim in fortibus^xpu^uandis morbis cxa^mients in mon- ^^^^^^«0^ 
itmoiam pf oiecto excreicent quanutaîcm , quam Aegri Hire ^Uborata^^ 
fafiidiant , atq.aduerfentur. Verdm tam mufîis ho£e4;um SîLtwli"^ 
hîsipUcibus , turn compohtis medicamentis^qu^^ quodiii^- ^^v^Cui^^ 
diocria iuK., minimumq> deleteria vipqllcant, hui;nanasque rhânnaciâi 
nacuraî baud multum aduerfentut^benedicâa nuncupari con* chymiciT^^ 
iueuerunt , noftri hiiius jEui phirmacia 4itata eft>vt innoxie faS'Sl**^ 
adi^odum in ijs diuagari ^offimus^augendo, minuendoque , 
prout magis opus efie vidcatur ^ vt prartcream imiumera a 
labp'riofoChymicorum artiiîciorumisîa induftria haiâenus 
inirenta j-quibus iccirco iMedicam iacukatem um mire ab ijs 
cxornacani pliiximum debere^genucfatendum eft . 

::-., C^c Carte- 

Digitized by 


L j; Câ^terum morbî ea parte , qua proxîmî fimt * 
uoihişct educendi {unt, de qua^parte fîngulis exitus proxî- 
fcm^a^cm lîius cft^extialiendi . 

SEntentia hzc iam expîicataBabcter &ex. ?:$ Jib- 2^ vbi. 
coniîmilis alia coruinetur» qucma&B^dum etiam ţcx. 1 1 . 
libri tertij . înde igioirx^fiimenda, neeadem fiuftrâ piurics 
repetamus/ jlkd obiter aHîîotaftces>noii fîii^ caiafe pr^- 
ceptum boc codes infintîaflfe Hippoctatcui , cum alias- pref- 
fus adnioduni fît^ magiii fiquidem momcntieft, vc alibi 
diclum . 

• 1 1^ Ahium autem îlibducentia talia funt^ qusecunque 

Aîuum^^^- lubrica^ ScinciRii'SL fiint, 8c qu3^cvnqiie in c^dis 

quorfiu^ attenuantur ; ( Venter enim calidns eft ) & relîqua , 

apud HiPP' qu3e ialiuginofa funt ; & quxcunque ex talîbus plu- 

rimum participant . XHontră , aluum non fub<îuceh-*- 

Aittum £- |.:^ ^ j-^^ lifle/rfia funt , qiix flatam exhibent : ( Jiumi-^ 

^at . ' da cnim rcîicnata natmn fs^ciunt ) > oc qu^ aditran- ? 

Humidairc gunt,&qii3ecalore compada funt, & friabilia.& 

^^^^^*'^ {icca ; Omnia autem, quse forîs extenuant /intra 

corpus affumpta , tumefacflionem inducunt ; eadem 

autem , & ventrem fîflientia , & pituitofa , & tume- 

facientia exiftunt., Etqiirealuumfubducuntatque 

extemiant > cum €.alefacientibus eadem funt ..Infu- 

per autem etiam acida pituitoik funt .Omnia vero> 

quse frigefaciunt ea, qiiae in ventre funt ^ taHa aluum 

fubducunt. Item quse friggida funt , & qu^ humi^ 

da . Gum autem non aîuum {iihduccntiz fiierint, cal- 

faciunt. Frigefaciiml^.autem Sccalidain ventrem 

alTumpta , & cito feceirum faciunt . Si vero feceC-^ 

fum non faciunt, ci^da in vejitre exiftunt . Ex iiis 

quxcunquc repîetioncm faciunt^ maxima pituitofa 



Digitized by 


cuacuanobus, adâdagcaâku > mmeiâckatibus, atq, exte- 
nuancibuş m^atioaemJiabuiflfet ; buhc earundem tacultatmii 
natur^Qi^^^arius €Xf4i^ accidentales ^âciSus 

cădem caufa exgOHic^mbd^ initmm diicens; in quo 

rum feric enumerat, qax ab innzu, knuq; humiditae^ aîut 
Yiaslubricantjfoecefque^quasattingunc, cenaciter trakunc; 
& quae parcium teauîcate craffos & leacos diflecanc humores, 
qui deq^^^^ P®3:ea â namrâ peiluiKur.- Hin 
*u.i4« Ragkiausiiumefl:ac pkuitam digandcas iiia acrimonîa.Icem 
qiise<:aUdi$.mloPŞ,yeatticuloaiiHk^ moHiuntur, acouc 
diquaatur> quceq;demuLn faliljginoiacum fiar, exDute^ 
iaccâiaorum vim irnan^ - Girca quis nou prseccreuaduaî 
«ft , qu@d aotat Alexan. Petron. Ub. de alu. fiae medic. moli* 
cap. i. > qnod kmuat vidciicet , iqusî iaier cibos , nea iacer Saifa f^^ ^^^ 
potus fal%inQfa fuat , & qu^cunque ex caJibus plurimiim 1?r^ara£Sî 

n(U ; aii x^m propter Juam corpalemiam in intefima potijpmum 
recipiuntiir : ^mmclrem UU,cnm alio firanfnr» ^jiccmiM xd 
polleant y fgâcem arefâdm^ia^ vmtrâm ^firingîmt . ^ , qmniam; 
ininîepinamagis repimt: ^JuafalfiSm fiimuUntts ^ almimcim^ - 

m.iS, Hînc Hipp*lib*4e Şq^ aer. & Ji^, > Almtmntur, inquit, homms 
âefdjîs â^uis propter irnperitiâm in eo , qiioi per abmmfaedârâ , 
eamqiie fihiere puîantur : maxime enim contraria jîmt ai alid^ 
egâjiionem^ ac feCi^jjum : fimt enimcrnA^y ^ coijtn nonpo^mti:^ 

^^'^^ • ipiârkymter m^gis abipBs zâ^.fingitur 9 qua^ eUqnMur. As 2, de 
ăixUyS:i.lfamenU fîccmt , ^ attmmnt i plerăq; etiâm dtmm 

nu.x6. ^mter mouent . zc paulo poli . Cf*,me$-fd$ fsmaî^ minus tin- 
dem alunty humido psrJaUm ţriuai^ ; attenuant etiamy ^ fic^ 

2\^-49' ciznt iCtc fufficimterduHm mouent . Ec libello de aSeCţ Sdfa.fe-- 
tionesahmmAdjiringe-râ.j filfis'ver-o dhs aV^r^.H^ec Petro- 
niu5* Collocacc.conadia ilftentiiîuinumero Jîaculenta>p:- 
. C CC 2 -tuitoli 

Digitized by 


I ^% nî?poctums fJs. nu m u^^ ^ 

J'^^r^^f w tuito6 vîdeKcct , craffamlcntamq; habentia humidîtatcm > 

*Ui^ *unt. ^^^^ ^^^ f xficcatur , hoc eft ^ <yfcudtur atq. refHuitur al> 

imbeciHioriprafcmm calote, in fpirituofumquendam aii- 

turn verdmty craffum aeque impamm,qiiipoftmodum,iî CC* 

piofior fit^vcl intelHna'coHUohiit, vel iatercipit feces , vel ex- 

' ficcat . Ea pariter ^qaas ex fui natura adftringentem habenr 

fecultatem> vt ăuftera, & 2K;erba > quasqae tcrreas cxiftunc , 

ai^'^^ friggidasq; fubftand^ . ^^J^î ^-^^^^^^inquit î%poc. ^«^ ^^ 

* âflFcd*, ^ ccntrahunt c0fpis;hahmt^vimfifienM .Quse itideni 

' caîore obduruerunc , & fîcca funt , & friabilia : talia namque 

cerrea cum fiî>t , & aquea> nuflam aut pingucdinettr, aut len- 

-tam humiditătem particip^it : quapropter nequaquam â ca^ 

^ îoreeiiquantutjfeddurioni potiuseuadont, vlceriusrefolu* 

ta aquea humiditâte, vt ialocinore eucnitj'quod commeftu> 

aluum fiftit, quoniam quo magis coquicuTy eo magi^ dure-» 

fcit,non eliquarur *Docuit id Arift. lib.2. de part. cap. 7. in» 

î^6 r4ut- ^i^^^ • Cerehmm ataem ejfe commnne aqudt it tertist confiat ex 

tur,nofecc- eo 9iţmâdacdMtxcummdmc(>qtdtţ^ 

modîtmmlegmninum, reliquorumque fruBnuindecQBionet^uoâ 
I enimesiterramagnaex paria conJiantthincexaBohuTnorâfqHem 

^^tim jiu aâmixtmn continent y dura, tenmoij^ 
^o^e relinquuntur . Et Hippoc. liKde 2fft&»'Stahiles,mquit ^ na^©. 
fecedunt , fiicccfajunt & rmura-coMa. Idem accidere aflerit 
Afia^ ctîr Hipp.2.dedi«.cireâafl[kayj2^^^S7w^//^?^ ^^^^* 

**'*^*^ ^^'^^^V ţroţtereaqHodhutmăitaSy itemqiţmguedoprignem ahlata Junt : 

ofcuU't>manicmcluduntyficcmî(l\^câl^adu^ , 

UmtiditatisfiJhmtMxcHifp. Quidautem fit friabile, docuit 

GaLHb.j.deafim.fecultxap.27. , L:l^«^M^J?g»^ 

^ ^:rabik^îii<i ăc fi Scasnikil in co ejjc letoTis aut pingiiedifiis. qu^ certe caufaîis 

/^"* definiţie efl;ciustamen forma| 

i , t€OX.ttzc.^.c.2.(^actmqueÂnqmt:,itâconcreuere9'otmHltisfia^ 


îgimr male coh^rent ob lenî;^ ^pinguis humiditadsindi* 


î • Digitized by 

L _._.^^_ 


gcnuam î trmk in mmîa^is commiauiparEes apta fimt yoBo^ 
câşt<jue , ac proinde cum cibishntorcptxi^m t^ia aîîmcntâr 
eonimiicere proficuum eft . Siftunt parkor omnia^rqiisB excc- 
lîus admota extenuant ; intm tzmtn fiumptareplent: H^c cc^ 
mm câ!idacumiînt&£eca> extenorcscjmdempartcs^ i^fo- fi^^^fj 

ficcatîsfedi^ , aîuoque obduiai^îe^^ dcînde ^^p^ 

dere nequeunt , cum priepeditas ofFcndaiit alui vias . Subdit . 
Qu^ aluum Julducunt i extenuantqHe'euacmndc^, calidap^nt^ 
mn ăutem ficca : Quod ad eorum difcrimen diaum cft^, quat 
excerius extenuant^ inms autem repîent ; & non modo calida> 

^ ^* fed etiam ficca cxiftunt.Id clarius expreffic ASc&Xat:di ^aH^k ac 
cihUficd qHîdem^Jîflunt;humorem enim in 'omîTereficcant tfi^vero bumi^ 
humdiJuntM^eBantes per calid2tat€m,aluuf^ducîmt^^ ^^^^^^^ 

m. 50- inferius . Qu^per aluumfecedîmtyfiiccofajunîi d? natwacdida . 


înmper etiam acida pituitofa fimt . £ f^"'^^^, 
cida^ proindcquc , & ipfa pituitofa^hac eft> replenria exiilunt 

;unt, f^«^^* 

A t ex 2 . de diasţ* Acida non reţlent . afiercurgue rario ; propte* 

vt docuit GâL 3. de aKm» &cuL c. 2 i^acida cum cxaiîum luc* 

cum in veiître muenerint, ipfum iîîcidunc > ac feorium âcâi^ 

mnu indcque dciediones humedanc? Qued fi vcntrempu* 

îum inucnermc^ipiîimmagisfîftimt: frigida enim&ficc^ t^^^^ 

fum 5 t€Duifque fubftanti^ : cx quonoa modo adftringum> vcntrem in- 

fcd etiam di&cam;vnd£ variosproducuatefeaus.piSma^ J^^^^ 

t€riei>circdquamaguîit> varietate. , &^* - 

Omma verd,Qtîaefiig€faciiiîitea,^^^ 

ftint. talia aliium fiibducunt, ^^/^^^j^^^^ 

V quod iiabetur lib. d. Î08SS v«© 

cpid. fee 5 . Refrigeraîio > i^ua in vmfrefunt , durut : Quod de ^^"^"^^^ ' 
tc5£* 27. exteriorum rcfrigeratioae intelligendum effe vulc Galeiuis ; 
extimis enim rcfrigerads ventresincalefcunt , dum intcrnus 
calorfrigorecircumfeptus, adintimiorarefugic, vnicurque; 
optima proindc fie ciborum conco^o , & dUtributio s qua. 


Digitized by 



k I 

prppcer d€icâ:ion<is ficcâri :coBfequjen&dîj A^urefcere , v 
Ipiraatc Aquilofîe ^ 6)?emalique temporexontiagere afferitut 
fee* i.aph.. î 5. ySc fee* 3 * aph. i q. Interiamm aumm reâige- 

; I utiohmriC^tl qtiixîimmQ celiacos interdum a^âjus> feu 

f ¥enţnsproflOTiacoxu:icai;,cibîsneque-prob£.€2^oj6fe 

1 1 : . titcdift3^u^,^x^ftatadhucl&.2.ded^ 

f [ :B^<^ S2îritm^:cihuţ:,:itp(iîîish 

ti s. « j^^^,^ Galcai authoritate refeîlas loco citato^ impoâSbiîe id eC- 

i feâîTerentiş> cumpattcs ventrisadeorigerenequeant, vtcibi> 

potufque congelaţi obdureîitur velucalia excrâ noftxum cor- 

|t pHs hyeme 3 &jgore concreta durefcmu : priusenuîi, ^uâ^^^ 

î : ica ftigercţ.> Bomo iatenrec : uam de vJera congdadoBe âaaud 

; ^ Hippocrarem loqui, certo cercius patet ex eodem zAc âixz.^ nii* 2> 
<^M 5t co- ^^^ ^^^ P^^gî^» Bjirsiis cîiam caliditaîis excejjusecmdem congela^i^it; 
.gcutîoapud ^intantum^vtdiffundiMâi^^ant^Loquitj^rm^ 
: , / Hippociatc. ^^^^ ^^^ ^^^ ^j^ exceffu pariter caîork prouenire pptefi,quaî 
limidyi^aeft coîigei^o, fedquşdâ.pQtiusincr^^^ 
celienti namq; mm ir^ore>timicaIore>t€nâis bum orCi fe urni- 

M . cxfîccando^umexprimeGdo^ai^idcraffioresi^dxi 

miaiis fluiaîes:ex qiK) bumoresbyemehaudbeiîepiH^arixo-^ 
muniter aiîermir> eo qudd craiîipres cu iintycacharticis minus> 
c^jl * ceduîi^Omkco:>quod^xGalcniiciiccntiafi'iggidsepotiO;CaIi- 
;/ 4is uatuc^ yeacricukim corroborar^ vnde 7.raethxâp. 4*>Ia-t 

rj ^ iumacaiuU- Cju{qţ^ muc gelidos exkibuk : quap^opcer Scncca nîaem ^ 

«aîumrobo- 2eituantisvencnculiio.iâriumnu:.naîpaiîit. rnggidaergo >nm 
£a!cpiftoc c^^ft[î^^ i^^^i^'fiî^ ^ ^c Tentriciiîi facuîcates dcijciâc , cercum 
i^îx ^%an _ efc quânmm^dî cx te ^ indurare ^ cogere ; yxide cx <5» cpid. 
Sla^^!^ ^^* i^'j^igp^^^^ ^^Id^venas francii , ^ r/^/J??;^ a/v?^^ ^?f wfj^ > 

refere, qu^ peraccideriScontingunt, qaalls eââibductio â 
f r€frigeanubns^modo^ad£nusexpIkato.Patetitaque vtnam 

ca , qu^ voacrem > iiucea^ qase in ^ntre iantj firigeâckmt^ - 
au£ qii^ exfui :iaauirairiggida iimt ^ pDoiadeque coqui inepca^ ' 
^^ -^ alHum 

Digitized by 



s^uuin tubducaiit: quatenus v-idclicctlsdia. ccKâioiae> aîim^n* 
. taxenuia> femicrudaqiiedcorfunifcrunîur; qucmadmodiun» 
qu^ nimis humida {unuzhhitndo eandem* aluum humc^tanc 
Quod'fi friggida nan vfquc aded potenciafînc, vclxfo caîore Cabta B, 
fubducant; tune calefecianc nece&eft: namc^rvc contra-' ^^f ^^^ 
do reiiftat > vnitai in fe ; indequeautiuperâtur ^ & tune vitia- 
£urxx>âk)^ ai^râcoatrâdjdrcamobiâftentiaaiîgetur. Nimia 
parker huiniditas. > jsiiî aJuo commota deijcicur, -putrefcit ia 
ventre » ind^queicai'or prateriiacuraliteraugeuir ♦ - 

" Frigefaciimt enam & caEda in ventrem afliîinpta . 

Simmiriimadeaiiuenl^fînty vrnaturaîenihumiditatemjin- air^ 
nati caloris pabuluui ,. valide abfumanc : tune enim naturaicm ^^^^1^, 
^"^ " ' calorem per actidcnsimminui , ablaco alimento, neceffc eft; ^;^/**^'*'" 
vt.patetin^potennoriviaa, copiose nimis haufro , quodim- ^^"^^ 
minmti caloris.acGidciîtia părere confucuit . Calidaigioir, fi aatuiaiem-^ 
taiiafînt>ip{â^ed§|Bd£cafli|j^'jufaciiint lasfa coclicne . Quodfi ^^^^^ 
naturalem câloreoimodo explicata nonisedant ; tune quod ilacui * 
calefaciant xieceflc eii ; id namquc perfe > âc ex fui natma- effi- - „. . 
cere apta exiftuiît.. hâsim^m^ 

tx his qusecunque repîetîojîcm facîunt Scc..^"^^^^^- 

Er alteientxs mEaimm, qii^cunque plaricaum nutriun'^patic^ ^. ^ ■ 
^eragignunt excrementa ^ h^c pixuiix>ia y fcu potius ^ ^r^epleci- piu^^Sîf 
ua^maximc iiisc v -minimeo uc aluum fubducurit ; velut c con* î^uuicria £- 
tta-^qas&niuiuîiuiTi i^criunr^piunmaquegvgnuncexcreaien- cxcrcmetor*; 
ta y abhoTumţoadere > aut acrimoaia, a^îiiumiditate aîuum f*^^Mtcxa£«. 
Citam fcra aeceâe eit* .:. \,- . . . . -- 


LIIL - ^ Medicina itaque mibi iam totaîniîenta ciîe vide- ,Moii«î,^ 

tttr, quâî. fiejbabet, & qu^ d:ox:et fîngulas & con- ^ 

, fuetudines âtoccaiîpnes : Qui enimiîc Medicinam 
iîQiut;,nim autcxpe<flat; fcd. 

&ci£râ fortuna^ 

ftan^ emm , 6e fiirma.eft tata Medicina,, & . docfîrin^ * 
optima in ipfa-compoCt^ ; minime fortuna cgerc 


Digitized by 


jji" siPPocRATis uBjn.J^E IOC. W :hom. 

apparent ; nam fortuna fui iuriseft, &miîiius impe- 
riofubeft ; nequeoptaîitiseft adipfara perueîiire : 
fcientia vero imperata facere cogitiir , & facie eft 
:? ' ''■ iplamfeiiciper aflequi, fiquisfciensvtiyeiit, 

TExtus hk Hippocratem vt iîbi pugnaîM:c^^^ 
. damnate videmrrquomQdoŞaim Medicina tou^m 
1^ eft>£Iib. de vet-medcomplui^ deia<^p$ imienuiriâ ii^^^ 
ficiend Vira , .5c inueatoîntmi iiiftm6îo af& 
cpiftola vigefîma adDemooricum; fe> quamuîs fcnem , ad 
. finem Medicina? nonperaQ3aiffefatcmr/Adhsec,ycnam^^ 
fians firmaque cota medîdna afleritur , cunitcx. 42. hm^ 
I?ri impoffibUe cfie^rmaiiierit, ftai:^ ^^ ^ 

^ţ^^^^ ^ primo vfque mimdieKordio Me^icinam cxcidiTerattobahiîe 
4io cid^: eft , non modo qupd primum iîlum humamgcn^ris Ero^eisi- ^ 

cocem nihil lamerit ; quaproptef^gim ^mbu£qiie rchus e^ 
, pî^eflfeia£f»f r^amm nomeîu^tîi^<kQpofii^ 
Mofcjscx- MjQ»fesi.GeGetcap^s.>Vem 
I^S'n^. ^"^^ ^^^^ depJorandum Diuins lx£x Maicftaţis crimen , io-. 
xneciamr» * ftuftp moiis coiîfilio , deceihndoque parratum ^ omne xmcn^ 
fŞ**^^ narum genushnmanitaî^^lhceflereic3epit ; ipia<ţ adea ne^ 
fiu£- ^^m variaporquirere ^obfeîuareque coegiti quo JbogMori- 

.buşfiiccurreretur. Tamen empirica prorsiis medicina iUafuiti 

c^feruationi tanttimmodo innixa vnnilis' i^^ 
^^^^ diuq;eamitapcrmaGfif΀cre^^^ eft>tumăpudChald«o§î 
d.-cb c^^ mim,^dwEgypdos4 cum nullius ;ad nos jaaeiîi^ria peru^e^ : 
& 3, . ,. . , ^^ ^ ^^ ApoUine priusillam accuratius.excatenţ,. Hic mq^ . 
ApoHo pri- herbarpm compJtiritim virtutes adeptus , quod eas in Morta- . 
^^^^j^^ lium yţilitaiem cpnt^cnîiint=er N^mtna r^E^ eftr namţunc ^ j 
-- temporisNii^ilii^^i^ 

^lif^'^^Moi^^â^ j ataue hdcad ^tem^m ghnam t;ii . Şccutus ilîum 

elî>Mculapi^ fl^ qiii Experimenta ratiombus exornare^ 
K^oiirSt- a^^&s #/ pnmaqueartis^ , atq^ am-;" 

aius c^pcri- ftfiarcT vr^&ipfeii^arî^^ , 

^^ ^ iaiifl^ Afclepiadş^i conijJure%vtiîi/fînmn^i«:alibusaA^^ 
t^ic ^mxb e2£penmenti$>; documcnaique^ei^c^re Qondciîaeatcsr> do- 

Digitized by 


nec i^aigmis iîîe fiippocr. Coims -txoxmsdk yfipxhxi pxz^ 

• pî:^claî:e adco dicauk> mmcxhm&um propi dodda^ th&* iiau&am^feC 
lautum reliqueric . Skm^mtes omnes artes mdesfum^ inqmc ^"^1^^ 
Senccâ , harumque mfroceffujuhtiîitas crcTut . lure <rgo aiîerit . 
Hippoctaces toatm M^MimmMm fibi i0ueîitam vi4eri^ i^St^?^ 

^^^ ecirn 1. ^txH^iim eft > fe^t hb. <le m, med. > reque ipla id 
dam^fea^i^ Mediem^ lumen Gaîcmisj^^i omzîia:aded 
iîlufirauitj^wxitqae^ vt peifeâiiîîmîe artis maieftatem-^ dfe ^^«<H- 
Cîmbuerit:; ne'q;pofthaedeerimt^<pxin vberrimohoc agi^ SL£l^ 
non kî^fcHcit^r-urfudâtiiri fînt 5 nifî âd€G e^^ 

ra, yt nil boni nune f reducere poflît: fed qiK>d vuîc Hippo- wLtdic^^ 
crateseft^quod Medica ars^ideS^'^ubriiimiiia prasceptio- ^i^i^^- 
amujlemetmarumq* concoîdium &4:oimexaru^ 
xâăpae experiociâţq;muentamm> iam toia â&o v%tempoj^ 
r^erta extaba: ^ fuis omnibus integraţi partibu^^iîueadPliy-. 
;/îolegiam,fiue ad Pathologiam,PropJiyla£iicam,SimiatîcaKi^ 
'&Therâpei3dcamripeâantibiisiica^ttîMtaacdeel1ct£^^ . 
qiîa^adveram peÂâamqtiexadoiiâlemdifc^ , 

tii^ndam^e^cCario requiamtiir; «a , in^am^ 
'fiegiilas'docet <oîiruetudines & occafîon 
tiun tSt&xxs y agendiq; opportunitaces ob waxlos ^idelicet rc^ 
.pentium humoium ioîpems i Nactirse^morbo aduerfantk vz- ,. 

tios ad varhs*partes cotiams , imaiaru Corporis fluxibiliţa- ■ 
tem > Medkamcntar^im varios iddem ^ atque inQpiaatos j . 
efefîiis^, qui emergere paffim confeeueîimi: 4 inque uaca ^ 
renum iacemmdkie 4c vari^ăitai<;/radoaabiHteroiîiBibus 
ie fe opponere docet; îtâ vc qui animum pra:ceprioa^ 
rite inftitutum habet , vfuque habitum reCia raţioncfaCiiiium 
acquiixuerit, aumqyam iemeteacquekconfuk^^ 
Jo^cmi^ {e/e commktcns, fedi re nataconfilkm in areiî^., vt 
dicii;ur^£apeiedidicit> temperam occaiîones , oppormmcar 
£esq;ad agenduca aoicensatq; arripiens;idqu^vî: diduin eft, ţ^^cepa^, 
generaliu pr^ceptîoru ope, quas legcs appelîac Plaîo, pcr.quf I^SfuŞ^ 
iymptoîn3tibus inregulariter ac turbate emergeiitibns , xegu- ^^^tojiaîio 
^uiaricer occMrrere docetur,cuiufmodi illud eft ..C^^m«rîc>^^ 

Digitized by 


Medicina itt 

J94 ffiFPOCiurK LîB. UL m LOC. m Hom 

cmtrarUpmtmedeU QuptnaximeNaiuraver^fperc^^ 

no^ mQuenda. CmcoBa medicari; cruda nmmouerey nequemţrm* 
cipysy nijîturgeant. Repentitmhumonmfmddadedmamyd^n 
uatioyrmuiţta ,jîccatm ^-r. aliaque Euiufeeţncxii, quibus apho- 
riftici Hippocratis lihn^ Gakniqiie metîao<his,, tefertâErat 
fiint. Quodqu^tovemmfitvhancnîmir^ 
tamab Hippocratis vfque cemporibus fuiflerepertarKy luce 
clatkis apparcc eius nmDunaenai perruffiraaribusrNonincîe ta* 
menfit, quiaimguî^h^epartes \H[teriusadhuc perfîciy ftn* 
pliarique queăc abijsyquiijfdem innixi fiindamentis>ea(fe'mq; 
viainfciefîigaBtcs progrediuntur^ vt enim afiTemitcitato Eb. de 
vet* med. ^Medicina ah antupia exifity ^prindpumy & viain^ 
^lfal|fs^ tieTsUa^ ^multa, ^prole haimttacomperta^nî.permuttumadeo 
ficipoteâ. tempi^x & reli^uaddncepsifmeTdmfur y ^qmsjuffkîensjit ^ ^ 
iamimtenî^itumgrumiSpex Bsadperqidrmdum precedat* Vt a.u- 
temdoceretaliam amneabbac Medicir^mfelfim eiîe, eofqj 
r^probaxet 5, qui de tK>uis conftituerrdis feâis aisiduelabo- 
rant > intct quos non immcriî^ fortafle e Spa^ricis nonnulU 
v^ Bouam adBumerafîdi rcmunt, qui mxfquirationales in Mcâicoscon* 
^icdiGinam yjicia e&tkc defiaunt^etfî alias non inutiles prorsusâtcamur 
tiâindame- medi£amentorum<piorundam prseparatîoncyquaîy h luxta 
*^^riâau^ Afcîepiadum dogmata , rationaEque methodo in vfum reuo- 
lunt» ceatur > perfepe fâîutaria admodum abfque dubia efle pocc* 
mnt;aJioqui pernicioiaplerumquecîcperiemur^ Sicpergît. 
chymkame Quicunqm^crQ hk reicBisyMommBusreprohatu,alia zdoydiaq; 
dicamcnt^ fo^cmaimmr&ce cmatuTy iţcfuid inuenifTe dcriatur^fdjus efl y ^ 
acgiîîacic©- fatktar. Sperandum îtaque> & inpolterumpras'Ciarinimăm 
ds^o^^iuf- batîcartem, pr^qae cseteris omnibusproficttamacceflfîones 
tis vfiirpen- habituram , ccfî iam cam nonmuItumpronaouericonipicia- 
M^dieînae. nius>e6 quodMcdicoruni multitudo^ quorum plerique folo 
'^'^"^^ -^ h^ nomine talcsiiint , viliorem aliquanto rcddiderint ; ita vt hcN 
bcf J& cur. mincs eam haud mnlti nune facere videantur^iuftis fraudames 
îiatâmcâii» îionoribus;indeqyn€ extinguitur amor,quicxPI^oaisfe^ten-. 
tîa y artium omnium gubernator & inuentof eft ♦ Bonosfi^ui^ 
cicJî.t.Tt:- demalit art^ipQimieJq^JncendimHr adfiudiaglori^ Cicero, 

iaţ^^uemfhnper^ ^u^e apud^^wj^cimprcimtur. Qui ergo 


Digitized by 


Tâdone, fcd «meritate cflMIiua ^ cui ^ă^m Axn&xmim^ ^ 
nieie fecommittet^ Sedabarce^quseihabitus eft opcration^ 9i«i& 
rcâaad^ttstatione^irigens, îege% 
beneios^ ^^rfalKMîi^ 

Mimpedât^ ^emSlaie^uam x>p^is£nem obirnebit^ viid^ 
:& citrâforaiiiam,&xumiroraina:beiie a^ittcumiorîunaqiâ- 
dem, finiha ciccamaceriale 0bk<5tum.acci4ac , opecationem 
irapedîen% j <iuinimm6-2aiguid accidentsai^^ 
dequelfinem feUcitcr^ffequ^mr.* citrâifoKmia^ 
Hipj>*ej>iaa 5. adCîratemm ^ i r^i?|^^ 
amc enim>etfîinteammaion^bî^eaLfineîi>,indc camenn 
iît,guin^mîmiS'Teâ:e^peîamsfue^^ : . 

prîBcepta egerit, ^tlaâus4iâum dl€ex*43. Atque ^calisyro- ^căicâau 
tione aîque«xpei:i;^Kia^om|>r<>Imu^ , coa^mencata eft, <o- 
ft3^ş,:atg^e^Etaadabi^ sexiîb^ iii^uc^Dpa^^ufo<îiiâmsH^ 
^exlc nîfflainaigctfortuaa, <iux incoîiftanter Vlîaab^uei^a^.^^ ,^^^ 
iriotie fempcr operanir^umtiulikar^aaripoffid^ibi^ vtâioc^^^^»^ ^ 
vel ăludprodxacat îiîjcmmi «nDreni^en:.,iediai leraper iuri$ ^jaa». 
eft-5 indifferensad xjuaeciinque , niiîiamhabaîs Gumiuo^ffe^ 
âu.^onîiexioaoaa rflequ^in vliius atfaicrio eftiUapotiri. Ac 
Scmmi^ku Ars ie contra xletoirmnamm-iaopus^Aii^atura 
direCia eft^ 'Scdn ordine adiUui ^acquirendii^ 
oî>aracur >facile & vt pltirimum'^tkm ^qmrk , ii prudcns 
bcneque mftimms Arttf^ fcfeucecr vi^iie^^ 
prşGCptaex arteinvfum^euecar^tBan^^^ ^^ - 

]?hto,-^ma nojlraper nrtmt mad^ i^f^mţia'o^ vt^erfiiy 
tmâ?ntm^ecvncum xfOgeîur^ Ex^idis lam&tispacec curdi* 
xedt iiippocrates t:-42. impoiîU)ie ^Ife âamm ^ercamquc 
do®ţnam îiiMedicmaiieri^caacrâac in pi^fenâjt^tu Jccre- 
likTnon %abct ^$e&inv<ertam Aacamqtic doârimmparoh 
cularis *vnim cerţi atqireinuarîâbiîis operacionis^ ^Scdpco- 
iria^ f abrili^naria,^ca^£r3equc huiusgei^sds , fed^um 

Ddd 2 mera: 

Digitized by 


- vamx pcne'fintiaca opcrandi vârîetates, etiamad cundrai 
finem obtiBendum > ccra tamea > ftabilique fcientia per vni- 
' .; ueriâJes-^palilam prasceptiones &: leges ici regulator, vtcx* 
dui^quamuis tetneriute ^ nihil incomuItQ agat» 

- y Deinde vero qnid opns efl: Medicinsefortuna ? fi 
*^ eîtîm morbarum^medicamentarckra funt 6c manife- 
fta , Yelut eqmdem arbitrar > nan expe<3:at fane for-- 
tunam ad fanandos marbos , fîquidem fimt medica- 
menta. Si yerO' cum fortuna exhîbereîpfaprodelr; 
nonmagis Kdedic amenta, quâm ea, giia^ nonfunt 
medicamenta > vnâ cumfortuna adliibita> fanos fa- 

aiŞcdkiriâm T3^^Ş^" vîterius oftcndere > quodMcdîcinâ £rma^ & certa 
n^cq^l^^ l^fit in fuis aperationibus y quiquc eam poiîîdet , non ac- 
miupciukt cidcRtaUter , & exfortunas arbkratu> fe^^^ 

falKbiliter bene operatur *:Prabauiţ id fup^riori textu rationc 
â medicing eflcnda defumpta ; cum .Medicina vera ars fir ^ 
P optiniis dacamer^ pr^cepii^îaejaâiţuţaj arţificis^ 
-^^ aes^ib r5«doiie ad<^u& dkigeas; pEc^^ 
'; eft^ nuHa âccidencaria caufa indiget> vtfuopotiaţurfi^e: 
vtquedicebat iHe . ,, . T 

5itti*kMe. ^ ; ; msfadmmBcriunaDeam^ Coeloqmbcmus^. ^ J . -, 
îd if Gim iam prob^ râtioae aîit â,ti^di€atnen|ţs petica; H^c 
mâmiivtxz iut^ac ccrtueft» qupd exfiiiaatura ad taliter vel 
, :r. talicer ^endumjalrerandamq, deterfBinatae^jţtantjquid ibr-l 
mnamexpedabuîicyt akerent? Omiuenim Ag^ 
frlicatum, fenaper, &;infaUibili£er.a^t . -Quod fi ad agendiim 

^ nonfatis&talkexfui^ruraeaeffe>connexk>^^ 

^ tzliA&ăn habere^ibî âdkuG fortuna opu^fit; vtique naş tm^ 
gis ri^dicamenta,: quam C2eceraqu5fcumqueindiffeîenrer> 
modo cum fbrtun3^ibcântur,far)U^:e^ reftiti^ent • JFortu- 
B^ hquidem efteflfecbm prc^g;^ CUî^ qup nu^ 
ti^icer connexionemibabeu 

Digitized by 


1^, . <^ ex 

alia qtrapiam ârte^xpelJit , dicitqueeosvqni probe 
xem aliquam (ciunt ^ fortuna n or yU ; is contrarîum 
milxî iucEicare vicîerur . MiJii enirn foii Jxi fortunate 
afîequîv itemqiie infortunate ROB al^ -^^^.^^^^^^ 

quire^eqm4&malef^ ^4^^ 

affeqi^> ettrecŞe&cere f ioc atxtem^l^ ^mcm?^ 

laciunL Nonafleqni auteiii, Jloe eft; fî^quis non 
fdatvhocnonredlefaciat. Indodî:usautemqiixcfl:> 
quomodo fortunate aâequi poffit ? Si quid enim e- 
ţiam alTequatiîrV nonmeinorabEem fane iiicceiTum 
liabcbît ; Qui enim non recfle quicTIacit ^.npn fortu- 
nate ai|equipot^rit> cum reliqua^ qu^^quiimeft 
facere, non iaciat. . - "^ 

VArius eft Forcmise fîgnificatus apud Hippocra:temt%m^ 
ficat ctenim quandoque , vt didum eâ , concingen- ^ţ^S^^J 
tem caufam , qu^^fieâum producit, cum quoimllamex fe S^i^^^rasâ.- 
habet coimcxioncm y neque ad illum dîreâa eft ;vnde teme* ^^*^^^^^- 
re & pr^ter râionem agens ^ rarâ euadcm attingic ; Hinc 

-. - Forttmaregzt, Jpargztquefmnu - ^ • Kippoiyu 

Pbiîofophus 2,pbykt.5 5> y Fortuna mtem e^de^s^^i^rarct. Eâ 
Hiîiîper iliiiuris i nuî!iiqu€;park kgibiis, aeq%îe in vHius aarbi^ 
trio eft eam qiîandoainquc acquirercsvtque dicefear Plato m 
Menoue»Ileg<f ducunt Mm h£cfoia r'vera Opinio jOîspic Sdentia ; 
^uihus hmoprxMtîiSidux ejfeal^s ^erepte^ : iiu^e emmfortîtna * 
antingunt^imfmcfhomitds ne^ua^iiamfunty^<^^ 
ădreBumiHxefijdHo J^c^Jma^Opmâ^at^^^ 
• accepit ctiamArafe*teks2>ph^ 

nam eife ^aufam fecundam acciden^in ijs , quse &cundum 

fikciioacmfcunţob aîiquem^^ 

Digitized by 


ţur :: Atque itaracc<pxa Fortuna ^ coi«x^ ad^ câ^imik^î?- 
tis prud^ntW , vţ fe fe ino kem «xctodaht ^ vt patet tx eoiem 
' Vbîmespiu* Anftotelecap^pJi*2^mag.mori^ 

ma»Ă: c coQ uâm recb raiio ord!inate, femperqoc eo^m ni<Klo agii;; non 
*** îta ^îîina :: Quap^opcer îieqiiaguam hac iadigee Mediem 

^ . adbefîs^en4um;;,:yi:attperd&<âamdi^fiî&k^ 

ta faasle^es agat a#koc,vt bene agat ; €x vfu mme^ <ifef<3^ 
teft adfdidtcragendum ^ & cum ^ena:&ciîiqu5iimş confe- 
^rmna ^a cutîoneictenimpluracircapl>icCÎumaccidcre queum 
p^etMe- tn«dicama3ti<>.peratiQnenifelicitetit^ autirrkâmfaciant, vt 

}ucufcat^do<aikHg^p*1ib.t^4cmoft> ^111.^5, 

VhiXa^.ii^'le^^mârimh^et^ frecai ^n* 

Significat 2vHippocrati Fortuna r^âamaâionem, qu^eprăL- 
tenfiicn affequitur .fiaems quo pââo>cum Fdicîtate ^uodam-» 
.. înodocoîrfandimr, quaîSoBaefta(âio>^^ 

^icms% 4;,^g,Xa]ifi^nfficatuaccepjtHippog:ateslib.4eirt^în^ ^*^" 

mancifiL Atqu€itaaccg)ifrepE5elenactiarp textu x:cv£cmkim 
Toîtana ab eft^4um^o$improbat., cfuiibrtuaam a Medicina j aut aîia 
cfdudcBda, ^quauis arte , pemtus excluaunti quemaamooum mpnori 
fcnfu accepta vid^tur maiori ex parte exciideâ^da : iiam quî 
&iimt quidi?eduiîi> quidiie Bialum iîţ marte; is&k6€m^& 
s>^agere, ^confe^pa^pcerfort^ 

bem agenspierumque^finem aflfcqljtot^ac proiiideioicmia- 
îe agit^ işii vcî^ mi^^it:, iuo^tpluriammibikatur iîne^ 
pramdeque infortunao^ agejis eft,. Ca^emtm texaisiatis per 
^ '. ie clarusexiftit j ad reliqua iccirco properandum* . 

l.VI> MprbiMuliebres/yien'ommumTO 

c^mafiint. bos^exhibenî, fîueafceniderînt^îîtiedefceîîde^ 
ytcri:4iăor- Et'Cum qiiidem yteii afcidum fuum ^lon deniitten- 


Digitized by 


tes> &:|>udeiidi emm^ntia^ nou coKtfegente^ trant 
moţi foeriîît fbrâs , kuiffimiis motbmcâ; cum tc- 
ro in anteriorenr partem promoti ftierint , 5c 
ofculum in pudendi eminentîas , ac labra îmmi- 
ferint; prîmuni quidemiplo contaclu dolorem ¥- 
teriîspercj^ir, acexHbet : demde'obturatns> &. 
vdutopcxculo contc<îîus, ex eo> quod pudendi 
eminentiis încumbit, fiuxus non contingir> qni nîcn- ^^^ ^?* 
iium nomine venit, mc vero iluxuscongregatus, ^^â*»»** 
titmorem, ac dolorem exîxibet: &fîqiudem înfrâ 
defcendens , & aiierfiis in inguen fe immilerît , do- 
lorem exhibebît; Si vero furfîim afcendens , aiier- 
fns, & obturatus fucrit; etiamficpropter rarita- 
tem, ac coar.dationem dolorem- exiubet. Cttm vero 
propter hoc a^grotarit , Coxendicum-> ac Capitis 
dolorem facit. Vbi vero Vteri inipîeti intiîmîTerint» 
niliil fiuit^ & pleni £xmt tcnm antenj plenî fk(f!îfrie- : 
rinţ> Coxendîcefqiie contingnnt dolores exhlbehg 
&în Coxendices>&in Inguen, & velutpiise in ven- vteromBi- 
tre dilcurruntv & Caput dolore ăffligtint, modo al- lâ^ 
tera ipfius parte ; modo totum , prout conţinut ipfî 

^7 Ix abfolunjm Medidna? comp^ditim dici podîet liber 
V bicnifî'aUqua in eode muli<bribiai.euam mQrbis^habef.^ 
renţurj cum hi non mimmamTfcerai^eticaEtpartemfîbiab- 
fumant, Muliercs itaque cum prsetereos, quos eumbaminit 
bîi$comtnunesbabentmorbos, aBjsnonpandspccuHaritar 
obnoxi^ Hm ob Vcerum , quem pectifiariter ip& poffidcnt ; 
him eft > quod illum motborum oipniăxâiifâm afferac Hip» 
poaateştimorbomm iddelicttmiilibrium; nifîdi^reircli- ^^^T^ 
mm caecerorum ctiam camatţx dici poiie, qnanda nuîmin ^nuDom-- 
morbigenuscft, cuiVter^s oVcafîoncmprsebfârenonvaîcaţ £^ *^^*^ 
^m mu ^uiufque fon^ cxacmcnat paa.bas quibufquc 

Digitized by 


. 4^ jSlPFQCRjil'IS: UB.Ilh DE mCilUMOM. 

iUnp?rdn|>pteft»^;qtîafcunq;în confen& trahcre aptiK; efîi ■ 

xumCerebfopei'l|>iixam, CordiperatţermSyH^atif crTC^; 

nas , proximis circurafîtis parcibus per %amenta & villos a<t« • 

.f. rie£lamr: vndeDeniocritus Hb.deiiat. huBioJP^^m^^inquit*,. 

Ditimm ^^ puerm^'^^'^^f^ > vehemmsmdum^ tnjimtamm^mmmrumm 

^^^^J^ MâUerc cmifaefl: Et Ar^taeiis liS*2,diut* paC t^.t.^MuMeri^ 

jtnitonem^ mdmMff^yOceruum can^U. Inter veiicam î^<3um<j; 
^ ^ iateflinam in Hyfog^tomcQnâmx^ proxima offibus^pro- 

Vttu&MS' proprijs quatuor îigamcî^tis c^firmaais;4spfici^ui<icm pro- 
pe fundam ab oiTe^roiufpenfiisdl; duplici o^buspubis 
periaguina iuxtâfualatera aîligatur, qusetamen îigameHta 
ita laîta apparent j vt in ampla coxehdicum câpacît%cc tmăth- , 
ptici mom quâque yer^us conîmode vagaripoiîîiiint defa<5to ' 

quibus Ma- funthasc Kgmienta, aut quod â gmndioris fetus pandere - 
ii^ d£^ eton^^fir^ aut in ipfom^t parm vim aîiquam paflk ; vt iam ^ 
«Kx^ praetercamnaturaîemadmotioşieshas, Sc^ixori^^ 

fitionem, quam aonnulte habemMuliere5> vtdociut^H^ 
lijb>. I 'de morb. rmiJ.; nimirum pb vreri pacuirae^m > qui ma- j^^^ 
ins procul dubio relinquit circa fe ipatîum> iii quo dimouerî 
' poffîc ; uamiion adeo âproximispartibus coariâatiir ; &t>b 
loD^orcm parirer cerck^m^ ex quahabec Ytcnis, vt ia partes 
^aslibctfecilius diâorqueriqueat;Quam Vieri paruitateprf* 
ternaturalitcr etiâ interdum accidere docuit Hip. i . de niorb« 
mul, his vcrbis . Sijuffocaticder^mU acceffmt ^fit auteminim^ m;.î$, 
fmhU y qu^ cum Viris mn 4:;9euntî ^ fmionlus ma^ ^cm 

tunCyvUmdienvafa^mactiatafii^ lahynmnts ' 

r^ccatiul£â(^ev^mcmuerttmtuTymtqm y 

acţromdemagis hihncij efl enm iţfis kcusjpatiajus vtcmuertm^ ■ ". 
twr 9'otţcfthvmtrevacmmfimte^ Hîtc H%p. Omnis autena 
nrofcX occafiovrerosprQpelkrcpot^^iîquklxnalihabeaiîCfBam 
ficiicprppd &âfrigore|>edkin & iumbommi S:âfaIcâtioeev eei^rore, 
lignommieâiDae & ciirfa4ui acdmem &p^ocliuem locu^ 
&abalijsmultispropelhîntui^ex m 


Digitized by 



fcribit Arecaeiiş 3* Acu t.c, 1 1 . inquicns.In medp lUhuş Midu- ^^^ .^^^ 
rum Vuluaţoţfa efl y wuliSrâ vifius , animdis firme n^uram ^ * 

gMin^î^ad]Mpmora } regîom^eHoris cartilaginefnjiihu ;m la-- 
tera qm^ue^m dextram videlket , 42^ l^euampartmi , mitad I^- 
mr, diaue întepina tmuetm'p ^ ad inferiora nrauraprocUmi>r efl, 
vtquepaucis abjoluam^ ţemtus err abunda efl, ^ iucundis odorihus 
ăele^aturj adippf^uefirecipit; contra fied} olentîbus conîfifla- 
tur ? ^ ai ipfls hngîusp proripit ^acţrorjus eflin honnm 'vulua 
4B,m 4ixiffe Jjocvrfms ammalisferminaîuram adepîum ^ # ^J^ 
inlooTtmeţmi^ 00 aşfiimă 

quamccnfuifle vere SdxcalirerYtenimeffe animal per fe <ii& 
ftiniŞtamâMulierc, inquaeft; fcd tales habere modoncs 
peritide ac fi animal effet-: Quo pa(9:o înceDigendus cdam efl 
I^ato; xxxvt GaLiS. de Ioc af£cap.5. iniiiria inliirgatin iîlurn, ^ 
Tcîut quid ridiciîla proculerit , cum i& ipft Hî>. de 
ficîoqaamr. VSems cum ,qualitat^n femitiiş affeSiat y ţoîus oi-- 
mamfifi Dffert > ^que accurrit ad cunnum i flioque colb ac gula 
xat etiam Ariftoc lib^j. de cap, 2, , inquiens ^ Multis 
atiam deflderio coitm , (quox>eliuueniUs ^tatisrattone , vel ^uia 
hn^tempcrealflînuerint^ îmmtur,) defcendtmt^ten^meflr20 
foaier în menjecitantur^y dome concipianty quofaâo afimdwîţ 
^fliofltn conflituuntur . Quod fi, dumfemen appetit, tpois 
ad cuauum & offcrt^^ atqae accurxxti cur dani nimimTa exfîc^ 
catus eft , âdeo abfurdum eiit ,ad Hq>ar:> leu, versusHepac 
deferri>fontem tamgraalîumoris, & ad I)iâ|^xagma> vc pti- 
iitt,i5, xvkm omnium docuit magfius Hippoc, lib. i , de morb. njuL?,^. 
Sialî^uid Vte i aflendere ^oideatur > idjere^pium efl ^ inquic — 
Gdi^ynequefiifficitadhocvtic^t^ madvmtrk quambciuA 

CMhm quidem ajcendi§e oflendM^ tantumahefl > vthmc p^^' tiiiÂ'^^^. 
teremdo , adS^timPrm^er^pmn^epp^ ^^^fmwmirum jtiactuiw 

£ec . 3iga- ' 

Digitized by 



mt mtcxdum Mâcm ligaminibus indiffolucis , ad mediâs^ 
viquecoxas prp]abkur? Inftatadhuc Galcnus iaquiens. îd 
autemp quoi dicunt^ exjtccaîos vtercs humms dejiderio ad'oU 
feera. ajcmdere , nemini non ahfurdum videri potefi';Jimim inu-^ 
tilem aliquando Vterus reqnirctt huniorem^ -veficam^ atqne crajji 
inteflini partem infenorem tctam fiU ţroximam habet;fi vero 
non fimplkiter humorem.fed Jmpdnmmhufnorem defrderat, ad 
Jyepar ţotius-^^ ^mtPÂfeptumtranfuerfnm yipfMmmm 
haty^c. Veriim VtemsâniEHiaeuaeuatioiie, Vela kbore,. ine- 
diaquc nimiirm exficcatns, rtlzh aîiqao imtams his^morum > 
vaporumue praua qualkate, qa^ zkm'mt^ vel a retencis 
menftruis ekuantur , pras moleftia fucccnsefâs> aEas ad aJiaiii 
partem deferrur , ha- vt ad VefiGam e tiam> & ad lumbos , vbi 
Hb. I. ă^ magna adeft vena ^ interdum contrertatur,» vc ibidem docet hij-it- 
moib. mul. Hippocraîesr i js verbis . QumdGppero, vM Mulier ^afa emcuâ- 
ta habnenty& infipr lahorarity Vtericomîerft , adVeftc^ fio-' 
machum dlahmtwr , ^ 'orifm plUcidimnindîmint , almd autem 
nihil malihahet , ^ curata ^ cito fayiefdh &quandoq; eîiamfţon- 
th . Quihufdătn -uero ex Iahre mt in^dia adlumhos.auîadcQms 
allapjip dolorej exhihent\ ¥cxmlius igitar hac in re audiendus 
Feraeîi-opi ^^- '^^*^* depatt. morb.& fimp Aom. cap. i^. y dum ita Io* 
nio ce vcexi ^^^^"^ * ^^^^i motus atîthorîtate nmnumqmm putaui vtenm 
tambus* nihil y autperexîgmm h fim JedeMmoueri : At cegrotarum^mme^ 
rtm modo querimoma y m 

deprehendi, infiar gîoUcuiuflaminvenîriculwn effmi,eumâ74e 
grameropprimere: Hlnc ^ f^emanudeprej^s efUm^^ 
tn propnam fidem propulfiis : mque id^JaneaHenummaais vi^ 
irtmfra. Qi^hisitaquehSm^ laxioresj^^^ 
quet: irniaturmtemauird pr^ternaînram; q^^^ 
mt; aut externa, dufque^aduerpmQleflîa . Tum qnipp} kceŞ^ 
7tm, &quafifiiccmsm$,de preprio loco decedit, alias inaliamp^ 


,.. . îmulus. 

Digitized by 


trkulus^^an etiamţlane, naturalis,jtnearhiîrî(hjm îujjunojh'â 
fnoueturfCum rd aliena iniuria, lacejptns, rmpio impetu hmc vo^^ 
mitiQmrepeîlit ; autfame^xinanms^ mundo cilo,^mJtgepms , vtenis a 
ucurrit. Afcmjuautemnmyqu^prănguîatujymptoma^ afceadâttâ- 

. fâdJumtaxaţ ţr^emitwr^uUârqmdam pr^cordijorumÂolore,Jpi* SuSîa>ail 
ranâidifficuki^mt animi deftBimeyatfme^^^otu^^ ^^^ .^f^^ 

conjogiat0shah(:^yâ infej^tur. ^Ămpt^S* 

yerumV.t€riisprî^er.natiiraIem hune 0io turn appeq^^ ta^/ 

etiâ habere â morbifica folumodd caufa prouemetes,&endu ^ 
eft , vtiium dus ligamcnta auuiimio fupemeniejatehumoi 
re repleta^ am nimis eKficcâtâ-,furfuin> aiic in ktcra conucl» 
luntur 3 aut nimio laxaca mado^ , eiongaacur ixa^vtd^oxmm 
vcemm pcolabi fînant ^ vî: explkauk GaL loo cit. 6. de loc*;^ 
alFec. > vbi â morbifka hac tantammcdo cauia omses vreri 
extorlîones prouexiire affirmauit -, Cuaiq^ membriim^hoc 
morborum pmne genus pad naţum iît , & vt pars c& iîmiîa- 
ris> & vcinftrumentaîisj concipiendo nonfoiiixn > pariendo- 
que dicâta , fed vniuerlb ctiam muliebri corpori expurga»- Vttd^BB. 
do , quod ob cralîm , quam obdnuk> calidainatqae humi- 
dam,, compluribus affidixe fcatet JiumîdîtatiBus ( compJuriu 
enim Ţenarum^^rtenarumqiie pardceps efl VtemS;, per xjuas 
meftru^ deferuntur euacuariones,quibus lumijs prodemid- 
bus , morbiiîimt exaph* 57.fec. $*; ^nonprodeundbus, 
ab Vtero mod>i condngunt ) perpaucoscamen hîcatdngii; 
Hippocrates , vc qui ad oftendendum podus vt nam ex hac 
cdam parte peculiarcs excitcntur morbi , ( quod ad Com^ 
pendij radonem fads eraţ^ quâm vtde doc ^argumente ex 
profeflbagcret, quod^culentilîîm^ feck inijsyquiextanc, 
librisjfcxui hiiic dicads>hanc materiam modo aifiimic^ ^quarc 
& nos ad cextum broiiter explicandum propercmus . 

-.r , . r iBorboruvideli* 

V terus moxborum omninm caută . ^^^ muHebrium 

per fe, cseteroru vero per accldes, caufa exiftit Vcerus > quace- 
Gus omnibus morbificam materiam fiibminiftrare aptus eft t 
Quocunque autem modo â naturali fitu dimotusfueric;& ad 
quatncumqî.âllabaturpartenv morbos paric, doloremmor: 

Eec z leflo 

Digitized by 


lefta cotttaSa excitando^ aut pardum* quas premit^ 
tioBes impcdkndo * 

Et cum quidem Vterî ofculum 

^ I>umjii<kfccndkVcenis,vtkii^riusipfiu$o$ 
tentes > cec. ^^^^0^^^! mane^ > neq. ip&m; inuertâtur ad 
pudcîidum'pememens, kuiflîmustuncmorlmseft .^^^ 
qai^ fondus^ tantupimoda ia hoc cafîi iaucrckur ^ quod 
cdaoi aatui^it^r in femims recepiione ficrî feicE^^ neq. maio- 
raiinde euemiint fymptomata» Prolabitur aiitem ijs pra^ci- 
ilpIk^Pult pue Mutcribus^ quas erpartuprogr€ifse,atq. in ipfomeEad- 
pc3:sac Lo- hiic puerpcrio cum viris condormterint, vti patet lib. de nat. ^«ni- 4- 
^fuboliu muIo&^*demorb.muLietfiîotriccs,&amaesjqua^pe- 
des iorfrigence-aq^a fepe immerfos hâbeat > morbo huic 
prscipuc obaoxi^ Cim : refrigeratis etenim inferioribus par- 
tibus, nutriciolxditur, mulc^q; aggregancur iiumidicatcs . 
Cum ¥erd in anteriorem partempromotîfuerint, 

& olculumin pude&4i e^^^^î^^ 

rint; &C* mnjîrum , cum itâ deupluitur Vterus ,proprijs 
îigamentis â nimio madore lax^tcis violatifque > vt non modo 
eius cmiitas > vt iam expîicatum eft> fed ceruix etiam inuerta- 
tur & defceridat^ ita vt incerius vtcri os intra pudendi labra 
fc feconlpicuum cfferat & întrtid^;tunc non modo dolorem 
ibi parit, fed pudendi os> atq. meamnx obftruens>menftruas 
impedit purgationes:vnde coaceruatus fâttguis partcs diftcn-^ 
dcns^doloris caufa exiftit & tumoris • 

it iiquidem jn&â defcendens > & mcxfus\ &cc. 

Si VterusT defcendens > non re^tâ feratur ad pudendum , fed 
declinct ,fle6taturq;ad ingucn akerutrum, stitcoxam; ibi 
premendbdoîorenî procreat • 

^i veroiurşum, ^ccndzt aucrfus^&c. ^^^ ^.^^ 

îiatur Ytenis>tîon rc<ăus quidem> fed obliquus in partem aii- 
quam; proindeque obftru^us Ut : ( nam quoties fundus e 
direiSQnoncoîirelpondeciawioriorificio» tune ofculum 

Digitized by 


au. 7» 


inuddenecefsitatc ohâmitur^nequeampîms menftxua cx-; 
pedite proccdunt> ) tune itâq; &proprer rarkatem >&pro» 
pter c6ar<ăatiorîenî, dolorem parit . Propter coarâatxonem Afcendens 
quidem, quiacoUeaus, & coaraatus ianguis, qui extrapro- ^^^ ţ^ 
cedere nequit, tumorem excitat jincandefcitque ; propter coftrftatio- 
raritatcmyero,quia rarefaâbobnimium languinem vtero, ^^^^aioă 
â quo diffeiîditur^pîurimi, prauîqtie eleuanturYapcreş^q^ patkt. 
fiipemas impetuntpamş , acq^fedunt : ex qiio fit ^ vt quiKu- 
iuimodivterorum aiicniucumpudendîobftruâm^^ labo- 
rant > coxeadicum, capitifque doloribus texentur: Coxcndi- 
ees namq; â coardati ianguinis tumcre > caîoreq; premun- 
tur>& incalefcunt s Capîtis aucem membranse â vaporibus di- 
ftenduntur . Quinimmo muko prauiora inde prcueniunt ac- 
cidcntia, prout deterior ianguinis conditio taerit> â quo va- 
pores eîcuantur ; aut nobiîior eft pars, qu^ coafficitur, vt do- 
cet Galcn. 5. de Ioc . aiF. .cap. 5. , apparctque manifeftius ia 
hyâericisafiectiombus • . 

. ^ Vterîvbî 
Ybi vero vteri împleti intumuerint ^ occ; cqpiofum 

adeo fanguinem exceperint, vt intumefcant ; Se zn&is pro- 

indeinlacitudinem venis, extenfifqae , earum ofcula angu- 

itiora reddantur vleu ipfametfanguinismultitudoobftruat; 

cunc nihil profecîo ex ipfis effiuere poteft 3 fed in dies a nouo 

fan^uinc magis teplentur; replcd vejo , quafcunq; attingerint 

partes ^ fiue coxendices hse fint , fîue ingaina , moîefto dolo* 

rcm contacîu ijs inducunt , ac velut pilx , muko infarâi faa* 

guinecum hnc^invarijs partibusabdominis, quafi ober-^ 

rantcs pcrcipiuntur , dura hac iflâc proprio pondere decidiit ,. 

Qmndo conturhatusy ifjecretusfanguisyinqiiit nat.puer. > 

foras nonp-Qceăityfeâ inVîercs * Vteri autem nmfnauârmt: fum 

Cane â finguine diutius immorante 'Vîeri catefcmîes yTeUquo cor^ 

ţoricalor£m trayJmitî'Hnt ;qiiăndQ^ue ^tiăm fingtdmm invmas 

corforis diflrihuunt ^ vt ^ ven^ repkt^ dokant? ^ tumores Iop^os 

ţroducunt • Quando^uc eîutm fericuhim.^fl ne clmtaicatio 4X hac 

inâticatur* Sed caput etiam Vteri hi doloreinfcllânt i nam , 

vtdiâ:umeft, infardusianguis partes extendendorarcfacit^ 

vaporibusque > quos incalidelcens €jnktjit,adtum furlum 


Digitized by 


parat . Dokt âiitem caput , aut toţum ^ aut altera t^ptummo- 
pa^aî?^- da parte, prout Vceri vâfa aut omnia rcpkta fucrint, aut 
10 k(ia£U£. aliqua tantiim â lateribus/. inferiores eţervim partes ka fupc- 

rioribus refpondent > y t reclitudiae feruata^dexterae^dextris ,; 

finiftrse fiiiiftris compatianţur^, _ 

L VIL |j2^e ^îtaque fie •curanda fimt ♦ Siquîdem dcfcen- 
Defccndetis derit-folum, &iiUni poffi , vter^qtiocunqii^Iibet 
v^xi cma. ex sfrauqolentinm genere aiit Cedro /aut AUiî intri- 
to, MyttotaGr^iecisappellato, aut aliquo alio ex 
meaţa in., grauiter , & male olentium numcro ^ eoque iumaim 
fiinonrdht f^itp > 6c fomenta ne adiiibeto , neque cibo , neque 
tc^f diur^ potavrinam cienţeiioctemporevtitpr, neque ca- 
i^^/^^«" Hda lauato , 

(Ropofîto Vteri defcenfu, afcenfuque » adcurationem 

îam acGeditaquam perpaucis ăbfoIuic;eo quod de horum 

moîÎK>rum differentijs, caufisjatq^curatione in muîiebribus li- 

bris abfoludffime egerir^ex quifcus repeteiKium eft quicquîd 

Wc dceric-. In defcenfio^e igitur prşcipua inteatio eft Vterii 

forfum ad natur^em fîtum reducere ; mm ligamenta > quîe a 

mmiolaxata funtmadore, priori eiicrafice refticuere; quod 

A^quepra^ftatgraue fed^queolencibusinfrâappofitis, qua* 

vterumiurfum fugaifenatafunt.; istcrdicit 7erd quas laxant, 

Yt funt humidi foms ^ caîid^ejquelotÎGiies, & quae dec^rfum 

dunt ^ vt diuretica * Verum ciim pofficMatrix modo defcen- 

derc laaitumv Inqyuei^ras deuolui partes , ahique eo p quod 

extrâappareat, quod vteri defcenfusiîmpliciter appellatur; 

Hquilpro modo ^lerfa foras procidcre,grauiori profeâo cafu, qui pro* 

îapfusfîu lapfusdkimrr kihcK:vtiquefruflrâgrauolentimmfufîîcibus, 

iîlitionibulq; Vcerum ad fuam fedcm propeMere ftuderemus , 

Be.ţaorb, ni manibus priuS;, alijfquc machinamentis intra coxendicum 

J^5 s^,^**' i^uitatem repofieus fucrit : Vnde Hipp. lib. de nan. mul. , & ^^-^^ 

De: ăeril. alibi >Vteros , quiek pudendis penitiis exciderint, ita vt ve- 
^^Ptokpfas lut fcrotum dependeant ; vbi prius âi> omni forde expurgaiiit^; 
vccrusnni vcl fi ab cxtcrno acte nimis obrigueriiit j tepentibus , emol- 



Digitized by 



Kentibufquc emolliuit ; moxadftringentibusaMutionîbosex 
nigro'aufteroquevino1:umma!ispui5ids, nimium vtcrima^ 
dorem , laxicaremque earrexk , iubeţ maiicrem fupinam, j(|>- 
dibus furfum extentis decumbere : fiqueid nonfacisfit > vt 
vteriingrediantur ; tune pedibus ad fcaîatn alligads , ita.vt ca* 
put deorfum pendeat , fcalam iuxtâ caputpulfari iubeCymanî- 
huixpcytcmtnmtruâi^qucy peraCto, foedis demum fuffitibus 
agit . Hinc pătct cur Hippocrates in pra?ien ti textu dixerit . Si 
dejiendent filtim ^ itâ vt illini ţoffit , "utere gravieolentihis . . 
Si yidelicet vtcms deorfum deuolucus tâBtammodd fit , nec 
forâs excideris , itâ vt alijs îaftrumentis non indigeat ad hoc^ 
vt intiis reponatur , fed ftatim iilini , fuffirique pcffir, eo quod 
foii fuffitus fatis fn turi fin t vt in fuam fedem afcendant 5 tune 
â graue olentibus fnfrâ appofitis exordiendy m ; â qmbus Vte- 
rus aborrens > au&gienfque, retroccdit* Inter grauekntiâ pri- cedrunu 
mo enumerat Cedru 111 5 Afiaîkam arborem , erli Creiicam ^<i&. 
probauerit Hippoc. îib. de nat. mvtL Huius ănx iuat fpe- 
cies ^ ahera frutîcofa lunipero adnniîlis ; cuius iimilimdine 
baccas eciâm patit rotundas baccarum Myrihi magnitudine; 
Akera arbor magna dkin Syria>in monte Ly bano potiiîîininn 
luxuriaris : Ex hac picem colligitur, quae Cedria nuncupatur , 
grauisvnque odoris , caliditace ficeicareque quartum attin- 
gens gradum,Fit & oleum â Cedriafe^aracum dum eoqmmri, 
yelîeribus fupra eius alitum expanfisî quiPifîelcon dicitur, ^.^^^^ 
ideft 5 Picis oîeum. Cupreffi modo nutes producit h^c arbor, cuid iit gc- 
quas Cecrides appellant / femen intr^ fe habentes . Horam ^^^* 
omnium vires & vium profequitur Di^fcorides> Gaîenus , & Ciofcjib. 1. 
Pîinius> pîurimihnque vfurpata reperiuntur Hippocrati pro q^'^^ j 
vterinis affediibus ; nam & Cedri ramenta,: & Baccasy'& Ce* mcikc, & 
driam, & Cedri oleum , f^epe, &diueriimodeadfiibuit,qua£^ m^^^H^^ 
tamen hac tempeitate exoleuave . iBter graueolentia pariter «ap* 3. 
adnumcrat Myttotum , quod Galen. in Exegefî 3 firotianus iib^^cap.5 
îtidem > alijque incerpretantur intritum ex allio : cenfendum ^^i^*^^^^ 
kaqueeft vulgare qiK)ddaHi compofitum fuiiTe*ex aîlio,reb4i£ ^^* 
que alijs ingraţi o<k>ris > vcquexoHigitur ex Anani] verficuUs 
^ud Athenseum iib. 7. Deipno&ph. > . * 

• * • v# . • t-^f <)îWî?î^?^/^ia^fî^|'J|^W ^^ -^^^ - ; ' 

Digitized by LjOOQ Ic 

^oZ mFFGCKAns Lis. îiL m mc. in hom. 

... Myttotos conmd^ ^* .*.•-•.•.. -^ r '• ' -i." 

Vhi inferius alij cdam citanmr ^x hxrhmxm im^wmm, 

^Jlk mim exipj^szmustadte&affatim 
- "xl^innumy^ MyttoUnîoUs £cs 

.Alliguriens ^<^ ...,. ' ^ > / - 

Ediiîiii aut condimenti^^nuâelţ, vtibi notat Scholiafies, 
int rkum efTc condimen turn ^ Ailio , Porrp ^ Aceţo f<:afeo > 
Aiîiu quo- GsepaiSc Ouo aifcrens . AUium ¥crd , npa^qdo qupdgraue 
S vmf p^rî oleat , proficuum effe poteft in vteri defcenfu 5 ycrum edani 
^?^^' quod ficîculencuai fit, cx 2. de di^c. , & lib. acut. , fi yidciicct ^;[; h- 
humorem inueneric catTum , inque flatuîencum fpintum ver- 
ti paratum : nam alias calidum cil , & difcuffiuum>flaîibufqu€ 
Vcemm expiere , & fursum propcîîere valet : vjadc Hipp* 2, 
de morb. Mul. , de vteri yeufipne verbafaciens ^ .h^c habet, nu, 24- 
^fommîQ veroftcQnfidsrarehoc poteft > i^fculum comngereiuheto ^ 
^jâtttoâ^ numfomentum iţftmvterosfldtu implet :J1 enimflatu implentur , 
Vtefmnfur- ofculum âx vaitda auerjione ^ ^ ad ccxa^m allapfn tnagis dirigtmf » 
lant^rţio^ acaperitîntur .Tdvmquamigiturtalejîifomentiim ^ ^h^c facere 
iapicrit » poftit yjicfousr^ oporîet . Own auîemfopient^nn adhihehis'y allium 
imÂ&re Qporteţ ^ % ?hoCi;€ adipem fuperfnndere \ at^m hocfacien* 
iumeflyimcc vim vUeimţuriuflati^ if^fculumfortiterfu-rfim 
0^1, vbi y teri âd tnedium lumborum proceileri^^^ fiftuîa ^"'^4* 

^d veiîcam aUigaca illos fufîîat, & fomemum adhibec ^ Atqui , 

m Mm^ odores.fiquid3emyt&> îîon nifi^pîft^ percipi ppiîlint; 

^, ; : I ^ţ^<^teaUâ$|«^batumiilit. Nequeveerps verum^ftanimalâ 
t : : \ taSlietedUlm^May itâ vtien^ odpcatus ei ţribuidebeat;, 
Sifaef^^usAcip^meniîsinlilxi.adGîauc3pam^ i^7,huii4s* 
m affcreas rationem^aiTeritCerebmm graueoleuti 

G^cium fpkkuîjx y ac^a: continuam m hm mpkftia j^^u^ 
edampsuticid^cpr^iahij atquehay^^ 
veluri exprimere > prop^Dereque ac deqrfiiîii ^mxmn^m^ 
Hor. Eugen . îrkcm . Addunt a^j^^fiimîde^lpMw.? :^^i Oîulâ ixm prp fprlţj 

lib. I2>epi0:. - - - " £qu\ 

Digitized by 


^i* 23. 

forîj muneribus deftinatî , a foeridis obtefos, reţfthi adfuum 
priucipium fiihul cum vitalibus Ipirkibus & ^nguinc, <Ju«b 
res violente fit quodamimpetu. HmcVtcro obuiam&cli. 
vimhabetxt ipfuîn propeiîeadi ad inferas partes • Verumhi 
probabilia vdque loquu ntur ; difEcultatcm attamen omnino 
non toUuat : Matrix namquenon modo âfuperîoribusad 
inferiora exairrit , graueolentibMS nari admotis > fed etiaoî ab 
inferioribusad fuperiora, fi infirâeâdcm apponantur ; quem- 
admodum contraria efficiunc odorata : Quinimnio Hipp. 
m. 27* Iib,deRac/muU,fiinlumbis>autinIaterismoUitudiscfuerîac 
vteriy & tranfinoucrevelis , iubeţ Sulphur & Bitumca îeri, 
Mcllequc coSo affufo , craiTam glandem iieri , indiquc ifl fc- 
dcm , vt percepto fcetido odore in pofticis partibtis > vbi tune 
Vteri hasrent, ad anteriora confeftim conuertantur : velut fi 
in pu۔pera ad coxam incumbuerint > vt codcm libro legitur , 
ad fanam coxam oleum iEgyptium album > aut Baccarina vn* 
guentum apponere fuadct, vt abodoratis ijs alliciantur vteri * 
& â morbofo fîtu difcedant ; ita vt cenum fit Matriccm non 
modo narium d&ciu , fed etiam per fe ad bene okmia mo» 
ueri , aufugere vero ab ijs ^ qux foeteat : vnde fibijiircţico ia 
paroxifmojdum Vterus ad fopeiiora conuo&s a Ventrk^^ 
atque Diapbragtna premit, tetrofque cmioiens vapores > pra- 
ua parit fymptomata j fi fetida , jquse tune aaribus admoucd 
confueuere > Ventriculi> aut Cordis regioni admouer^ntur* 
prodeflentvtiquc, nullatcnus aflFeâo odoratu ; nMiVterws 
ca perfenfîens ,illica difccderet > licet naribus appiicita ma^ 
exciteat , animalibusfpiritibus vnâ cum Cerebro initatis* 
Verum quo euidcntior efi effeSlus iftc^ eoîmiolutior apparct 
ratio , Nihilominus , doacc meliora adferantur ^ dicendma 
cenfemus > quqd quemadmodum Ventricutis ad congruuni 
fibique cognatum cibum cxcipi^ndum > coquciKiiţmque â 
natuca inftitutus-> abfque co> quod ^nă^i praediîus fit, â^ars^ 
aut fummc acida, vd aufteta aueiiatur> rc%itquc ab ijs; 
dulcia vero , vt naturse noftne iamiiiaria,> alendcH^e aptiora > ' 
ampleâitur, moueturquc ad ea cxcipienda; ita pariter & Vtc- 
rus, odoratu quidem nequaquam prarditus , â natura adfe- 
mcn excipiendum excitandumque lormâCus,cum illud corpus 

Fff ^ fit 

Digitized by 


4î<^ «irPOCRMIS UB. ni. DE mc. W HQM. 

Sambtici j ynccfliquod omma,quxcu&queh^ 

coâă oimirum , tenuibuiqaereferâa parcibus , vt fibi &mi« 

liariâ profequitur & ampteatuj; talia vcrofiifitfiKttieokn* 

tia omnia, que , vt docetThcophralkis lib. i. de o4or^ « 

coâ:a funt > fubtilia , minime terrcaa ; pr^femm cum in 

halim ficus fit omnis odor; m^eolemia vcrd contrariaţi 

vcque docuic Arift. problem» 4rfe<S. to. , -M^ odmscanja^ 

oiBzAunh- erudita^ qwed^m e(i • Odorataimtur>»oavtodorata fu ne, ied 

quatcnus îtimofa corpora , oprtme elaborata, ad mftar fcmi- 

nis cxiftunt , qu^rit > & ampleditur Vterus , refugiţq; con- 

traria, Ita & Corad vicales gignendos ipiritus fabrefadîum , 

tenuîorcm ianguinem y aeremiţ elaboratum ampleâitur , 

c^t îctudz foetidumyerdrefu^t>atqiie aiierfatur; itâvtdumtaliseiof- 

aucx atttr . f^^j j^yy ^ yj^ pulfare audeat . Localis tamcn Mc motus pro- 

iecucioms&:fugse,nonaded confpicuus eft inhis partibuş, 

quemadmodum in Vcero, quodar6Hus circumfitis parucLili$ 

obligatajfînt; Quod ftkxk^resl^bercmtahea^^eijideado- 

rcm vdque localcm huncmotum oftenderent; qmnimmQ 

nequc in ipfoniet Vca^taroa £|iidcndâ conlpicitur , niiî vbi 

morbofus quodammodd fit , laxioraque > quâm pro natura 

âia , habeat ligamcnat > eo quodaut in partu vim pafla &^ţ* 

rint; vel â nimio madore^ob vitiatam coftîonem , delatum vc 

co cxcremcntum^, laxata Bnt . Atque hatc de Vreri errjc>ribus 

obiter diâa . Sed ad-cextum iam modo redcumdum,in quo 

confulit Hippocrate^vt didum fuk> graueolencibiîş Vcerum 

Fomcnmm ' ^^^i probil^t nihiîomim^ hmcnUy cum camen Gaîen. 

omnfm"^. <^* epid^ com. 3. tcx, g I. 5r^a/A?, hoc eft ; calidumfomen- 

Hditatcm^ ' ^^ > <Jmnem cxcrirrfecus nos inuadcmem caliditacem figni- 

fîsnificac . ficafeaflferat: farcjadum proinde cft aliam diftinaionem fe- 

cutum hic foifie Hippocratem > ac quem^admodum fufficu 

fumtimexcrematis rebus vi ignis confurgentem pr^ecipuc in- 

al^Sâ^ teîîexic/qtîîinVceri cauitatem periirfimdibuIuaHaliauain- 

dii«at • flrumenta, recipitur, exficc^diq; femper vi pollct; quapro- 

prer in Matricis defcenfu ea ctiam rationc proficuus cft^qudd 

nimium abfii»at niadorcm; itâ profomemo^fvt optimis ra^ 


Digitized by 



-^e al^^4iiU€atmus^IeuamiB:itttm<^^$ : h^iiq^di^Ia- 
^ndi fe^per yipolknt> icrfîinijş â4ârjtogeaua iecoqua^i^"^ 
B^ ©ptijsie macera^ ât^U€ ^coiâia fîat: ^uea? jaam^; p^t^ 
pximiim afccndunt ; adilrin^emiâ vcrĂ > vtpote tcrreftriora^ 
remanent ^ Caucadse itaq; euaporationes, 2u: quicquid îa- 
xandi vim obdneţ.^ vt ex fimplici calente aqua lotionesi vnâc 
i<îc^ lîix. 2» jâe^rm>fb. mill. jânguia omnîa , aut pingu^diocm fe^ 
ftttl^^. * bentia interdmt eadem hac ratioiîc, poftquâm in fixam ie- 
^em Vcerusj:cpclîtuscft : non prohibecia: taa^n louo j qiişi 
cx adftrmgentium de:co<âione cum fpongiis adminiftrs^ur , 
^p^ qualem adhibuitîib. de^iîat. muL , inquicas> cum fie bdhuerit^ 
Myrthi haccas^ fy Loti ramm^a m a^-co^uiîp , ^ a^uamp^ »ft- 
fiemfith âi^;ic]^Qmto &ptdcnda cum eo âecoSio qua jriggidijpm$ 
p&rfunditQy^eade triîafrocâtaph^afţadhihetoJBt morb. 
*^*^^' muL Si vteriextrâ ţrominuennţ, ^ dependent velut fcrotum , 
Myrthiiaccas,ijOtiramenta,-Riihi , ^Okie folia fimd coj}uitt> > 
^cEcea etkm adftringcadi vis extrahimr ^ Ă: aqu| fubftantise 
communiditiîr, qu£B ab a^aH ei^^ 

bet d^mum^iuretica , feu omma yrijpiîw praupcaoqii>^(^ mm^itc^ 
^ibo >fiueiiipQtu fumanmr j tiimquiâ muî^ish^chumi^- f^^^|^; 
tat€sad¥tcripartcsdeducuntvqu^laxitatemaugentj ţum 
^tiam quod plcraq; ex Jiis menfes eriam mouerc coniueuc* 
unt: vjide^um vberiorc Vterum fanguine ^plem;, illum ag- 
grauant ^ coguntque 4eorsiim Iterum delabi , vc doc^mr 
lib. de nat. puer.,^ Aii^uando pkni fcmgtdms ex^enmVtâmjprQ* 
m>7' cidtmt mîadcoxeădices^autlu'ikboSih 

^emiii^imum confulir viâum in hoc ;affed'. lib« de nat. mni^ 
vtinedianimijs abfump£is^.humiditaabus,cuaâ^ cxficccn- 
*"*^ tur,roborcnturque>. 

LVlîi 5iautemfurfumalbenderît,6cnQii.^uerfa fueri^ vtcdiUri^ 
medicamemis fiippofîtitijs b^n^ deiitibus , &quae. afcc^d^i^^ 
£mul calfaciuîit^ vtere , vdu t&îit Myrf lia , aitt vn- ^^ "^r 
guentiim,aut aliud quoddam odoratura i&nulq; ca- 
îcfa<îlarimn . Ethls quidem fubdititiis vteris; Eomcn- 

Fff~ a . mm 

Digitized by 


tuni autcmcjcinfernis e:ş viţio adhibebis, & calida 
aqaa iauabis, & vrinam cieatibus vteris : JEx hoc au- 
tem manifeftum fit auerik fit , nec ne r Si enim fur- 
sumprogrefla,.auerfanonfuerit, fluxus procedit: 
Siveroaueffa fiti*fiuxiîs,menftruaappeMata, noa 
contingit . Hune morbum fomento primim ţali cu- 
me oportet . In vino groifos immittito , ipfumque 
vinum ealfacito , & cucurbitam circkn ofculum 
vafîs , inquocal»fit,additoiioc modo. Cucurbi- 
tam per medium dilTedam euacuato , &fummitate 
ipfius modice refcifla, vdut in vtriculis fieri foîet, 
iianc ipfam vafî , veîut opercuîum circtmdato > quo 
odor per anguftiam means, adVterum p&feratnr . 
Infuper autem & calida aqua fouere , & calefacien- 
tibus medicaraentisfubdititilsvti oportet .Calefâ- 
cientia autem funt ea, quîe ducunt ex fupernis reîa- 
tis ; itemqueh»c. Stercus bubulum ; Fel birbulum ; 
Myrria, AJumen , Galbanum,&fî qaod aMid iiuiuf- 
mpdieft;Plurimi& etiam ipfarumpcrpurgantiain- 
fernc medicamenta aîuKs^ fubducenda eft , &per 
.debilia, qoae vomitum faciunt, ne euacuatio ex fu- 
pereuacuationc fiat. 

QVcmadnrodum vms eflc poffiiat cau& cur Vterus ad 
fiipcriora,yt diaum eft,conaer£atur j iîc profead 
«r- & vari^ ei dcbentur curationcs ; cum vnaquzq; 
caitapeculiarenipirouidentiam requirat . Afceadit'praîtcrea 
fS«^ ytcrusautitâ,v£ nuHam in partcmfleaamr,diftorqucaturq;, 
denfefiobii- «a r?aofursdmtramitetrahaEur,veIafcendit; aut in altern- 
"""'Â"î^ «""»fle'^jatus,&aucrfus,atq.oWiquusfit. Quodin- 
unwr. de co5aofciafreritur,,qaod vbi deflcxerit, interius vceri ori. 
iicmm obftrukiirjquapropter menftma fluxiones , aut peni- 
^us,aut magnapt parte fupprimuntur. Seciis accidir fireaus 
fit, « ^«ndus ipfi orificio e difc^o refpondeat . Idem docuit 



Digitized by 


îiariter fibi profpici qua^rk, quemadmodum proipc^ 
de morb. mul, > & alibi y hune ita affe<5î:um Vtenim o^^tis 
primdioiicrciubens ; digiios deinde reuelfere kfm^^^sm^ 
haeiic; demumtcdsliş^,^plumb£^ 

f c . In praefexîd tamen ioctu vmuc^a quardam 
do pro curâtione proponuntiur , qua? in quoiiis ^ %>arnâs 
pârtes , & ex quacunquc caufa, rccurfii, tuto prseftari pofl^t ; 
indiuidua vero yzc pecufiaris cuiuique curado > vt fepîus dixi. 
mus, inlib.dcnat., âc Mc morb. Mul. qu^rendacft , ybî 
€xaaiffima repcritur . Dumitaque fursiim afcenderit î^lx> 
ccque obliquaiît, vede eius r eda6Hone foUicjti îaîiî cffe de- 
beamu^ , fuauiter olentia ^ quar calefaciunt iîmul ^ ialrâ con- 
fefiim adhiberi precipit ; iuo h^ec namque odore Vterum Cdoratacta 
deorfum alUciunt; calidicareyero diktaîxr^ prauofque conco- ^'"<* P^^- 
quuathumorcs, extenuant, digcruat: HuiufmodieftMyrr}^, "^^ 
arabicşe arboris lacryma, calida atque pd^Hrai^j, qij^., ţefte ^^^^^ *^ 
Diofcoridc lib. i. cap. 67.^ j^uluam emollîţ y narprseclu^ ^*" * 
m* ^u ^FJ^i^^^îîciifes &:partuscderiter extrahir.Eâdm vfus eft Hipp. 
* îib. de nat. md. , vbi fie; Ipquiţur . Si vteri afchidet^esjuffoc^ 
rinî^funkulum lucernarifmaccenjhnextingmto , ^nmiusad^ 
tnouetoyqmfiifmtnattrahat ;p>jieâMyrrhamxmptmodiluUm^ 
i^kna exceptam aţponito. Sedquodmagismirumeft,etiam 
Galbanum , quod fuccus efl nafcentis, in Syria feruJse, inter xkSt^^ 
odorata recenfec , qu^ appofita , deorfum ducunt matrkems v^ "^ 
€umtamenexDioicoridegrauisomninofî€odoriş,interqu€ ^ 
carecenieturiGaleno,^uaB fticanguk^^ Gai,m«. 

Eadem fubit admiratio de Caftoreo , quod & ipfum grauitcr ^« c wnpoC 
oleac , caldemque byfterkas olâ<5iu excitare natunLcft , cx f^^* [Z 
am. S3. eodcm Gal. , eodemq; paâo vtitur Hipp. lib. de natanuL ijs 
verbis .Cum Juffhcarinî: vteri , ^aueolmtia atmiajuffkâ cportet > 
Bitumm videlicet ^fulţhuTyCornu , lucâmmumfiimcubm^ho^x 
^iţ&m> Ca.^ormm^0domav&tofHh 
^^* ^ ^^eBadllruitwab.a.4emQrbtpua*-,^ 


Digitized by 


^I6du. valone ftknguIatustiefpirareafiaric-Dioicotv Jib. |^ 

<.74»^€l,^jelosgia$progrediamur^ aotandum eft HippcK 

bSafJ^Ta <sc^^m-> ^îi<îuiddxonftabit>cukimqiieOina?ciomim Iibros 

fugâBdumy 'âtteBâjkîs perojrrcnd -, .graueolentia ad *.&^ vteros m 

{^^iimz %ftei:ii:is.affc^ibus,nofî alit^rfc^ vnguam adfaihui&,quâm 

Hippocute* jnfufS^ru, pt^tcrquam dumper os exhibuit, quafi nidor iUe^ 

^*"" 'qucmi:dum graucbleKtiacremautur,fîbi adfcilcan<,&tidum 

-acuat odo-rem , Vccroque infeâum rcddat : alioqui muica , 

Craueoietia *qua2>01fa(^gr-auiom'iudicat odoris , idem , quodXuaueo- 

fJ^oieda ^"^^^3 pra^ftant > -e4 quodcâlida finr , & iîcca , prauof^-ac va- 

^^^l^ leant^oqucrc, digercre, acdiiîîparchumores, vaporefque. 

45Eemcnmr. ^^tcriîm odorata vnguenta Hippocrati faaiiiiaria in vterf 

;^ ;fcangufam,*referufîCurlib.2.4eiiiorb. muL ViiguentumAi- na.ig. 
3>um,^^grptium, Baccarium,Amarickuim^ aliacjue huius 
cenfusi q^seâiagaa iek parte Hodiecxole^ere : Quemadmo* 
ÂVLm fetida ^uoc Pbarmacum nigram , Capra^xoi-au^nigruiB, 
aut C^atim, Phoca? adeps , aliaquc compilară, qiKE iam re- 
<€Hfcr€-opei^;pî^timn miaiMe^ft . Iubeţ pfsetereâ ex Vino "' ■ 
iomtnmm adhîber^ quod calefaciendt^roquemii, difciitieo^ 
fia?5^*"^ <ii<î«€ vim habe«: prarfemm £ graffi m^eo cbuiUcrinr, '^pivid, 
ExGaî îiamqueGrsecis^ GaprîficusLatifîîseft, ;ficus mmi^ 
1^^»^ ftîs>quiflimiquâni^dmaturicatem4euef^ valenterc^fa- 
cc»&iifîca. <:it^^fîccat,dfic«tkiatqucjrefbluiţ4^^^ 

^ros, floxumgue^fîccandum ifrcqiiemer ysviu^ 
<r^» <^akBtemdem a^aiau^ adlîffiandum f v^^ 
f6mcmif«t- ^^eatîa ofierî^ eo^uod baec deorfiim^acMLîeant . dim autem 
^^^^ fomenta adkiberi nvandaffet^ 4occtpromdeytn^^ 
fe. fl^*«^^pon;eat,exxuciu:^îtaparatoii/uudi^ 

^moddm aliâsarundim^fiim âocmt^cfâi^^ 
g^^ Vi^ris, vtJib.^* demorb.-!^ 
, ^^^^fidenria,gua:deo3rfum trabum>prâîter«,,qu3^ 

^ 4itqiie 

iiiiia4. I 

Digitized by 



bulumaridahoc ft€rcorec<?J3fi(;i^t> cuivaark im ; - 

atomsttâ ^ iuppofitoquc ignc^ iumum e^citabat ,^ 
liB. de nac muL, & alibi; itâ vtmirari hceat doctiffim^m Mcr- 
eurisaem^quigrauî Medico ia%miiudicat adeo turpi vd mc- ^^^^^^^^ 
dicamentoy cum Aa noKlior^pir^fto fîat; proindeqj^^^^ 

iQcteJbmiKaiemineritHippaa3»c^.>OTpoffi ^IbiS^ 

tiese£râtum&iffe> dîceBdiimq^^n^e>x;i«^mcdicamea- ^ 
ttmihoGratiombikfoa durisagrcftium miiUerumcorp 
bus aptm poffej.&iigiqucefre Medici ommb^ 
forcis confulerc . Bubuîum iddem fel eaidem obtinet ^cdca- 
te5,coq;fepiffimevfusefi:HippocratesinMtdieribu^ - 

mcn^quod ^gyptium cseteris pra£poniLur> cxficcat &c digenî* 
adftrii^eîitique,y qua pollec craflîoribus fui pardbu§,ftc;uUâre, 
cthm roborat.Dc Caftoreo autem>&. Galbano iam di6tum tu 
perius.GoB&Hum deniq>HippocratieAquocunquein vteri J^^^^ 
afcenfu,aluum deoi'ium purgare; fice^m vnâcîimhumo» jipjobamt. 
ribus^vtcms eriâ ad inferiora Ciecuc i queiiiadmodum ia ciuf* 
dem prolapfu voînitum gerpetuo pxab;^uticonccarioru nam* : ^ 

qiie contrarise funt curationcs^ vomicuque diîm farsum panes 
omnes coguntur , Vterus vnărctrahitur» Yerum quia accide» 
re potcil, vt â validiori c^bardco nimia excitemr euacuado * 
â qua & Vcerum plufqcam [m$ cxficcari peiiculum ^ i^ ^2f- 
fecado aiiccm vnaeft ex caufisip£um^iuperior3i deducea* 
dbas;ided ia tali eafu voinittmi etiam leuiter ci>imn<^^^^^^ 
fa5 cffo infinuat , ad commoum aîuum . aliquandfper iiippli^ 
mendam :> facta reuulfîoae > vt fuperpur^doni «curramus • vomimsm 
Oinitto quod Hippociates id ipâim agere coi^iieuit, ^i>i J^op£J 
vterus lumbis , alijfue pardbus tenaciter adha^fit; iiifcmam fit. 
cteoimaluum mouct> leuemquc vomitum fimul excitac> vc ^^^ ^^^^ 
contrarie hoc mom qiiafi coscudarur vcerus , dîuellaturque fimui^at^uc 
â^parte ^ cui adferex , vt patet ex^pluribusiocis , ied praler^ ^^caîap 
^.35, dm ex:2. de mori: mul^^îfic habetur.^im:^rai^^^^^ ^iao^ 

^c. cumjîc hahueriuţhaimacum hâm^mdatOfâ^o jurjiim ^ 

Digitized by 


LIX. -C^terum fubdititiasglanduîasfîc facere oportetT 

gS^S^ fi forte's facere veiis . Mei femicodum facito , & ex 

^' pr2efc;riptis fubdititiis pharmacis, qua; vaide eSca- 

cia fujit , immittito , & vbi immiferis , glandulas for- 

matb inftar earum , qu^ein fedem induntur \ veriim 

ioagas &cxte has , & itenues . Mulierem vero fupi- 

namreclinato, iocisâpcdibusle<fliaîtius înftratis; 

deinde apponito,& panniculo intecfto, aut alia qua- = 

dam-reconlimili,calfacito, doneccoîliquefcat. Si 

aS4^t* verodebiUoremgrauduiamfubdcreveHs, iniinteo- 

PclTusgr^ctt r^ Vbditkiâs ^îadulas , quas peffos coa^munîtcr gr^co so- 

w«acn. ^ ^.^^ appeUainns> hic formare cdocet^^qudd hoc for- 

^ tafeamcdicamendgenus, ptascartcrisommbus proficu«m, 

^ atque vficâtum ik in vtermis quibufcunque afedibus, noa 

f e^ quîd tauuum in fttaiig^^one ^c^ iam curator .£^^«t5mf 50^ > 

. aorisfiaum- Horumdiflforenda^^ 
idem Author cx AntyUo: alii namqife cmoîliendi,aIii adftriîi- ^•^^• 
gcndi y alij deni<|ac rafa meatufqus aperiendi vim obtîncnt : 
Et paulo inferius * OpmetaHtmţsjficra^udi^^ 

rr^tfr^ .Conficicndi modum & vfum aperds ver&is explicat 
Hippocrs^es praîfaui texm ; vbi aotandum ad medicamenti 
vitTiretundendam, cum itaexpedirevidctur, lincco aîiquo 
tcnuiflimo , aut ferico , aut bombycino peffulum inuolucrc * 
accontegcrc . De hoc codem fatis luculenţer iocutua eft lib. j^^^, 
de Scerilib.his verbis. Suhdititifs vîerc . Crodqtimtîm voles , & 
NLyrrh^ rmgmttdmtm fabbarum duarum , dr fdem fiifficientem 
^ •gprmiJccillorHmrsJpeliH» ^fdîis taurini fahharumdmrumma^ 

Digitized by 


cra^us^%Jdndc confiqueMer\s^oady^ hac 

ipjîmp]tm:tMs'On^m ^MOf ideuigai^os infigim ; ]fmt auîemJmgitU'- 
dinu fhcdigimwH pdemăelanamoM^pma Jurmhs^imoluito , j^ 
'jîlotmuujtipsmeÂeUgăU ^^^emine^ jilum -^uatim* diptorum 
lon^tudmefraefiirmîismfacu: pojî^^ 
ramjeipfamfsdt ipfkmad^.teri.4>s apponat .^ UnîeHmfut^ coxas 

mulS'CompluEes apud ipfitm Hipp<^mtem regiftracse rcpc- 
riunvur: Variumaucem hodie coniîciendi modum, atq; viUm 

apudpkrpfguejc^ere-cuique facile eâ^ 

■ ' . , ' * ■ 

hzhncrinty Scnon Suxerînt,fluxîonati facere op or- 
tcty §c lubdîtîtiis pîiarmacis £znwrCpTtcmqnc.&micn^ 
tis , velut fcnptum e^ 
fiuxian:eiii|>prena^. ^ ^ 

DIxeratVccru fursum^vel deorsumfcrfî modo reSâ;mG- 
do obîique^ac fi oWiquus fentur, menîbaium fupprimi - 
fluxuax; fi £e6îus.,ncunquam^ Gmiîquciamdocue^ 
xemmotioscs curate ; de obiiquis modo agere inftituft^etfi-ticumîo* 
compendiosc nimis ) videlket 4 um iiiterno vte^obferacd 
ofculo , eo qudd-caukas'm partcm aliquam dcflexerit^ iîuxu- 
rusiangiiis intus xecmetur , quo tîcm^^ 
pleniur r^iqiie iuxcâ orificium humoi^cs colligaatur:, iiicume-. 
icic r Porro in cafu hoc pracipua-curaâonisinienii*^ eft fliixio^ 
aempromouere&fiAdicidjspharaiaciSjfejris vidclicet ap&. 
rkiitîbus -9 & em^em tacukâtis fomlHtis ea racione adhibiâs^ 
Vtfupcâ fcripmm eA . VeriîiB ea vcrba . ItdfacimdO'y'vtmfii^ .« 
fmorefluxum^îipj^^ :, cum "" "~ 

fuprâ de fupprefla ftuxionc nufîquam egerk : ^aapropcer ne 
mcndofciaatadiicaa.vakle fi^plaamur^ ea«vagi% quodea- 

Ggg dem 

Digitized by 


co»E«xw vi<ictMmusîî ac pramck neafoiii£onb«stMsam«>»- 
tafuerinr* nmmîevcren<kimeft. Caeterum.hanc Vteroruoi 
- auei£one vixvquain folofuf&u, famcntifuecui-aKipQfVcipe^ 
randuHJ, vc &prâtex.s8> »o^J»di<auFuK»iUalij*€«indigeBt 
mfeumeMi&;ad jtec v£ priuakigamur v.?f eeijttes miUcamt 
Hippoc.» prxfertiro 1. de roorb, muî. xrvţifîelocutws elt ♦ 

fouere oportet . Tojifmmtim autem perdigitumaifidfim a coxa 
detrcânto . Ctm autem diMmt, tedis, t plvmbmfiiulu tmw^ 
fts iuxtâp-iorm raţionm in reBituMnem diri^ta : tih vera retii- 
fcati^atqucctpvtifiimnt'utm^VieMcam - 

aliafacitaiuietArdatamratmm.Eznh.z. de ţ»orb.muU ^^^ ^^^ 
Q^lufimiiueofwlvm alio inclwtur^^ adcoximdlahntr i con- 
tinmntenim dr h^c^ qm-vterumţfirgaidfrtihibmt:* ^gmtvrm 
fufcipere, ^ îiheros pgnere ; hanc oM>ratisfeuere Oportet y & ţojt . 


vehadiBum ^^Cimjmtem'adtumiraie»pie>»^*-edifrint>p -^ţ^ 


fadtalM nuraquina'^d câlccm deueniretur , fi confîmilia 

omnia loca hiic adducere , atque annotare âatutum effet . 

M£fi««fe- lUud potiuş operx pretiam erit fcire, pluries , quam quiş for- 

gvt^X taffe^itmeţur,» accidere, vtabauerfovterpfluxionesde^. 

tineatur , fj^jut i quoprofe^âa m cafu nequicquam omnia adhibec- 

^''S : mry iiift ad na^^uraiem ^tiim 4tquo prius infjirumenco Yie- 

LXI. "c^in&fîittanterîorempartemprocedenşVte- 
rus » auerfusfuerit, fluxionem facere oportet ,. velut 
iRliipenorefluxîone fupprefla. 

N"^ O» modo fi anterforcm inparţcminflexusVtcryş-, â 
r€<Şo, naturalique fitudiftorqueatur; verumquocua- 
queMpxail, {îueinîumbps,;,fiu«inleuam,a«tdexteţain 
partie^v^its vtjnterius eius orificium , aucriijm,occlufmnque 
fupetfît, , fitmcuftwa fiftatHi pursatio i.codef»pa<Şo, quo 

Digitized by 


£OMmNTmmiu;itsm£rrs. 41^^ 

diâtim fuît^iltjxiqquâmiprimum ,ptociirânda^£ft> âw^is 
yip ,3iamr^^emque in£imm4câuM%; , mox £uî&u ^ fomque 
^edkameuds ijs adhibitis ^ qu«: apcîkmiiieiiii ^bciiîwi:> 
atteauaaiîi ^ atquc i:rahcndi* :, . ^ 

LXII Cum verdfluxusnimîiîsîuerît^iîegiie calicia aqua, 
ii:equeaHb^uopiam<:aîefâcere cportet/n^gue vri^ 
riam cîentîbus va ,^^ cîbîs aluimi febdaceiiti- 

ţus :ieâi autem partes âpedibiî^ 
tet :, y ţ ne Şeclrnatio fluxiiî tfadlitatem pr^Eeat ; 
Vtere autem fîiuul etramfâbditiâis adftringentibiis . 


nu* x$. 

^pe fit ;, y t faîiguis â fupprcffis mttifîbus copiose coa- m^^ ^sro- 

oematus^ confertkn i atqiiccoxxcicatiifâ^rmapac:; ^9^^ ^^^miu^ 

îui^ e^i^ritiiriaffe^ioyquj meii^ prefibs pic- 

Buncupatur ^"Oocuit id Hrpp^iib. =de tiat. mul. ^^iVtenţr^ I^^Z^ 
t^ ncituTăm hienţ ^ % mmfesţlm^uamjoportet ţroăema^ ^mfcojî^ 
refqti& i ^ frequmtior^s %o. ;^tmăem i:tmiâncnjes fiipfreffi J^e- 
fen^ er^^fp&rmt, Qupdpariter Tep^etit per ead^m Texba 'lib*2\ 
m. 5x. de morb.mul. Iure igimr poftmulicbrium fiipprcffioncm ob 
^uerfum ¥teri<)rificium, ^qiio iamiiiodo^c^^ isăQti^ 

ftmx purgatioBes > <umoptimiiniob iir^m -fiicrint â tiatura xario^ 
inftituta?, nîmiaim ad congraam con^ 
alimoniam, ^ad corpus vniucrfum^â m 

ribus expiandaoi ; c^tasfedam^atqiiedefiaitashabeclegesj >«<sî£iEBu 
in quaîitatej quantkate , exc^W^^^ & tenifpore,quas ^^^' 

iiuBquam fere trarij^rediun^ur^îiifî mo^i^oîf euaferiiu^: vnde 

mmt€S 9 ţurgmmeminiiemt <0^ r^reJîiraH^ 4. Et aph. 57, ^^mî-^ 

. jî^«? , ex'vtero onorii tmtin^Aif^ . Quâs profecto moxboâs 
traQfgtcffibnesamplilîîme profecutus cl%Hipp:m*nu!kbrium 
iibris^ icâ vt miflime opus ficîiiCHSas i^ecenfei^ ; Tbi qiiaBtum 
ad^cc>mp^ndij iîiftkucuni îlEtl^ 

' c 'Og^ z fltixus 

Digitized by 


42^ HiPPoeiMTi^ xmim i^xoc:i^H03i. 

acticarum mmfura ,- feo^ ejî,wginti imcys feceâmî y aut p^- 
Uţlureh^^ fmci^Hs;aiquehoQaââtm' yauttres âies.. Lm^ 
dus autem tevipis ^ mt hreuim > mcrlofim p fterik efi ., 
ConieBari prroc^QrtetMt4lieriscorpiSînf^dend(>.,iţinterog 
collaticne ad ţriofo^fa^a , mfemfer morhofd viuat yOut non • 
'Siemm pauci<>res ^ aut pkrerdies ^ quâm filent , prodeant; aut 
"TpJ? ţauci&ns ^? ăut^ pkres^ fuerint ymorhofi fant; nifi natura ipja 
morhfa , & fterilis jmrit . Si verâhoafumt h ad faluhriQ^ 
reinflatum tranjhmtatur , melius efi. Procedit autem fanguis 
yoâlut a^lHmay ^ citoc^ngclatur > fi fana fumlmulier - Qui^ 
hus v^oin natura efi> ztP piurâs >. quam ^uatucr âks ţurgmtur.9 
^ nunfes ^aldimulti pr&ieunt ^ha tenues: fimt^ 6 fQ^tusipfon 
mmteme^:» & emanefcunt ^ Quiius mtm pu^ati$..infm tres 
âies fit > aut pauci mmf^s. fecedunt , h^ craff^ funt ^ if Une ca- 
hrat^vinleplue y.Acţartmimtnemores,S ^H^^ condţiunt .. 
H^c Hippocrate^. ♦ Ux quibusp^hm Bt noirvnum cmni- 
bus efle meiiftmotuin modmn atque mcpfuram^:fed cs- varia 
nudid>rium corporui»h?tbiîudim£;a<i qitod & im^s vit^ ia- 
ăituiix$ > & rcgio yariar aoa mininijim pr^feda coiifcrant; 
Eircoilim- -proimicq; cxj&auki viaiufcuittfqs.canluetudiBe^deHior&ofo 
ăîieiUîu- cuiuiiî;ft^cucoiiieCÎandum=e^e ^ Atquitalibus neţismen- 
Sudi?£ ^ariittmhimcfl.u^m € mork muUer. ^^^^ 
#mcnf«*^ 5 j j3«xî^^ in ^teris ohortns fuer^jjmgms mtltus §uit , ^ ^>7i»2i 
coînpa3iexcidun£yitM^r cccţ^PM^^^y â laterum moilitu- 
dinent^ ac. imuş» vm^em, d^dţm^s-'^ventep r ^,ad contaSum 
âolety ^ rigori fd^acufaxQrript ^ it- dehilitas ohrituvy 
i; omnia pr^ter humcroi ac fiapuks^ ickt y d" .<^^^or inuadit 
^.ruhfcit^ jăf v^^J^^^.fi^'^ ^ ^^- vmitmtes . Morhus hic 
maxime fit cx ^iprtu: • ^it ^ cum nsmfes multo tempore n- 
îemH , ierepenu erupmT^ . mdc^ ^c. Verum fymptcmiatis 
huiu^ complures aUx effc poffuBt eaufe^ qu^ omnes in vido 
^^Tc^U cpjafifty^t jr aux Facultacis^aut Sanguinis>auţ Vafprum, vt optir 

Digitized by 



pcculiari prouickntia fîbi confuli proetd dubio poftuIâţ;*H^ 
pocrate&mhilominus conimunem omnibus'curatione pt<> 
poaiti planam a<ico , vt nuîlavlterms explicatione indigcati 
omnta pcohibcns > quaîiariguincm dcorfum dticea<K âcuka- ^ ^ 
tem habent V qucmadHiodiHn iunt iniernarum parqum cx âtmx i quî 
caîente aqua loîioaes , alijquc fotus i diuretica paricer > atque ^^^*^^^^ 
aîuumc^îtWbaaciacibaHa. Ad hîec aptum proponit decub> 
tiîm/ncbumor€sinirafeciled€labantur> nimirum vtakiori» 
buscubccpedibus^ adftriiîgtncibtis denique fubditiţijs îaxata 
vaiommori&ciaadftringere , atteiiuaîuir.que faîsgumfîîx^ den* 
&re coaatur . Mukas autem psiesenaiittk re^uffioBes » vt il^d 
fee. 5 * apb. M^âim tmnfes fi cohihere^eUs^; mcui^hiudam ^luâm 
m^ maximam ad mammas appms . Ei Hb.i de morb, Mulierjâfiu" 
xioneinfe^ăt^ey adnares^ ant ds ,fluxicnemtranfire yhmnm t quas 
im.s. omBes^yt diâum eft, lib*2. de morb. mul: , &: alibi diîigen^ 
tcr ptQpofuit : lUud iam dabiiare coatingir > cnt in pr^fend 
texm cibos probibeatălu'dm ftîbdiiGe«ceS'j> £um tameiilib* de 
au^ij. nat mu^». &vbicunque de menfttuorum fiuxione curanda Andeerfup 
• c<=^icjpnarmacum intra purganspotaaaiimpr9aeât*\^ux-auDi* «cniaatbs^ 
ţ:Sioniita fatisfe^iei^umâirbitramur>^c^^^^ ^S».^^ 

gans mcdicamemum^ vc quod poiîîc ab aiiqya cacoc&j?mia 
ianguinis matTani expurgare > vtab a£ri& băiofoicro> vel 
pituitoia hiimiditâtc V quse languinem vel dikrioreni p fiuxi- 
bilioreî:pqMe , vel erodendi vi pra?dituiB CGnâituebant : 
AtaluuBs lubduccnces cibi nil ali^d poi&nt^ quam inî^^^^ 
partesbumeâare/qiMB potius c&nt exiîccands; cum aii 
ktcrim vition humoris e venis aUiciant atque expurgejîC. Ap- 
ponit eaam ccpc&â:oria > fi>uccqac VceEum in ijfi^m citatis 
Bbiis / quod umen hic interdicicMt * ad fedandum neinpc 
dolorem 3 qui vteri partes. malc^uexan$> maiorcm excitare 
fiuxionem aptus eft > quo vtiqiic fcdato ;t &ige&cicndbus arqi 
a^ing.cimbu&ytkw: «. 



Digitized by 


4*2. HIPPOCEJtTIS UB. III. J>£ lO^:. Ii? HOM. 
iklll. Hu3donesparrd,cmncoTîfeffimvenen^^ 
m&^r^ fl^- #2îim!ttbcruent£e fiunt : Cum vero tardius prodic- 

S^î^ ^1^1 Heorematîs Mus mionemitâ expreffit Hippoc. lib. î , n«.(S. 
ms_eâifî,ve- I ^^ îttorîx muîw Quihufdam fippuratifimtmenfisy vhi per 

mm incidunt mţeBmem , ^ p^^^^^ioms fortes , ^ cmtoBumnm 
- mina; Etfimeîmhahituraeft, mmfes iffi rumpuntin pudm^ 
durnyifţroccMt piS acfangms.dfprocedit grm 
mitom .ăiîtmuemdiâ. Inpiore-oey^o^ 
•eji mted . Foftqmm autem depurgatafueriîi>&ptîmum4uîdem ejtp 

PHsUlenty qm^Iceranonputrefcant, d^ gramolentia fimt .Rxc 
Hipp- Ex qua>uspaîim fit fupprcflbsmcnfes; ficito, & priui- , 
quam viuentur ;, erumpaiit ^ cruentos ac velut â iu^ulata viiâi- 
maftuere; Atl<iiutiusrcaiterint, pr^tercasccra, quas pro 
VşM:iaikj^misy coîTporiiipe di^ fbkmacci-- J^^ 

SupprefTom ^entia, qu5clib«de nat puer. pleniffime rcceafenctir, illud ^'7. 

Sl!'^^ cmmmtctduai acctdcre> vtmenfouuscruorintenuioribus 
vteri veais plufquam iads eft coâceruacus , incuîcatufque > 
prsEtcmaturaliter incalefcac^ & febrem accendat s â cuius pra* 
uo calorc > naturali adhuc accedente ^ in pus quoddam verti^ 
xxit, quod fua actcdine venuîarumofcula interdum rcferans , 
invtericauitatem defcendit; indequefanguini sdmixtum, 
pluribus dicbus affaciiB extrâcmittitur^pcokuiqucfan^ 
TOulier. Q^andoq; Tero^^^oam iaoa aperit oicula>red rnagna, 
quâ poJlcc>«rodcdi Yi>exedendo viam fibi parac, modo'ingui- 
0a verfus^akafueexternas partes;modo verius vteri cauicaicnî, 
ac tune vlc^ra val^e conciimacia C3u;iiantur , Qijod re^iciens 
Hipp,2. de moxh.muL Diutimia ejiy'mqmt.faniofiflmns mm^ au^ij- 
-tio.Cseterum rK>iaiîdu eft^fuppreflum hune fauguine îhîIîo ex- 
citate xuba:^ulo> fednimiumcanrummodo invenuliscoar- 
âamm^fuppiirari; nam, €tfi dolorîu;que pulla tio circa pe- 
Sinem in ^ectu hocpercipîatur; nuUustamen adeft circiim- 
fcriptus tumor^ qtii vcraminnamaiacionem , iângume in po- 


Digitized by 



aam*9w ^^^*^^|?s4i&foj aţteftctur. Quinimma aperris verbis Hip. 
pQcrates loco hâ6tcnus cirato de morb, mul* ., menfes fuppu- 
ratos fiuSos , nifi in pudendum procedact ^ ad partes circa in- 
guem erumpere cicrâ tuberculum afTerit : neque profeâ:o ta- 
cuifTcţj fi verp oborto phiegmone pus Hîud geoitum cffe arbi- - 
traretur: quemadmodum non fubricuit eodcm loco^dum im* 
mediate aife<3um alteru mi fuppreiîîs meafibu^^ 
deicripiît . Qtahufdam'vhimt himepres ^ aut trîmeŞreSy aut diu* 
îumkresfuerint mmfes > 6* ^^ /^f otV mollitidinmialîăţfifiimnt^ 
cum nenfyprratijmtmenjes^velut îuherculumft drcâmguenjină 
caţite f magnum ^ ruhrum : ^ "vtilgtts medicorum ignamm quid 
hoc ejjet j iam f^e feciîerunî ^ &fic mpericulumindHxemnt . C^-- 
terum id^ quod vdut tuberculumjît ^ toii modo fit . Fruiturjangui^ 
ne caro i^a ^c. ^ imţletur caro ah ipfi , ^ injurgit 3, ac eminet ^j&^ 
htptngîdine repleta^ytxi\m baud pouum eft in Hippocratjs ,. 

Do<3rinâ>pus nulîopr^uiopblegmonc dgfii, vtannotauimus pr^iophi^ 

test.4.1ib.2^ . . jrtcne ir.. 

' ... tcrdum ci* 

_ : gniîiir {ccâ^ 

"î^- Et iurioribus fiibcruenta magîs prodeimt; femîo-^ c^eS^f^" 
resveromagismucoiameiîiîrimîîabent* - 

VArij fuat fluxvs> qui muîiebri e fînu prseterBatutam mi^ y^j ^^r 
pere confueuerunt ; finguliquepecuîiariinfigniuntur Vtcnun fiu- 
nomine ,. peculiarem conftituentes fpeciem > pro ^fflucntis *^oA^rS 
mater ei diuerfîcatetnam modo mehiVs pluiquam faris eft eua» i>«"f ^ ^^^- 
cuantuPj ficque > vt diximus > meiifium fluxus y fiue hi in qua- 
litate fecundum naturse îegesconftituti fînc, iuguîatîe viCama? 
fanguinem refercntes ;' fiue in propria fubftanda^vei ex prauo- 
rum humorum admixtione vitiati i vndc puruîenri , biliofî ^ 
pimi tofi> vel melancholici egrcdiunmr : modo â corpore vni» 
uerfo, vel â determinata aîiqua parte ad vterum vitiati humo- 
xes deriuantur > vel m ipfomet maie affeito coBgcruntur,qui 
per pudoris fînum diu ^ continenccr > atque inordinate diftiî* 
îantes, fluxumcofhtuunt^qi^mmuIiebrcni^velaJbumcbm- ^}^^ fcu* 
munirerappellant; modofemeninuolumariepraîterlabkur; albi'!' ^^ 
& gonorrhcea> feu feminis fluxns efficicur ; modo cumefe<Sse 
ircauk in ofculo , aut ccriwce maoricis, fanguinem varijs pe- ^^^^^'^* 


► Digitized by 


, 4*4 sm^^KATIS UB. III. M IOC. IK mM. 

"^^''' lcfluxioBesproprijsai§n»fclfigHts«rmmeft;quzanmmc 

SlocTuius rccenfU vt menftrua pmc.eamus,atq; puer. 

' Ieria,quxexnaturxlege cffiindi con&e^ere ; In propofito 

• lutem Kstu ffiudtaatutn annomur , iunior<:s namtum niti- 

u«es!;^a ; fores vero flaxui muiicbri. feualbis rten purgamenm magţs 
ie. v«o ^{fe obnoxias , Quod vtique dacumcnmm iaitio hb 2. a« 
'^^t'},^^ mor mui. ficreeiftratum inuenimus . Vluxus dhus lUj mon- 

*■"• -s'WftKS.; iî«*«f ruherinitmorihus . Et niher qmdmpuxus jit 

ex Âlrr,in^''isaMtemexahortH. Fit 6' exmmfitminUnceptions, 
cum c'€tMm ex fmrtu. ^ şx pbn^ 
hu^b Omms pwfiuit 'odăi mdtHs, ^grumiexcidunt , &c. 
Cuius vericatis haud arduum eric rationem add^cere, cum m 

• Iumoribusvig«atcaIor,qwioptimupIerHmq;gigmcIanguinc 
turn venofum.WQi arterialemîâ quorum copia imwcanatura. 
âuxioaesbafce crtientas plemmqî excitat. Sccusplaac cucnu 
ieniotibus midietibus , quomm imbccaiis cador eft, excre- 
mcatomm maxime ferax , quje ab cxpuîtrice Jaceffitaad^vţe- 

\jum, cuius viasiarofatBJliareshabet,dcmandaatur. Nihilo- 
miaas nequc id adco prapctuum cenfcndum<lt,quincomra- 
*rium accidercquaadoqac po&t; eft fiquidem«^eiarc luue- 
*ulas , quarum ,temperamcntum , vel in vniuerio corpore, 
vel prasăpuis ia partibus.aded wiatâexiliityvt cmufq; gcnem 
. .^crementigigncteaptaefintjquemadaiodumi contra 
_jnfemoribusBdQnuUisdiutius vigecidor , opci^ 
xnoquc ftuuntHt tcmperamento, ica vt opti- 
Bium pariterfâaguioemgignere qucanc 
y.erum quod plcrumque fit > Theo- 
• -tematis vim id habeteratio- 

îîbri Tcrtij atqucf oftremi Tinis. 


Digitized by 



NO T A Bl LI ¥ m; 

\^StfW>.^DOMEN cur morUi 

I heaî:\ fag. 7 

licetîmres\ 2,2 1 

AceiumhilioJ?sprodefl\ 522 

Acida'quomodo repleant^ - 389 

Acida ţituiîojum ventrem luhri» 

[ ' cant f piTum adjirîngurit» 589' 

ABio'vîJ^equattir^ tria tiecs^arUi 

funt y i^qptât. \ /" _ ^ 15 

jfHlo ex contrârictate formaţii faci^ 

'" lis a,Hio txrna^terLe ăffmitate în 

Agonie i;FâJfoprGuenii*^^ ' ' 1^ 

Acn^ahidiţ J^it^a»Ux. 5 J'.fi?* 2. 

Ad^s humîdîjftmtiS efi inter humt* 

dasfctrtes^ ' 5?8 

Aejciăăfius Apollînis filins^ex^rî'- 

tnenta rationihis expmareţrîr 

^ aggrejfus ejî . " B9^ 

Aeţyptioruntmy^moja religio.. 29* 

Jiegypty VotniUi ^ dy^imlmăiti 

pjir^pr^arunt .." ] \ 3^4' 
AegroTH tnaximavarietas infndr**' 

hisţoîhrandis^ . ^ i^z 

Afigri cur prcpe morfem mâiits hor 

\\lerevideimtnr^^ ^ ^ '." -229 

j&r Auri 'iiitpldriBhus a^mimis 

^ e/î.40. idem immohiUs * - ^ '^ju$ 

Aprtmmae intus reuocwdo ohjini^ 

Bifmaugcnt/ - ' î8j 

Ag^s naturaîeno agit în dipans, ^ 4 
Aoricidtura Medicinuc afftTnHattir, 

omnesq; conie^zivatrices. 555 
AUmenta plmimimi ntarientîa'jî^ 

'fiuntahăijiexcrsmentpfa aniem 

fohitînîl TP'î 

Alimenîi^ ^ MeScamenti dî^eren-^ 

tî.^^ " " j§o' 

Alimente mederiphcnimi ef^ j 75 
Alimcntti'm 'Medicamenta quando ^ 

^ quotfmodis îrmniJce:i£Kr, j^S z 
AUmentnm ^^ndo fTopinariâhni 
^ ala^iimpto€ăthnnîc^* "*3'8jV 
AlHutn momo^^Topt m 'vtâripro^ 

Alnum fiibducentix qnotjmt ap^ 
Hippocratm:. • ' 5 S5" 

AJ^rkmjjpenîzdqu^jtrJ^ ' ;Rtl 

Akmxompa&â Vcfnitiafikdr^^ji 

AluîfhiXîis in morhis feOoris mir 
nîJilzdpr^firHaKâ^im. - '22a 

^^F^i nonirritarJa ajpdtiism^^ 
câmkis dimentojis infihncixa^' 
îihis* ^ 271 

Aluus in'morhisjpcBaris vt'i^cm'^f^ 
pdebeat." 7 ' ' * 221* 

AhitiStiirhata injî^piirato mdUi : 
tex. i2.HL 2. păgubi 

AlmiS consmota in Vntneratis f ]fî 
'^ej^^îejijhtîir » lah^ 

tihh Aiuus 

Digitized by 



firîfftU 45 

Jtmjâtcoiex fluxiontquomod<^f^^ 

An^rc^ fadlis- efi tranj^tus m 
Âjcitim&Tympitmtitn:^ 149= 

Anatema in Brutis- antifdtur fie-- 
Tuvîi^s^ei^ercencmjţimt * 82. 

An^itAfangmnei incdli mttisco- 

An07ia/£xjolius ^riimvitia^'i^gi 
Angina apQpleBica. ^^ . .^9^ 
JnAnpnafinţMsexvîro^; ItâC'- 

Ân^ruc nxmeri^ 'unde^ 2.8p 

jinmna npmme Hipj^acraUs c^ne^ 


adiacmtvimţartmm affeShs • 

AnffndecurattaexItî^jraU 291 
An^ncLTummir^^dis^ , 2.90- 
Angî^fm^pi^h$e^^^^S.j J^^ 
ţQţîusAphth^^^\" , 29? 
JbmăiidpQ^ ex H^s:rafe.^ 1, : J^tf 
ini^ ^donncily ar^uBi'eŞ • 

diîatem, qim continui filtiţior^ 

Antîpdihia. inter humard] formrîs 
' ţancsinhonh^am^ 

jtorf ^ ifiterdHptjî^nifcattr/uh^^^ 

apud HippQcrâ^^ . \i90f 

E X. 

Aphari&ms vnde^ dilhiSiîext i Jz.J 

ApdkpntnusMeJicin^ excnhar . 

Apaţlexî^ quandafeMsjttncxia. 
ţdg. MJ 

CQfJ[jjîatZ ^S 

Aphthk maligna &ptfilentes.^9^. 
Mm^nie d>MgmtiiT ţri^corpare. 

A^^ţtepenţ vkerihui pfi^^Xf 
\ ţvs£cme^J - .'' ' ^?? 
A^qu^kc^eJc0K'\ i'4^ 
Aquam conăfi quUpt^ î ^ S 

Aiin^calmiîs'cGirârjj ^eBus* J74 

^ .ŞîmâcuiU ' "", .", ' ' ' ^^74 

'Ar^esaFixtMfdfeWereUlH 'vf 
namJmîaSteTnpei^mdi^ ' '277 

Aripotelis opmb ^de^^enişa cprd^ 

'ofiurdis^V Hippoa\iie d^fu^- 

yţtheff^^ t ^ -<^.^^ V - -^f 

Amtdâjit. - î ş:^* 3>> 

J^fl? Virtuscima^ilJi^wiJ^ 

}rtuY. { Ţ'-\^ ^ ^^%t 

Ars&firi:unaqmddîffeî*ant. '^^f 
ATtisff<tcepta îkgesjunţ. 5^i?| 
Arţes cntnes na^enUs fudes futit ^^ 
4ju,e^ po^tngdum fc^dunţur . , ^ 

' -;i«?r ^]7 . , . '; ^\ '[ : / "/^^ ' ' ' 19Ş 
Arţe^ffuompda dicajtiur fingui* 
^ j^noriirrigani' '\ ,. .75 

^■■"" '^' -' Arte- 

Digitized by 


75 Afr4 MîsfaktâHter ţsrvcmîtum 
AuMtus > tiujque organi ^fcri-^ 


Articulus modo Artkd^hnem $ 

modo Acetdbuh^m > wodo my 

^uod Acetdbuk mfintw^fi^i-^ 

fcătApudHiţp. :; 117 

Articulorummucus, — ^ ^ ^ 

Articîihrum'umi^liepmesohmuci Aud^us fer ^aammfieri^mmodo 

-vitimn. > 123 mteltigat$ir . ' : 45 

Artimbrum ^damitates 4X "mma Audith perminUrdumfit^ 47 

Î20 y Auditşs^andehsb^i>rredd:^w'^jţx 
tîj AuMtîisquidjîtm ' 142 

humiditaSe* 1^4 

^rîiculopum humiditate Ajîatîca % 

Scytîca^ensinuaUdiffima» 124 
ArMculi %>fiwmbmrohraiitHr. ihi* 

Articuli quomodo înfifimtur\âjlu^ 

xionîbns . î5J 

Artiailonmt nafuralis opportţmitas 

fluxiins excipiendis , .^ ^54 
Arîîcukrîim affeBi^na^utum^m 

iUdem . 
Ariiciilorum affhWoTies ^ur ireties 

aliipianda 4icantur ^ -^54 
Arîimlorum affeSHmes ^ua$uor 

funt- 155 

olfadmuSr&CHr* 54 

Auditmr tantimwtoda quodp^rmf' 

'branamingreMtut^ 47 

4;<m dejcţtpîio . 39 

-Aurmm m^Upericds^jhres qiîâm 

cadontm. 157 

Aurium Aoîiur intefijus ^ ^ cur * 

ihidem . 
^rdf ^wmodo c^drum Udanî, 

pxg. Î58 

Aurmmfmrlieiătiofi^ 158 

.ămif ^o/^r -Df îî.^fZ2 citretur , 1 5o 

cametstum. ihidsm^ 
Aunbus cucmiituLepropmt^ 1 6$ 

Ajuttica gens nrtkukrumiumidi'' Aurihu^ friggdo morU UbarMti'' 

ţatâ imhecillma efficitur 124. hm pmguimsfni^ ^hefi^ 16$ 

Tfftionihus sos Tvhrdbktahidem ^ Auritmt -motiŞca^mlmap^ n^ 

Ajptcurabiîmjtjiant. 588 resăermanda. ^ i^$ 

Atra UBs quomodo <imtidctur m AurmmmorUs Vimiius ^nads con- 

magms dolonhus . 341 ^&dat ,quând4) non, 16% 

Atra. MHs quomodo generau^ in Atins mdbmf&tmedksmmferum 

Wilneratis. 307 excejftmi. ^ 166 

Atra kllis vijaftfpmaefi , ^feie$ Mimmt'morins fmesvrnmspmcu" 

■ dmturniţîîmsfacit. :s58 hse Marota :, quam îunmcs 

Atrs hilis vomSus ietbaHs ^ ^06 ţag. ^$7 

Bhh z Ad 

Digitized by 



M Aunspum cur violenta \ i %% 

Mns ii^mOf ţarsmemm4e:ikar 
. ta. ' . ■;•."':> -ii.;.; 39: 

A^rmm mm'smtră vnde ţrm^^ 

mant * 40 

JmiumdoÎGra'flmîone* 157 
Mdum affeHknesnuTn^uam cm- 

temmd^^ 157 

Âurimla malh (^e^ă/vîx vUtm 

oÂmttit meMcamenîttm ^ t6 i • 
Anfţera ammcdafimt ad rohur ^ 

fîcdtateni'. tex.^2^ Uhra 2. 
1^' 255. 

Authores graues ^^ue anthţuinon 

temere (unt repr^hendendi îo. 

Cur- ohfamjmt Jhdem • . . 

^ fi 

BAcchîmaricâs Nptî^^jmt * 
P^S- .517 

Saînd confiderătiQ. tex. 3 1 , /f ^. 2. 
f^- 22J 

i^dimcţ^u^ tmius ea vti fo^tmt 
in morhis AUdem . 

B^îneiprer^g^^iuein ffmrUsfeB<h 
n^ ihidem, 

Balnctnocumenta ^ iUdem .^ 
Balnei'ofm • 2:^^ 

BeUairixMsdkmaaJJtmîIatuv.^ 55 
i^7i> tmnflaua» tum atra quomcd^- 

generetur in Vulneratis . 507 
Bilisnomîne cali^stmnes compre- 

hendiî hdmaresHiţpocrates.}! 7 
Bf /^ deorfiim eiiocuanda , it Fitui* 

E X: 

tafdrfum ^ mr. 32^ 

Bitişincerehro ţitnitefcit. 141. 
ŞUiofis naturis animalia cm^ain- 

teBa^o^mi^ zj^ 

Biliş fimpliciter frqiata dupHciter 

0mîîm ypro bumore , ^ pro 
morh . 140 

MUsjnc^his ^ ilidem ^ 
'Bilis â jrigore ma^quam âcalcre 

de<y^jum conmm&tur ^iUdem ^ 
BiUspaJlida^ ^em^vires^ %i6 
Bilis^UccpiosegigTUitur ^ 2S.2 
Bilis atra vifiojtjpma e^,^ diutur- 
mffimasfe^fadt^ 258 

Bilis atra . Vide Mra hilţf . 
Bracch'^ cmjideratia. . 114 

- _ . C 

CMfio quid pt^ ^^^ 

C^peoculis prodej} educmdo 
lacrymas. 18^ 

edidis & Ulîojts natvms cmPăcea 
^ mimaliaprojunt. 279 

Cahrmodo trahit^mQdo trănjmittit 
hrimoreSy^ cur\ î.33 

Color pituitofas fljmcnes^ i^adex^ 
' trâ magis conmumet . . 139 
Calorqucfmodotrahăt .r i^j 

Ciî/or naturalis immmnttir d caii*. 
disyi; d Vino potentiore . 391 
Calidaintiis apumpta qucmodc/fH' 
gefaciunt. iUd^ 

Color d jrigore aumnr: ihiâ» 

CalidahficcafonsadhiUtay eme-* 
nuantfintHireplent. . 38^ 
' Ca- 

Digitized by 


î N D 

^dîda intîis exhihiM , nmn ad ai* 

trahant. tex.^6. lih.2. ţag.z^z 
Smeri carne hahentfriaUIem^ qme 

facik ăig^itttr y i^Tahuîis con- 

uemtJex^SjJii.z.pag. 255» 

€alM£ excrementd ^Homodc cumur 

l lentyr. ^73 

Callus quomodQ CTdrmduf» 55^ 

Calhjum 'vlcus ^nQpu)d& curandum 

fit. ^ 535 

Cnllojum 'oîcuf quomodopat. iUd* 
Cammants qtdd fit apud Hippocr» 

fag. ii7§ 

Cammarus qtiotfignificet. ihA. 
Câtnrnarus ^nilmj conueniaî. iUdm 
Caţitupfi4%diquarum affîum nor-^ 

mdfimt^ IG2 

Captisdaler ţhîebotomia ^ 'vfiiO" 

mhuscurandus. 3SO 

Câţitis dolm 3 nifi vehemensfit; 

ţhîebotomia non CQUîimit\ 350 
Câţitahomvmmi nihil inter fi com-^ 

muniterhalent. 104 

Câfut hutnanorum mcrlcrumca^^ 

fit ^ cur. y 

Capitis€m>ies ţafpones â fiomaca 

proueninnt^ 19 

Caţiti curVmttictiiîS maximi con^ 

fentit\ x8 

€aţitevulnerato cur liliofitsa^e* 

niat Vomitm. ilid* 

Capit curotnms fitţerflmtatesăt* 

. Jrahat» I9,C^24 

Capiî cur vnaţane, dole^akera 

E X. 

^kfiUxai^Sio muîfavnsfuefimţi 

■ Cafut d ^uihus incâiefiat * î 32. 
Caput ţauca came ccmt^Bus efi ; ^ 

Caput fer^mty i; ^astnasexpi^ 
:i ptur. r ,îjy 

€4pitis -Cont^rmimaHcf MidfiS ^ 

Capitis vlcâra • 1 74 

Caput qua parte al 'Dtero l^datuy» 

pag. 4otf 

Căpitis fraBur^sCamm^li curam. 

pag. 297 

Capitis fi'offio lataaB^e pericuh 

efi. 298 

Capitirqiioiliht 'vulnm pericpJi* 

fiim efi , nîfi reBe aftăur. ilid. 
Qapitisyulmis. Vide FraBio Fi^t^ 
' Vulnus. 
Caput' fâhricitanti non p4Tgm* 

dtim. 304 

Capmpirrgare quidfit apudBipp$. 

craîem, - iUd^- 

Caput rdmium cal^aBo non efipiv* 

găiidum. 305 

Caput expm^gattîT dVomittt, ■ 35 1 
Capiptrrgiafortia d toto copite tra* 

huni 9 leuia z^ero ah Oculis \ prp^ 
" ximisq; partihis . . ij2 

Jn Capite dălenteah inferms partU 

husppurgatio capitis ohfiti; cw* 

CameSy i; Cutiscfmm.m colligatio^ 
. mtn, & confiru^onem corpori 
, tribmmt^ iaz 


Digitized by 



- ^ quiius meMcamsMit ipna 

C^rotisartârLedeJcriptio. 75 

CmiCătes^ ^rmum auâitus infiru» 
vtentum,^ qmrnodo idinuUi-- 
^endum fu* 45 

iC-^mxquid fit. 155 

0drunt qmdjît; quU Cedna ^Ce* 
- trides î 407 

^ler^hrum qwmodo ah Aurihus affi- 
xidtur. . 158 

"Cholera difficik Jidatur , & cur. 

Ch^aM4m diffâra^ ^ Hyţ^rcA* 

shai^^ 514 

0G^^^rm iBk^eStmA "oetm vino ^ 

^j^fmc4m^m$mt:a^alida t^n-* 

mfiin mxgnis morhis ^Jurpan- 

da. 385 

^hymjcantâdicammta vtîUa Junt 

, f P<^^maţi€ormnpr^cep£îS tA^ 

•Chymă iPharmacmn Mărunta 

•J^ 385 

Chymids mn parumJeha mUka 

famltas* ^85 

Chymci -mnnulîi ■nouatores-.j ^f in 

f^' \ , 3P4 

(^^ ^uza cakrc mn. Ji^HcmUtf:, 

nmfec^mt f^^iâuum* ^%$ 

€ihi ,J2 mmîa qtimAtate affuman-^ 
* ttir^^pdd^^mdisit^ ^ 379 

jwg. V ; : . 270 

if^miâui^m. tex* 3 i;iift. 2» 

J^g* : - . : - 2po 

€i Ji :» 4«i ncn ejîmentes ai ^dendu 

imdtmî jfu^endi . :2 1 

Cilum capere mU îempus maximi 

erratnm. 2Z 

Cîbus fi tardîus Jum^ur ^u^e adue- 

Circukă qmd fit. . -5 

Cir culm pindpo , ^» fine caret» 

^enms ămţoufimoîus 5 

Circulî €xen^a %>pa£fi.Hi^(x>r/ms 

ad deâarandas 'oenanmt^^dUo- 

fag. ^ 

Circulo defcriţto prinăpum mn 
reperitur, ~ ^ x' 

CÎamcuU <>fiendunt £^c^mt Pul" 
monis partem* 1%^ 

ClamcMlarumratm.^ 132 

Chmicuîdecuritadiiîae. ' n? 

ty & Chald^fipr^firHorut.fZ^ 

'<kllyria plmm^ fimt ineffica^ 

da , j^jr 

. Comhifiihikqtddfit. ^ i o 


fm0kmo "ona^conjţiraîio^^mycon* 
Jh^imUa^mom ^ j 

Digitized by 


Cojenps înhumam corpore ex par^ ./ cîime^,^,^ , •. 3<J 

. , fz//»2 arHjiciofarC(^mxione pr^- Cgrgorif, hm^- mhdîîiia^ vpde 

.: ^^'^ ţrcuemîy - . ^ . ...poumiat J '^ ' ^^ ^75 

£o»^«^x . VihSyrnj^^ia, . ^p^i^ >»z^«/ /:oga?-//a ci^j^ 

(^mpi^iidp ep maximi c^cinjtd^ran^ 

,' dain'vcmentihus m 227 

CctqtiendA clanfaefse dehent * . ,1 ^3 

Contraria Juntidem genere), Jpccie 

C^ntufiones occult^e in crwm^îio^ 

e^y vt Animat Jermaiiregaiwq; 

mttu-UliîiSf,^^^ .:,,:.^.- Ir 

Corpus himanum jtH %% idem ac 

Corpoiis raritasadjamt4t^^^40i^ 

./Viftajf -tJv^Jftr- ^^^^fX^jt Ij T...*_ F 

fhcandajimt, . „2$^. hHeefi. ' "" ^ ' \ \ ct, 

C^wtljisiptis proxima fttjmin. r^ntu^i^;, ,-;•,/;:: . ■e''';--ij 



^ ihiem . 
(k^xmdids curatio / f^^- 3 <^. i"^* 2. 

'^0tueniunt * 2^'4^ •: 

Ca- ' 

Digitized by 


(^Utdum fnâitur multis mitma- 
nifips j^m, ata ccnij^om- 

Qtmvum Jî ^cmUe fi'oMmH ^jftf- 
- 1 fkm, aut cont$^pif)^ty %um cu^ 

CntflaceaanhnAÎia conuenhmtTa-^ 

hîâîsit EcBids* tex. J 3 • /iJ.- % 

p^g. 255, e^ 27^ 

Cuhitiis ,* jSwfT/w^ V- -'^ •-. ^ • '• î. i;^ 

Cticurhiîulde a^echsĂuifihHSy -^-tOr- 

CncHrlitîiUnan genera tex. 55, 

lih.2.pargrs^ < ■ ■ ■ 24X 

Cucurhitule îfchiaMcîs pro^M^ * 

&§CHrlnt^je qHMâ& • -fim^ândde 

* test.ySitihMipâ^-' '-i4r 
G^^io nune jh] per cbntrana , 

-- -m^ fer^Şmiiictp. nune perv^ 

* trumque , / j5^ 

Ckratk per fimilia ăd'cmhranmt 


^^h-^ ■ 

Eîntes ^uomoâo foriîorls£ me^ 

dicamenta'offuTnere d^- 

hednt:-''^^''' ' '*" ' '2 74 

peUti exifiente ^grOi ffmrio verS 

"magno , ţm^agendum • 3 20 
Deîeteriar'cmgrnevjurpata m'^^ 

' gnam'afferunt^tilitatem .339 
Denfităs corporis ad roiur, non aâ 

pmitatem coniucit . 105 

BeusvUquejpleniet,' ' ^ . 28 
JKtfe/4 cmnium tutijjifna efl , ^ ^zf?r 
''- moda profit, * ' " 2^7' 

^>\ lAita-TT^i ' quid JfgnTficBt * 3 oS 
IHfiipHn^ â fine difiinguntur , d^ 

^:if modo procedendi . 3 1 

jyîuretîca in Vîeridefcenfii non ex^^' 

' hBenda\'Z> ' '405' 

Diuretica, ^tplurinmm'meHfiks mo^^ 

"'nefit.'^^ ''' ' "' '^ * " 41 r 

Dopuaticrfitentzâs'ofmes 'Meâicinât 

jubfatnulari copmt • 3 5 J 

Dogmatzeommpr^erog^iîi^ . 3JZ' 

Dokrvndefiat. . " ^ "J^î 

J>c/c?r /r 't^fc' natjîra- ateratur ^ 

-comţmpitur •' "' ^ ""'-^ ^' : ^^a" 


CuTAfidum non ejtmmorhcrufn^î^ 
gpre.'^ ■ ^^ -^ 334 

Onţis^ tuntefoBa în copite vulnHfâH" 
* lisofratur: '■'■"■ •*"v.'-;>c :,. >^-^^ 
Cutisconfideratto:.' ' .*..;;:-:.:• j^g 
C?rf!& nmpot^'expHrg^pirJec^^- 

371;^ 3(îlim-Ţq^id-^nittitîsfQÎutîo necejj^^^ 

■iriafit . , , * ; 3^3 

Jk^lcrihus' m.^msmm'S ohnoxium' 

^ "*ejî eucraton corpus • 3 d^^ 

Pokretiam infiihitâ reditu ad m* 

'■ itiraîem patimi^ excTtatury-i^hi 

^'l^atonisi; GalenicocHiatţOi^'dS^ 
Jkîiir^.căitfitadT^moăo 'alreratio ^r 

^fmdo continui JoluţiQiX Găien^ 

Digitized by 


1 HiD 

teretur. 3^4 

X^fitaHus . iliiem 

Bdhrprocmifa dokrîsfepi^ acdpi^ 
turahHippocrate. if^ 

Polor maxime attrahit. liSţ 

D^kr grauatims dohns^mmnneno 

yMptafyirab ^Hip^crate, 317 
Balor dohremfedat . . 371 

Dolorvtfiat nec^jfariaefiattmîm^ 

facuhas. ... 3^5 

D<^lor cum e^ natura inJUtHtetfit^cur 

^ptomatkumt ^d -dicaur . 

:ţag^ ..;:;, -,-\ ... v^<?^, 
I><?iiw «î^w S InmijdifatejiAt . 5^7 
Pa/pnV nafHT^^ £pt!ogm . 3 58^ 
Solorcaptisţhkhîcmiai; vjîione 
\cuxmdm #*\ - Wv-: ^sm 

Ba/^ caţiîis m^văm^ms^^^ 

fyiBolorâ capitisah infsrnuţarţv- 
hHi:p*cumiei^rcctpitis pui^a* 

- ^if^* 318 

DohrAims vtn^ curiţur . 160 

D^lor^s vary varimn aftefimîur 

4Hm huivfirmi^ ttimpart^maf* 

E x;: 

feBam i 317 

JDote p^rf€;^ Jî dîjiungantw cum 

gmdean^ muttw conUiMu \ ^ ^ 

cm. . 355 

pdor^^ canf^ amditio ex^Ihfo^ 

Bolmfic^ caufe quoufyie intendi 

dd^eant. > 3^^^ 

Dolorific^ cokft ratio inJuUta mn- 

. tăticfne ccfnjifiiu '■ - \ ^66 

Dolonfîcus cpjangms^ 3 iS 

Dmeiarum cantio* ,.148 

M .^ . 

E&^^asepx}olw^^ma infima^ 
pag. . 3îtf 

' Mhriontm curaîîQ. Z^S. 

Ehry pr^fentiummdorum ohlimoft 

ilrwnpn 'vomtus non ejt fidm-* 

^^ -:t.\*r'- ,' :H . :Vv' 3,1:^., 

^kncnm 4uratu> ţota mVomim ^ 

. fimnocmfijţit^ _ ihM. 

Eulegmatum dot£S, tcx.^u iih^ ^. 

pâg. r '32P 

Bffe^ţiS peracifii^ r^ducitm- ii^f 
(;£Uifam per fe^ ' ^ 7 1 ; 

BffeBwm c^tUrmmm^ ^^4 -^If ^ 
producmţur ,cqrpms wt^eciMi- 
tasincaujaejî^ J72 

Şffipyema inThprăcţ fieri pct^e^ 
'fiammatione^^cur. , 14Z- 

Em^ica 'onde diHa^^dm ratio * 
J^ . ; , 35:t 

Epiglottid^confli^Mk . 739 
iii £pi- 

Digitized by 


kma epe dehent . X7 i 

îad^ "vero ah oculis ^ a 'oimds 

Enacuatio ad ţr^femanâ&mft â 
hnginqidmbi^x p^tiim^J- prc^ 
odmiorihiis ^emad mra$tSim\ 
te:».^^. 239^ 

Euacuandis hitnQrihus hcus^ ^âm^ 
ţroximior eligendus efl: ihid» 

Euacuand^ fihris ejiperţrcximam 
..partem. 274 

Bxcrementa exîtiaja minus malum 
' epmacHori a pharmaca , quanp 

Exercit atio fanorum propria ep, 

* F^i* ' ''' ' 3'^^ 

Exercit aiio . Vide Gymnafiiat* 

Expsrientiam reUmpiere ^ ţmâ- 

dus nos lateat ratiopfuîfefipe-' 

F ' 

FAcîes 'i^ ficm mr facile* fii^ 
denP. -^ * ' • ^15 

^des ah^i^' neims e^ fiemukm^ 

in^eiligmdum, ' roi 

l^acieţ cur palkfi^in poflica^fii^ 
' xione. "' ^ '• 147 

Pddd jsfia* ' 107 

F tuces ipi^^canfftr ^ 2p o 

Fehnkm raţia* - .^i^f 

Fthium periodi mirahiles* 16^ 
Tebriimtiimammks^ - T0^ 

: B XV 

¥,âms generaţii^ . ihid» 

j^dris^ â lakmhmsă ^ mtafm% 

ţdnsarde^^pmratiiL, :- iM 
yehns cmnis refngjsm^^^^^&L 

Sehris gracilium: 'cttcttranda^.zy^ 
Ethns per prcximim'^ăf^ p^^rie^ua^ 

cuandd, ... ^75 

E:ehis partiiim • jod 

Ee^hris ^ rigcr per ^ 

pa§, ' " . joj 

Febris Apoptsxi^ quănda noxia . 

pag. 34Î 

E^hrisan^^ qmmudaexdtandain^ 

\-^'€muulp$. 345 

Bdms^t tdnmdfuprcfit iptos^cm^ 

. '-'didoms hdUre^'âehcat^^i ^ 5,42 

l^^V quandoque d tonuuljicne Jc- 

\^^m^' . - -^. v^ ' 1.42^ 
Eehris cupnm^fidanMin^Fleuriti^ 
ds* %CL% 

"pehiUs caloris caufa^ Hi^crati 

" pr(^fkMâus^* ^ -. ' ^ 27a 

Ef^ncitantihih dhii-mn offenYi- 

dm, ^ . '^ 270. 

E^emâfmsncfatp0r infiuidonibus^X" 

terids. ' ^rjS 

Ferdel^ ^ppniodc^ 'i>teri\ crrbrih^* 

pag. ^ * 40Z 

FekricitanHhttf ahiurncn iugiterip^ 

ritâda medicoinmtofaaimenfrs'^ 

Digitized by 


in D 

thoritafe HippocraSis . ZJU 
4iusreficietM. a 73 

pag. ^ " . . ^59 

Fi^rarum difirimhutm copite, 

l^î&ur4toccHlt<e in Crmio £^40fmdo 

a5gtsofimi^'m\y : ^ .300 

VUtsmi faciunt buif^da. rifccaia . 

iunt. \ r 4<^ 

cet. 1^7 

f feacîo cuUihetmcrio aut ori^em» 

^ainctwîmtum dare ţotefi . 

Iţdg. ^ 127 

fimionibus homocwmaxiwi cJmcn 

A^^ 1^7 

i^bmmesa^tdhta ^ofTrnmţM^ur^ 

Bh^gionis cauja în ţartâmandante, 

FluxiGnis materia. ihid* 

Blw^icnis caupctr^in parte tranf' 
< mittent^ , lMgus,Qai&r,Kj^^iG^ 

E X:. 

p$g. igo 

Şimmds caujk in parU rcdpimte. 

Şkimones capiii^ [(ţtmt^ ^ q^ .. 

pag. 137 

fkxioadThoracenu^ . , 138 
Fhâm^d ptttur fadUs^ -9. qms 

noncontechifn. t^g 

fiuxi^nes. adextrăfadlius^acdore^ 

ndmtr/i -vero faciUus â frig&rc 

<oncitantur* i<9 

JPhixiimis remedia • ^p6 

Fhccio diuerja m quaUi^ate i; quanr^ 

titate diuerfis partt affcfba • 

pag. ^ ^oj 

Thixioms dpericranio amttio . 17 y 
$lux:(y fdjkpmfiâ copite inaiîe- 

fcente. ^ 17% 

Ţluxio nip/ihinterms captis parti" 

%us prmmUat'i acms^ ţî^rj^^i 
... ^onejh ^75 

parte. 173 

¥bixic ad aures curmckitt^ • 158 
flţmo Micft^fng^^9pit$i^jk 

ţalorefacHiusi^mcit^aur . ^39 
Phxio^adimduikm^nalem^ 1 34 
Wh^txiofmm pojîicarHmpathgncnC'^ 

tmcafffia. * - ' - ^>^ 
"Phmone p^cdexifi^^ec^^'^tiili 


trahat. 147 

Fhxiones a^ fac^s perintemas , 

quam perext^mas paxtes^-t^S^ 

fu X55 

Iii z viu- 

Digitized by 



Whixionu gmeralis curatio . tex^ 3 2 

Wliimo ad Ventriculum . ^^.34 

^hădo ad Ventriculum vtilis ht$^^ 
H :diim.ibidem.ţag. 2,>^j 

^ktxus di vertehras vtnâm curan^ 


Pofida idem quodjuaueolentiapr^- 

fiant in vieramfi cremetuv . 414 

Wmida cor amrf^ur . 410 

Fetida yteruscm^erfâtur .ihtd. 

¥^tuspartes omnesfimul dijcrimi" 


- frimmimnkisappărmt ^ 4 

Tceîus dmiformatur nequeHepate 

indiget ^neqm.Cord& .^ , , 4 

Pomenii ^ admnijiram in vtmno 

l ^Şu. . 414 

Fommtum externam cmnemcalidi^ 

tatmpjignificat^ ■. ^xq 

Fmesf^a humida] mVţmS^fmjk 

nofkadhihenda. .^ , ^^^ .;-^^. ^aq6 

T^orţi^nrmm^^mdp .tex:ji :Uh 2 

For^m^.^dfit:,^^:'^: . . , . j^^ 
l^cr^^ e^ ^ qmddl^m. ibid. 

\^ppdHi2p^cratcm . ^^^ ^^^y" 

tortmâ 4m4 pr^et M^dm$^ 

'pag. %:• :0 :i98 

'Portuna hmâ memoria mdicme 

y pag. ' : -gp^ 

forttmaTf^ăma 0vUMenfpki>* 

rima^ . jpg 

Fărţuna ah artihus nm^exclud^ 

da . ". T -jpS 

:Fmunatea^e^md fit -opid mp- 

:-lpocratem. S97 

PraSîurala$am capite^hjqu^peru 

cuhejîfireite curetur . 598 

Wra£îâ ojfa dîius fmantur fi cutis 

^ imigra fita^ . 303 

^aHuraquidfit, i; ^mt eim fipc- 

Bmiînr^ circa cravyfuturas d^- 
. ^cHexo^ofitmţm^^ , . , 301 

Brialileqţddfit^ 588 

■Bvmbiîia ahitîmfifiuht . , ii/^ 
^riggida. et^jerîm .akdj^ durant^^ 
'^'^mtusverofidbMîctint. ^ 389 

Fr^^jmmdajmiehatpelbriaz i 
Frigus hiliofas jJuxiones intus ver-^ 
t^fitsfmliuscommoneţ^ log 

\:n^dus. 'ZIO 

^0^^<>rmpQţîon£s.\ ijg 

Ffiggidam exceffu quomodp cmge^ 

. im^almmfifiant . . v : ^^jo 

Fri^diispotus imhecilhm i caHdi- 

tat&Ymtricdtm roharat . 3p,Q 

GJiems Mcdidnam MMn^ 
Gaîbanlnat.ura ^ ' ^415 

Digitized by 


V ifpeTnmA. ^iv%i 

Qem articulaţia:. v^Vî ^eiS 

Gmu curimpojka Jh^molizi^^vx^ 
Ghnâijmtjuhdititiarmn ratio .415 
Ghns fi dehiliorlrequiratur linteo 
inwlumda. 41 5 

Grmlitas'vndecontrahaîuT:]* 573^ 

Gm(£imnfibnsm^curatida^^z^ 3. 

^ 32^. -.-■-- 

di. :^: .ihid^ 

Gf^dlis bahitm^m^tţis^ 

Graciles qS^^ome^edehâmit^^'^d^ 

Gmciles facih x>&nienUs oh confidc- 

; tudineni fiitfitm purgare^ cpbr-^ 

îeî ^ ^.^uoiidcL. . . . .. \ - ■ : ■ 5I9 

Gr^ci "viîiorutn cmniiim g^nito^ 

Gymnapica quîi ^^îrpcet^ -^ , ş 2 2 
Cymna^im inHmtăres^rmi^yiientii 

Cymnafiica Meâicin^e Wntrmia e(î 

Cymnafitm qmi fit , Q^.^Gym- 

y^opi^ itigemâtăs,.t6it 
I Hippocratis endimmumi%%6 

MipfQ'^mmrJ^mdiimtmBlin^ câ= 
lumvâcL in iîiera . * 28 1 

Hippccraîes Ccus hmăm^Ştim,^ 

Bi^ocraUs • FiUores imitatm in 

Wfpocrati^-^Hcatio ^ " < . CvN v^ 
Mippocrati phmmd dyijd$miuf â 

. -Galem ^ / :- ' ; ■ - -, :ţe> 
Miţpocraîes cmmm Medictn^f^r-^ 

Hiţţocrates anatomica omni^p ^Uds 
;- ?mce^ariafimifp^Be-caihdt:i 

MHiţ^crăts^mn ^ aitmdend^ 

lexaBus ordo^ - ^ ^ . -^^ 

Msmc^finxioTuhm e^mtă^nmeămb^ 

i xius . ' î?7 


\ fîusfălfus eji . - . - . I2P 

MofmnesinUmferântes ÎMutumm. 

\infidr ăqnafiatu^e e^cuherant 

H^&mines aut natura y âttd intempSi^ 
' ofiâMtia. m^GJi mt^fimt^rm^ 
-^<di . * .1 î2g 

-Hopza h^het.<MBficia^ais m^ 

i Ipnem . _, .^v '\*v\ :%:,% z 
Mcnor-artium gah^Pnatwz .i?^ 
^■^lientor * ,■;;;..: ^94 

Miimani\ ccrporis regimm. = 4fiî^^«^ 
-^^chia:^,,.j^ i,\..:^ ?;:i ^ ^^^24 
Htmani corporis imhedBit&S'^^de 
V ':p*OTmmtt^ ^ v^^iv* ;% >/:u"-:- 3^. 
mimidim mn^finttmf^f..^^ 
Htmim,mmpt]^^f^Ji. paiiu^.^% 
Bkmlâiores partes facile tranfinit'- 
'Ktunt^ d{0îcife rehimnK:. i $:, i j. 
Hmnâicn-.m pscrtmm-^.iTiiiThiuito 

J^^iidiora^minus 'issgroioKt'y^'frii^ 
>^:- ';pi:sddenr:^^'-:: v >^^. -:-.-■. 7 

Digitized by 


Jţumores pr^m^^imd^^hktmi; 
BjLdropis Jianificatio mdiifk» . 

^f^: -^ - ' --:--.: -150 

Hydropid'ukjecandi. \ihi(L 

■ Bobispate. .15 1 

In Myâ^^p^Aim 6jiatus curfmr 
^ ,pr mifcsantur . * j j x 

IiyiKQpis$xd0rfimr.iMo . t^x. 35^ 
Uhz.pAg. ^ ^^^ 

Hydr^pipHitpJk dhma inUrJum 

proJmfqTndm^pag.' 241 

Hy drops d colliquationâ 249^ eius 

^ydrpps ţo^ aUos morioj lahalis 

f^i* 250 

^ydrQ]pdx,fludicăm£nU qm fir^ 

nu exhihenda * 252 


JaaMmenta. iUd^ 

InHydrj^maqmţrius educm^ 

Lda y an potius mfiera att^n^ 

ţiyţrcpiciaerumnis cwrm£m*s^ ^54 

UydT(^cmim antiqm.^^o de 
mypercatharjisvnd^ fi^^ 312 

B E X. 

i iera, 
Uyprc/xtharfis curdtw 


IAtrîces Gymna^d cppânîtw, 

UJerus cur Pisufitidi fiperumioL^ 

lBmti4 cur primi in vculis inmtef 
• t^cat. ihid, 

i£kncuratio. * 380 

tmpnewmm:is^' 21^ 

iMtams modo primamis ^ m^âofe" 
-'■^widmime^^i - ^^ 

f3^^smorlnf Jupervenienf ^ji- 
. ţomaks/vhiiippocr^Pi^^^ 
c bimniad^hiMtur* .vy: ' . ^^ 
iBerus vel aureus, veîmcen, wi 
:V alhus. - l: :.^::^^; -282 * 
iBm curăţia in tria tempor^dim- 

IS^icis quando ^erumnopa^iSus 
conueniat . K 28? 

^ exhibmdum^ u; , - „ ^S-i 
& ^^^f'&nieLmchSfPxtmmdPi^ 

■tio» . -^nî„\ •■ '. .^5 

Digitized by 


•^ a rneâicamm^o prcMiCimtur. 
ţag.' 372 

IpdfecilHtas hwwd cmforts^ 'vnie 


Z^Tym^ âiutwrna c^ecitatem ^4- 
tacT) m^ octiJum extenuant. 182 

ImietiUihusfortia medicanrnoa no -l,asr^^n^:k^ipdh^r' c^^s^4suuti:mr^ 

-Infiar^mationi ah initw pirgatio LacryTn^e qî^cmod&a p^thmatihis 

: . ^» conumit • ' - 2^p excutu.ntur . - ifeî. 

^hiŞm^ fipium ejî manihus. fedi- l^icryfn^ ex gimdixy^exm^fhtm 

' yiiify;ejjedijieimimj::. ; 345 . \ţ^g-'\ - i^j 

^îstemperantia- labsmmtss wmfimt Lacrynsa; 'ver^jimtâoloris^indkâs * 

Intemperant es homines lacunamm Lacrym^'vohintari^ qji^* imd» 

inteŞinorutn tQtnmna a ^ cefehrak 
: ":- fiuxione. tex* 3 ^Jih,2 . ^0^*%^ 7 

- ratio. ^ . ^ ?iiii. 

Intefiinis labcmntilus mtm^,am 
" 'fortior cathartiat coroemiimt . 

'^'^mt^vnarum toxminihus feiris^ 
zmt ahii fiuxHS fipârutmgns , 
^> lethdis ihid, zyS 
jfihias.VidsCoxendix ^ 
^ijlhiadicis clyfkres maxime pr^fi- 

: cuuţcx.^âJih.z^pag.Zj^z. 
It^fcîdă^ infehddtaa^îhus'^priiimr 

: tur ex authoritate Hippocrasis . 
ţag. - ' 271 

>l'for 'umajtgnificai ad »Jp- 
pocracm. 124 

Laerymm^dohr lemtiiT» %&^ 

'LacKyva^A -qmhus. m^Us fantt * 

iUdcrtn, . 
tăaymamm fluxus db extesm^ca^ 
- pki^'cacmhym^:^ " ic^S 

Zacrpms fadUsai^m^isah- $CHli$ 

adnas^es: 171 

diff^. 183 

lafŞtud:nes influsdmt coiULcitaiA^ â 

^I^ffitudo curperipneumoni^^er- 

uerdaU i^î 

laffitudo ^mdjk *. 2^ 7 

Laffiti^dine ohrtte fihris^fmstio . 

t^er de loc. iniumu t^^i^^mms 
. medicina compendkiffu llLy 

liherde hcanik^ ci^aîtîrĂG<!^ 
AîiTeHano UI* 5 . Chr<m^cap*i . 

Jjherd^I^cân bim^ţatura C^m^ 


Digitized by 


tim expurgAt: Ventricuhm,, i , .249 

Idems analoga cum JmipmJ^ac* 

Idemficur h^^mmp^tiais^afhl^ 
'h^tomia in fummis manihvs fe^ 

, cunâf^m VdbfiwTim , ^ - 90 
lient Videsplen* . . ,, ■. 
Idmaces. non coroiemtmî fhthyfids 

: ,cx Faronio.tex.^^. i'^*P^^^^9 

Lingua exukeraîa *vt Angîna'cu" 

- Tanda.* c : -. ^pj 

ţingua concolor e^aâi^tînm-ţai^ 

'oideliceP , Vmîricidi ^ X^apitis. 

V cânt hmior^^^mfem 
' Fulmonis pariam ofimâmUiSp 
Lip^tuâinis ficc^figna ^curatio^, 
■pag. /l7^ 

liuortsayyt^dstatioi ţxx 

lâmr fy nîgrities vlcmbns ynde • 

Iduor cur exitiojîornigrim^ 3 1 î 
tocalia meiicamenta^hijîatifh'aâ- 
bihereUceat. , : - .; : x^g 

tocuîio quid jîtl. 4^ 

îjocutioquofmdo^fiat^, .-, ■ ^45 
Locutio AmuffLj^- r '/ ^ "44 

ijitrices^tmi p^âă^ plenmtqtm 

iMmhorumcotţfcn^ ^Mejmtenă^ 

ijm^rU fiipplicîa mcrhu : ■ ^ ^ ^^9 

Mandragora maniafnairas. 

Jîl^^r^j'or^ quomodo ^omi^sx^pT" 
tuletur* ■: 340 

Maniaci conpderaîio * 3 38 

■Mambid^FeMhusqus ăifientum^p' 
l > fipinfaniit^jifignuvi;^ . 34Î 
Mani£sdt£plick£rac£ipit:ur*:v B$ 
Manusprototo hracchioaccîpitgirm 
- p^. : ^ - : V ^î 

Mam£um Mgnitas^ j^ defcriptio , 
:}p^. _ tiţ 

Âianus hominhprudentiam te^an^ 
': :Snir^i . ,: . ■ ...... î -:\ .- ;. /; ....Jg^f. 

Martianus notatur circa twcemela^ 
V tirim4ţex»^jMh,2,pa&.z^^ 
Martianus r^dlUur in caihjivlce^ 

ris curaiwne* . ^^37 

Mzrsîmus râdargnitut , aff^mş 
,: fikm.A^im votări By^^em' 

ah Hippocraiâ:^: - •v-.:jA.ii5o 
3I45 quomodcf:gm£reţur* ; ^ ; ■ • - -8 % 
'MafiicMoria a Copite ^. a^mt-rir 

ctdotrjihunt^ :\-, .172 

Muxillarum dcfcrîptio. , 107 
MaxilUjupârions ojfa. ^ ihtd. 

balent. . 108 


Digitized by 


I N D 

^Maxijlas hmri fmiptm. xoS 

' tia^ 380 

Medkamânta ]uni/lm ţr^fintem 

patimi tranfinoi^enU HB. 

MedicamsntiraiQ generalijjhna. 

fag* ^&î 

MeMQkmentim ^uotttţilex • -581 
$îedicammtonifm îumefacienîium 

atque atţenumtiwncmPrair^ ef- 

feBuS: 3^^ 

MedicammU fanî ap*eferunU^20 
Medicamenta Ţanis ^uando eschi- 

henda ^ ihid^ 

Medicamenta attmuanîîa ^omodo 

'ţt4ffgenî» 337 

Medicammta alflerjiua ^^mt fro- 

friejmt. 337 

Medicammta jomnifi^a -fangnini 

qvnetem affmmt , 53P 

Medicamenta delmna\cmp^ m-^ 

JurpatavPiUa^(unt^ ■/ ihid* 
Medicamentmn dimento quanda j 

^ ^wt modis aâmijceattîT .382 
Medicammta fortia-dâbUilus non 

txhilenda. tie^ie in exigua ţHa* 

titatâ^ 584 

Medicammta valida ^Jiue chymica^ 

Jmemny mjt inmagnis m^rbis 

mnpdnt vfurpanâa . 385 

Medicamenta complura fer acd-^ 

dms operantwr • - 357 

Medicâmmtum non exhilendttm 

e(i<orporeflmdo exhifimte.z 6'8 

Medicammtoţurga^ti fhîdiotcmia 

'- - eflpr^mittenda • \ - ibid. 

' Medicamenta^ vdHSora '^^modo 

E X. 

U ^î^pmiendajînt^ ăeWionhm^ 
fag. " ,^74^3^320 

Medicmnmtitm deUlms (^<modi> 
■validiorem morlwn expu^et * 
pag. ^jâ^^zz 

- Medicina ^tiidj^t.. 335 
": Medicina aJimidi exordio âxţitit * 

pag. 19^ 

Medicine^.prÎTn^is cnltor4pollo. ik'd* 

^Medicina tot a irmmSaefli^ j^^t 

'Medicinam Gakms maxime iliu^ 

flrauit. " 3P3 

Medicma in dies niagis ferfci jpo- 

i#H?. ^ 3P4 


fiatî£r,falUtîtri^faIKţ. 5574 
MeMânaexiguommcinho^iore ha- 

letur&cur* -ip4 

Medicinanonindigâtfortima. 3^5 
.M^id^^ ttito eperoctur qzionttifm 

t^ exfh% i(^qfi€ â fQmma fen-^ 

ăet .. 3P^ 

Medicina BelJatrixy NmdgaSoria.^ 

if Agrictilttira afpmilatHr. 555 

Mediem^ finis non efi pinare , fid 

. imectiva^e* 35$ 

Medicina nifi ajje^uaturjm^n ex- 

- termmpnon aâfanda. ihiâ. 

Medicina îranfmntatiqne agă . 

- pag. ; ' 3^ 
Medicina Gymnapc^ ofponitur . 

. pa^- 32^ 

Medicina human^ jalutt pr^jmens 

. _ ^mtmodisjimtaniT* ilid. 

MedictnaxitoJdfiinonpoteJî .351 

JHeifw^^ ?j?3fiît: ^ ]îan'?s non idem 

fadt . . 

Digitized by 


I N D E X. 

medh^ d^mîm-vndefrouefmt fimdatur aqm. tex. iJib. 3* 

- paq, 353 P^' ; , ^^ 

Mdkm^fuhîemmitamtas. ihid. Mefnh'M^0CukmmmU&^^^ • 

Medidm Antiquorum midador . ţ^g* . , 1 • r 

. 4ex. S7^iii^ ^'V^^ ^^ :Mmhranaex fngpâo glumofi^m 

Medicina occafiQ Ireuisefl,. în eaque Mmoreex^atommmr^ 66 

'^ofhenda toU Medici ţrudm- JM&mhKanarum cerehn dejcnptio . 

ti^icmfifiit. 37^ ţ^g* _ ./J 

mdkmcL qnondam VUhfofhieţarj De eartm numere dzjcre^ant Ana- 

hahehatur. 35 tomci . -^bid- 

Medicina firori;Contuhemaiis.efl MmbrM^ ^.cerebn mt^^m^ms 

Ppienti:t. 35 .e^dsm permanent fi vfdnem 

MedidTLenuîlap^enafiaîuta^fijilia p^* Vi. .. .: .:.^ ' ^■ 

quâmi^omim^. S6 ^-^ns videt , Mens audit . _3<5$ 

Medicusdogmaticmfcimtias'mtms ~;M^»wi^|f^#rw*^^^^^*35^9 

medidn^fuhfamukncQgit.^$^ ^,^(irua JuppriTnunttir vU^^^ 

Medicorum do^atic0Tum fr^o- \ . : :/mijoU}§ms0rsim aţcendent . 

Midiciîneeejfampraxis efi. 3$6 ^Mertjum^mf^^^ 

Medidnonexlihrisfiunt..ihidem. rfiiţprejjQS^giermtm^fit . 419- 

MedicQTHminduIgentia ^adnlmo ^Mm^morti^mk&k^^* ^^id. 

ţcLg. 347 -M^nfirmpro'vniufcm^^^ 

Medicus qu^ctmque confiderat y m . . tudim iudicanda An nmiraUa 

humanicorporisvaktudiîtemdi'* - finî . . 420 

rint . 6 Menfiumfluxuscauf^.iyd.Aqui''' 

Medicus mr fepe ^egTOtos inuifere histimc ab^mdum .Md.iAn 

deheat. 14 \ pirgmtiAMcrfiimcaymm 

Medico Anneceţfaria fit Phyficafd'- ibidem. 

entia. 34 ■ M^rcurialis redarguitiirîn vfiione 

Medicus quidmutueturaFh^fico* ■ cculorum . lâS 

pag, 33 Merrcurialis notatur ajferms^ pr0 

Medicorum infdtia de fhyfidida- fiercore huhulo lulhum ejfiefcn^ 

natur. %6 Imdum. ^ 415 

Medid argumfur/jui aJiqtdd fem» Mtnfium fluxu$, ^uando eruentus 

per drca agrotos agunî . 27Z fitp^u^oţurulmtus . 42 % 


Digitized by 


I N D 

jAe^um fufpreponm t^Bm . 

Metaptojh cmjtdâratio ♦ i p5 . 

Metajîaps exfârtium art^ciofa 

Metapîum 'onguentum ^tddjît* 1 62 
Methadicifixmenjîhus meMdnam 

docâhant. 35^ 

MorUsqmhusdmominenîur. xiz:. 
jlorJi c^r^ cogniîio certum cjîm^ 

ditremedium. S^9 

Morbi non attingmdi ţrius qmm 

eorum ejjentia confHteriî . 295 
Morbi oc culţi qm nam Jmt ex Hip- 

ţocrat^* iUd. 

Morhuscufnigmtus^ , ^mdâgm* 

dum • . 52a 

Morhus cccultus leuiţharmaco ex- 

plorandus^ 5 19^. i6%r 

Morbi natura a itmantihus ^ Ix" 

dmtibus detegiţur. : 3 ^ 9 

Morbi âfortifjima caufaţrcuemen" 

tcSfforîiffimJunty^ e contra', 

pag. 25 

Morbus vU magmiseji^ > ^ 'oires 

cdehileSiipiidjît agendam. ,520 

MorbtiS vdidiorquonmdo&dânHo^ 

': f^medicamento expugtmbar^Z'j^ 

Mprbus dejperatus non aitmgen" 

dus ,■ ' '^r:, .. .^.>- •. . ..^55 , 
M<^bi omnes vlcerajlinî fecmtdum 

diquo$\ '-"^ -'- .■ 523 

MorU antî/]uî nouandi Junt vt cu^ 

rentur • - 335 

Morbus ^novetufiior^eo curaîu dif- 

' jkilior* -^^ ': ^ : ibid, 

M^rbimijmCHrMk^ : - 334 

E X; 

MorU netaiis hahmt vt amm^a ^ 

pag. ./ z^s 

Morbos jî quisantetempiis ampu-^ 

tarefiudeM^ l^iîphis qim pro* 

fu. 2p6 

MorU num A fortioribns y *vel ai 

. ntqmlibusyvd adeUlioribîiS me-* 

dicammtîs curmtur, 275 

Morboriiffi complicaimm ctiratio . 

pag, ^ 288 

MorU ah initîo curandi , eorum^uă 

caufe fcindenâ^ ^uamprimum 

fimt. 294 

Morhoriim iniţia /^notjmty 2-9 5 
Morborum cmmum nulla corporis 

pars ahfoîuti'jprinciţiumâicmda 

efl y aut finis • 6 

Morbusidem non/adem ci0*atione 

fanaturjî diuerfajk amja. ^6.2 
Morbi per confenjum qjiomodo finit 

curandi^. 25 

MorUJecundarîj qumoJh curan-- 

di . 2^7 

Morhumpr^te-r rationem mit^Jcrră 

peximum ejî . 220 

Morbus rn^bo duplicitst fUcceÂit ^ 

pag. , ; . 196 

Morbtis mm aitţr alterijucfâditj 

occidit. . -19$ 

Morbi per^ -proxmiorem part^m 

cuactiandi . 5 85 

Morbi curfepius per intemaspar-^ 

Us,fe<ie^u.i;t:prma^^pi^ per £x^ _ 

temasfidore iudicmtur. 149 
MorU aneruk: ^ aiias part^s in^ 

îerdum tr^mfinittuntur * 98 
Mojci generatio * 52 

KKK z Mofis 

Digitized by 


î N D 

mendatuTOS rims omnihusim^ 

ţojuitî ' ^y9^ 

MiiluMun^ ommum mo^hm cau-- 

Mntis ţrudemiores funî Cmu jp - 
iînti- voi^em firmanij fid nonAr" 
'fictdant • ' " 45 

Myrrh<ie natural 413- 

M*l ttotum qîdd Jtt l 407 

NArhfm-deJcnpfîO'l. 47'- 

Narium x>fus multîphx^, -48 - - 
NanbHsnonefiforamm 9 fid- q^dd; 
fţongiofum. 5>j 

Uâfo maicfias , d^cus^ ptgadtks ■ »^ 
mdoHfqrie indidum'- datumefi . 
ţ^' - : ^- :, ^48-. 

ji^afi puritas ăâ oâorandummaxî'* 

i^aSura, paHiumin- ^m cmffiat - 

ţag. ^ 3^j 

imatura in mtîmdm fartimlis 'oă'*^ 

rietatâ inUrdum ludit • -' 1^2 2 
Uatura.^d4m gâfisrat' fimtăîuf^2i^\ 

0âres • . : . I 

i^attmii!V7m ^ nmvna , 5^^^ 

Matura corpons ţrinciţiumfermo- 

nîs ir^arte medica. . " 3.2 - 

^ătur^j:i).gmtioanfitMedico mcef- 
xjtiria . v\; . .; j^ 

f^migtîQria MeMcin^' ajpmh^,. 

- ^rv- ^' -■•--• ■■•:' • -v. : S$S 

^erHorumgenustn^lm; § J. 

ţr4hmdîmtur* - '^ 

N^m flexionemtControBîbnem,^ 

âiflmtiQnem trihutmh 1 os: 

'^jmunereJ^iJuM^. . . ZOOi 

$^^iiOs cpirnatm'a^ârtQtuf^CjorpuSx 

■ ' diffeminatdt . , : .^ • , ice 

Herui ^ quammcjîcdpmr^âmmi' 

-dek/mu. . ■ ^; 

J^p^ojitm 7uniofogmm curmam^ 

K^morummorhidifficiliorMy qţidfn 

H^mijtccr fdnt f i^/cauitatmt-nşn^ 
^ hahent.:p^^'ti^untîir ah offţ^. 

' c^nfiitutiâ^ /, %em. 

l^mor^m -morhi ^uandk ad- alias 

• parSestranpnittmiîîir v.^ > \: p$^^ 
Heridmorhos cidnf4viegenms..per-' 

' peU p^j^ut ». :: ; ■ ■ , ' '.:g^ 
NermpremTintartiăiBţkr '} . : ^p 
N^morumtremor * : şp 

Nemi non funt in. fam yfed fila^^ 

Nigntîd^ratk*-. . ^ , . ; - ^ VA^^kjQh. 
î^igr^Mmmt^jquid^dmt^^^^^ i 
Nigr^în rdâ&nhdSMmd^^^ \ J opr 
^^ip'^do cur minus emtidis. i^mm 
iiuor»- i " jxr 

Mx ^JiuantiiVmtrkuli joUtium* 

fcajio quîdJtL . 55^ 


Digitized by 


î N n 

z Eippocrate* „ ' ■ ibiâ^ 

€csajiojtgnifiC:tt cmfas ţrimitiuas. 

Occafio.figrdjicat medîcămm opera* 
^ tionum opporţunos 'vŞiS . 3 7S 
Qccaflo. medicarum omnium, op^ă-* 

tionwm momenţ^rm ef- - ^0 
€)cc^o meâicin^ h^mişejiJneaq^HS, 

mfcendă tota Medici pmdenîia 
- conjijiiţ,. - },JS 

Qccăfw cuy^ţr^cepsjit* 1:4, ,55 6 
Ckuhrfimpr^flmtMi, ■ . ^ 55 
Qciilonmz. vtiliîm M fcim^s cmn- 
_ pdmndiSi .,-,.':■ '.\.'. , - %% 
Ociu^mm encomia « - ' - $ ^ 

QfuHjjmţ.ardm'ri'i^.dices <> ihid», 
Qcuhrtimvjus* - 55 

Bctdus Stur Jitimon purifjtmci* 
r -mg* ^ * SB^77- . 

^mlorum hmnores, ,61 

OcjiH ţempâmmmţumm ^^imm ,. 
r 'veîigneumfit* .^ ,/, 6z^ 

Ocidorum fplendor vnde* - 178^ 
ţ)culpmm:^mdormdtatâm por^ 
^rjendms. , .; . ţ^^* 

©4?ifo oTKnf^ opaca nocsr/d-^ \'JSb 
Qcuhrura 'aJanduU . - . . .« X 8^ 
Qcujorum fmrhivofrţ-- pcundupt 

ţartium iiarietaUm ^ . 6^ 

Qculi perfpkaciores oh a^ue^fiu* 

tţnonem» , c: - ^^-74 

Qcuîi db a^uathtîme purificantur . 

pag* iiid* 

^kliiS'd fdmp kcTpms epctema< 

E X. 

Omlormnmorh^f peoftUam Medi^ 
: cosyrifcidAcanmî. 6^ 

Oculus extingidipiT 'vhi/venuî^jiid'^ 
rint rejiccat^'f if curmjiccmUiri, 

f» ; Ol..;. - :5& 

Omlorum J[^i<>nfBm ptirgantia 

Omii fkcilş:i^03i^0îîr' a. localihus^ 

Oţulorum coIJyria îneffkac^^, pî 

plmimumi^ ^ -^ / ihi^ 

ÂbOmlis ad auriiim radicesopti^ 

Omhs fimmpmţy. ^t^cmodaju^w^ 
■^ randm. / ■ ^ H^d» 

Omloru-vksra 'otm airenfur.-i 8 1, 
Octduscm ccm^pîmckîsfiiiU ikid. 
Oculis ccepepTitdefî^^ 1^82 

Oculis mr ^uriamm T.enimjimi^^, 
j Ikcra inUrdum^ off^ranti^^^ 7§* 

Qcul&nmmorUfc^maUpa-jid na- 

ci-resdmHandamr -.^Jh 

CeiilorHi^. 'pm^comhtmrpir: ., in 
^ fîiixiQnihiSy^ cuttm . ?75^ 

Qdorjjuidfa^ .^ .43^ 


gdm' deleîtiT dfrigcre •. . 5 Q. 

Odopm ■d^^fimt pr^pti^ gensra,, 
_ ntihiHuum y ^ ah cjcd ind.ysn- 

dens:^ ' 5ţ 

Odores mitrîmentornmper acfiâens 

■ adoiţafa^mU i-;- -^^ ; Jţ* 

Odorihus fhd (wmthişfqli haminî 

datum e^şVt^ctr^hrum tucrir: 

P^T. . iO 5 2 

Digitized by 


Cur aliqmfripâi dicmtur\ $Z 

Odor conjeru^tur ah oleojis ^fin^ 

gnihis^it cur* 52 

6dor4tiorx qii^damJunty^4&~ji(xio^ 

Odorati^sJmfRjo^ dimivirâtt, 
&ma(uiimsh(msi&csir*^ $z 

âdoratiores Viole in c<muallihuSy^ 
; €ur» .-: '_ \ c% 

OdoraViora, funf mnict '^fluofts in 
" hasi^cur.-- ;■ ! - a^ 

Odoratiora p-ofertOrîtnulis pla- 
g^quamS^MtrM£isi Meri-- 

Odsratctmimis producunturjicdo* 

Odoraţa curVteropx^ua* ' 41 ^-^ 
Oă^ra. 51 
Odor^^redduntur Arhores fjî^ra 

^i£as Iritînj^rit,^ci^: 50^ 
Od^aSifmnusfloresin Aâ^to,dh 

derem kmon^ulQjîm .50^ 
OdcratimxHnatura. 410 

Odmferajylmrum fertilitate exuP 

tamSah^Feiids Arahi^e PopuHi 

^doratus vUfiaf., ^ ' 4^ 

Odorams pâximus homini efi, ^ 
^ cur. j^ 

Qdoratusnonnijtzn^randofit, & 
cur. j^ 

Odoramus inmnorî dipoHa^udm 
mdimHs. - - ^^ 

Omsntide^nptiâ^ j 2a^ 
Omoplatammratio. j j 5 

Omopîatîrfirtîfuâo^ât^ ţruâm-' 
tiaafftgtiata • 114 

Oţhtalmi^ triţlex differmtta apud 
Hippoeratem* i6y 

Opthalmitecuratio. i6j- 

Opthdmieperjpicmorvijus Jucce^ 
dit. iUd^ 

Opticormndefcriptio4 57 

Ojjîum fceletum Apollinî dicauit 

Hippocr. 102 

Oj^um do^rina Medicispemecejfa- 

"ria.. . xoz 

Oţa corpori jhhilitatem, reSitudi^ 

"i^i^ySJpmem exhihent * x o^ 

Ofjh capitis reliquorum norma funt. 

P^g^ ibidi 

Offz vnxm continuant feriem mod^ 

venarum, m^^^ 

Os ficci^imum afilinterjGccas par*' 
îes. ^y 

Ojfaexhumorepingui exufîogi^u- 

O^ciihmquodmwcetm alHip^ 
pocrate. j^ 

Os puhisA 117 

Ofpculormttrium v^inaurihus^ 
h qui$ ea repereriî. • 4^ 

OjpUlium^-' \ : ij^y 

Offor manuum eadem Juntnumerâ 
cumoQihuspedum. 121^ 

Oximel quomadojkt, ^ eius vires . 
m- 2Zt 

O^na^uomodojîat. X55 

PArs nulla ^Ppropterfiipfam 
tanthm. z 


Digitized by 


I N D E X. 

f^rs nuUaiilfoîuUpflis ejî^utprin Pes in Crurem > Tthiam p ^ mrt* 

cîpiumomniummorhorum, 6 tmimţedem âiuiâitur » xi6 

Vărs qu^lihet miro ârîificio conflm^ Fedum cjfa Jknt 1 2 o.> atque eadem 

flaefl. 2p numei^Q fimt cum o^.hus ma,^ 

Parsqu^lihet adjuam gmtilitaîem nuum - X2 1 

transfcrU 3 o Fedum multijunt articuli . 120 

Fartiumâmerjitas atqu^focutas in 

corporc humano. 2 

. FarUS:ga^dentnmtuo contacîu »>j^ 

cur;f7que difiungantur » dolcnt 

^ negre f^Ţunt \ ^6^ 

Fartes omnes perpetue in animaUs 

Icmmconjpiranţ. Z 

' Fartes omnes in famiâatum vrdtiS 

operaP^nis confirmi . 5 

FATtes omnes i^iiomoiocirciilum in-- 
terjecon0tuănt. 3 

Fartes omnes jîmtd difcriminantur 
^ augetUYy'veriim mai^resprius 
appdrentminorihus. 4 

Fericuîofo in morbo periclitări op^r- 

tă'vtcures* ^54 

Mclius eŞiuuare cumpericuioc^iam 

ahfque vîlo rrniedîQpn^remori ^ 

\pag. 255 

Fmpneummia pmgulo^or, qucmt 

Fieiiritis, " ^ 19 î 

. Feripneumonue ChT lafptudines ad- 

rueniant* itia. 

Feripneumoni^ exitiojajîgna . 2 1 Z 

Feripneumoniajine Jţuto . 258. 

Fetrus SaHus notatur in Mydropâ 

pag. i)^ 

P^fi^sgr^ecum nomen ep* 410 
FefsHS ^uidjit^ujq; diffcrctueâUi* 

Fartes qu^ Hyeme , if ^lue Vere Fe^us vide Glans . 

macu^d^. 330 FhMotQmiapurgationi-pr^tîm* 

Fartes congener es cur f mul coaffi-^ da . %6Z 

ciantur , 31 FhîebGtomandi qm jtnt > Qui pur-^ 

Fartes cur inuicem l^dnnîur • 1 5 3 gnndi . 2^9 

Fartium monftrucfa interdumva^ FhUhotomi^.aurîhus frigido morU 

rietas . I^^ hhorantihîis exitioja. 16$ 

Farte qudîbet minimă maîe affc-^ FbilQfiphiama^mîim efi JDeompz 

Ba , tciîum corpus mafe afficitun tnunus . , 5 5 

fy cur. ^-6* 30 ^Ă^ yM aptid mppocratemqnQtji^ 

Fathemata cur dicantur animi ^gri^ gnifcet .tex. 3 ^.Hh.2.păg.z^o 

tiidines. 383 Fhrhyfis ad phres annps interdum 

Fedis cummambusfmiliîudo. 120 , jxtUiturJex.^^Jihzpâg. 244 

p^ apprehendendi inflrumcnttm Fhthyficis an cmfiăcea animaţia 

quodammodo eft yeiufyue cum cmusrdant .Jhidem. 239 

mammcmparatio. 120 Fbthyfi curatio pr^fcriUtur etji 

■ ■ *" ' inctira-- 

Digitized by 


încuriMis jky %cur* tex. ^3* 

^': Uh, 2:pa^. ' : ' : ^^<$ 
'^Phthyjts Vide Tales^. 
^ Fhyfica anjit necejfarîa Medtcc*3 4 
Thyjtologla Muomoio inter Medicina 

partes sonnumerettir * g 5 

Tingtda leniunt , ^ meabikm red-- 

dun. tex. 53. lih. 2»pag. 233 
JPinguîa Tabidis inimica^ tex* 35 
' Uh.2.pag.-- 234 

Fituita furfum purgandâ ^ Bilis 

deorjum if cur* 3 29 

Vîîiiîta alha qnîd Qt \ î $ i 

FitiâtcL quomodo magnos inueHat 

iolares . 318 

Pituit^ nomine Bîppocratesfriggi-' 

dos 'omnesintelîigîî humore^ . 

F^^ 317 

Pituitop ^uand& *VJ>mere âeleant . 

f^ 32§ 

"Fituitoji cihi ^uomodo conumianf 

m-fluxifine'od pojîicas partes . 

■ tmf$.iih.2.pag. 240 

Tituitofi cihi Hydropi inter dum 

pwfunt^ ihid. 

Vhuritidis nomen cui€unque lateris 

dolori aptamt Hippocrates ,187 
Vhmitisinpuîmmefa^a . 187 
Fîeunticorumcadmeracurpulmch - 

nihus affeSa Rom^ reperian- 

fur . 185 

Fleuritis vera ah Hippocrate cogni- 

tafuit* 185 

Pleuritis^era ^uomodo generetur ^ 

ihid* 6* 223 : . \ l 

Pkuriticomm fehrispon fedanda • 

D E X^.^ . 

: PkutinMs'mBbpe ]t^ăl &,% 

'Fkuritidis cUrdtio. - 220 

Plmritiâi ăn Jlatîm fomenta cm- 

uenîănt. 22^ 

Pleuritis rar o per duî fmxum îudi^ 

catur* 220 

Pleuritis Judore îudicatd • 2 1 5 

Pleuritis Jtcca^ ^dus idea * 25^0 


Pleuritis ex Puîmonelateri ^hti^ 

năto^ ihii^ 

Pleuritis fine jputo • 25 8 

Pletmtidisficc^ctiri^ttî^* 260 

Pleiiriîicorum dolor expeBaratione 

fâdatur* 2SZ 

PlenriticQS cur nonfola potione^ fiâ 

firhitione repetat Hippocrates ^ 

tex. 31. Uv. 2. pag. 223 

Pîeuriticis acidior potio ţrodefi * 

pag. 22X 

Pleuriticispotiones copiojk, ^ptt 

pînres vices offerendk . 222 

Plinitis Hippocrati ^Medicis om* 
mbus infenjus . 28 1 

Polipus mppocratisdijcipulus aFr^ 
eeptoris dogmatihus numquam 
âifceffit^ . 3^5 

Volypus . ■ 155 

Fottisfenfim ajîîmptusâdVulr/tones 
dâlahitur •• ; 25î 

Potm :> qid non Qtientes ad potan^ 
âuminuitanty cauendi^ 21 
.Pâtiones. cur auferend^ Fleuriîids 
■ ■ innimhusfieuacuatîoohoriatur* 
tex.yi^lih.fZ.pag^ ; .'131 
Fotiomm tmitaţio- ^itum porno- 
^^na ^ .-■.... •■.^ , . V2<<'2 

Digitized by 


Praxis m^aria omnim ejî j^£^ 
ds . 35^ 

frolapfusVttiriquUfîţ. 40^ 
Frincipîum corporis nullum eţiai- 
folute yfeâ omniafimiliter frin- 
cipium i; omniafTus ^. i 

irinciţium magnum aâ quamuîs 
minifHampartemperuenit , ^i 
-contra. 2 

frincipium qmâpî > ^ ijuot modis 
dicatur^ ^ a 

principia ineffmdo cmgmha ^nf 
homim» a 

Principia Medicina triaJunU 37 
Prifiorum dogmata numquamjperr- 
nenda , tîfiinrationahilîa nohis 
jOppareanK i^^ 

Pruriîus in jfluxîoneadPuImones. 
P^i* 207 

Pruritm 'vnde ^icatur^ ihiâ. 

Puhis ojfa» jiy 

Puerper^ ^teri pr$îapju pr^dpue 
lahoranf. 4^4 

PtdmonisconJtd^atîC. î88 

Pulmonis. vjus % necejptas» li?o. 

Puhno cur faciff exftaetur. i^tf 
Pdmplerîmque in ^^^^oque îatere 

4ţfficiturif cur. 185 

PHbnoquandol^m agghttnetur^ 

ţ^g- 187.255 

Pulmomsaâlaitraţrolapfi fipkt. 

M- 25P 

Puhnoni^VîaccîM^Laimque adh^- 

rentis mratic, ^61 

puhno cacochymia tumejcms lotus 

1 x: 

Puhno cum PleurarS^hra^mU^ 
MeM^iim i; Clmdculîs ficieta^ 
Umhahet, jgg 

Puhi(yfuppiirattoms tapase pr^d- 

pu}eji.: 205 

Puhmefi'oas phhgmaUs . 260 

Puknonmn TiaZnraiisfitis , veljicd- 

^- 358 

Pulmo anjmn^urapccmjiţ^ 25P 
Pulmones 'oomituimmmur. 322 
J^uljusartmarum'vndâ. 75 

Puljus encorma» yS 

Furgantia mn nţfi in mc^a necef- 

fitateexhihenda^ 2p7 


pag. . / 305 

Purgantîa cur înterâmz frujlrenr- 

tur jîiojme. . 353 

PurgMtium 'medkammî(mim cpn^ 

troff^^aus^ . .^ 357 

P^rganteajjumpto quando ăUmm- 

torum aliqîmdaffumendsmz.^Zţ 
Purgentur cur alîqm melius aprâ^ 

Soy qurnn ante prandium. 3 83 
'Purgatk if^anmu^om db initio 

ftonconuenit. ^g^ 


Mm 2(^ 

Purgandx^uifmt^ Phkhtcma^ 

di. 25p 

Purganda fehris per pro^dmorcm 

partent. . 274 

Purgandmn nm efl xapit^mnmm 

<alefaEio, ., 3^5 

PuftuU corpori "OmMrfifuperui- 

nientes'tnm^ifer^ . 312 

Pus dp£m <onfidti4r 4^Hrfehres ^ 

Digitized by 


.dolores jm^* 

Fus nullo pPi^uîo fhkpnone fieri 

potefl. . 197-423 

l^uris ma0na copia fluShiatimimi 

inhihet in Furulentis* 305 


194 RMffiiS Ephejîus4uână0/jj0*uentl 

M' 38 

Ruţturayfiu Traiîus in camihus 

qmdfîU 344 

Ruptura a (juihusfiat . iUd^ 

Ptis ^uomoda^jJcdeheaţmSufpura^ Ruptura vnde dolor ^fihris adue 

^ tîs-* :. 205 

Fnns fiii^atioin Furuimtis.z 10 
FuTîilenH.yidâ'Supptirati m 
FîitredahMmidorumejî* $ 

Fuîrsdini adjurfatnrjiccitas* ihid. 

mat,^ d quo die^ 



yartm%a non re^g&rmda, 
pag. . 257 

SÂlfa ejculenta ,non potule^fa 
aluum hhicant, 387 

Salft irritant, ahpergunţ» iy aîU-- 
nuantJek\i2Jih.2,pag.2^ 5 : 
Saluatdl^ feBio . perueîus J^r*^- 
dium, , j^i 

dus* -2^8 

Quartan^jf cur exFhkhotimia in 

jumms tnamhxa plimtmm 

iHumtur*' ^p 

'O^artan^ ipns inîsrferm- SalmtelU feSUo ratim^ ^odam-^ 

modo caret. ^Z 

Saînatella cephaîic^ propago e^* 
• ţ^g^ ,- -- ■ ■ ^ ^Z 

SduatelU analogia cumvifceribuSf 
' pag. ^ gz 

Saluatella alia indextra^aliainji' 

rd^raefi.^ :' 9-- 93 

MlnaidU fiiîi<^ num-cognita Hip^ 

pocraîi. qq 

Sanguisdolaripcms^^»;:: . , ' ■ 3 1$ 
Şakiîms ar S::: circa qu^ vevfeturf. 
.. f^g* . . ■ -322 

^akihris: ars tranjmutatione non 

aget. ^ 323 

Sanguisextrd vajacur gnmefcat. 

i^i^ 20 z 

SanguinîsmiSîiovnde, . 81 

Şanguis proprio caloretempcratus 

eftyfed ai infiumti calidijjîmus . 

P^* 318 


RAritas corporis adfimtatm 
conducit* / =105 

Kaucedo tom exJTumiiiMfkr^am 
t exficcifate proumire pot^^,^^^ 
' R^mt^e^iudex fia-, ^. i^hli^if 

iRs^itudQvenarum inquo confinat. 

72. 83. 93.94 ^ 
ReBitvidincs 'omcirum^vH deferi^ 

hat Hippocrates. .^; 71 

Rdgorpercaputi^HidJît.: 3^5 
Rofe curfiragrantioresfunt dum m 

rmt^ifmatHtimshorii^ ,52 

Digitized by 


I- N D E X. 

Sanguzms enaamîo aunhurfri^do S^cctcramins eoufentuoa a!Ss , A 

morhlahorantibusexitiofa.i6$ cosŞdunîvir, . ^i 

Sani iriedicamentW mokflefirmf . Sicconm mcrhorum mta 'efî nihii 

P^i' 320 excemere. 255 

Smh quando^ue vtiliafuntmeâi- Signa humoris exiOaaUinFidmL 

Sanitasconftderatuf^PhiJofopho, SimiUtr^do inter ^luejtt , zi 

.& a Medico, fiddiuerjîmode, Sin^iltusin-morbispeaoris. ■217 

e ^^* - ^ BS Singultus qmd fit. ihid. 

Samrsnonep finis meScina, fid Singultus cur firepitumfadat. ihid. 

benecurare. jjj Singultusperafenfimquomodofiat 

Satietas . ^70 

Scyth^ periles oh fangmnis miffio^ 

nem in 7>misţofi aures . 8 5 
S^tiari etiam x>tiiihus malum eft. 

P^n^ 580 

Semen eflanîmatumJecHndtim Sen- 

nerîtmt. e 

^ P^'^g* ihid. 

Sinijîrapars cur âehiUâr &c Macro^ 


Sonmjpad Jk. :^ j^ 

Sontd efjkimdo qtm nue^mh r^ 

^uirantur^ iUd* 

Sonus qmtî^hxfit . : - ^j 

Semen ah omnihus partihus proce- Sonus qnDfnodoaHP^râcmca^, 
dere tmţugnatur ah Arîjhtile. pag. ^X 

P^^-^ \ 8<î Soni InfeBorum. % 

Smnndts materna a cerehromagnx Somnifera fangmni ^uiaem M. 
ex parte deciditnr. 87 rtmt^ ^ o ^ *w 

Siccitas aduerfaturputmdînu 8 Somnus^ehriorummeida. ^^ 

Siccitas qmmodo attr:d)athîimidi- 

totem. j^A 

-Sic-ca facile contîmd foluîwnem pa'- 

tiuntiţr & cur. . . i o 

Siccitatesfdubriorâsjunt^ g 

Sicciora magis feîu^tur amorUs . 

H?- • 8 

Sicciora facile recipiunf, ^ Sfficile 

Sranfnittuntyir cur. 8, 1 1 
Sicciorum morhus contHmax ejî. 

P^g* 7. II 

Spermatic<e partes MncQoi^îmtfi 
diuidantury^ cur. 6% 

^ifke defiriptio 6tdigmtas . -lop^ 

Spina cur,phmbus 0jphus4mpru- 
;^-1 * îop 

Spina dim^tw^ in Cerukem, Dar- 
fimy^ LufMhos. iUd. 

spina fumitur interdum db Hippo- 
erate pro ea tantumpart£,qu^ 
efiinDorfof^UnnUs. jop 

Skcioram^gîs^groîaiUtdolmt^ SpinaUsmekk^uxiovti^ termic 
qmmbumida^ . - 7 «^ ** ,^^ 

tlî 2 spi^ 

Digitized by 


ţore jymţăthia^ . 14 j 

Splndis înedalUlahes^Qfm^jiat*, 

iUdem . 
Spinalis^meMU^ morii 'o^rif^ 144. 
Spnalis mcâMllâ cur fmUl^^cdMMT^ 

pag^ < : ; 144 
Spinii mMIa UJk totabumana 

Spiikîhs meduila ^utius cm^fre-- 


^ âi difficultatem Jîgnijîcat apta 

Hipp^raţem^ , . ipi 

^Imîs CQnjUeratio ^ tex^ r. lih. 5 . 

Splmis-opis. ihid. 

^Im. ep aqu^pramptuariMm * i^i. 
- 247/. . . . 

%fe;2 eflfnaididcmicilmm . zS/^. 
^mfîarefcit qtdhus corpis conîa^ 

Spkn exaquds ^ mdancbolicis au^ 
^ geturJha^pag/i^ 

Spâta omnia mda ^^dolin'em non 

^ §e£cmyitmr^ 2j^ 

Spitarum'vacHitas'onde * ăid. 

SteriîiMsxu^ adumiat ^gnis poji 

awresdi^ms^ 85» 88 

Stemuţammfyimmmarhis peBorix 

mdumaex.i 2 Jii^^a pig^n z 
Strangm'ia. ab, mdsmmeî curatur ât 

Jf^ 570 

Strepîtm ţuîd fiu 45 

&uiaîfw:ikjr(m^^ss^ mr^ 

SudorjluidfiU 214 

Sudotvndeprauenîiit^ ibid^ 

Şpidor ommbm m^hi^ fcmnmnis 

ep. ZIS 

Sudareş partiakf^ ihid. 

^dares pram var^. 2 1 5 

S^dore Flmriţumddcata ^ ihid^ 
StMffufiamsraţk^ xjp 

Su^fionisimtium^ 78 

Sj^fiifiQTiiimpatia. 180 

Suffitiis d fommîct ^(tiid differaî . 

pag. ^ 410 

Superpurgationis cur atic * 312 

Vide Mypercathaps , 
Suppuratzonis natura^ XpJ 

SMppîiratia inîerdum primigmia ^ 
■ ,.mterdum.a!iQrmzmQrhoru con^ 

fitîaneaefi\ ihid^ 

SuppuraMa fdutarîspJerumqucnifi 

:mgHgaS:ur. ip^ 

Sîippuratioms varia tempera, j p 7 

SHppmtm exvlcmhus Fulmomm^ 

f^ ^ 20a 

Suppuratîo^e^vvdnmhus'.' ■ 205- 
- curlmorfiL 202 

SuppHratîQms caufie adttiagm^ra 
■- rmomntm^::., - 20^ 
^^puratiamVi^ . î^feV 'nffmîas 1 

. gmi^ma.p4gjiQ$. ipS 
^ppuratorum ex Feripne^monia 
^ Smesmagisimnunturi Immes 
/u^a ma^sexalifs. ip 5 

Su^urasi^dîcantur. IP4. ipS 
Suppuratorum 'varia figna^ 2 op 
J^uppura^nis împomm figna. 
î^g- xp& 

Digitized by 


I N D 

iuppurati ex Pleurîtidrtt Perip- 
neummianonmoriuntîir . 195 

Suppuratisîn Thoracevjtw commo^ 
dăeji. - 202 

SuppuratQTttm Vfiic-. Vide Vfiîo, 

Stippurati px Tahidis. . 2 06 

curfiequmtîor fit.î^idem* Eîus 
aliqti^ (pecies : * jgg 

Suturarum ^anarym dejcripm . 



S^^ppuraHvtnamfmtexpkrandi . Sutnrtrum ntdla diffirmtiaex f^ 

m- 208. 

, Snppuratorum dohr vnde. 2 op 
Suppuratomm tujps ^nde, iUd, 
SnţpuratQmmraucedovnde^ 210 
Suppuratis curţedes ^ gmua intu- 

mefcunt^ 2jo 

Suppuratomm extmuaîo. 211. ^a- 

mmdemjudor. iUd. 

ST^puratorum curatioaex. ^zJih 


S^puradc^bris ^fiigoris vki^- 

tudinespoHuntur. 211 

SHppuratorum 'ungues tur iuamiâ' 

^us -varietaU. 104 

Suturanmi, ntimerus 'varius, ioî* 
. Varia dus genera. ihid^ 

SpJuTaever^etres. 102 

S'^Jur^e'fpun^^ it^Xomnmnestr^. 

SutJirarumvJîiS^ 105 

Suturarum mc certus locus^nec nw 

fnertis. 104 

Suturarum maior numerus cmfert 

adfanitatmt. 105 

Sympatbi^ am^cumqns in humam 

corporâpr^dpuâ cazifaefl par- 

ttumartijicîofac<mn^i^^ j 

it^purăttscuralmsmcdefcatyăd- SympatbuerâtiQinhumm^ cm>L 

ueniatq; diarrh^a * 211 re. ^ ^ 

Suppuratomm liuor in 'vnguilus. Sympathza if confenjiis tripJid rt 

f^ir ;2i4 timeacdâit^ xj 

BuţpmatQrum vlcera in corpore • Sympathi^ ^ Anîipathi^ renmin 

ihidem. ^umuerfi. ^7 

Suppuratis caput purgdndtm eji. Symp^hicmmmorUnm curatio . 
- m.i'idib.2.pag.2^i. pag. 26 

Suppuratis cur mnum Aîdfierum ^Symp4ţhîcaaffhBiatotaefiinf^n 

pr<ebeat HippocraSe^ V ^idem 

pag. \. 233 

Şyppurati itmeneş cur minus peridi^ 
. teţttur* %g6 

Sîippirari melius ep^eifi dohrifi- 

cwn. jp7 

-Siippuratio ex cerehraUfltmoneipp 

m^ 27 

Sympathid affhBus ii diutius perje- 
tierenty ipidiopathiamtrmpnu" 
tantw\ ' ' ■ 27 



Digitized by 


r N D 

j^ Tahis ^ Sîippuratiords ^j^lrd- 

tas* 206^ Eonmdem redţroj:^ 

generatio. '■ Zo% 

Tah^s k fluxîone .ad Ftiltnones . 

paa, 206 

Tabes âjpin^^^iimedulla , 144 

Tahis dwrpdh 'Oârîx Sffermxi^ . 

pag, 145 


T^es dorjalis cwr Jicatur ocmita • 

pag. 146, 

Tahs ex fluxione^rttrorfîmt- quo\ 

moda curanda . text. 37. M, 2. 

fag. . . 242 

Tahîdos 'VcmitupHfgat Hippccrates 

^ c^r interScanir mApharip 

mis, 352 

TaUdis ătâm ex^ccătis ^mfmhm 

cnipacea animalul comiemtmt» 

Taiidis Viimm Juhmfienmt ^e*. 

TaHi^rum curatioJext.^^.uL 2. 

In ^10 differasâ cura Furukn^ 

tcnrum, 23 j 

Tahidisţm^ia ^ amainimka^, 

ToMdorumm^iiS plemorjk. text^ 

5 iM.'i.fag,^^ ^.Aqmfim vi- 

nrnn ys ojfsrend. ■ ^ ^id. 
rSes, YiieThthyjis. 
Taiîus cur- datus Animantîhus . 

pag. ^66 

E x; 

Ta^.s' pr^îpuedohr ip . ilîâ. 
Tafluscur fertotum corpus diffu* 

fiisfîi.- 155^ 

Temportim YefLt y feu Arterî^ cur 

perp^îuQfulfmţfectmdum Hip-r 

pocraiem, 75 

^ThoraxVQmituimiaîîir . 542 

Thoracicamm. partium* morhi ^ 

jJuxione^ VideBltmo. 
Tiiie confideraticf. lîp 

Tâph{>rum gmerătiă in m^iadis ^ 

pag. 124 

Tra&iori^i^ pm-iesjmt apî^. tcxm 

Tradus m car/iihis ^îid ft* Vid& 

TtmiefaBiOi&fwmdBmmd attra^ 

Bioidem e^ opudHippotratcm . 

K^ v33â 

Tuips ab,40denj excitări^ ^xurari 

piŞ. 370 

VÂcukm qîimiaia JjtpTJmum 
auditus iftjirmvmtum:'' ■ 45 
Vmanmin:tt2iră qtmmcdo ,c-onJ^aî 
. inhutmdo^ ,95 

Venanmi fi^aatesm quo am0aS 
fioindum Hippacvătem, P4 
Ven^e qucmodo inter fi communi" 
tmt. .^ . ^ : -^ 

VmarumreBitudo in quomnffiat . 

Vmarum commenîaria ah Hippch 
erate cmfiripta vfip^e d Galeni 

Digitized by 



Venofm aen^is curvemfi ma:dme Vm^ axillans dejcrîpîio. 8 g 

Vmarum morii Î4^iores /jtiam qtsi 

confenjiat^ x6 

VeVeniiJn-plici ordine egiţHippO' 

crates* "70 

Vmanitn Jimplex ^^vera hijicri^ 

^Udefirihatur^ ihid. 

Venamm rcBitudines ifconfsnfas 

^li defirihat Hiţfpcr.y i . huius 

defcriţrio pr<£ omnihus 'uîili^- 

ah Hippocrate. 72 

Vmasâ Cordâ'prcfcifdab Hippo- 
erate didiceraî Arifmelcs. 7 1 

Vmuirum nomineArteriof^iam ^ 
Neruos dejignarunt vetufliffifm 



Verue caii^ afcendenîis defcriptio , 

ţ^g* 73- 7P 

Yem^fro^iş^ 7^ 

Ven^phiresjuntjiipra, quaminjrâ. 

VetidC SpiritumyFkxum^if Motum 

corpori trihuunu • ^ lo2' 

Ven:!e tcmporum cur oculos primat. 

Ven^fecundum aures. pfQ fierili" 
tateminductmt. ' ■ 8 2' 

Venarum reSUtudo ^ maJogiaMe* 
ddcîs pr^dpue nofcenda* 85 

Vena. eîigenda in *z)JiimihMs ,^^%, 
Cur x^rantHT. 347. Bamm x>rfdi 
raîio* J45 

Vm^ ocîilorum fi exficcenturyocu" 
lus exHngtdtur^^curexficeen^ 
tur. 58 

aNeruis. 7-8»94 

Venter naturdis aeconomi^e prm* 
ceps * 20 

Venferc/^nti » Capîa veniri ^car^ 
sdbm Juas affe^iones impertitur 
pag. ^ îS 

Ventnsi?nportumtas. 22 

Venter cum ege^Honem moderafam 
ncn fecerit,qîtidcQnîing^ . 19V 
Venîncuhis pîur^ariam iudpitur 
ah Hippocrate. 18 

VenîriciilusCapitic^îrTTîăXîfne con-- 
Jmjmt. iS 

AVenîrictilo cmnes capitis affe^io 
nes. ip 

Ventr^'culus nonppmno 'exhazirien- 
cihns. 2j 

Ymtricidi^ar*^ affeSîus €X intern" 
. perantia. 22 

V.entrictîhîsxdt^ Charyidis^dator^; 
■ omnis mcmiditaîîsp^imocvmM' 
. tatis* ' za 

Ven^CîikiS (iio îatratu Cjeterarum 
• ţarWim inâigmti^wi indicat. 21 
Arîis i; Ifi0n^ largtî^ ^jî, 
Ventricuhs moemim fi^eo if hn^ 
mido ţ^mnptuamdm imtcd ai 
. maris injiar dat ommbm ^ f^- 
dpit^h cmniips* 20 

Yentricidijliixio d cerelro, tex.^^* 
. Uh.2.pag.2^6 


Digitized by 


^^n^ncîM-^umtis filat • 

VertkuU.aŞpbira, Şyfmdora 

'^^tehrammproceffjis. iio 

ViBus ratio m^tiofr^estpue ton-- 
fiM: .20 

VilîHS acutommtriţlex.. 324 
ViSîus ratio A^tati. , Tempori ^ 
• Temperammîo cmumiens fity 
^ M>:od non nijt â finju indicatur . 

VioU cur cdovotzores vmh'ojtstn 

■ . contidlihus ohort^t. 52 

ViniâoUs, . 31? 

' yimmJkhaufieif*Hm$uppuratis & 
^Tahidiscomienit^ iUâ* 

%mîm chokricos gi£nit ajfcBtts *• 

nmMţotentiuscalorefn vmmînuit. 

fag. ; 39^ 

Vmoft mratw^ 31 > 

Virium ratio ^âipiitas* 2^6 

• Vires quomodo ad auxily