.CD
A HISTORY
INDIAN PHILOSOPHY
May He, who links the minds of all people,
through the apertures of time, with new threads
of knowledge like a garland of flowers, be pleased
to accept this my thread of Eastern thought, offered,
though it be small, with the greatest devotion.
A HISTORY
OF
INDIAN PHILOSOPHY
BY
SURENDRANATH DASGUPTA, M.A., Ph.D.,
VOLUME I
CAMBRIDGE
AT THE UNIVERSITY PRESS
1957
PUBLISHED BY
THE SYNDICS OF THE CAMBRIDGE UNIVERSITY PRESS
London Office: Bentley House, N.W.I
First Printed 1922
Reprinted 1932
1951
1957
MAY 2 3 f95S
Printed in Great Britain at the University Press, Cartridge
Reprinted by offset-litho
by Percy Lund Humphries & Co. Ltd.
DEDICATION
The work and ambition of a life-time is herein humbly
dedicated with supreme reverence to the great sages
of India, who, for the first time in history, formulated
the true principles of freedom and devoted themselves
to the holy quest of truth and the final assessment
and discovery of the ultimate spiritual essence of
man through their concrete lives, critical thought,
dominant will and self-denial.
NOTE ON THE PRONUNCIATION OF
TRANSLITERATED SANSKRIT
AND PALI WORDS
The vowels are pronounced almost in the same way
as in Italian, except that the sound of a approaches
that of o in bond or u in but, and a that of a as in army.
The consonants are as in English, except c, ch in church ;
/, d, n are cerebrals, to which English t, d, n almost
correspond; t, d, n are pure dentals; kk, gh, ch, jh,
tk, dh, th, dh, ph, bh are the simple sounds plus an
aspiration ; n is the French gn ; r is usually pronounced
as n, and s, f as sk.
PREFACE
T~" N HE old civilisation of India was a concrete unity of many-
J. sided developments in art, architecture, literature, religion,
morals, and science so far as it was understood in those days.
But the most important achievement of Indian thought was
philosophy. It was regarded as the goal of all the highest
practical and theoretical activities, and it indicated the point of
unity amidst all the apparent diversities which the complex
growth of culture over a vast area inhabited by different peoples
produced. It is not in the history of foreign invasions, in the
rise of independent kingdoms at different times, in the empires
of this or that great monarch that the unity of India is to be
sought. It is essentially one of spiritual aspirations and obedience
to the law of the spirit, which were regarded as superior to every
thing else, and it has outlived all the political changes through
which India passed.
The Greeks, the Huns, the Scythians, the Pathans and the
Moguls who occupied the land and controlled the political
machinery never ruled the minds of the people, for these political
events were like hurricanes or the changes of season, mere
phenomena of a natural or physical order which never affected
the spiritual integrity of Hindu culture. If after a passivity of
some centuries India is again going to become creative it is
mainly on account of this fundamental unity of her progress and
civilisation and not for anything that she may borrow from other
countries. It is therefore indispensably necessary for all those
who wish to appreciate the significance and potentialities of
Indian culture that they should properly understand the history
of Indian philosophical thought which is the nucleus round
which all that is best and highest in India has grown. Much harm
has already been done by the circulation of opinions that the
culture and philosophy of India was dreamy and abstract. It is
therefore very necessary that Indians as well as other peoples
should become more and more acquainted with the true charac
teristics of the past history of Indian thought and form a correct
estimate of its special features.
But it is not only for the sake of the right understanding of
viii Preface
India that Indian philosophy should be read, or only as a record
of the past thoughts of India. For most of the problems that
are still debated in modern philosophical thought occurred in
more or less divergent forms to the philosophers of India. Their
discussions, difficulties and solutions when properly grasped in
connection with the problems of our own times may throw light
on the course of the process of the future reconstruction of modern
thought. The discovery of the important features of Indian
philosophical thought, and a due appreciation of their full signi
ficance, may turn out to be as important to modern philosophy
as the discovery of Sanskrit has been to the investigation of
modern philological researches. It is unfortunate that the task
of re-interpretation and re-valuation of Indian thought has not
yet been undertaken on a comprehensive scale. Sanskritists
also with very few exceptions have neglected this important
field of study, for most of these scholars have been interested
more in mythology, philology, and history than in philosophy.
Much work however has already been done in the way of the
publication of a large number of important texts, and translations
of some of them have also been attempted. But owing to the
presence of many technical terms in advanced Sanskrit philo
sophical literature, the translations in most cases are hardly in
telligible to those who are not familiar with the texts themselves.
A work containing some general account of the mutual rela
tions of the chief systems is necessary for those who intend to
pursue the study of a particular school. This is also necessary
for lay readers interested in philosophy and students of Western
philosophy who have no inclination or time to specialise in any
Indian system, but who are at the same time interested to know
what they can about Indian philosophy. In my two books The
Study of Patanjali and Yoga Philosophy in relation to other Indian
Systems of Thought I have attempted to interpret the Samkhya
and Yoga systems both from their inner point of view and from
the point of view of their relation to other Indian systems. The
present attempt deals with the important features of these as also
of all the other systems and seeks to show some of their inner
philosophical relations especially in regard to the history of their
development. I have tried to be as faithful to the original texts
as I could and have always given the Sanskrit or Pali technical
terms for the help of those who want to make this book a guide
Preface ix
for further study. To understand something of these terms is
indeed essential for anyone who wishes to be sure that he is
following the actual course of the thoughts.
In Sanskrit treatises the style of argument and methods of
treating the different topics are altogether different from what
we find in any modern work of philosophy. Materials had there
fore to be collected from a large number of works on each system
and these have been knit together and given a shape which
is likely to be more intelligible to people unacquainted with
Sanskritic ways of thought. But at the same time I considered
it quite undesirable to put any pressure on Indian thoughts in
order to make them appear as European. This will explain
much of what might appear quaint to a European reader. But
while keeping all the thoughts and expressions of the Indian
thinkers I have tried to arrange them in a systematic whole in a
manner which appeared to me strictly faithful to their clear
indications and suggestions. It is only in very few places that I
have translated some of the Indian terms by terms of English
philosophy, and this I did because it appeared to me that those
were approximately the nearest approach to the Indian sense of
the term. In all other places I have tried to choose words which
have not been made dangerous by the acquirement of technical
senses. This however is difficult, for the words which are used in
philosophy always acquire some sort of technical sense. I would
therefore request my readers to take those words in an unsophisti
cated sense and associate them with such meanings as are
justified by the passages and contexts in which they are used.
Some of what will appear as obscure in any system may I hope be
removed if it is re-read with care and attention, for unfamiliarity
sometimes stands in the way of right comprehension. But I
may have also missed giving the proper suggestive links in
many places where condensation was inevitable and the systems
themselves have also sometimes insoluble difficulties, for no
system of philosophy is without its dark and uncomfortable
corners.
Though I have begun my work from the Vedic and Brah-
manic stage, my treatment of this period has been very slight.
The beginnings of the evolution of philosophical thought, though
they can be traced in the later Vedic hymns, are neither connected
nor systematic.
x Preface
More is found in the Brahmanas, but I do not think it worth
while to elaborate the broken shreds of thought of this epoch.
I could have dealt with the Upanisad period more fully, but
many works on the subject have already been published in
Europe and those who wish to go into details will certainly go
to them. I have therefore limited myself to the dominant current
flowing through the earlier Upanisads. Notices of other currents
of thought will be given in connection with the treatment of other
systems in the second volume with which they are more intimately
connected. It will be noticed that my treatment of early Bud
dhism is in some places of an inconclusive character. This is
largely due to the inconclusive character of the texts which were
put into writing long after Buddha in the form of dialogues and
where the precision and directness required in philosophy were
not contemplated. This has given rise to a number of theories
about the interpretations of the philosophical problems of early
Buddhism among modern Buddhist scholars and it is not always
easy to decide one way or the other without running the risk of
being dogmatic ; and the scope of my work was also too limited
to allow me to indulge in very elaborate discussions of textual
difficulties. But still I also have in many places formed theories
of my own, whether they are right or wrong it will be for scholars
to judge. I had no space for entering into any polemic, but it
will be found that my interpretations of the systems are different
in some cases from those offered by some European scholars who
have worked on them and I leave it to those who are acquainted
with the literature of the subject to decide which of us may be
in the right. I have not dealt elaborately with the new school of
Logic (Navya-Nyaya) of Bengal, for the simple reason that most
of the contributions of this school consist in the invention of
technical expressions and the emphasis put on the necessity of
strict exactitude and absolute preciseness of logical definitions
and discussions and these are almost untranslatable in intelligible
English. I have however incorporated what important differences
of philosophical points of view I could find in it. Discussions of
a purely technical character could not be very fruitful in a work
like this. The bibliography given of the different Indian systems
in the last six chapters is not exhaustive but consists mostly of
books which have been actually studied or consulted in the
writing of those chapters. Exact references to the pages of the
Preface xi
texts have generally been given in footnotes in those cases where
a difference of interpretation was anticipated or where it was felt
that a reference to the text would make the matter clearer, or
where the opinions of modern writers have been incorporated.
It gives me the greatest pleasure to acknowledge my deepest
gratefulness to the Hon ble Maharaja Sir Manindrachandra
Nundy, K.C.I. E. Kashimbazar, Bengal, who has kindly promised
to bear the entire expense of the publication of both volumes
of the present work.
The name of this noble man is almost a household word in
Bengal for the magnanimous gifts that he has made to educational
and other causes. Up till now he has made a total gift of about
.300,000, of which those devoted to education come to about
200,000. But the man himself is far above the gifts he has
made. His sterling character, universal sympathy and friendship,
his kindness and amiability make him a veritable Bodhisattva
one of the noblest of men that I have ever seen. Like many
other scholars of Bengal, I am deeply indebted to him for the
encouragement that he has given me in the pursuit of my studies
and researches, and my feelings of attachment and gratefulness
for him are too deep for utterance.
I am much indebted to my esteemed friends Dr E. J. Thomas
of the Cambridge University Library and Mr Douglas Ainslie
for their kindly revising the proofs of this work, in the course
of which they improved my English in many places. To the
former I am also indebted for his attention to the translitera
tion of a large number of Sanskrit words, and also for the
whole-hearted sympathy and great friendliness with which he
assisted me with his advice on many points of detail, in par
ticular the exposition of the Buddhist doctrine of the cause of
rebirth owes something of its treatment to repeated discussions
with him.
I also wish to express my gratefulness to my friend Mr
N. K. Siddhanta, M.A., late of the Scottish Churches College, and
Mademoiselle Paule Povie for the kind assistance they have
rendered in preparing the index. My obligations are also due to
the Syndics of the Cambridge University Press for the honour
they have done me in publishing this work.
To scholars of Indian philosophy who may do me the honour
of reading my book and who may be impressed with its inevit-
xii Preface
able shortcomings and defects, I can only pray in the words of
Hemacandra:
Pramdnasiddhantaviruddham atra
Yatkincidnktam matimdndyadosdt
Mdtsaryyam ntsdryya taddryyacittdh
Prasddam ddhdya visodhayantu^.
S.D.
TRINITV COLLEGE,
CAMBRIDGE.
February, 1922.
1 May the noble-minded scholars instead of cherishing ill feeling kindly correct
whatever errors have been here committed through the dullness of my intellect in the
way of wrong interpretations and misstat ements.
CONTENTS
CHAPTER I
INTRODUCTORY z
CHAPTER II
THE VEDAS, BRAHMANAS AND THEIR PHILOSOPHY
1 The Vedas and their antiquity 10
2 The place of the Vedas in the Hindu mind 10
3 Classification of the Vedic literature 1 1
4 The Samhitas 12
5 The Brahmanas 13
6 The Aranyakas .14
7 The Rg-Veda, its civilization 14
8 The Vedic gods 16
9 Polytheism, Henotheism, and Monotheism 17
10 Growth of a Monotheistic tendency ; Prajapati, Visvakarma . . 19
11 Brahma 20
12 Sacrifice ; the First Rudiments of the Law of Karma . . .21
13 Cosmogony Mythological and_ Philosophical 23
14 Eschatology; the Doctrine of Atman 25
15 Conclusion .26
CHAPTER III ~
THE EARLIER UPANISADS (700 B.C. 600 B.C.)
1 The place of the Upanisads in Vedic literature .... 28
2 The names of the Upanisads; Non-Brahmanic influence . . 30
3 Brahmanas and the Early Upanisads 31
4 The meaning of the word Upanisad 38
5 The composition and growth of diverse Upanisads .... 38
6 Revival of Upanisad studies in modern times 39
7 The Upanisads and their interpretations 41
8 The quest after Brahman : the struggle and the failures . .42
9 Unknowability of Brahman and the Negative Method ... 44
10 The Atman doctrine 45
1 1 Place of Brahman in the Upanisads 48
12 The World 51
13 The World-Soul 52
14 The Theory of Causation 52
15 Doctrine of Transmigration 53
16 Emancipation 58
CHAPTER IV
GENERAL OBSERVATIONS ON THE SYSTEMS
OF INDIAN PHILOSOPHY
i In what sense is a History of Indian Philosophy possible? 62
2 Growth of the Philosophic Literature
3 The Indian systems of Philosophy .
4 Some fundamental points of agreement
1 The Karma theory
2 The Doctrine of Mukti
3 The Doctrine of Soul .
65
67
74
75
5 The Pessimistic Attitude towards the World and the Optimistic
Faith in the end 75
6 Unity in Indian Sadhana (philosophical, religious and ethical
endeavours) 77
xiv Contents
CHAPTER V
BUDDHIST PHILOSOPHY
PAGE
1 The State of Philosophy in India before Buddha .... 78
2 Buddha: his Life .......... 81
3 Early Buddhist Literature . . . ... . . .82
4 The Doctrine of Causal Connection of early Buddhism ... 84
5 The Khandhas 93
6 Avijja and Asava .......... 99
7 Slla and Samadhi 100
8 Kamma 106
9 Upanisads and Buddhism 109
10 The Schools of Theravada Buddhism .112
11 Mahayanism 125
12 The Tathata Philosophy of Asvaghosa (80 A.D.) . . . .129
13 The Madhyamika or the Sunyavada school Nihilism . . .138
14 Uncompromising Idealism or the School of Vijnanavada Buddhism 145
1 5 Sautrantika theory of Perception 151
16 Sautrantika theory of Inference 155
17 The Doctrine of Momentariness 158
1 8 The Doctrine of Momentariness and the Doctrine of Causal
Efficiency (Arthakriyakaritva) . . . . . . . .163
19 Some Ontological Problems on which the Different Indian Systems
diverged 164
20 Brief Survey of the Evolution of Buddhist Thought . . .166
CHAPTER VI
THE JAINA PHILOSOPHY
1 The Origin of Jainism . . .
2 Two Sects of Jainism
3 The Canonical and other Literature of the Jains
4 Some General Characteristics of the Jains
5 Life of Mahavira
6 The Fundamental Ideas of Jaina Ontology
7 The Doctrine of Relative Pluralism (Anekantavada)
8 The Doctrine of Nayas
9 The Doctrine of Syadvada
to Knowledge, its value for us
1 1 Theory of Perception
12 Non-Perceptual knowledge
13 Knowledge as Revelation
. 169
. 170
i?i
. 172
i?3
173
175
. 176
179
. 181
3
. 185
. 186
14 The Jivas 188
15 Karma Theory 190
16 Karma, Asrava and Nirjara .192
17 Pudgala 195
1 8 Dharma, Adharma, Akasa 197
19 Kala and Samaya 198
20 Jaina Cosmography 199
21 Jaina Yoga 199
22 Jaina Atheism 203
23 Moksa (emancipation) 207
Contents xv
CHAPTER VII
THE KAPILA AND THE PATANJALA SAMKHYA (YOGA)
PAGE
1 A Review 208
2 The Germs of Samkhya in the Upanisads 211
3 Samkhya and Yoga Literature 212
4 An Early School of Samkhya . 213
5 Samkhya karika, Samkhya sutra, Vacaspati Misra and Vijnana
Bhiksu 222
6 Yoga and Patanjali 226
7 The Samkhya and the Yoga doctrine of Soul or Purusa . . . 238
8 Thought and Matter 241
9 Feelings, the Ultimate Substances 242
10 The Gunas 243
11 Prakrti and its evolution 245
1 2 Pralaya and the disturbance of the Prakrti Equilibrium . . . 247
13 Mahat and Ahamkara . . . 248
14 The Tanmatras and the Paramanus . . . . , .251
15 Principle of Causation and Conservation of Energy . . . 254
16 Change as the formation of new collocations 255
17 Causation as Satkaryavada (the theory that the effect potentially
exists before it is generated by the movement of the cause) . . 257
1 8 Samkhya Atheism and Yoga Theism 258
19 Buddhi and Purusa 259
20 The Cognitive Process and some characteristics of Citta . .261
21 Sorrow and its Dissolution 264
22 Citta 268
23 Yoga Purificatory Practices (Parikarma) 270
24 The Yoga Meditation 271
CHAPTER VIII
THE NYAYA- VAISESIKA PHILOSOPHY
1 Criticism of Buddhism and Samkhya from the Nyaya standpoint . 274
2 Nyaya and Vaisesika sutras 276
3 Does Vaisesika represent an old school of Mimamsa ? . . . 280
4 Philosophy in the Vaisesika sutras . . . * . . . . 285
5 Philosophy in the Nyaya sutras 294
6 Philosophy of Nyaya sutras and Vaisesika sutras . . . .301
7 The Vaisesika and Nyaya Literature 305
8 The main doctrine of the Nyaya- Vaisesika Philosophy . . . 310
9 The six Padarthas : Dravya, Guna, Karma, Samanya, ViSesa, Sama- 313
vaya 313
10 The Theory of Causation 319
1 1 Dissolution (Pralaya) and Creation (Srsti) 323
12 Proof of the Existence of Is* vara 325
13 The Nyaya- Vaisesika Physics 326
14 The Origin of Knowledge (Pramana) 330
1 5 The four Pramanas of Nyaya 332
1 6 Perception (Pratyaksa) 333
17 Inference 343
1 8 Upamana and Sabda 354
19 Negation in Nyaya-Vai5eika 355
20 The necessity of the Acquirement of debating devices for the seeker
of Salvation ........... 360
2 1 The Doctrine of Soul 362
22 Is" vara and Salvation 363
xvi Contents
CHAPTER IX
MlMAMSA PHILOSOPHY
PAGE
1 A Comparative Review 367
2 The Mlmamsa Literature . . 369
3 The Paratah-pramanya doctrine of Nyaya and the Svatah-pramanya
doctrine of Mlmamsa 372
4 The place of Sense-organs in Perception 375
5 Indeterminate and Determinate Perception 378
6 Some Ontological Problems connected with the Doctrine of Per
ception 379
7 The Nature of Knowledge 382
8 The Psychology of Illusion 384
9 Inference 387
10 Upamana, Arthapatti 391
11 Sabda-pramana 394
12 The Pramana of Non-perception (anupalabdhi) .... 397
13 Self, Salvation, and God 399
14 Mimamsa as Philosophy and Mlmamsa. as Ritualism . . . 403
CHAPTER X
THE SANKARA SCHOOL OF VEDANTA
1 Comprehension of the Philosophical Issues more essential than the
Dialectic of Controversy 406
2 The philosophical situation : a Review 408
3 Vedanta Literature 418
4 Vedanta in Ga.udapa.da 420
5 Vedanta and Sankara (788 820 A.D.) 429
6 The main idea of the Vedanta philosophy .... 439
7 In what sense is the world-appearance false? .... 443
8 The nature of the world-appearance, phenomena . . . 445
9 The Definition of Ajnana (nescience) ..... 452
10 Ajnana established by Perception and Inference . . . 454
11 Locus and Object of Ajnana, Ahamkara and Antahkarana . 457
12 Anirvacyavada and the Vedanta dialectic . 461
13 The Theory of Causation 465
14 Vedanta theory of Perception and Inference .... 470
15 Atman, Jlva, Isvara, Ekajlvavada and Drstisrstivada . . 474
16 Vedanta theory of Illusion . 485
17 Vedanta Ethics and Vedanta Emancipation .... 489
1 8 Vedanta and other Indian systems 492
INDEX 495
CHAPTER I
INTRODUCTORY
THE achievements of the ancient Indians in the field of philosophy
are but very imperfectly known to the world at large, and it is
unfortunate that the condition is no better even in India. There
is a small body of Hindu scholars and ascetics living a retired
life in solitude, who are well acquainted with the subject, but they
do not .know English and are not used to modern ways of thinking,
and the idea that they ought to write books in vernaculars in
order to popularize the subject does not appeal to them. Through
the activity of various learned bodies and private individuals both
in Europe and in India large numbers of philosophical works in
Sanskrit and Pali have been published, as well as translations of
a few of them, but there has been as yet little systematic attempt
on the part of scholars to study them and judge their value. There
are hundreds of Sanskrit works on most of the systems of Indian
thought and scarcely a hundredth part of them has been trans
lated. Indian modes "of expression, entailing difficult technical
philosophical terms are so different from those of European
thought, that they can hardly ever be accurately translated. It
is therefore very difficult for a person unacquainted with Sanskrit
to understand Indian philosophical thought in its true bearing
from translations. Pali is a much easier language than Sanskrit,
but a knowledge of Pali is helpful in understanding only the
earliest school of Buddhism, when it was in its semi-philosophical
stage. Sanskrit is generally regarded as a difficult language. But
no one from an acquaintance with Vedic or ordinary literary
Sanskrit can have any idea of the difficulty of the logical and
abstruse parts of Sanskrit philosophical literature. A man who
can easily understand the Vedas, the Upanisads, the Puranas, the
Law Books and the literary works, and is also well acquainted with
European philosophical thought, may find it literally impossible
to understand even small portions of a work of advanced Indian
logic, or the dialectical Vedanta. This is due to two reasons, the
use of technical terms and of great condensation in expression,
and the hidden allusions to doctrines of other systems. The
D. I
2 Introductory [CH.
tendency to conceiving philosophical problems in a clear and un
ambiguous manner is an important feature of Sanskrit thought.but
from the ninth century onwards, the habit of using clear, definite,
and precise expressions, began to develop in a very striking manner,
and as a result of that a large number of technical terms began to be
invented. These terms are seldom properly explained, and it is
presupposed that the reader who wants to read the works should
have a knowledge of them. Any one in olden times who took to the
study of any system of philosophy, had to do so with a teacher, who
explained those terms to him. The teacher himself had got it from
his teacher, and he from his. There was no tendency to popularize
philosophy, for the idea then prevalent was that only the chosen
few who had otherwise shown their fitness, deserved to become
fit students (adhikdrt) of philosophy, under the direction of a
teacher. Only those who had the grit and high moral strength
to devote their whole life to the true understanding of philosophy
and the rebuilding of life in accordance with the high truths of
philosophy were allowed to study it.
Another difficulty which a beginner will meet is this, that
sometimes the same technical terms are used in extremely
different senses in different systems. The student must know the
meaning of each technical term with reference to the system in
which it occurs, and no dictionary will enlighten him much about
the matter 1 . He will have to pick them up as he advances and
finds them used. Allusions to the doctrines of other systems and
their refutations during the discussions of similar doctrines in any
particular system of thought are often very puzzling even to a
well-equipped reader; for he cannot be expected to know all the
doctrines of other systems without going through them, and so
it often becomes difficult to follow the series of answers and
refutations which are poured forth in the course of these discus
sions. There are two important compendiums in Sanskrit giving
a summary of some of the principal systems of Indian thought,
viz. the Sarvadarsanasamgraha, and the Saddarsanasamuccaya of
Haribhadra with the commentary of Gunaratna; but the former is
very sketchy and can throw very little light on the understanding
of the ontological or epistemological doctrines of any of the
systems. It has been translated by Cowell and Gough, but I
1 Recently a very able Sanskrit dictionary of technical philosophical terms called
Nyayakoda has been prepared by M. M. Bhimacarya Jhalkikar, Bombay, Govt. Press.
i] Introductory 3
am afraid the translation may not be found very intelligible.
Gunaratna s commentary isexcellentso faras Jainism is concerned,
and it sometimes gives interesting information about other
systems, and also supplies us with some short bibliographical
notices, but it seldom goes on to explain the epistemological or
ontological doctrines or discussions which are so necessary for the
right understanding of any of the advanced systems of Indian
thought. Thus in the absence of a book which could give us in
brief the main epistemological, ontological, and psychological
positions of the Indian thinkers, it is difficult even for a good
Sanskrit scholar to follow the advanced philosophical literature,
even though he may be acquainted with many of the technical
philosophical terms. I have spoken enough about the difficulties
of studying Indian philosophy, but if once a person can get him
self used to the technical terms and the general positions of the
different Indian thinkers and their modes of expression, he can
master the whole by patient toil. The technical terms, which are
a source of difficulty at the beginning, are of inestimable value in
helping us to understand the precise and definite meaning of the
writers who used them, and the chances of misinterpreting or
misunderstanding them are reduced to a minimum. It is I think
well-known that avoidance of technical terms has often rendered
philosophical works unduly verbose, and liable to misinterpre
tation. The art of clear writing is indeed a rare virtue and every
philosopher cannot expect to have it. But when technical ex
pressions are properly formed, even a bad writer can make himself
understood. In the early days of Buddhist philosophy in the
Pali literature, this difficulty is greatly felt. There are some
technical terms here which are still very elastic and their repeti
tion in different places in more or less different senses heighten
the difficulty of understanding the real meaning intended to be
conveyed.
But is it necessary that a history of Indian philosophy should
be written? There are some people who think that the Indians
never rose beyond the stage of simple faith and that therefore they
cannot have any philosophy at all in the proper sense of the term.
Thus Professor Frank Thilly of the Cornell University says in
his History of Philosophy 1 ^ 1 h. universal history of philosophy would
include the philosophies of all peoples. Not all peoples, however
1 New York, 1914, p. 3.
I 2
4 Introductory [CH.
have produced real systems of thought, and the speculations of
only a few can be said to have had a history. Many do not rise
beyond the mythological stage. Even the theories of Oriental
peoples, the Hindus, Egyptians, Chinese, consist, in the main, of
mythological and ethical doctrines, and are not thoroughgoing
systems of thought: they are shot through with poetry and faith.
We shall, therefore, limit ourselves to the study of the Western
countries, and begin with the philosophy of the ancient Greeks,
on whose culture our own civilization in part, rests." There are
doubtless many other people who hold such uninformed and
untrue beliefs, which only show their ignorance of Indian matters.
It is not necessary to say anything in order to refute these views,
for what follows will I hope show the falsity of their beliefs. If
they are not satisfied, and want to know more definitely and
elaborately about the contents of the different systems, I am afraid
they will have to go to the originals referred to in the biblio
graphical notices of the chapters.
There is another opinion, that the time has not yet come for
an attempt to write a history of Indian philosophy. Two
different reasons are given from two different points of view. It
is said that the field of Indian philosophy is so vast, and such a
vast literature exists on each of the systems, that it is not possible
for anyone to collect his materials directly from the original
sources, before separate accounts are prepared by specialists
working in each of the particular systems. There is some truth
in this objection, but although in some of the important systems
the literature that exists is exceedingly vast, yet many of them
are more or less repetitions of the same subjects, and a judicious
selection of twenty or thirty important works on each of the
systems could certainly be made, which would give a fairly correct
exposition. In my own undertaking in this direction I have
always drawn directly from the original texts, and have always
tried to collect my materials from those sources in which they
appear at their best. My space has been very limited and I have
chosen the features which appeared to me to be the most
important. I had to leave out many discussions of difficult
problems and diverse important bearings of each of the systems
to many interesting aspects of philosophy. This I hope may be
excused in a history of philosophy which does not aim at com
pleteness. There are indeed many defects and shortcomings, and
i] Introductory 5
these would have been much less in the case of a writer abler
than the present one. At any rate it may be hoped that the
imperfections of the present attempt will be a stimulus to those
whose better and more competent efforts will supersede it. No
attempt ought to be called impossible on account of its imper
fections.
In the second place it is said that the Indians had no proper
and accurate historical records and biographies and it is therefore
impossible to write a history of Indian philosophy. This objection
is also partially valid. But this defect does not affect us so much
as one would at first sight suppose; for, though the dates of the
earlier beginnings are very obscure, yet, in later times, we are in
a position to affirm some dates and to point out priority and
posteriority in the case of other thinkers. As most of the systems
developed side by side through many centuries their mutual
relations also developed, and these could be well observed. The
special nature of this development has been touched on in the
fourth chapter. Most of the systems had very early beginnings
and a continuous course of development through the succeeding
centuries, and it is not possible to take the state of the philosophy
of a particular system at a particular time and contrast it with
the state of that system at a later time; for the later state did not
supersede the previous state, but only showed a more coherent
form of it, which was generally true to the original system but
was more determinate. Evolution through history has in Western
countries often brought forth the development of more coherent
types of philosophic thought, but in India, though the types
remained the same, their development through history made them
more and more coherent and determinate. Most of the parts
were probably existent in the earlier stages, but they were in an
undifferentiated state; through the criticism and conflict of the
different schools existing side by side the parts of each of the
systems of thought became more and more differentiated, deter
minate, and coherent. In some cases this development has been
almost imperceptible, and in many cases the earlier forms have
been lost, or so inadequately expressed that nothing definite
could be made out of them. Wherever such a differentiation
could be made in the interests of philosophy, I have tried to do
it. But I have never considered it desirable that the philosophical
interest should be subordinated to the chronological. It is no
6 Introductory [CH.
doubt true that more definite chronological information would be
a very desirable thing, yet I am of opinion that the little
chronological data we have give us a fair amount of help in form
ing a general notion about the growth and development of the
different systems by mutual association and conflict. If the con
dition of the development of philosophy in India had been the
same as in Europe, definite chronological knowledge would be
considered much more indispensable. For, when one system
supersedes another, it is indispensably necessary that we should
know which preceded and which succeeded. But when the systems
are developing side by side, and when we are getting them in
their richer and better forms, the interest with regard to the
conditions, nature and environment of their early origin has rather
a historical than a philosophical interest. I have tried as best
I could to form certain general notions as regards the earlier
stages of some of the systems, but though the various features of
these systems at these stages in detail may not be ascertainable,
yet this, I think, could never be considered as invalidating the
whole programme. Moreover, even if we knew definitely the
correct dates of the thinkers of the same system we could not
treat them separately, as is done in European philosophy, without
unnecessarily repeating the same thing twenty times over; for
they all dealt with the same system, and tried to bring out the
same type of thought in more and more determinate forms.
The earliest literature of India is the Vedas. These consist
mostly of hymns in praise of nature gods, such as fire, wind, etc.
Excepting in some of the hymns of the later parts of the work
(probably about 1000 B.C.), there is not much philosophy in them
in our sense of the term. It is here that we first find intensely
interesting philosophical questions of a more or less cosmological
character expressed in terms of poetry and imagination. In the
later Vedic works called the Brahmanas and the Aranyakas written
mostly in prose, which followed the Vedic hymns, there are two
tendencies, viz. one that sought to establish the magical forms of
ritualistic worship, and the other which indulged in speculative
thinking through crude generalizations. This latter tendency was
indeed much feebler than the former, and it might appear that
the ritualistic tendency had actually swallowed up what little of
philosophy the later parts of the Vedic hymns were trying to
express, but there are unmistakable marks that this tendency
i] Introductory 7
existed and worked. Next to this come certain treatises written
in prose and verse called the Upanisads, which contain various
sorts of philosophical thoughts mostly monistic or singularistic
but also some pluralistic and dualistic ones. These are not
reasoned statements, but utterances of truths intuitively perceived
or felt as unquestionably real and indubitable, and carrying great
force, vigour, and persuasiveness with them. It is very probable
that many of the earliest parts of this literature are as old as
500 B.C. to 700 B.C. Buddhist philosophy began with the Buddha
from some time about 500 B.C. There is reason to believe that
Buddhist philosophy continued to develop in India in one or
other of its vigorous forms till some time about the tenth or
eleventh century A.D. The earliest beginnings of the other Indian
systems of thought are also to be sought chiefly between the age
of the Buddha to about 200 B.C. Jaina philosophy was probably
prior to the Buddha. But except in its earlier days, when it came
in conflict with the doctrines of the Buddha, it does not seem to
me that the Jaina thought came much in contact with other
systems of Hindu thought. Excepting in some forms of Vaisnava
thought in later times, Jaina thought is seldom alluded to by
the Hindu writers or later Buddhists, though some Jains like
Haribhadra and Gunaratna tried to refute the Hindu and Buddhist
systems. The non-aggressive nature of their religion and ideal
may to a certain extent explain it, but there may be other
reasons too which it is difficult for us to guess. It is interesting
to note that, though there have been some dissensions amongst
the Jains about dogmas and creeds, Jaina philosophy has not
split into many schools of thought more or less differing from one
another as Buddhist thought did.
The first volume of this work will contain Buddhist and Jaina
philosophy and the six systems of Hindu thought. These six sys
tems of orthodox Hindu thought are the Samkhya, the Yoga, the
Nyaya, the Vaisesika, the Mlmamsa (generally known as Purva
Mlmamsa), and the Vedanta (known also as Uttara Mlmamsa).
Of these what is differently known as Samkhya and Yoga are but
different schools of one system. The Vaisesika and the Nyaya in
later times became so mixed up that, though in early times the
similarity of the former with Mlmamsa was greater than that with
Nyaya, they came to be regarded as fundamentally almost the
same systems. Nyaya and Vaisesika have therefore been treated
8 Introductory [CH.
together. In addition to these systems some theistic systems began
to grow prominent from the ninth century A.D. They also probably
had their early beginnings at the time of the Upanisads. But at
that time their interest was probably concentrated on problems
of morality and religion. It is not improbable that these were
associated with certain metaphysical theories also, but no works
treating them in a systematic way are now available. One of
their most important early works is the Bhagavadgltd. This book
is rightly regarded as one of the greatest masterpieces of Hindu
thought. It is written in verse, and deals with moral, religious,
and metaphysical problems, in a loose form. It is its lack of
system and method which gives it its peculiar charm more akin
to the poetry of the Upanisads than to the dialectical and syste
matic Hindu thought. From the ninth century onwards attempts
were made to supplement these loose theistic ideas which were
floating about and forming integral parts of religious creeds, by
metaphysical theories. Theism is often dualistic and pluralistic,
and so are all these systems, which are known as different schools
of Vaisnava philosophy. Most of the Vaisnava thinkers wished
to show that their systems were taught in the Upanisads, and thus
wrote commentaries thereon to prove their interpretations, and
also wrote commentaries on the Brahmasutra, the classical ex
position of the philosophy of the Upanisads. In addition to the
works of these Vaisnava thinkers there sprang up another class
of theistic works which were of a more eclectic nature. These
also had their beginnings in periods as old as the Upanisads.
They are known as the Saiva and Tantra thought, and are dealt
with in the second volume of this work.
We thus see that the earliest beginnings of most systems of
Hindu thought can be traced to some time between 600 B.C. to
IOO or 200 B.C. It is extremely difficult to say anything about
the relative priority of the systems with any degree of certainty.
Some conjectural attempts have been made in this work with
regard to some of the systems, but how far they are correct, it
will be for our readers to judge. Moreover during the earliest
manifestation of a system some crude outlines only are traceable.
As time went on the systems of thought began to develop side
by side. Most of them were taught from the time in which they
were first conceived to about the seventeenth century A.D. in an
unbroken chain of teachers and pupils. Even now each system
of Hindu thought has its own adherents, though few people now
i] Introductory 9
care to write any new works upon them. In the history of the
growth of any system of Hindu thought we find that as time went
on, and as new problems were suggested, each system tried to
answer them consistently with its own doctrines. The order in
which we have taken the philosophical systems could not be
strictly a chronological one. Thus though it is possible that the
earliest speculations of some form of Samkhya, Yoga, and
Mlmamsa were prior to Buddhism yet they have been treated
after Buddhism and Jainism, because the elaborate works of these
systems which we now possess are later than Buddhism. In my
opinion the Vaisesika system is also probably pre-Buddhistic,
but it has been treated later, partly on account of its association
with Nyaya, and partly on account of the fact that all its com
mentaries are of a much later date. It seems to me almost certain
that enormous quantities of old philosophical literature have been
lost, which if found could have been of use to us in showing the
stages of the early growth of the systems and their mutual
relations. But as they are not available we have to be satisfied
with what remains. The original sources from which I have drawn
my materials have all been indicated in the brief accounts of the
literature of each system which I have put in before beginning
the study of any particular system of thought.
In my interpretations I have always tried to follow the original
sources as accurately as I could. This has sometimes led to old
and unfamiliar modes of expression, but this course seemed to me
to be preferable to the adoption of European modes of thought
for the expression of Indian ideas. But even in spite of this
striking similarities to many of the modern philosophical doctrines
and ideas will doubtless be noticed. This only proves that the
human mind follows more or less the same modes of rational
thought. I have never tried to compare any phase of Indian
thought with European, for this is beyond the scope of my present
attempt, but if I may be allowed to express my own conviction,
I might say that many of the philosophical doctrines of European
philosophy are essentially the same as those found in Indian
philosophy. The main difference is often the difference of the
point of view from which the same problems appeared in such a
variety of forms in the two countries. My own view with regard
to the net value of Indian philosophical development will be ex
pressed in the concluding chapter of the second volume of the
present work.
CHAPTER II
THE VEDAS, BRAHMANAS AND THEIR PHILOSOPHY
The Vedas and their antiquity.
THE sacred books of India, the Vedas, are generally believed
to be the earliest literary record of the Indo-European race. It
is indeed difficult to say when the earliest portions of these com
positions came into existence. Many shrewd guesses have been
offered, but none of them can be proved to be incontestably true.
Max Miiller supposed the date to be 1200 B.C., Haug 2400 B.C.
and Bal Garigadhar Tilak 4000 B.C. The ancient Hindus seldom
kept any historical record of their literary, religious or political
achievements. The Vedas were handed down from mouth to
mouth from a period of unknown antiquity ; and the Hindus
generally believed that they were never composed by men. It was
therefore generally supposed that either they were taught by God
to the sages, or that they were of themselves revealed to the sages
who were the "seers" (mantradrasta) of the hymns. Thus we find
that when some time had elapsed after the composition of the
Vedas, people had come to look upon them not only as very old,
but so old that they had, theoretically at least, no beginning in
time, though they were believed to have been revealed at some
unknown remote period at the beginning of each creation.
The place of the Vedas in the Hindu mind.
When the Vedas were composed, there was probably no
system of writing prevalent in India. But such was the scrupulous
zeal of the Brahmins, who got the whole Vedic literature by
heart by hearing it from their preceptors, that it has been trans
mitted most faithfully to us through the course of the last 3000
years or more with little or no interpolations at all. The religious
history of India had suffered considerable changes in the latter
periods, since the time of the Vedic civilization, but such was
the reverence paid to the Vedas that they had ever remained as
the highest religious authority for all sections of the Hindus at
all times. Even at this day all the obligatory duties of the Hindus
at birth, marriage, death, etc., are performed according to the old
CH. n] Classification of the Vedic literature 1 1
Vedic ritual. The prayers that a Brahmin now says three times
a day are the same selections of Vedic verses as were used as
prayer verses two or three thousand years ago. A little insight
into the life of an ordinary Hindu of the present day will show
that the system of image-worship is one that has been grafted
upon his life, the regular obligatory duties of which are ordered
according to the old Vedic rites. Thus an orthodox Brahmin
can dispense with image-worship if he likes, but not so with his
daily Vedtc prayers or other obligatory ceremonies. Even at
this day there are persons who bestow immense sums of money
for the performance and teaching of Vedic sacrifices and rituals.
Most of the Sanskrit literatures that flourished after the Vedas
base upon them their own validity, and appeal to them as
authority. Systems of Hindu philosophy not only own their alle
giance to the Vedas, but the adherents of each one of them would
often quarrel with others and maintain its superiority by trying
to prove that it and it alone was the faithful follower of the
Vedas and represented correctly their views. The laws which
regulate the social, legal, domestic and religious customs and
rites of the Hindus even to the present day are said to be but
mere systematized memories of old Vedic teachings, and are
held to be obligatory on their authority. Even under British
administration, in the inheritance of property, adoption, and in
such other legal transactions, Hindu Law is followed, and this
claims to draw its authority from the Vedas. To enter into
details is unnecessary. But suffice it to say that the Vedas, far
from being regarded as a dead literature of the past, are still
looked upon as the origin and source of almost all literatures
except purely secular poetry and drama. Thus in short we may
say that in spite of the many changes that time has wrought,
the orthodox Hindu life may still be regarded in the main as an
adumbration of the Vedic life, which had never ceased to shed
its light all through the past.
Classification of the Vedic literature.
A beginner who is introduced for the first time to the study
of later Sanskrit literature is likely to appear somewhat confused
when he meets with authoritative texts of diverse purport and
subjects having the same generic name " Veda " or " Sruti " (from
sru to hear) ; for Veda in its wider sense is not the name of any
1 2 The Vedas, Brahmanas and their Philosophy [CH.
particular book, but of the literature of a particular epoch ex
tending over a long period, say two thousand years or so. As
this literature represents the total achievements of the Indian
people in different directions for such a long period, it must of
necessity be of a diversified character. If we roughly classify
this huge literature from the points of view of age, language, and
subject matter, we can point out four different types, namely the
Samhita or collection of verses (sam together, hita put), Brah
manas, Aranyakas (" forest treatises ") and the Upanisads. All
these literatures, both prose and verse, were looked upon as so
holy that in early times it was thought almost a sacrilege to write
them; they were therefore learnt by heart by the Brahmins from
the mouth of their preceptors and were hence called sruti (liter
ally anything heard) 1 .
The Samhitas.
There are four collections or Samhitas, namely Rg-Veda,
Sama-Veda, Yajur-Veda and Atharva-Veda. Of these the Rg-
Veda is probably the earliest. The Sama-Veda has practically
no independent value, for it consists of stanzas taken (excepting
only 75) entirely from the Rg-Veda, which were meant to be
sung to certain fixed melodies, and may thus be called the book
of chants. The Yajur-Veda however contains in addition to the
verses taken from the Rg-Veda many original prose formulas.
The arrangement of the verses of the Sama-Veda is solely with
reference to their place and use in the Soma sacrifice; the con
tents of the Yajur-Veda are arranged in the order in which the
verses were actually employed in the various religious sacrifices.
It is therefore called the Veda of Yajus sacrificial prayers. These
may be contrasted with the arrangement in the Rg-Veda in this,
that there the verses are generally arranged in accordance with
the gods who are adored in them. Thus, for example, first we get
all the poems addressed to Agni or the Fire-god, then all those
to the god Indra and so on. The fourth collection, the Atharva-
Veda, probably attained its present form considerably later than
the Rg-Veda. In spirit, however, as Professor Macdonell says,
" it is not only entirely different from the Rigveda but represents a
much more primitive stage of thought. While the Rigveda deals
almost exclusively with the higher gods as conceived by a com-
1 Panini, in. iii. 94.
u] The Brahmanas 1 3
paratively advanced and refined sacerdotal c\a.ss,theAtAarva-Veda
is, in the main a book of spells and incantations appealing to the
demon world, and teems with notions about witchcraft current
among the lower grades of the population, and derived from an
immemorial antiquity. These two, thus complementary to each
other in contents are obviously the most important of the four
VedasV
The Brahmanas 2 .
After the Samhitas there grew up the theological treatises
called the Brahmanas, which were of a distinctly different literary
type. They are written in prose, and explain the sacred signi
ficance of the different rituals to those who are not already
familiar with them. " They reflect," says Professor Macdonell,
" the spirit of an age in which all intellectual activity is concen
trated on the sacrifice, describing its ceremonies, discussing its
value, speculating on its origin and significance." These works
are full of dogmatic assertions, fanciful symbolism and specu
lations of an unbounded imagination in the field of sacrificial
details. The sacrificial ceremonials were probably never so
elaborate at the time when the early hymns were composed.
But when the collections of hymns were being handed down from
generation to generation the ceremonials became more and more
complicated. Thus there came about the necessity of the dis
tribution of the different sacrificial functions amongseveral distinct
classes of priests. We may assume that this was a period when
the caste system was becoming established, and when the only
thing which could engage wise and religious minds was sacrifice
and its elaborate rituals. Free speculative thinking was thus
subordinated to the service of the sacrifice, and the result was
the production of the most fanciful sacramental and symbolic
1 A. A. Macdonell s History of Sanskrit Literature, p. 31.
a Weber (Hist. Ind. Lit., p. u, note) says that the word Brahmana signifies "that
which relates to prayer brahman." Max Miiller (S.B. E. I. p. Ixvi) says that Brah
mana meant "originally the sayings of Brahmans, whether in the general sense of
priests, or in the more special sense of Brahman-priests." Eggeling (S. B E. XII. Introd.
p. xxii) says that the Brahmanas were so called "probably either because they were
intended for the instruction and guidance of priests (brahman) generally; or because
they were, for the most part, the authoritative utterances of such as were thoroughly
versed in Vedic and sacrificial lore and competent to act as Brahmans or superintend
ing priests. " But in view of the fact that the Brahmanas were also supposed to be as
much revealed as the Vedas, the present writer thinks that Weber s view is the correct
one.
14 The Vedas, Brahmanas and their Philosophy [CH.
system, unparalleled anywhere but among the Gnostics. It is
now generally believed that the close of the Brahmana period
was not later than 500 B.C.
The Aranyakas.
As a further development of the Brahmanas however we get
the Aranyakas or forest treatises. These works were probably
composed for old men who had retired into the forest and were
thus unable to perform elaborate sacrifices requiring a multitude
of accessories and articles which could not be procured in forests.
In these, meditations on certain symbols were supposed to be of
great merit, and they gradually began to supplant the sacrifices
as being of a superior order. It is here that we find that amongst
a certain section of intelligent people the ritualistic ideas began
to give way, and philosophic speculations about the nature of
truth became gradually substituted in their place. To take an
illustration from the beginning of the Brhadaranyaka we find
that instead of the actual performance of the horse sacrifice
(asvamedha) there are directions for meditating upon the dawn
( Usas) as the head of the horse, the sun as the eye of the horse,
the air as its life, and so on. This is indeed a distinct advance
ment of the claims of speculation or meditation over the actual
performance of the complicated ceremonials of sacrifice. The
growth of the subjective speculation, as being capable of bringing
the highest good, gradually resulted in the supersession of Vedic
ritualism and the establishment of the claims of philosophic
meditation and self-knowledge as the highest goal of life. Thus
we find that the Aranyaka age was a period during which free
thinking tried gradually to shake off the shackles of ritualism
which had fettered it for a long time. It was thus that the
Aranyakas could pave the way for the Upanisads, revive the
germs of philosophic speculation in the Vedas, and develop them
in a manner which made the Upanisads the source of all philo
sophy that arose in the world of Hindu thought.
The Rg-Veda, its civilization.
The hymns of the Rg-Veda are neither the productions of a
single hand nor do they probably belong to any single age. They
were composed probably at different periods by different sages,
and it is not improbable that some of them were composed
n] The g- Veda, its civilization 1 5
before the Aryan people entered the plains of India. They were
handed down from mouth to mouth and gradually swelled through
the new additions that were made by the poets of succeeding
generations. It was when the collection had increased to a very
considerable extent that it was probably arranged in the present
form, or in some other previous forms to which the present
arrangement owes its origin. They therefore reflect the civilization
of the Aryan people at different periods of antiquity before and
after they had come to India. This unique monument of a long
vanished age is of great aesthetic value, and contains much that is
genuine poetry. It enables us to get an estimate of the primitive
society which produced it the oldest book of the Aryan race.
The principal means of sustenance were cattle-keeping and the
cultivation of the soil with plough and harrow, mattock and hoe,
and watering the ground when necessary with artificial canals.
"The chief food consists," as Kaegi says, "together with bread,
of various preparations of milk, cakes of flour and butter, many
sorts of vegetables and fruits; meat cooked on the spits or in pots,
is little used, and was probably eaten only at the great feasts and
family gatherings. Drinking plays throughout a much more im
portant part than eating 1 ." The wood -worker built war-chariots
and wagons, as also more delicate carved works and artistic cups.
Metal-workers, smiths and potters continued their trade. The
women understood the plaiting of mats, weaving and sewing ;
they manufactured the wool of the sheep into clothing for men
and covering for animals. The group of individuals forming a
tribe was the highest political unit; each of the different families
forming a tribe was under the sway of the father or the head of
the family. Kingship was probably hereditary and in some cases
electoral. Kingship was nowhere absolute, but limited by the
will of the people. Most developed ideas of justice, right and
law, were present in the country. Thus Kaegi says, " the hymns
strongly prove how deeply the prominent minds in the people
were persuaded that the eternal ordinances of the rulers of the
world were as inviolable in mental and moral matters as in the
realm of nature, and that every wrong act, even the unconscious,
was punished and the sin expiated 8 ." Thus it is only right and
proper to think that the Aryans had attained a pretty high degree
1 The Rigveda, by Kaegi, 1886 edition, p. 13 * Ibid. p. 18.
1 6 The Vedas, Brahmanas and their Philosophy [CH.
of civilization, but nowhere was the sincere spirit of the Aryans
more manifested than in religion, which was the most essential and
dominant feature of almost all the hymns, except a few secular
ones. Thus Kaegi says, " The whole significance of the Rigveda
in reference to the general history of religion, as has repeatedly
been pointed out in modern times, rests upon this, that it presents
to us the development of religious conceptions from the earliest
beginnings to the deepest apprehension of the godhead and its
relation to man 1 ."
The Vedic Gods.
The hymns of the Rg-Veda were almost all composed in
praise of the gods. The social and other materials are of secondary
importance, as these references had only to be mentioned inci
dentally in giving vent to their feelings of devotion to the god.
The gods here are however personalities presiding over the diverse
powers of nature or forming their very essence. They have
therefore no definite, systematic and separate characters like the
Greek gods or the gods of the later Indian mythical works, the
Puranas. The powers of nature such as the storm, the rain, the
thunder, are closely associated with one another, and the gods
associated with them are also similar in character. The same
epithets are attributed to different gods and it is only in a few
specific qualities that they differ from one another. In the later
mythological compositions of the Puranas the gods lost their
character as hypostatic powers of nature, and thus became actual
personalities and characters having their tales of joy and sorrow
like the mortal here below. The Vedic gods may be contrasted
with them in this, that they are of an impersonal nature, as the
characters they display are mostly but expressions of the powers
of nature. To take an example, the fire or Agni is described, as
Kaegi has it, as one that " lies concealed in the softer wood, as
in a chamber, until, called forth by the rubbing in the early
morning hour, he suddenly springs forth in gleaming brightness.
The sacrificer takes and lays him on the wood. When the priests
pour melted butter upon him, he leaps up crackling and neighing
like a horse he whom men love to see increasing like their own
prosperity. They wonder at him, when, decking himself with
1 The Rigveda, by Kaegi, p. 26.
n] Polytheism, Henotheism and Monotheism 1 7
changing colors like a suitor, equally beautiful on all sides, he
presents to all sides his front.
All-searching is his beam, the gleaming of his light,
His, the all-beautiful, of beauteous face and glance,
The changing shimmer like that floats upon the stream,
So Agni s rays gleam over bright and never cease *."
R. V. I. 143. 3.
They would describe the wind (Vata) and adore him and say
" In what place was he born, and from whence comes he ?
The vital breath of gods, the world s great offspring,
The God where er he will moves at his pleasure :
His rushing sound we hear what his appearance, no one 2 ."
R, V. x. 168. 3, 4-
It was the forces of nature and her manifestations, on earth
here, the atmosphere around and above U9, or in the Heaven
beyond the vault of the sky that excited the devotion and
imagination of the Vedic poets. Thus with the exception of a
few abstract gods of whom we shall presently speak and some
dual divinities, the gods may be roughly classified as the terres
trial, atmospheric, and celestial.
Polytheism, Henotheism and Monotheism.
The plurality of the Vedic gods may lead a superficial enquirer
to think the faith of the Vedic people polytheistic. But an in
telligent reader will find here neither polytheism nor monotheism
but a simple primitive stage of belief to which both of these may
be said to owe their origin. The gods here do not preserve their
proper places as in a polytheistic faith, but each one of them
shrinks into insignificance or shines as supreme according as it is
the object of adoration or not. The Vedic poets were the children
of nature. Every natural phenomenon excited their wonder,
admiration or veneration. The poet is struck with wonder that
" the rough red cow gives soft white milk." The appearance or
the setting of the sun sends a thrill into the minds of the Vedic
sage and with wonder-gazing eyes he exclaims:
" Undropped beneath, not fastened firm, how comes it
That downward turned he falls not downward ?
The guide of his ascending path, who saw it 1 ?" R. V. IV. 13. 5.
The sages wonder how " the sparkling waters of all rivers flow
into one ocean without ever filling it." The minds of the Vedic
1 The Rigwda, by Kaegi, p. 35. * Ibid. p. 38.
D. 2
1 8 The Vedas, Brahmanas and their Philosophy [CH.
people as we find in the hymns were highly impressionable and
fresh. At this stage the time was not ripe enough for them to
accord a consistent and well-defined existence to the multitude
of gods nor to universalize them in a monotheistic creed. They
hypostatized unconsciously any force of nature that overawed
them or filled them with gratefulness and joy by its beneficent or
aesthetic character, and adored it. The deity which moved the de
votion or admiration of their mind was the most supreme for the
time. This peculiar trait of the Vedic hymns Max Miiller has called
HenotheismorKathehotheism: "a belief in singlegods.each in turn
standing out as the highest. And since the gods are thought of
as specially ruling in their own spheres, the singers, in their special
concerns and desires, call most of all on that god to whom they
ascribe the most power in the matter, to whose department if I
may say so, their wish belongs. This god alone is present to the mind
of the suppliant; with him for the time being is associated every
thing that can be said of a divine being; he is the highest, the only
god, before whom all others disappear, there being in this, however,
no offence or depreciation of any other god 1 ." " Against this theory
it has been urged," as Macdonell rightly says in his Vedic Myth
ology*, "that Vedic deities are not represented as independent of
all the rest, since no religion brings its gods into more frequent
and varied juxtaposition and combination, and that even the
mightiest gods of the Veda are made dependent on others. Thus
Varuna and Surya are subordinate to Indra (i. 101), Varuna and
the Asvins submit to the power of Visnu (i. 156).... Even when a
god is spoken of as unique or chief (eka), as is natural enough in
laudations, such statements lose their temporarily monotheistic
force, through the modifications or corrections supplied by the con
text or even by the same verse 3 ." " Henotheism is therefore an
appearance," says Macdonell, "rather than a reality, an appearance
produced by the indefiniteness due to undeveloped anthropo
morphism, by the lack of any Vedic god occupying the position
of a Zeus as the constant head of the pantheon, by the natural
tendency of the priest or singer in extolling a particular god to
exaggerate his greatness and to ignore other gods, and by the
1 The Rigveda, by Kaegi, p. 27.
1 See Ibid. p. 33. See also Arrowsmith s note on it for other references to Heno
theism.
1 Macdonell s Vedic Mythology, pp. 16, 17.
n] Growth of a Monotheistic tendency 19
growing belief in the unity of the gods (cf. the refrain of 3, 35)
each of whom might be regarded as a type of the divine 1 ." But
whether we call it Henotheism or the mere temporary exaggera
tion of the powers of the deity in question, it is evident that this
stage can neither be properly called polytheistic nor monotheistic,
but one which had a tendency towards them both, although it
was not sufficiently developed to be identified with either of them.
The tendency towards extreme exaggeration could be called a
monotheistic bias in germ, whereas the correlation of different
deities as independent of one another and yet existing side by side
was a tendency towards polytheism.
Growth of a Monotheistic tendency; Prajapati, Visvakarma.
This tendency towards extolling a god as the greatest and
highest gradually brought forth the conception of a supreme
Lord of all beings (Prajapati), not by a process of conscious
generalization but as a necessary stage of development of the mind,
able to imagine a deity as the repository of the highest moral and
physical power, though its direct manifestation cannot be per
ceived. Thus the epithet Prajapati or the Lord of beings, which
was originally an epithet for other deities, came to be recognized
as a separate deity, the highest and the greatest. Thus it is said
in R. V. x. I2i 8 :
In the beginning rose Hiranyagarbha,
Born as the only lord of all existence.
This earth he settled firm and heaven established :
What god shall we adore with our oblations ?
Who gives us breath, who gives us strength, whose bidding
All creatures must obey, the bright gods even ;
Whose shade is death, whose shadow life immortal :
What god shall we adore with our oblations ?
Who by his might alone became the monarch
Of all that breathes, of all that wakes or slumbers,
Of all, both man and beast, the lord eternal :
What god shall we adore with our oblations ?
Whose might and majesty these snowy mountains,
The ocean and the distant stream exhibit ;
Whose arms extended are these spreading regions :
What god shall we adore with our oblations ?
Who made the heavens bright, the earth enduring,
Who fixed the firmament, the heaven of heavens ;
Who measured out the air s extended spaces:
What god shall we adore with our oblations ?
1 MacdonelFs Vedic Mythology, p. 17. a The Rigveda, by Kaegi, pp. 88, 89.
22
2O The Vedas, Brahmanas and their Philosophy [CH.
Similar attributes are also ascribed to the deity Vivakarma
(All-creator) 1 . He is said to be father and procreator of all beings,
though himself uncreated. He generated the primitive waters.
It is to him that the sage says,
Who is our father, our creator, maker,
Who every place doth know and every creature,
By whom alone to gods their names were given,
To him all other creatures go to ask him 2 . R. V. x. 82. 3.
Brahma.
The conception of Brahman which has been the highest glory
for the Vedanta philosophy of later days had hardly emerged in
the Rg-Veda from the associations of the sacrificial mind. The
meanings that Sayana the celebrated commentator of the Vedas
gives of the word as collected by Haug are: (a) food, food offering,
(b) the chant of the sama-singer, (c) magical formula or text,
(d) duly completed ceremonies, (e) the chant and sacrificial gift
together, (f) the recitatioa of the hotr priest, (g) great. Roth
says that it also means " the devotion which manifests itself as
longing and satisfaction of the soul and reaches forth to the
gods." But it is only in the ^atapatha Brahmana that the con
ception of Brahman has acquired a great significance as the
supreme principle which is the moving force behind the gods.
Thus the atapatha says, " Verily in the beginning this (universe)
was the Brahman (neut). It created the gods; and, having
created the gods, it made them ascend these worlds: Agni this
(terrestrial) world, Vayu the air, and Surya the sky.... Then the
Brahman itself went up to the sphere beyond. Having gone up
to the sphere beyond, it considered, How can I descend again
into these worlds ? It then descended again by means of these
two, Form and Name. Whatever has a name, that is name ; and
that again which has no name and which one knows by its form,
this is (of a certain) form, that is form : as far as there are Form
and Name so far, indeed, extends this (universe). These indeed
are the two great forces of Brahman; and, verily, he who knows
these two great forces of Brahman becomes himself a great force*.
In another place Brahman is said to be the ultimate thing in the
Universe and is identified with Prajapati, Purusa and Prana
1 See The Rigveda, by Kaegi, p. 89, and also Muir s Sanskrit Texts, vol. iv. pp. 5-11.
8 Kaegi s translation.
8 See Eggeling s translation of Satapatha Brabmana S. B. E. vol. XLIV. pp. 27, 28.
n] Sacrifice: the First Rudiments of the Law of Karma 2 1
(the vital air 1 ). In another place Brahman is described as being
the Svayambhu (self-born) performing austerities, who offered
his own self in the creatures and the creatures in his own self,
and thus compassed supremacy, sovereignty and lordship over
all creatures 2 . The conception of the supreme man (Purusa) in
the Rg-Veda also supposes that the supreme man pervades the
world with only a fourth part of Himself, whereas the remaining
three parts transcend to a region beyond. He is at once the
present, past and future 8 .
Sacrifice; the First Rudiments of the Law of Karma.
It will however be wrong to suppose that these monotheistic
tendencies were gradually supplanting the polytheistic sacrifices.
On the other hand, the complications of ritualism were gradually
growing in their elaborate details. The direct result of this growth
contributed however to relegate the gods to a relatively unim
portant position, and to raise the dignity of the magical charac
teristics of the sacrifice as an institution which could give the
desired fruits of themselves. The offerings at a sacrifice were not
dictated by a devotion with which we are familiar under Christian
or Vaisnava influence. The sacrifice taken as a whole is con
ceived as Haug notes " to be a kind of machinery in which every
piece must tally with the other," the slightest discrepancy in the
performance of even a minute ritualistic detail, say in the pouring
of the melted butter on the fire, or the proper placing of utensils
employed in the sacrifice, or even the misplacing of a mere straw
contrary to the injunctions was sufficient to spoil the whole
sacrifice with whatsoever earnestness it might be performed.
Even if a word was mispronounced the most dreadful results
might follow. Thus when Tvastr performed a sacrifice for the
production of a demon who would be able to kill his enemy
Indra, owing to the mistaken accent of a single word the object
was reversed and the demon produced was killed by Indra. But if
the sacrifice could be duly performed down to the minutest
detail, there was no power which could arrest or delay the fruition
of the object. Thus the objects of a sacrifice were fulfilled not
by the grace of the gods, but as a natural result of the sacrifice.
The performance of the rituals invariably produced certain
mystic or magical results by virtue of which the object desired
1 See S. B. E. XLIH. pp. 59, 60, 400 and XLIV. p. 409.
2 See Ibid. XLIV. p. 418. R. V. x. 90, Purusa Sukta.
22 The Vedas, Brahmanas and their Philosophy [CH.
by the sacrificer was fulfilled in due course like the fulfilment of
a natural law in the physical world. The sacrifice was believed
to have existed from eternity like the Vedas. The creation of
the world itself was even regarded as the fruit of a sacrifice per
formed by the supreme Being. It exists as Haug says " as an
invisible thing at all times and is like the latent power of elec
tricity in an electrifying machine, requiring only the operation
of a suitable apparatus in order to be elicited." The sacrifice is
not offered to a god with a view to propitiate him or to obtain
from him welfare on earth or bliss in Heaven; these rewards are
directly produced by the sacrifice itself through the correct per
formance of complicated and interconnected ceremonies which
constitute the sacrifice. Though in each sacrifice certain gods
were invoked and received the offerings, the gods themselves
were but instruments in bringing about the sacrifice or in com
pleting the course of mystical ceremonies composing it. Sacrifice
is thus regarded as possessing a mystical potency superior even to
the gods, who it is sometimes stated attained to their divine rank
by means of sacrifice. Sacrifice was regarded as almost the only
kind of duty, and it was also called karma or kriya (action) and
the unalterable law was, that these mystical ceremonies for good
or for bad, moral or immoral (for there were many kinds of
sacrifices which were performed for injuring one s enemies or
gaining worldly prosperity or supremacy at the cost of others)
were destined to produce their effects. It is well to note here that
the first recognition of a cosmic order or law prevailing in nature
under the guardianship of the highest gods is to be found in the
use of the word Rta (literally the course of things). This word
was also used, as Macdonell observes, to denote the " order
in the moral world as truth and right and in the religious
world as sacrifice or rite 1 " and its unalterable law of producing
effects. It is interesting to note in this connection that it is here
that we find the first germs of the law of karma, which exercises
such a dominating control over Indian thought up to the present
day. Thus we find the simple faith and devotion of the Vedic
hymns on one hand being supplanted by the growth of a complex
system of sacrificial rites, and on the other bending their course
towards a monotheistic or philosophic knowledge of the ultimate
reality of the universe.
1 Macdonell s Vedic Mythology, p. n.
n] Cosmogony Mythological and philosophical 23
Cosmogony Mythological and philosophical.
The cosmogony of the Rg-Veda may be looked at from two
aspects, the mythological and the philosophical. The mythological
aspect has in general two currents, as Professor Macdonell says,
" The one regards the universe as the result of mechanical pro
duction, the work of carpenter s and joiner s skill; the other
represents it as the result of natural generation 1 ." Thus in the
Rg-Veda we find that the poet in one place says, " what was
the wood and what was the tree out of which they built heaven
and earth 3 ?" The answer given to this question in Taittiriya-
Brahmana is "Brahman the wood and Brahman the tree from
which the heaven and earth were made 8 ." Heaven and Earth are
sometimes described as having been supported with posts*. They
are also sometimes spoken of as universal parents, and parentage
is sometimes attributed to Aditi and Daksa.
Under this philosophical aspect the semi-pantheistic Man-
hymn 8 attracts our notice. The supreme man as we have already
noticed above is there said to be the whole universe, whatever
has been and shall be ; he is the lord of immortality who has become
diffused everywhere among things animate and inanimate, and
all beings came out of him ; from his navel came the atmosphere;
from his head arose the sky ; from his feet came the earth ; from
his ear the four quarters. Again there are other hymns in which
the Sun is called the soul (atmari) of all that is movable and
all that is immovable . There are also statements to the effect
that the Being is one, though it is called by many names by the
sages 7 . The supreme being is sometimes extolled as the supreme
Lord of the world called the golden egg (Hiranyagarbha 8 ). In
some passages it is said " Brahmanaspati blew forth these births
like a blacksmith. In the earliest age of the gods, the existent
sprang from the non-existent. In the first age of the gods, the
existent sprang from the non-existent: thereafter the regions
sprang, thereafter, from Uttanapada 9 ." The most remarkable and
sublime hymn in which the first germs of philosophic speculation
1 Macdonell s Vedic Mythology, p. n.
2 R. V. x. 8 1. 4. 8 Taitt. Br. 11. 8. 9. 6.
4 Macdonell s Vedic Mythology, p. u ; also R. V. n. 15 and iv. 56.
8 R.V. x. 90. 6 R.V. i. 115.
R. V. i. 164. 46. 8 R. V. x. in.
Muir s translation of R. V. x. 73 ; Muir s Sanskrit Texts, vol. v. p. 48.
24 The Vedas, Brahmanas and their Philosophy [CH.
with regard to the wonderful mystery of the origin of the world
are found is the 1 29th hymn of R. V. X.
1. Then there was neither being nor not-being.
The atmosphere was not, nor sky above it.
What covered all ? and where ? by what protected ?
Was there the fathomless abyss of waters ?
2. Then neither death nor deathless existed;
Of day and night there was yet no distinction.
Alone that one breathed calmly, self-supported,
Other than It was none, nor aught above It.
3. Darkness there was at first in darkness hidden;
The universe was undistinguished water.
That which in void and emptiness lay hidden
Alone by power of fervor was developed.
4. Then for the first time there arose desire,
Which was the primal germ of mind, within it.
And sages, searching in their heart, discovered
In Nothing the connecting bond of Being.
6. Who is it knows ? Who here can tell us surely
From what and how this universe has risen?
And whether not till after it the gods lived ?
Who then can know from what it has arisen?
7. The source from which this universe has risen,
And whether it was made, or uncreated,
He only knows, who from the highest heaven
Rules, the all-seeing lord or does not He know 1 ?
The earliest commentary on this is probably a passage in the
atapatha Brahmana (X. 5. 3. i) which says that " in the beginning
this (universe) was as it were neither non-existent nor existent;
in the beginning this (universe) was as it were, existed and did
not exist : there was then only that Mind. Wherefore it has been
declared by the Rishi (Rg-Veda X. 129. i ), There was then neither
the non-existent nor the existent for Mind was, as it were, neither
existent nor non-existent. This Mind when created, wished to
become manifest, more defined, more substantial : it sought after
a self (a body) ; it practised austerity : it acquired consistency 2 ."
In the Atharva-Veda also we find it stated that all forms of the
universe were comprehended within the god Skambha 3 .
Thus we find that even in the period of the Vedas there sprang
forth such a philosophic yearning, at least among some who could
1 The Rigveda, by Kaegi, p. 90. R. V. x. 119.
2 See Eggeling s translation of S. B., S. B. E. vol. XLIII. pp. 374, 375.
3 A. V. x. 7. ro.
n] Eschatologyi the Doctrine of Atman 25
question whether this universe was at all a creation or not, which
could think of the origin of the world as being enveloped in the
mystery of a primal non-differentiation of being and non-being ;
and which could think that it was the primal One which by its
inherent fervour gave rise to the desire of a creation as the first
manifestation of the germ of mind.from which the universe sprang
forth through a series of mysterious gradual processes. In the
Brahmanas, however, we find that the cosmogonic view generally
requires the agency of a creator, who is not however always the
starting point, and we find that the theory of evolution. is com
bined with the theory of creation, so that Prajapati is sometimes
spoken of as the creator while at other times the creator is said
to have floated in the primeval water as a cosmic golden egg.
Eschatology ; the Doctrine of Atman.
There seems to be a belief in the Vedas that the soul could
be separated from the body in states of swoon, and that it could
exist after death, though we do not find there any trace of the
doctrine of transmigration in a developed form. In the Satapatha
Brahmana it is said that those who do not perform rites with
correct knowledge are born again after death and suffer death
again. In a hymn of the Rg-Veda (x. 58) the soul (manas) of a man
apparently unconscious is invited to come back to him from the
trees, herbs, the sky, the sun, etc. In many of the hymns there
is also the belief in the existence of another world, where the
highest material joys are attained as a result of the performance
of the sacrifices and also in a hell of darkness underneath
where the evil-doers are punished. In the atapatha Brahmana
we find that the dead pass between two fires which burn the evil
doers, but let the good go by 1 ; it is also said there that everyone
is born again after death, is weighed in a balance, and receives
reward or punishment according as his works are good or bad.
It is easy to see that scattered ideas like these with regard to
the destiny of the soul of man according to the sacrifice that he
performs or other good or bad deeds form the first rudiments of
the later doctrine of metempsychosis. The idea that man enjoys
or suffers, either in another world or by being born in this world
according to his good or bad deeds, is the first beginning of the
moral idea, though in the Brahmanic days the good deeds were
1 See 5. B. i. 9. 3, and also Macdonell s Vedic Mythology, pp. 166, 167.
26 The Vedas, Brahmanas and their Philosophy [CH.
more often of the nature of sacrificial duties than ordinary good
works. These ideas of the possibilities of a necessary connection
of the enjoyments and sorrows of a man with his good and bad
works when combined with the notion of an inviolable law or
order, which we have already seen was gradually growing with
the conception of rta, and the unalterable law which produces
the effects of sacrificial works, led to the Law of Karma and the
doctrine of transmigration. The words which denote soul in the
Rg-Veda are manas, dtman and asu. The word dtman however
which became famous in later Indian thought is generally used
to mean vital breath. Manas is regarded as the seat of thought
and emotion, and it seems to be regarded, as Macdonell says, as
dwelling in the heart 1 . It is however difficult to understand how
atman as vital breath, or as a separable part of man going out of
the dead man came to be regarded as the ultimate essence or
reality in man and the universe. There is however at least one
passage in the Rg-Veda where the poet penetrating deeper and
deeper passes from the vital breath (asu) to the blood, and thence
to atman as the inmost self of the world ; " Who has seen how
the first-born, being the Bone-possessing (the shaped world), was
born from the Boneless (the shapeless)? where was the vital
breath, the blood, the Self (dtman) of the world ? Who went to
ask him that knows it a ?" In Taittiriya Aranyaka i. 23, however,
it is said that Prajapati after having created his self (as the world)
with his own self entered into it. In Taittiriya Brahmana the
atman is called omnipresent, and it is said that he who knows
him is no more stained by evil deeds. Thus we find that in the
pre-Upanisad Vedic literature atman probably was first used to
denote " vital breath " in man, then the self of the world, and then
the self in man. It is from this last stage that we find the traces
of a growing tendency to looking at the self of man as the omni
present supreme principle of the universe, the knowledge of which
makes a man sinless and pure.
Conclusion.
Looking at the advancement of thought in the Rg-Veda we
find first that a fabric of thought was gradually growing which
not only looked upon the universe as a correlation of parts or a
* Macdonell s Vedic Mythology, p. 166 and R. V. vm 89.
9 R. V. i. 164. 4 and Deussen s article on Atman in Encyclopaedia of Religion and
Ethics.
n] Conclusion 27
construction made of them, but sought to explain it as having
emanated from one great being who is sometimes described as
one with the universe and surpassing it, and at other times as
being separate from it; the agnostic spirit which is the mother
of philosophic thought is seen at times to be so bold as to express
doubts even on the most fundamental questions of creation "Who
knows whether this world was ever created or not?" Secondly,
the growth of sacrifices has helped to establish the unalterable
nature of the law by which the (sacrificial) actions produced their
effects of themselves. It also lessened the importance of deities
as being the supreme masters of the world and our fate, and the
tendency of henotheism gradually diminished their multiple
character and advanced the monotheistic tendency in some
quarters. Thirdly, the soul of man is described as being separable
from his body and subject to suffering and enjoyment in another
world according to his good or bad deeds; the doctrine that the
soul of man could go to plants, etc., or that it could again be re
born on earth, is also hinted at in certain passages, and this may
be regarded as sowing the first seeds of the later doctrine of
transmigration. The self (atman) is spoken of in one place as the
essence of the world, and when we trace the idea in the Brahmanas
and the Aranyakas we see that atman has begun to mean the
supreme essence in man as well as in the universe, and has thus
approached the great Atman doctrine of the Upanisads.
CHAPTER III
THE EARLIER UPANISADS 1 . (700 B.C. 600 B.C.)
The place of the Upanisads in Vedic literature.
THOUGH it is generally held that the Upanisads are usually
attached as appendices to the Aranyakas which are again attached
to the Brahmanas, yet it cannot be said that their distinction as
separate treatises is always observed. Thus we find in some cases
that subjects which we should expect to be discussed in a Brahmana
are introduced into the Aranyakas and the Aranyaka materials
are sometimes fused into the great bulk of Upanisad teaching.
This shows that these three literatures gradually grew up in one
1 There are about 112 Upanisads which have been published by the "Nirnaya-
Sagara" Press, Bombay, 1917. These are i isa, 2 Kena, 3 Katha, 4 Prasna, 5 Mun-
daka, 6 Mandukya, 7 Taittiriya, 8 Aitareya, 9 Chandogya, 10 Brhadafanyaka,
ii vetasVatara, 12 Kausltaki, 13 Maitreyi, 14 Kaivalya, 15 Jabala, 16 Brahma-
bindu, 17 Harnsa, 18 Arunika, 19 Garbha, 20 Narayana, 21 Narayana, 22 Para-
mahamsa, 23 Brahma, 24 Amrtanada, 25 Atharva&ras, 26 Atharva^ikha, 27 Mai-
trayam, 28 Brhajjabala, 29 Nrsimhapurvatapini, 30 Nrsimhottaratapini, 31 Kalag-
nirudra, 31 Subala, 33 Ksurika, 34 Yantrika, 35 Sarvasara, 36 Niralamba, 37 u-
karahasya, 38 Vajrasucika, 39Tejobindu, 40 Nadabindu, 41 Dhyanabindu, 42 Brah-
mavidya, 43 Yogatattva, 44 Atmabodha, 45 Naradaparivrajaka, 46 Trisikhibrahmana,
47 Sita, 48 Yogacudamani, 49 Nirvana, 50 Mandalabrahmana, 51 Daksinamfirtti,
52 Sarabha, 53 Skanda, 54 Tripadvibhutimahanarayana, 55 Advayataraka, 56 Rarna-
rahasya, 57 Ramapurvatapini, 58 Ramottaratapim, 59 Vasudeva, 60 Mudgala,
6 1 Sandilya, 62 Paingala, 63 Bhiksuka, 64 Maha, 65 6ariraka, 66 Yogasikha,
67 TuriyatTta, 68 Sarnnyasa, 69 Paramahamsaparivrajaka, 70 Aksamala, 7iAvyakta,
72 Ekaksara, 73 Annapiirna, 74 Surya, 75 Aksi, 76 Adhyatma, 77 Kundika, 78 Sa-
vitrl, 79Atman, 80 Pas\ipatabrahma, 81 Parabrahma, 82 Avadhuta, 83 Tripuratapini,
84 Devi, 85 Tripura, 86 Katharodra, 87 Bhavana, 88 Rudrahrdaya, 89 Yogakundall,
90 Bhasmajabala, 91 Rudraksajabala, 92 Ganapati, 93 Jabaladariana, 94 Tarasara,
95 Mahavakya, 96 Paficabrahma, 97 Pranagnihotra, 98 Gopalapurvatapini, 99 Gopa-
lottaratapini, 100 Krsna, 101 Yajfiavalkya, 102 Varaha, 103 ^athyayanlya, 104 Ha-
yagriva, 105 Dattatreya, 106 Garuda, 107 Kalisantarana, 108 Jabali, 109 Sau-
bhagyalaksml, no Sarasvatirahasya, in Bahvrca, 112 Muktika.
The collection of Upanisads translated by Dara shiko, Aurangzeb s brother, contained
50 Upanisads. The Muktika Upanisad gives a list of 108 Upanisads. With the exception
of the first 13 Upanisads most of them are of more or less later date. The Upanisads
dealt with in this chapter are the earlier ones. Amongst the later ones there are some
which repeat the purport of these, there are others which deal with the 6aiva, akta,
the Yoga and the Vaisnava doctrines. These will be referred to in connection with the
consideration of those systems in Volume II. The later Upanisads which only repeat the
purport of those dealt with in this chapter do not require further mention. Some of
the later Upanisads were composed even as late as the fourteenth or the fifteenth century-
CH. in] The place of the Upanisads in Vedic Literature 29
process of development and they were probably regarded as parts
of one literature, in spite of the differences in their subject-matter.
Deussen supposes that the principle of this division was to be
found in this, that the Brahmanas were intended for the house
holders, the Aranyakas for those who in their old age withdrew
into the solitude of the forests and the Upanisads for those who
renounced the world to attain ultimate salvation by meditation.
Whatever might be said about these literary classifications the
ancient philosophers of India looked upon the Upanisads as being
of an entirely different type from the rest of the Vedic literature
as dictating the path of knowledge (Jftana-mdrga) as opposed
to the path of works (karma-mdrgd) which forms the content
of the latter. It is not out of place here to mention that the
orthodox Hindu view holds that whatever may be written in the
Veda is to be interpreted as commandments to perform certain
actions (vidht) or prohibitions against committing certain others
(ntsedha). Even the stories or episodes are to be so interpreted
that the real objects of their insertion might appear as only to
praise the performance of the commandments and to blame the
commission of the prohibitions. No person has any right to argue
why any particular Vedic commandment is to be followed, for no
reason can ever discover that, and it is only because reason fails
to find out why a certain Vedic act leads to a certain effect that
the Vedas have been revealed as commandments and prohibitions
to show the true path of happiness. The Vedic teaching belongs
therefore to that of the Karma-marga or the performance of Vedic
duties of sacrifice, etc. The Upanisads however do not require
the performance of any action, but only reveal the ultimate truth
and reality, a knowledge of which at once emancipates a man.
Readers of Hindu philosophy are aware that there is a very strong
controversy on this point between the adherents of the Vedanta
( Upanisads) and those of the Veda. For the latter seek in analogy
to the other parts of the Vedic literature to establish the principle
that the Upanisads should not be regarded as an exception, but
that they should also be so interpreted that they might also be
held out as commending the performance of duties ; but the
former dissociate the Upanisads from the rest of the Vedic litera
ture and assert that they do not make the slightest reference to
any Vedic duties, but only delineate the ultimate reality which
reveals the highest knowledge in the minds of the deserving.
30 The Earlier Upanisads [CH.
^ahkara the most eminent exponent of the Upanisads holds that
they are meant for such superior men who are already above
worldly or heavenly prosperities, and for whom the Vedic duties
have ceased to have any attraction. Wheresoever there may be
such a deserving person, be he a student, a householder or an
ascetic, for him the Upanisads have been revealed for his ultimate
emancipation and the true knowledge. Those who perform the
Vedic duties belong to a stage inferior to those who no longer
care for the fruits of the Vedic duties but are eager for final
emancipation, and it is the latter who alone are fit to hear the
Upanisads 1 .
The names of the Upanisads ; Non-Brahmanic influence.
The Upanisads are also known by another name Vedanta, as
they are believed to be the last portions of the Vedas (veda-anta,
end) ; it is by this name that the philosophy of the Upanisads,
the Vedanta philosophy, is so familiar to us. A modern student
knows that in language the Upanisads approach the classical
Sanskrit ; the ideas preached also show that they are the culmina
tion of the intellectual achievement of a great epoch. As they
thus formed the concluding parts of the Vedas they retained their
Vedic names which they took from the name of the different
schools or branches (sdkhd) among which the Vedas were studied 2 .
Thus the Upanisads attached to the Brahmanas of the Aitareya
and Kausltaki schools are called respectively Aitareya and
Kausltaki Upanisads. Those of the Tandins and Talavakaras of
the Sama-veda are called the Chandogya and Talavakara (or
Kena) Upanisads. Those of the Taittirlya school of the Yajurveda
1 This is what is called the difference of fitness (adhikdribhedd). Those who perform
the sacrifices are not fit to hear the Upanisads and those who are fit to hear the Upa
nisads have no longer any necessity to perform the sacrificial duties.
2 When the Samhita texts had become substantially fixed, they were committed
to memory in different parts of the country and transmitted from teacher to pupil
along with directions for the practical performance of sacrificial duties. The latter
formed the matter of prose compositions, the Brahmanas. These however were
gradually liable to diverse kinds of modifications according to the special tendencies
and needs of the people among which they were recited. Thus after a time there
occurred a great divergence in the readings of the texts of the Brahmanas even of the
same Veda among different people. These different schools were known by the name
of particular Sakhas (e.g. Aitareya, Kausltaki) with which the Brahmanas were asso
ciated or named. According to the divergence of the Brahmanas of the different
Sakhas there occurred the divergences of content and the length of the Upanisads
associated with them.
in] Brahmanas and the Early Upanisads 3 1
form the Taittiriya and Mahanarayana, of the Katha school
the Kathaka, of the Maitrayam school the Maitrayanl. The
Brhadaranyaka Upanisad forms part of the &atapatha Brahmana
of the Vajasaneyi schools. The Isa Upanisad also belongs to the
latter school. But the school to which the vetasvatara belongs
cannot be traced, and has probably been lost. The presump
tion with regard to these Upanisads is that they represent the
enlightened views of the particular schools among which they
flourished, and under whose names they passed. A large number
of Upanisads of a comparatively later age were attached to the
Atharva-Veda, most of which were named not according to the
Vedic schools but according to the subject-matter with which
they dealt 1 .
It may not be out of place here to mention that from the
frequent episodes in the Upanisads in which the Brahmins are
described as having gone to the Ksattriyas for the highest know
ledge of philosophy, as well as from the disparateness of the
Upanisad teachings from that of the general doctrines of the
Brahmanas and from the allusions to the existence of philo
sophical speculations amongst the people in Pali works, it may be
inferred that among the Ksattriyas in general there existed earnest
philosophic enquiries which must be regarded as having exerted
an important influence in the formation of the Upanisad doctrines.
There is thus some probability in the supposition that though the
Upanisads are found directly incorporated with the Brahmanas
it was not the production of the growth of Brahmanic dogmas
alone, but that non-Brahmanic thought as well must have either
set the Upanisad doctrines afoot, or have rendered fruitful assist
ance to their formulation and cultivation, though they achieved
their culmination in the hands of the Brahmins.
Brahmanas and the Early Upanisads.
The passage of the Indian mind from the Brahmanic to the
Upanisad thought is probably the most remarkable event in the
history of philosophic thought. We know that in the later Vedic
hymns some monotheistic conceptions of great excellence were
developed, but these differ in their nature from the absolutism of
the Upanisads as much as the Ptolemaic and the Copernican
1 Garbha Upanisad, Atman Upanisad, Pra^na Upanisad, etc. There were however
some exceptions such as the Mandukya, Jabala, Paingala, 6aunaka, etc.
32 The Earlier Upanisads [CH.
systems in astronomy. The direct translation of VisVakarman or
Hiranyagarbha into the atman and the Brahman of the Upani
sads seems to me to be very improbable, though I am quite willing
to admit that these conceptions were swallowed up by the atman
doctrine when it had developed to a proper extent. Throughout
the earlier Upanisads no mention is to be found of Visvakarman,
Hiranyagarbha or Brahmanaspati and no reference of such a
nature is to be found as can justify us in connecting the Upanisad
ideas with those conceptions 1 . The word purusa no doubt occurs
frequently in the Upanisads, but the sense and the association
that come along with it are widely different from that of the
purusa of the Purusasukta of the Rg-Veda.
When the Rg-Veda describes Visvakarman it describes him
as a creator from outside, a controller of mundane events, to whom
they pray for worldly benefits. " What was the position, which
and whence was the principle, from which the all-seeing Visvakar
man produced the earth, and disclosed the sky by his might ? The
one god, who has on every side eyes, on every side a face, on every
side arms, on every side feet, when producing the sky and earth,
shapes them with his arms and with his wings Do thou, Visva
karman, grant to thy friends those thy abodes which are the highest,
and the lowest, and the middle... may a generous son remain here
to us 2 "; again in R.V.X.82 we find "Visvakarman is wise, energetic,
the creator, the disposer, and the highest object of intuition He
who is our father, our creator, disposer, who knows all spheres and
creatures, who alone assigns to the gods their names, to him the
other creatures resort for instruction 8 ." Again about Hiranyagarbha
we find in R.V. I. 121, " Hiranyagarbha arose in the beginning ;
born, he was the one lord of things existing. He established the
earth and this sky ; to what god shall we offer our oblation ? . . .
May he not injure us, he who is the generator of the earth, who
ruling by fixed ordinances, produced the heavens, who produced
the great and brilliant waters ! to what god, etc. ? Prajapati, no
other than thou is lord over all these created things : may we
obtain that, through desire of which we have invoked thee; may we
become masters of riches 4 ." Speaking of the purusa the Rg-Veda
1 The name VisVakarma appears in 6 vet. IV. 17. Hiranyagarbha appears in 6vet.
in. 4 and iv. la, but only as the first created being. The phrase Sarvahammani Hiran
yagarbha which Deussen refers to occurs only in the later Nrsimh. 9. The word Brah
manaspati does not occur at all in the Upanisads.
a Muir s Sanskrit Texts, vol. iv. pp. 6, 7. 3 Ibid. p. 7. * Ibid. pp. 16, 17.
in] How did the Upanisads originate ? 33
says " Purusha has a thousand heads. . .a thousand eyes, and a thou
sand feet. On every side enveloping the earth he transcended [it]
by a space of ten fingers. ...He formed those aerial creatures, and
the animals, both wild and tame 1 ," etc. Even that famous hymn
(R.V. X. 129) which begins with "There was then neither being
nor non-being, there was no air nor sky above " ends with saying
" From whence this creation came into being, whether it was
created or not he whp is in the highest sky, its ruler, probably
knows or does not know."
In the Upanisads however, the position is entirely changed,
and the centre of interest there is not in a creator from outside
but in the self: the natural development of the monotheistic posi
tion of the Vedas could have grown into some form of developed
theism, but not into the doctrine that the self was the only reality
and that everything else was far below it. There is no relation
here of the worshipper and the worshipped and no prayers are
offered to it, but the whole quest is of the highest truth, and the true
self of man is discovered as the greatest reality. This change of
philosophical position seems to me to be a matter of great interest.
This change of the mind from the objective to the subjective does
not carry with it in the Upanisads any elaborate philosophical
discussions, or subtle analysis of mind. It comes there as a matter
of direct perception, and the conviction with which the truth has
been grasped cannot fail to impress the readers. That out of the
apparently meaningless speculations of the Brahmanas this doc
trine could have developed, might indeed appear to be too im
probable to be believed.
On the strength of the stories of Balaki Gargya and Ajataatru
(Brh. II. i), Ibvetaketu and Pravahana Jaibali (Cha. V. 3 and Brh.
VI. 2) and Aruni and ASvapati Kaikeya (Cha. V. 1 1) Garbe thinks
"that it can be proven that the Brahman s profoundest wisdom, the
doctrine of All-one, which has exercised an unmistakable influence
on the intellectual life even of our time, did not have its origin
in the circle of Brahmans at all a " and that "it took its rise in
the ranks of the warrior caste 8 ." This if true would of course
lead the development of the Upanisads away from the influence
of the Veda, Brahmanas and the Aranyakas. But do the facts
prove this ? Let us briefly examine the evidences that Garbe him-
1 Muir s Sanskrit Texts, vol. V. pp. 368, 371.
2 Garbe s article, "Hindu Monism," p. 68. 3 Ibid. p. 78.
D. 3
34 The Earlier Upanisads [CH.
self has produced. In the story of Balaki Gargya and Ajataatru
(Brh. II. i) referred to by him, Balaki Gargya is a boastful man
who wants to teach the Ksattriya Ajataatru the true Brahman,
but fails and then wants it to be taught by him. To this
Ajataatru replies (following Garbe s own translation) " it is
contrary to the natural order that a Brahman receive instruction
from a warrior and expect the latter to declare the Brahman to
him 1 ." Does this not imply that in the natural order of things a
Brahmin always taught the knowledge of Brahman to the
Ksattriyas, and that it was unusual to find a Brahmin asking a
Ksattriya aboutthe trueknowledge of Brahman? At the beginning
of the conversation, Ajatasatru had promised to pay Balaki one
thousand coins if he could tell him about Brahman, since all people
used to run to Janaka to speak about Brahman 8 . The second
story of vetaketu and Pravahana Jaibali seems to be fairly con
clusive with regard to the fact that the transmigration doctrines,
the way of the gods (devaydnd) and the way of -the fathers
(pitrydna) had originated among the Ksattriyas, but it is without
any relevancy with regard to the origin of the superior knowledge
of Brahman as the true self.
The third story of Aruni and AsVapati Kaikeya (Cha. V. n)
is hardly more convincing, for here five Brahmins wishing to
know what the Brahman and the self were, went to Uddalaka
Aruni ; but as he did not know sufficiently about it he accompanied
them to the Ksattriya king Asvapati Kaikeya who was studying
the subject. But AsVapati ends the conversation by giving them
certain instructions about the fire doctrine (vaisvdnara agni) and
the import of its sacrifices. He does not say anything about the
true self as Brahman. We ought also to consider that there are
only the few exceptional cases where Ksattriya kings were in
structing the Brahmins. But in all other cases the Brahmins were
discussing and instructing the atman knowledge. I am thus led
to think that Garbe owing to his bitterness of feeling against the
Brahmins as expressed in the earlier part of the essay had been
too hasty in his judgment. The opinion of Garbe seems to have
been shared to some extent by Winternitz also, and the references
given by him to the Upanisad passages are also the same as we
1 Garbe s article, "Hindu Monism," p. 74.
2 Brh. n., compare also Brh. iv. 3, how Yajftavalkya speaks to Janaka about the
brahmavidya.
in] Aranyakas and the Upanisads 35
just examined 1 . The truth seems to me to be this, that the
Ksattriyas and even some women took interest in the religio-
philosophical quest manifested in the Upanisads. The enquirers
were so eager that either in receiving the instruction of Brahman
or in imparting it to others, they had no considerations of sex and
birth*; and there seems to be no definite evidence for thinking
that the Upanisad philosophy originated among the Ksattriyas
or that the germs of its growth could not be traced in the
Brahmanas and the Aranyakas which were the productions of
the Brahmins.
The change of the BrShmana into the Aranyaka thought is
signified by a transference of values from the actual sacrifices to
their symbolic representations and meditations which were re
garded as being productive of various earthly benefits. Thus we
find in the Brhadaranyaka (l. i) that instead of a horse sacrifice
the visible universe is to be conceived as a horse and meditated
upon as such. The dawn is the head of the horse, the sun is the
eye, wind is its life, fire is its mouth and the year is its soul, and so
on. What is the horse that grazes in the field and to what good
can its sacrifice lead ? This moving universe is the horse which is
most significant to the mind, and the meditation of it as such is
the most suitable substitute of the sacrifice of the horse, the mere
animal. Thought-activity as meditation, is here taking the place
of an external worship in the form of sacrifices. The material
substances and the most elaborate and accurate sacrificial rituals
lost their value and bare meditations took their place. Side
by side with the ritualistic sacrifices of the generality of the
Brahmins, was springing up a system where thinking and sym
bolic meditations were taking the place of gross matter and
action involved in sacrifices. These symbols were not only
chosen from the external world as the sun, the wind, etc., from
the body of man, his various vital functions and the senses, but
even arbitrary alphabets were taken up and it was believed that
the meditation of these as the highest and the greatest was pro
ductive of great beneficial results. Sacrifice in itself was losing
value in the eyes of these men and diverse mystical significances
and imports were beginning to be considered as their real truth 8 .
1 Winternitz s Geschichte der indischen Litteratur^ I. pp. 197 ff.
J The story of Maitreyl and Yajflavalkya (Brh. n. 4) and that of Satyakama son of
Jabala and his teacher (Cha. iv. 4). 8 Cha. v. n.
32
36 The Earlier Upanisads [CH.
The Uktha (verse) of Rg-Veda was identified in the Aitareya
Aranyaka under several allegorical forms with the Prana 1 , the
Udgltha of the Samaveda was identified with Om, Prana, sun and
eye ; in Chandogya II. the Saman was identified with Om, rain,
water, seasons, Prana, etc., in Chandogya III. 16-17 man was
identified with sacrifice ; his hunger, thirst, sorrow, with initia
tion ; laughing, eating, etc., with the utterance of the Mantras ;
and asceticism, gift, sincerity, restraint from injury, truth, with
sacrificial fees (daksina). The gifted mind of these cultured Vedic
Indians was anxious to come to some unity, but logical precision
of thought had not developed, and as a result of that we find in the
Aranyakas the most grotesque and fanciful unifications of things
which to our eyes have little or no connection. Any kind of instru
mentality in producing an effect was often considered as pure
identity. Thus in Ait. Aran. II. I. 3 we find "Then comes the origin
of food. The seed of Prajapati are the gods. The seed of the gods
is rain. The seed of rain is herbs. The seed of herbs is food. The
seed of food is seed. The seed of seed is creatures. The seed of
creatures is the heart. The seed of the heart is the mind. The seed
of the mind is speech. The seed of speech is action. The act done
is this man the abode of Brahman 8 ."
The word Brahman according to Sayana meant mantras
(magical verses), the ceremonies, the hotr priest, the great.
Hillebrandt points out that it is spoken of in R.V. as being new,
"as not having hitherto existed," and as "coming into being from
the fathers." It originates from the seat of the Rta, springs forth
at the sound of the sacrifice, begins really to exist when the soma
juice is pressed and the hymns are recited at the savana rite,
endures with the help of the gods even in battle, and soma is its
guardian (R.V. vin. 37. i, vin. 69. 9, VI. 23. 5, i. 47. 2, vn. 22. 9,
VI. 52. 3, etc.). On the strength of these Hillebrandt justifies the
conjecture of Haug that it signifies a mysterious power which can
be called forth by various ceremonies, and his definition of it, as
the magical force which is derived from the orderly cooperation of
the hymns, the chants and the sacrificial gifts 8 . I am disposed to
think that this meaning is closely connected with the meaning as
we find it in many passages in the Aranyakas and the Upanisads.
The meaning in many of these seems to be midway between
1 Ait. Aran. II. 1-3. * Keith s Translation of Aitareya Aranyaka.
* Hillebrandt s article on Brahman, E. R. E.
in] Aranyakas and the Upanisads 37
"magical force" and "great," transition between which is
rather easy. Even when the sacrifices began to be replaced by
meditations, the old belief in the power of the sacrifices still
remained, and as a result of that we find that in many passages
of the Upanisads people are thinking of meditating upon this
great force " Brahman " as being identified with diverse symbols,
natural objects, parts and functions of the body.
When the main interest of sacrifice was transferred from its
actual performance in the external world to certain forms of
meditation, we find that the understanding of particular allegories
of sacrifice having a relation to particular kinds of bodily functions
was regarded as Brahman, without a knowledge of which nothing
could be obtained. The fact that these allegorical interpretations
of the Paficagnividya are so much referred to in the Upanisads
as a secret doctrine, shows that some people came to think that
the real efficacy of sacrifices depended upon such meditations.
When the sages rose to the culminating conception, that he is
really ignorant who thinks the gods to be different from him, they
thought that as each man was nourished by many beasts, so the
gods were nourished by each man, and as it is unpleasant for a
man if any of his beasts are taken away, so it is unpleasant for
the gods that men should know this great truth 1 .
In the Kena we find it indicated that all the powers of
the gods such as that of Agni (fire) to burn, Vayu (wind) to
blow, depended upon Brahman, and that it is through Brahman
that all the gods and all the senses of man could work. The
whole process of Upanisad thought shows that the magic power
of sacrifices as associated with Rta (unalterable law) was being
abstracted from the sacrifices and conceived as the supreme power.
There are many stories in the Upanisads of the search after the
nature of this great power the Brahman, which was at first only
imperfectly realized. They identified it with the dominating power
of the natural objects of wonder, the sun, the moon, etc. with
bodily and mental functions and with various symbolical re
presentations, and deluded themselves for a time with the idea
that these were satisfactory. But as these were gradually found
inadequate, they came to the final solution, and the doctrine of
the inner self of man as being the highest truth the Brahman
originated.
1 Brh. I. 4. 10.
38 The Earlier Upanisads [CH.
The meaning of the word Upanisad.
The word Upanisad is derived from the root sad with the prefix
ni (to sit), and Max Miiller says that the word originally meant the
act of sitting down near a teacher and of submissively listening to
him. In his introduction to the Upanisads he says, "The history
and the genius of the Sanskrit language leave little doubt that
Upanisad meant originallysession,particularlya session consisting
of pupils, assembled at a respectful distance round their teacher 1 ."
Deussen points out that the word means "secret "or "secret instruc
tion," and this is borne out by many of the passages of the Upani
sads themselves. Max Miiller also agrees that the word was used
in this sense in the Upanisads 8 . There we find that great injunc
tions of secrecy are to be observed for the communication of the
doctrines, and it is said that it should only be given to a student
or pupil who by his supreme moral restraint and noble desires
proves himself deserving to hear them. Sankara however, the
great Indian exponent of the Upanisads, derives the word from
the root sad to destroy and supposes that it is so called because it
destroys inborn ignorance and leads to salvation by revealing the
right knowledge. But if we compare the many texts in which the
word Upanisad occurs in the Upanisads themselves it seems that
Deussen s meaning is fully justified 8 .
The composition and growth of diverse Upanisads.
The oldest Upanisads are written in prose. Next to these we
have some in verses very similar to those that are to be found in
classical Sanskrit. As is easy to see, the older the Upanisad the
more archaic is it in its language. The earliest Upanisads have
an almost mysterious forcefulness in their expressions at least to
Indian ears. They are simple, pithy and penetrate to the heart.
We can read and read them over again without getting tired.
The lines are always as fresh as ever. As such they have a charm
apart from the value of the ideas they intend to convey. The word
Upanisad was used, as we have seen, in the sense of "secret
doctrine or instruction" ; the Upanisad teachings were also in
tended to be conveyed in strictest secrecy to earnest enquirers of
high morals and superior self-restraint for the purpose of achieving
1 Max MUller s Translation of the Upanishads, S. B.E, vol. I. p. Ixxxi.
a S. B. E. vol. I. p. Ixxxiii.
8 Deussen s Philosophy of the Upanishads, pp. 10-15.
in] Revival of Upanisad studies 39
emancipation. It was thus that the Upanisad style of expression,
when it once came into use, came to possess the greatest charm and
attraction for earnest religious people ; and as a result of that we
find that even when other forms of prose and verse had been
adapted for the Sanskrit language, the Upanisad form of com
position had not stopped. Thus though the earliest Upanisads
were compiled by 500 B.C., they continued to be written even so
late as the spread of Mahommedan influence in India. The
earliest and most important are probably those that have been
commented upon by^ankara namely Brhadaranyaka, Chandogya,
Aitareya, Taittirlya, fsa, Kena, Katha, PraSna, Mundaka and
Mandukya 1 . It is important to note in this connection that the
separate Upanisads differ much from one another with regard to
their content and methods of exposition. Thus while some of
them are busy laying great stress upon the monistic doctrine of
the self as the only reality, there are others which lay stress upon
the practice of Yoga, asceticism, the cult of Siva, of Visnu and
the philosophy or anatomy of the body, and may thus be
respectively called the Yoga, aiva, Visnu and J->arira Upanisads.
These in all make up the number to one hundred and eight.
Revival of Upanisad studies in modern times.
How the Upanisads came to be introduced into Europe is an
interesting story. Dara Shiko the eldest son of the Emperor
Shah Jahan heard of the Upanisads during his stay in Kashmir
in 1640. He invited several Pandits from Benares to Delhi, who
undertook the work of translating them into Persian. In 1775
Anquetil Duperron, the discoverer of the Zend-Avesta, received
a manuscript of it presented to him by his friend Le Gentil, the
French resident in Faizabad at the court of Shuja-uddaulah.
Anquetil translated it into Latin which was published in 1801-
1 802. This translation though largely unintelligible was read by
Schopenhauer with great enthusiasm. It had, as Schopenhauer
himself admits, profoundly influenced his philosophy. Thus he
1 Deussen supposes that Kausitaki is also one of the earliest. Max Miiller and
Schroeder think that Maitrayani also belongs to the earliest group, whereas Deussen
counts it as a comparatively later production. Winternitz divides the Upanisads into
four periods. In the first period he includes Brhadaranyaka, Chandogya, Taittiriya,
Aitareya, Kausitaki and Kena. In the second he includes Kathaka, Ia, SvetasVatara,
Mundaka, Mahanarayana, and in the third period he includes Pras na, Maitrayani and
Mandukya. The rest of the Upanisads he includes in the fourth period.
4O The Earlier Upanisads [CH.
writes in the preface to his Welt als Wille und Vorstellung^,
"And if, indeed, in addition to this he is a partaker of the benefit
conferred by the Vedas, the access to which, opened to us through
the Upanishads, is in my eyes the greatest advantage which this
still young century enjoys over previous ones, because I believe
that the influence of the Sanskrit literature will penetrate not less
deeply than did the revival of Greek literature in the fifteenth
century: if, I say, the reader has also already received and
assimilated the sacred, primitive Indian wisdom, then is he best
of all prepared to hear what I have to say to him. ...I might ex
press the opinion that each one of the individual and disconnected
aphorisms which make up the Upanishads may be deduced as
a consequence from the thought I am going to impart, though
the converse, that my thought is to be found in the Upanishads
is by no means the case." Again, "How does every line display
its firm,definite,and throughout harmonious meaning! From every
sentence deep, original, and sublime thoughts arise, and the whole
is pervaded by a high and holy and earnest spirit... In the whole
world there is no study, except that of the originals, so beneficial
and so elevating as that of the Oupanikhat. It has been the solace
of my life, it will be the solace of my death! 1 " Through Schopen
hauer the study of the Upanisads attracted much attention in
Germany and with the growth of a general interest in the study
of Sanskrit, they found their way into other parts of Europe as
well.
The study of the Upanisads has however gained a great
impetus by the earnest attempts of our Ram Mohan Roy who
not only translated them into Bengali, Hindi and English and
published them at his own expense, but founded the Brahma
Samaj in Bengal, the main religious doctrines of which were
derived directly from the Upanisads.
1 Translation by Haldane and Kemp, vol. I. pp. xii and xiii.
1 Max Muller says in his introduction to the Upanishads (S. B. E. I. p. Ixii ; see
also pp. Ix, bii) "that Schopenhauer should have spoken of the Upanishads as pro
ducts of the highest wisdom "...that he should have placed the pantheism there taught
high above the pantheism of Bruno, Malebranche, Spinoza and Scotus Erigena, as
brought to light again at Oxford in 1681, may perhaps secure a more considerate
reception for those relics of ancient wisdom than anything that I could say in their
favour."
in] The Upanisads and their interpretations 41
The Upanisads and their interpretations.
Before entering into the philosophy of the Upanisads it may
be worth while to say a few words as to the reason why diverse
and even contradictory explanations as to the real import of the
Upanisads had been offered by the great Indian scholars of past
times. The Upanisads, as we have seen, formed the concluding
portion of the revealed Vedic literature, and were thus called the
Vedanta. It was almost universally believed by the Hindus that
the highest truths could only be found in the revelation of the
Vedas. Reason was regarded generally as occupying a compara
tively subservient place, and its proper use was to be found in its
judicious employment in getting out the real meaning of the
apparently conflicting ideas of the Vedas. The highest know
ledge of ultimate truth and reality was thus regarded as having
been once for all declared in the Upanisads. Reason had only to
unravel it in the light of experience. It is important that readers
of Hindu philosophy should bear in mind the contrast that it
presents to the ruling idea of the modern world that new truths
are discovered by reason and experience every day, and even in
those cases where the old truths remain, they change their hue
and character every day, and that in matters of ultimate truths no
finality can ever be achieved ; we are to be content only with as
much as comes before the purview of our reason and experience
at the time. It was therefore thought to be extremely audacious
that any person howsoever learned and brilliant he might be
should have any right to say anything regarding the highest
truths simply on the authority of his own opinion or the reasons
that he might offer. In order to make himself heard it was neces
sary for him to show from the texts of the Upanisads that they
supported him, and that their purport was also the same. Thus
it was that most schools of Hindu philosophy found it one of their
principal duties to interpret the Upanisads in order to show that
they alone represented the true Vedanta doctrines. Any one
who should feel himself persuaded by the interpretations of any
particular school might say that in following that school he was
following the Vedanta.
The difficulty of assuring oneself that any interpretation is
absolutely the right one is enhanced by the fact that germs of
diverse kinds of thoughts are found scattered over the Upanisads
42 The Earlier Upanisads [CH.
which are not worked out in a systematic manner. Thus each
interpreter in his turn made the texts favourable to his own
doctrines prominent and brought them to the forefront, and tried
to repress others or explain them away. But comparing the
various systems of Upanisad interpretation we find that the in
terpretation offered by arikara very largely represents the view
of the general body of the earlier Upanisad doctrines, though
there are some which distinctly foreshadow the doctrines of other
systems, but in a crude and germinal form. It is thus that Vedanta
is generally associated with the interpretation of ^arikara and
arikara s system of thought is called the Vedanta system, though
there are many other systems which put forth their claim as repre
senting the true Vedanta doctrines.
Under these circumstances it is necessary that a modern in
terpreter of the Upanisads should turn a deaf ear to the absolute
claims of these exponents, and look upon the Upanisads not as
a systematic treatise but as a repository of diverse currents of
thought the melting pot in which all later philosophic ideas were
still in a state of fusion, though the monistic doctrine of ^arikara,
or rather an approach thereto, may be regarded as the purport of
by far the largest majority of the texts. It will be better that a
modern interpreter should not agree to the claims of the ancients
that all the Upanisads represent a connected system, but take the
texts independently and separately and determine their meanings,
though keeping an attentive eye on the context in which they
appear. It is in this way alone that we can detect the germs of
the thoughts of other Indian systems in the Upanisads, and thus
find in them the earliest records of those tendencies of thoughts.
The quest after Brahman: the struggle and the failures.
The fundamental idea which runs through the early Upanisads
is that underlying the exterior world of change there is an un
changeable reality which is identical with that which underlies
the essence in man 1 . If we look at Greek philosophy in Par-
menides or Plato or at modern philosophy in Kant, we find the
same tendency towards glorifying one unspeakable entity as the
reality or the essence. I have said above that the Upanisads are
1 Brh. iv. 4. 5, 11.
m] The Quest after Brahman 43
no systematic treatises of a single hand, but are rather collations
or compilations of floating monologues, dialogues or anecdotes.
There are no doubt here and there simple discussions but there
is no pedantry or gymnastics of logic. Even the most casual
reader cannot but be struck with the earnestness and enthusiasm
of the sages. They run from place to place with great eagerness
in search of a teacher competent to instruct them about the nature
of Brahman. Where is Brahman? What is his nature?
We have noticed that during the closing period of the Samhita
there were people who had risen to the conception of a single
creator and controller of the universe, variously called Prajapati,
VisVakarman, Purusa, Brahmanaspati and Brahman. But this
divine controller was yet only a deity. The search as to the
nature of this deity began in the Upanisads. Many visible objects
of nature such as the sun or the wind on one hand and the various
psychological functions in man were tried, but none could render
satisfaction to the great ideal that had been aroused. The sages
in the Upanisads had already started with the idea that there was
a supreme controller or essence presiding over man and the
universe. But what was its nature? Could it be identified with
any of the deities of Nature, was it a new deity or was it no deity
at all? The Upanisads present to us the history of this quest and
the results that were achieved.
When we look merely to this quest we find that we have not
yet gone out of the Aranyaka ideas and of symbolic (pratika)
forms of worship. Prana (vital breath) was regarded as the most
essential function for the life of man, and many anecdotes are
related to show that it is superior to the other organs, such as the
eye or ear, and that on it all other functions depend. This
recognition of the superiority of prana brings us to the meditations
on prana as Brahman as leading to the most beneficial results.
So also we find that owing to the presence of the exalting
characters of omnipresence and eternality dkd&a (space) is
meditated upon as Brahman. So also manas and Aditya (sun)
are meditated upon as Brahman. Again side by side with the
visible material representation of Brahman as the pervading Vayu,
or the sun and the immaterial representation as akasa, manas or
prana, we find also the various kinds of meditations as substitutes
for actual sacrifice. Thus it is that there was an earnest quest
after the discovery of Brahman. We find a stratum of thought
44 The Earlier Upanisads [CH.
which shows that the sages were still blinded by the old ritualistic
associations, and though meditation had taken the place of sacrifice
yet this was hardly adequate for the highest attainment of
Brahman.
Next to the failure of the meditations we have to notice the
history of the search after Brahman in which the sages sought to
identify Brahman with the presiding deity of the sun, moon,
lightning, ether, wind, fire, water, etc., and failed; for none of
these could satisfy the ideal they cherished of Brahman. It is
indeed needless here to multiply these examples, for they are
tiresome not only in this summary treatment but in the original
as well. They are of value only in this that they indicate how
toilsome was the process by which the old ritualistic associations
could be got rid of; what struggles and failures the sages had to
undergo before they reached a knowledge of the true nature of
Brahman.
Unknowability of Brahman and the Negative Method.
It is indeed true that the magical element involved in the
discharge of sacrificial duties lingered for a while in the symbolic
worship of Brahman in which He was conceived almost as a deity.
The minds of the Vedic poets so long accustomed to worship
deities of visible manifestation could not easily dispense with the
idea of seeking after a positive and definite content of Brahman.
They tried some of the sublime powers of nature and also many
symbols, but these could not render ultimate satisfaction. They
did not know what the Brahman was like, for they had only a
dim and dreamy vision of it in the deep craving of their souls
which could not be translated into permanent terms. But this
was enough to lead them on to the goal, for they could not be
satisfied with anything short of the highest.
They found that by whatever means they tried to give a
positive and definite content of the ultimate reality, the Brahman,
they failed. Positive definitions were impossible. They could not
point out what the Brahman was like in order to give an utterance
to that which was unutterable, they could only say that it was not
like aught that we find in experience. Yajfiavalkya said "He
the atman is not this, nor this (neti neti). He is inconceivable,
for he cannot be conceived, unchangeable, for he is not changed,
untouched, for nothing touches him ; he cannot suffer by a stroke
in] The Negative Method and the Atman doctrine 45
of the sword, he cannot suffer any injury 1 ." He is asaf, non-being,
for the being which Brahman is, is not to be understood as such
being as is known to us by experience ; yet he is being, for he alone
is supremely real, for the universe subsists by him. We ourselves
are but he, and yet we know not what he is. Whatever we can
experience, whatever we can express, is limited, but he is the
unlimited, the basis of all. "That which is inaudible, intangible,
invisible, indestructible, which cannot be tasted, nor smelt, eternal,
without beginning or^nd, greater than the great (makat\\he fixed.
He who knows it is released from the jaws of death 3 ." Space, time
and causality do not appertain to him, for he at once forms their
essence and transcends them. He is the infinite and the vast, ye.t
the smallest of the small, at once here as there, there as here; no
characterisation of him is possible, otherwise than by the denial
to him of all empirical attributes, relations and definitions. He
is independent of all limitations of space, time, and cause which
rules all that is objectively presented, and therefore the empirical
universe. When Bahva was questioned by Vaskali, he expounded
the nature of Brahman to him by maintaining silence "Teach
me," said Vaskali, "most reverent sir, the nature of Brahman."
Bahva however remained silent. But when the question was put
forth a second or third time he answered, " I teach you indeed but
you do not understand; the Atman is silence 8 ." The way to in
dicate it is thus by neti neti, it is not this, it is not this. We
cannot describe it by any positive content which is always limited
by conceptual thought.
The Atman doctrine.
The sum and substance of the Upanisad teaching is involved
in the equation Atman = Brahman. We have already seen that the
word Atman was used in the Rg-Veda to denote on the one hand
the ultimate essence of the universe, and on the other the vital
breath in man. Later on in the Upanisads we see that the word
Brahman is generall> used in the former sense, while the word
Atman is reserved to denote the inmost essence in man, and the
1 Brh. IV. 5. 15. Deussen, Max Miiller and Roer have all misinterpreted this
passage; asito has been interpreted as an adjective or participle, though no evidence
has ever been adduced ; it is evidently the ablative of asi, a sword.
a Katha III. 15.
3 Ssankara on BraJimasiitra, III. t. 17, and also Deussen, Philosophy of the Upani-
skads, p. 156,
46 The Earlier Upanisads [CH.
Upanisads are emphatic in their declaration that the two are one
and the same. But what is the inmost essence of man? The self
of man involves an ambiguity, as it is used in a variety of senses.
Thus so far as man consists of the essence of food (i.e. the physical
parts of man) he is called annamaya. But behind the sheath of
this body there is the other self consisting of the vital breath
which is called the self as vital breath (prdnamaya dtman),
Behind this again there is the other self "consisting of will" called
the manomaya dtman. This again contains within it the self
"consisting of consciousness" called the vijndnamaya dtman. But
behind it we come to the final essence the self as pure bliss (the
dnandamaya dtman). The texts say: "Truly he is the rapture;
for whoever gets this rapture becomes blissful. For who could
live, who could breathe if this space (dkdsa) was not bliss? For
it is he who behaves as bliss. For whoever in that Invisible, Self-
surpassing, Unspeakable, Supportless finds fearless support, he
really becomes fearless. But whoever finds even a slight difference,
between himself and this Atman there is fear for him 1 ."
Again in another place we find that Prajapati said: "The self
(dtman) which is free from sin, free from old age, from death and
grief, from hunger and thirst, whose desires are true, whose cogita
tions are true, that is to be searched for, that is to be enquired ;
he gets all his desires and all worlds who knows that self 3 ." The
gods and the demons on hearing of this sent Indra and Virocana
respectively as their representatives to enquire of this self from
Prajapati. He agreed to teach them, and asked them to look
into a vessel of water and tell him how much of self they could
find. They answered : " We see, this our whole self, even to the
hair, and to the nails." And he said, "Well, that is the self, that
is the deathless and the fearless, that is the Brahman." They went
away pleased, but Prajapati thought, "There they go away,
without having discovered, without having realized the self."
Virocana came away with the conviction that the body was the
self ; but Indra did not return back to the gods, he was afraid and
pestered with doubts and came back to Prajapati and said, "just
as the self becomes decorated when the body is decorated, well-
dressed when the body is well-dressed, well-cleaned when the
body is well-cleaned, even so that image self will be blind when
the body is blind, injured in one eye when the body is injured in
one eye, and mutilated when the body is mutilated, and it perishes
1 Taitt. n. 7. 2 Cha. vin. 7. i.
in] Atman as changeless 47
when the body perishes, therefore I can see no good in this theory."
Prajapati then gave him a higher instruction about the self, and
said, "He who goes about enjoying dreams, he is the self, this
is the deathless, the fearless, this is Brahman." Indra departed
but was again disturbed with doubts, and was afraid and came
back and said "that though the dream self does not become blind
when the body is blind, or injured in one eye when the body is
so injured and is not affected by its defects, and is not killed by
its destruction, but yet it is as if it was overwhelmed, as if it suffered
and as if it wept in this I see no good." Prajapati gave a still
higher instruction : "When a man, fast asleep, in total contentment,
does not know any dreams, this is the self, this is the deathless,
the fearless, this is Brahman." Indra departed but was again
filled with doubts on the way, and returned again and said "the
self in deep sleep does not know himself, that I am this, nor does
he know any other existing objects. He is destroyed and lost.
I see no good in this." And now Prajapati after having given a
course of successively higher instructions as self as the body, as
the self in dreams and as the self in deep dreamless sleep, and
having found that the enquirer in each case could find out that this
was not the ultimate truth about the self that he was seeking,
ultimately gave him the ultimate and final instruction about the
full truth about the self, and said "this body is the support of the
deathless and the bodiless self. The self as embodied is affected
by pleasure and pain, the self when associated with the body can
not get rid of pleasure and pain, but pleasure and pain do not
touch the bodiless self 1 ."
As the anecdote shows, they sought such a constant and un
changeable essence in man as was beyond the limits of any change.
This inmost essence has sometimes been described as pure subject-
object-less consciousness, the reality, and the bliss. He is the
seer of all seeing, the hearer of all hearing and the knower of all
knowledge. He sees but is not seen, hears but is not heard, knows
but is not known. He is the light of all lights. He is like a lump
of salt, with no inner or outer, which consists through and through
entirely of savour; as in truth this Atman has no inner or outer,
but consists through and through entirely of knowledge. Bliss is
not an attribute of it but it is bliss itself. The state of Brahman
is thus likened unto the state of dreamless sleep. And he who
has reached this bliss is beyond any fear. It is dearer to us than
1 Cha. vm. 7-i.
48 The Earlier Upanisads [CH.
son, brother, wife, or husband, wealth or prosperity. It is for it
and by it that things appear dear to us. It is the dearest par
excellence, our inmost Atman. All limitation is fraught with pain ;
it is the infinite alone that is the highest bliss. When a man
receives this rapture, then is he full of bliss ; for who could breathe,
who live, if that bliss had not filled this void (akdsd)1 It is he
who behaves as bliss. For when a man finds his peace, his fearless
support in that invisible, supportless, inexpressible, unspeakable
one, then has he attained peace.
Place of Brahman in the Upanisads.
There is the atman not in man alone but in all objects of the
universe, the sun, the moon, the world ; and Brahman is this atman.
There is nothing outside the atman, and therefore there is no
plurality at all. As from a lump of clay all that is made of clay
is known, as from an ingot of black iron all that is made of
black iron is known, so when this atman the Brahman is known
everything else is known. The essence in man and the essence
of the universe are one and the same, and it is Brahman.
Now a question may arise as to what may be called the nature
of the phenomenal world of colour, sound, taste, and smell. But
we must also remember that the Upanisads do not represent so
much a conceptional system of philosophy as visions of the seers
who are possessed by the spirit of this Brahman. They do not
notice even the contradiction between the Brahman as unity and
nature in its diversity. When the empirical aspect of diversity
attracts their notice, they affirm it and yet declare that it is all
Brahman. From Brahman it has come forth and to it will it
return. He has himself created it out of himself and then entered
into it as its inner controller (antarydmin). Here is thus a glaring
dualistic trait of the world of matter and Brahman as its controller,
though in other places we find it asserted most emphatically that
these are but names and forms, and when Brahman is known
everything else is known. No attempts at reconciliation are made
for the sake of the consistency of conceptual utterance, as
^aiikara the great professor of Vedanta does by explaining away
the dualistic texts. The universe is said to be a reality, but the
real in it is Brahman alone. It is on account of Brahman that
the fire burns and the wind blows. He is the active principle in
the entire universe, and yet the most passive and unmoved. The
in] Brahman in the Upanisads 49
world is his body, yet he is the soul within. "He creates all,
wills all, smells all, tastes all, he has pervaded all, silent and un
affected 1 ". He is below, above, in the back, in front, in the south
and in the north, he is all this 2 . "These rivers in the east and
in the west originating from the ocean, return back into it and
become the ocean themselves, though they do not know that they
are so. So also all these people coming into being from the Being
do not know that they have come from the Being.... That which
is the subtlest that is the self, that is all this, the truth, that self
thou art O Svetaketu 3 ." "Brahman," as Deussen points out,
"was regarded as the cause antecedent in time, and the universe
as the effect proceeding from it; the inner dependence of the
universe on Brahman and its essential identity with him was
represented as a creation of the universe by and out of Brahman."
Thus it is said in Mund. I. i. 7:
As a spider ejects and retracts (the threads),
As the plants shoot forth on the earth,
As the hairs on the head and body of the living man,
So from the imperishable all that is here.
As the sparks from the well-kindled fire,
In nature akin to it, spring forth in their thousands,
So, my dear sir, from the imperishable
Living beings of many kinds go forth,
And again return into him 4 .
Yet this world principle is the dearest to us and the highest
teaching of the Upanisads is "That art thou."
Again the growth of the doctrine that Brahman is the "inner
controller" in all the parts and forces of nature and of mankind as
the atman thereof, and that all the effects of the universe are the
result of his commands which no one can outstep, gave rise to a
theistic current of thought in which Brahman is held as standing
aloof as God and controlling the world. It is by his ordaining, it
is said, that the sun and moon are held together, and the sky and
earth stand held together 5 . God and soul are distinguished again
in the famous verse of Svetasvatara 6 :
Two bright-feathered bosom friends
Flit around one and the same tree ;
One of them tastes the sweet berries,
The other without eating merely gazes down.
1 Cha. Hi. 14. 4. 2 Ibid. vn. 25. i; also Mundaka II. i. n. s Cha. VI. 10.
4 Deussen s translation in Philosophy of the Upanishads, p. 164. 5 Brh. m. 8. i.
6 Svetasvatara iv. 6, and Mundaka ill. i. i, also Deussen s translation in Philosophy
of the Upanishads, p. 177.
D. A
50 The Earlier Upanisads [CH.
But in spite of this apparent theistic tendency and the occa
sional use of the word Isa or hdna, there seems to be no doubt
that theism in its true sense was never prominent, and this acknow
ledgement of a supreme Lord was also an offshoot of the exalted
position of the atman as the supreme principle. Thus we read in
Kausltaki Upanisad 3. 9, " He is not great by good deeds nor low
by evil deeds, but it is he makes one do good deeds whom he
wants to raise, and makes him commit bad deeds whom he wants
to lower down. He is the protector of the universe, he is the
master of the world and the lord of all; he is my soul (atman)."
Thus the lord in spite of his greatness is still my soul. There are
again other passages which regard Brahman as being at once
immanent and transcendent. Thus it is said that there is that
eternally existing tree whose roots grow upward and whose
branches grow downward. All the universes are supported in it
and no one can transcend it. This is that, " . . .from its fear the fire
burns, the sun shines, and from its fear Indra, Vayu and Death
the fifth (with the other two) run on 1 ."
If we overlook the different shades in the development of the
conception of Brahman in the Upanisads and look to the main
currents, we find that the strongest current of thought which has
found expression in the majority of the texts is this that the
Atman or the Brahman is the only reality and that besides this
everything else is unreal. The other current of thought which is
to be found in many of the texts is the pantheistic creed that
identifies the universe with the Atman or Brahman. The third
current is that of theism which looks upon Brahman as the Lord
controlling the world. It is because these ideas were still in the
melting pot, in which none of them were systematically worked
out, that the later exponents of Vedanta, ^ankara, Ramanuja,
and others quarrelled over the meanings of texts in order to
develop a consistent systematic philosophy out of them. Thus it
is that the doctrine of Maya which is slightly hinted at once in
Brhadaranyaka and thrice in ^veta^vatara, becomes the founda
tion of ankara s philosophy of the Vedanta in which Brahman
alone is real and all else beside him is unreal 2 .
1 Katha n. 6. i and 3. a Brh. II. 5. 19, vet. I. 10, IV. 9, 10.
m] The World 51
The World.
We have already seen that the universe has come out of
Brahman, has its essence in Brahman, and will also return back
to it. But in spite of its existence as Brahman its character as
represented to experience could not be denied. Sankara held
that the Upanisads referred to the external world and accorded
a reality to it consciously with the purpose of treating it as merely
relatively real, which will eventually appear as unreal as soon
as the ultimate truth, the Brahman, is known. This however
remains to be modified to this extent that the sages had not
probably any conscious purpose of according a relative reality to
the phenomenal world, but in spite of regarding Brahman as the
highest reality they could not ignore the claims of the exterior
world, and had to accord a reality to it. The inconsistency of this
reality of the phenomenal world with the ultimate and only
reality of Brahman was attempted to be reconciled by holding
that this world is not beside him but it has come out of him, it
is maintained in him and it will return back to him.
The world is sometimes spoken of in its twofold aspect, the i
organic and the inorganic. All organic things, whether plants, )
animals or men, have souls 1 . Brahman desiring to be many created
fire (tejas\ water (ap) and earth (ksiti). Then the self-existent
Brahman entered into these three, and it is by their combination
that all other bodies are formed 2 . So all other things are produced
as a result of an alloying or compounding of the parts of these three
together. In this theory of the threefold division of the primitive
elements lies the earliest germ of the later distinction (especially
in the Samkhya school) of pure infinitesimal substances (tanmdtrd)
and gross elements, and the theory that each gross substance is
composed of the atoms of the primary elements. And in Prana
IV. 8 we find the gross elements distinguished from their subtler
natures, e.g. earth (prthivt), and the subtler state of earth
(prthivtmdtra). In the Taittirlya, II. i, however, ether (dkdsa)
is also described as proceeding from Brahman, and the other
elements, air, fire, water, and earth, are described as each pro
ceeding directly from the one which directly preceded it.
1 Cha. vi. 1 1. * ibid. vi. 2, 3, 4.
42
52 The Earlier Upanisads [CH.
The World-Soul.
The conception of a world-soul related to the universe as the
soul of man to his body is found for the first time in R.V. X. 121. I,
where he is said to have sprung forth as the firstborn of creation
from the primeval waters. This being has twice been referred
to in the vetavatara, in III. 4 and IV. 1 2. It is indeed very strange
that this being is not referred to in any of the earlier Upanisads.
In the two passages in which he has been spoken of, his mythical
character is apparent. He is regarded as one of the earlier
products in the process of cosmic creation, but his importance
from the point of view of the development of the theory of
Brahman or Atman is almost nothing. The fact that neither the
Purusa, nor the ViSvakarma, nor the Hiranyagarbha played an
important part in the earlier development of the Upanisads
leads me to think that the Upanisad doctrines were not directly
developed from the monotheistic tendencies of the later Rg-Veda
speculations. The passages in &vetas" vatara clearly show how from
the supreme eminence that he had in R.V. X. 121, Hiranyagarbha
had been brought to the level of one of the created beings. Deussen
in explaining the philosophical significance of the Hiranyagarbha
doctrine of the Upanisads says that the "entire objective universe is
possible only in so far as it is sustained by a knowing subject. This
subject as a sustainer of the objective universe is manifested in
all individual objects but is by no means identical with them. For
the individual objects pass away but the objective universe con
tinues to exist without them; there exists therefore the eternal
knowing subject also (hiranyagarbhd) by whom it is sustained.
Space and time are derived from this subject. It is itself accord
ingly not in space and does not belong to time, and therefore
from an empirical point of view it is in general non-existent; it
has no empirical but only a metaphysical reality 1 ." This however
seems to me to be wholly irrelevant, since the Hiranyagarbha
doctrine cannot be supposed to have any philosophical importance
in the Upanisads.
The Theory of Causation.
There was practically no systematic theory of causation in the
Upanisads. Sankara, the later exponent of Vedanta philosophy,
always tried to show that the Upanisads looked upon the cause
1 Deussen s Philosophy of the Upaniskads, p. 201.
in] Transmigration 53
as mere ground of change which though unchanged in itself in
reality had only an appearance of suffering change. This he did
on the strength of a series of examples in the Chandogya
Upanisad (vi. i) in which the material cause, e.g. the clay, is
spoken of as the only reality in all its transformations as the pot,
the jug or the plate. It is said that though there are so many
diversities of appearance that one is called the plate, the other the
pot, and the other the jug, yet these are only empty distinctions of
name and form, for the only thing real in them is the earth which
in its essence remains ever the same whether you call it the pot,
plate, or jug. So it is that the ultimate cause, the unchangeable
Brahman, remains ever constant, though it may appear to suffer
change as the manifold world outside. This world is thus only
an unsubstantial appearance, a mirage imposed upon Brahman,
the real par excellence.
It seems however that though such a view may be regarded
as having been expounded in the Upanisads in an imperfect
manner, there is also side by side the other view which looks
upon the effect as the product of a real change wrought in the
cause itself through the action and combination of the elements
of diversity in it. Thus when the different objects of nature have
been spoken of in one place as the product of the combination
of the three elements fire, water and earth, the effect signifies a real
change produced by their compounding. This is in germ (as we
shall see hereafter) the Parinama theory of causation advocated
by the Samkhya school 1 .
Doctrine of Transmigration.
When the Vedic people witnessed the burning of a dead body
they supposed that the eye of the man went to the sun, his breath
to the wind, his speech to the fire, his limbs to the different parts
of the universe. They also believed as we have already seen in
the recompense of good and bad actions in worlds other than our
own, and though we hear of such things as the passage of the
human soul into trees, etc., the tendency towards transmigration
had but little developed at the time.
In the Upanisads however we find a clear development in
the direction of transmigration in two distinct stages. In the one
the Vedic idea of a recompense in the other world is combined with
1 Cha. vi. 4-4.
54 The Earlier Upanisads [CH.
the doctrine of transmigration, whereas in the other the doctrine
of transmigration comes to the forefront in supersession of the
idea of a recompense in the other world. Thus it is said that
those who performed charitable deeds or such public works as the
digging of wells, etc., follow after death the way of the fathers
(J>itryana\ in which the soul after death enters first into smoke,
then into night, the dark half of the month, etc., and at last reaches
the moon ; after a residence there as long as the remnant of his
good deeds remains he descends again through ether, wind, smoke,
mist, cloud, rain, herbage, food and seed, and through the assimi
lation of food by man he enters the womb of the mother and is
born again. Here we see that the soul had not only a recompense
in the world of the moon, but was re-born again in this world 1 .
The other way is the way of gods (devaydna), meant for those
who cultivate faith and asceticism (tafias). These souls at death
enter successively into flame, day, bright half of the month, bright
half of the year, sun, moon, lightning, and then finally into
Brahman never to return. Deussen says that "the meaning of
the whole is that the soul on the way of the gods reaches regions
of ever-increasing light, in which is concentrated all that is bright
and radiant as stations on the way to Brahman the light of
lights " {jyotisam jyotiK)*-
The other line of thought is a direct reference to the doctrine
of transmigration unmixed with the idea of reaping the fruits of
his deeds (karma) by passing through the other worlds and with
out reference to the doctrine of the ways of the fathers and gods,
the Yanas. Thus Yajnavalkya says, "when the soul becomes
weak (apparent weakness owing to the weakness of the body with
which it is associated) and falls into a swoon as it were, these senses
go towards it. It (Soul) takes these light particles within itself and
centres itself only in the heart. Thus when the person in the eye
turns back, then the soul cannot know colour; (the senses) become
one(with him); (people about him) say he does not see; (the senses)
become one (with him), he does not smell, (the senses) become
one (with him), he does not taste, (the senses) become one (with
him), he does not speak, (the senses) become one (with him), he
does not hear, (the senses) become one (with him), he does not
think, (the senses) become one with him, he does not touch, (the
senses) become one with him, he does not know, they say. The
1 Cha. V. 10. 2 Deussen s Philosophy of the Upaniskads, p. 335.
in] Transmigration 55
tip of his heart shines and by that shining this soul goes out.
When he goes out either through the eye, the head, or by any
other part of the body, the vital function (prdnd) follows and all
the senses follow the vital function (prdna) in coming out. He
is then with determinate consciousness and as such he comes
out. Knowledge, the deeds as well as previous experience (prajfta)
accompany him. Just as a caterpillar going to the end of a blade
of grass, by undertaking a separate movement collects itself, so
this self after destroying this body, removing ignorance, by a
separate movement collects itself. Just as a goldsmith taking a
small bit of gold, gives to it a newer and fairer form, so the soul
after destroying this body and removing ignorance fashions a
newer and fairer form as of the Pitrs, the Gandharvas, the gods,
of Prajapati or Brahma or of any other being.... As he acts and
behaves so he becomes, good by good deeds, bad by bad deeds,
virtuous by virtuous deeds and vicious by vice. The man is full
of desires. As he desires so he wills, as he wills so he works, as
the work is done so it happens. There is also a verse, being
attached to that he wants to gain by karma that to which he
was attached. Having reaped the full fruit (lit. gone to the
end) of the karma that he does here, he returns back to this
world for doing karma 1 . So it is the case with those who have
desires. He who has no desires, who had no desires, who has
freed himself from all desires, is satisfied in his desires and in
himself, his senses do not go out. He being Brahma attains
Brahmahood. Thus the verse says, when all the desires that are
in his heart are got rid of, the mortal becomes immortal and
attains Brahma here" (Brh. IV. iv. 1-7).
A close consideration of the above passage shows that the
self itself destroyed the body and built up a newer and fairer
frame by its own activity when it reached the end of the present
life. At the time of death, the self collected within itself all
senses and faculties and after death all its previous knowledge,
work and experience accompanied him. The falling off of the
body at the time of death is only for the building of a newer
body either in this world or in the other worlds. The self which
thus takes rebirth is regarded as an aggregation of diverse cate
gories. Thus it is said that "he is of the essence of understanding,
1 It is possible that there is a vague and obscure reference here to the doctrine that
thi fruits of our deeds are reaped in other worlds.
56 The Earlier Upanisads [CH.
of the vital function, of the visual sense, of the auditory sense, of
the essence of the five elements (which would make up the
physical body in accordance with its needs) or the essence of de
sires, of the essence of restraint of desires, of the essence of anger, of
the essence of turning off from all anger, of the essence of dharma,
of the essence of adharma, of the essence of all that is this
(manifest) and that is that (unmanifest or latent)" (Brh. IV. iv. 5).
The self that undergoes rebirth is thus a unity not only of moral
and psychological tendencies, but also of all the elements which
compose the physical world. The whole process of his changes
follows from this nature of his ; for whatever he desires, he wills
and whatever he wills he acts, and in accordance with his acts
the fruit happens. The whole logic of the genesis of karma and
its fruits is held up within him, for he is a unity of the moral
and psychological tendencies on the one hand and elements of
the physical world on the other.
The self that undergoes rebirth being a combination of diverse
psychological and moral tendencies and the physical elements
holds within itself the principle of all its transformations. The
root of all this is the desire of the self and the consequent fruition
of it through will and act. When the self continues to desire and
act, it reaps the fruit and comes again to this world for performing
acts. This world is generally regarded as the field for perform
ing karma, whereas other worlds are regarded as places where the
fruits of karma are reaped by those born as celestial beings. But
there is no emphasis in the Upanisads on this point. The Pitryana
theory is not indeed given up, but it seems only to form a part
in the larger scheme of rebirth in other worlds and sometimes in
this world too. All the course of these rebirths is effected by the
self itself by its own desires, and if it ceases to desire, it suffers no
rebirth and becomes immortal. The most distinctive feature of
this doctrine is this, that it refers to desires as the cause of rebirth
and not karma. Karma only comes as the connecting link between
desires and rebirth for it is said that whatever a man desires he
wills, and whatever he wills he acts.
Thus it is said in another place " he who knowingly desires is
born by his desires in those places (accordingly), but for him whose
desires have been fulfilled and who has realized himself, all his
desires vanish here" (Mund III. 2. 2). This destruction of desires
is effected by the right knowledge of the self. " He who knows
in] Transmigration 57
his self as I am the person for what wish and for what desire
will he trouble the body,... even being here if we know it, well if
we do not, what a great destruction" (Brh. IV. iv. 12 and 14). " In
former times the wise men did not desire sons, thinking what
shall we do with sons since this our self is the universe " (Brh. IV.
iv. 22). None of the complexities of the karma doctrine which
we find later on in more recent developments of Hindu thought
can be found in the Upanisads. The whole scheme is worked
out on the principle of desire (kfimd) and karma only serves as
the link between it and the actual effects desired and willed by
the person.
It is interesting to note in this connection that consistently
with the idea that desires (k&ma) led to rebirth, we find that
in some Upanisads the discharge of the semen in the womb of a
woman as a result of desires is considered as the first birth of
man, and the birth of the son as the second birth and the birth
elsewhere after death is regarded as the third birth. Thus it is
said, "It is in man that there comes first the embryo, which is
but the semen which is produced as the essence of all parts of
his body and which holds itself within itself, and when it is put
in a woman, that is his first birth. That embryo then becomes
part of the woman s self like any part of her body ; it therefore
does not hurt her ; she protects and develops the embryo within
herself. As she protects (the embryo) so she also should be
protected. It is the woman who bears the embryo (before birth)
but when after birth the father takes care of the son always, he
is taking care only of himself, for it is through sons alone that
the continuity of the existence of people can be maintained. This
is his second birth. He makes this self of his a representative
for performing all the virtuous deeds. The other self of his after
realizing himself and attaining age goes away and when going
away he is born again that is his third birth " (Aitareya, II. 1-4)*.
No special emphasis is given in the Upanisads to the sex-desire
or the desire for a son ; for, being called kama, whatever was the
desire for a son was the same as the desire for money and the
desire for money was the same as any other worldly desire (Brh.
iv. iv. 22), and hence sex-desires stand on the same plane as any
other desire.
1 See also Kausitaki, II. 15.
58 The Earlier Upanisads [CH.
Emancipation.
The doctrine which next attracts our attention in this connec
tion is that of emancipation (mukti). Already we know that the
doctrine of Devayana held that those who were faithful and per
formed asceticism (tapas) went by the way of the gods through
successive stages never to return to the world and suffer rebirth.
This could be contrasted with the way of the fathers (pitrydnd)
where the dead were for a time recompensed in another world and
then had to suffer rebirth. Thus we find that those who are faith
ful and perform sraddhd had a distinctly different type of goal from
those who performed ordinary virtues, such as those of a general
altruistic nature. This distinction attains its fullest development
in the doctrine of emancipation. Emancipation or Mukti means
in the Upanisads the state of infiniteness that a man attains
when he knows his own self and thus becomes Brahman. The
ceaseless course of transmigration is only for those who are
ignorant. The wise man however who has divested himself of all
passions and knows himself to be Brahman, at once becomes
Brahman and no bondage of any kind can ever affect him.
He who beholds that loftiest and deepest,
For him the fetters of the heart break asunder,
For him all doubts are solved,
And his works become nothingness 1 .
The knowledge of the self reveals the fact that all our passions
and antipathies, all our limitations of experience, all that is
ignoble and small in us, all that is transient and finite in us is
false. We " do not know " but are " pure knowledge " ourselves.
We are not limited by anything, for we are the infinite; we do
not suffer death, for we are immortal. Emancipation thus is not
a new acquisition, product, an effect, or result of any action, but
it always exists as the Truth of our nature. We are always
emancipated and always free. We do not seem to be so and
seem to suffer rebirth and thousands of other troubles only because
we do not know the true nature of our self. Thus it is that the
true knowledge of self does not lead to emancipation but is
emancipation itself. All sufferings and limitations are true only
so long as we do not know our self. Emancipation is the natural
and only goal of man simply because it represents the true nature
and essence of man. It is the realization of our own nature that
1 Deussen s Philosophy of the Upanishads, p. 353.
in] Emancipation 59
is called emancipation. Since we are all already and always in
our own true nature and as such emancipated, the only thing
necessary for us is to know that we are so. Self-knowledge is there
fore the only desideratum which can wipe off all false knowledge,
all illusions of death and rebirth. The story is told in the Katha
Upanisad that Yama, the lord of death, promised Naciketas,
the son of Gautama, to grant him three boons at his choice.
Naciketas, knowing that his father Gautama was offended with
him, said, " O death let Gautama be pleased in mind and forget
his anger against me." This being granted Naciketas asked the
second boon that the fire by which heaven is gained should be
made known to him. This also being granted Naciketas said,
" There is this enquiry, some say the soul exists after the death
of man ; others say it does not exist. This I should like to know
instructed by thee. This is my third boon." Yama said, " It was
inquired of old, even by the gods ; for it is not easy to under
stand it Subtle is its nature, choose another boon. Do not-
compel me to this." Naciketas said, " Even by the gods was it
inquired before, and even thou O Death sayest that it is not easy
to understand it, but there is no other speaker to be found like
thee. There is no other boon like this." Yama said, " Choose sons
and grandsons who may live a hundred years, choose herds of
cattle ; choose elephants and gold and horses ; choose the wide
expanded earth, and live thyself as many years as thou wishest
Or if thou knowest a boon like this choose it together with wealth
and far-extending life. Be a king on the wide earth. I will make
thee the enjoyer of all desires. All those desires that are difficult
to gain in the world of mortals, all those ask thou at thy pleasure ;
those fair nymphs with their chariots, with their musical instru
ments; the like of them are not to be gained by men. I will give
them to thee, but do not ask the question regarding death."
Naciketas replied, " All those enjoyments are of to-morrow and
they only weaken the senses. All life is short, with thee the
dance and song. Man cannot be satisfied with wealth, we could
obtain wealth, as long as we did not reach you we live only as
long as thou pleasest. The boon which I choose I have said."
Yama said, " One thing is good, another is pleasant. Blessed is
he who takes the good, but he who chooses the pleasant loses
the object of man. But thou considering the objects of desire,
hast abandoned them. These two, ignorance (whose object is
6o The Earlier Upani$ads [CH.
what is pleasant) and knowledge (whose object is what is good),
are known to be far asunder, and to lead to different goals.
Believing that this world exists and not the other, the careless
youth is subject to my sway. That knowledge which thou hast
asked is not to be obtained by argument. I know worldly hap
piness is transient for that firm one is not to be obtained by what
is not firm. The wise by concentrating on the soul, knowing him
whom it is hard to behold, leaves both grief and joy. Thee
O Naciketas, I believe to be like a house whose door is open to
Brahman. Brahman is deathless, whoever knows him obtains
whatever he wishes. The wise man is not born; he does not die;
he is not produced from anywhere. Unborn, eternal, the soul is
not slain, though the body is slain ; subtler than what is subtle,
greater than what is great, sitting it goes far, lying it goes every
where. Thinking the soul as unbodily among bodies, firm among
fleeting things, the wise man casts off all grief. The soul cannot
be gained by eloquence, by understanding, or by learning. It
can be obtained by him alone whom it chooses. To him it reveals
its own nature 1 ." So long as the Self identifies itself with its desires,
he wills and acts according to them and reaps the fruits in the
present and in future lives. But when he comes to know the
highest truth about himself, that he is the highest essence and prin
ciple of the universe, the immortal and the infinite,he ceases to have
desires, and receding from all desires realizes the ultimate truth
of himself in his own infinitude. Man is as it were the epitome
of the universe and he holds within himself the fine constituents
of the gross body (annamaya kosa\ the vital functions (prZlna-
maya kosa) of life, the will and desire (ntanomayd) and the
thoughts and ideas (vijndnamaya\ and so long as he keeps him
self in these spheres and passes through a series of experiences
in the present life and in other lives to come, these experiences
are willed by him and in that sense created by him. He suffers
pleasures and pains, disease and death. But if he retires from
these into his true unchangeable being, he is in a state where he
is one with his experience and there is no change and no move
ment. What this state is cannot be explained by the use of
concepts. One could only indicate it by pointing out that it is
not any of those concepts found in ordinary knowledge ; it is not
1 Katha n. The translation is not continuous. There are some parts in the extract
which may be differently interpreted.
in] Emancipation 6 1
whatever one knows as this and this (neti neti). In this infinite
and true self there is no difference, no diversity, no meum and
tuum. It is like an ocean in which all our phenomenal existence
will dissolve like salt in water. "Just as a lump of salt when put
in water will disappear in it and it cannot be taken out separately
but in whatever portion of water we taste we find the salt, so,
Maitreyi, does this great reality infinite and limitless consisting
only of pure intelligence manifesting itself in all these (phenomenal
existences) vanish in them and there is then no phenomenal know
ledge" (Brh. II. 4. 12). The true self manifests itself in all the
processes of our phenomenal existences, but ultimately when it
retires back to itself, it can no longer be found in them. It is a
state of absolute infinitude of pure intelligence, pure being, and
pure blessedness.
CHAPTER IV
GENERAL OBSERVATIONS ON THE SYSTEMS
OF INDIAN PHILOSOPHY
In what Sense is a History of Indian Philosophy possible ?
IT is hardly possible to attempt a history of Indian philosophy
in the manner in which the histories of European philosophy have
been written. In Europe from the earliest times, thinkers came
one after another and offered their .independent speculations
on philosophy. The work of a modern historian consists in
chronologically arranging these views and in commenting upon
the influence of one school upon another or upon the general
change from time to time in the tides and currents of philosophy.
Here in India, however, the principal systems of philosophy had
their beginning in times of which we have but scanty record, and
it is hardly possible to say correctly at what time they began,
or to compute the influence that led to the foundation of so many
divergent systems at so early a period, for in all probability these
were formulated just after the earliest Upanisads had been com
posed or arranged.
The systematic treatises were written in short and pregnant
half-sentences (sutras) which did not elaborate the subject in
detail, but served only to hold before the reader the lost threads
of memory of elaborate disquisitions with which he was already
thoroughly acquainted. It seems, therefore, that these pithy half-
sentences were like lecture hints, intended for those who had had
direct elaborate oral instructions on the subject It is indeed
difficult to guess from the sutras the extent of their significance,
or how far the discussions which they gave rise to in later days were
originally intended by them. The sutras of the Vedanta system,
known as the ^arlraka-sutras or Brahma-sutras of Badarayana
for example were of so ambiguous a nature that they gave rise
to more than half a dozen divergent interpretations, each one
of which claimed to be the only faithful one. Such was the high
esteem and respect in which these writers of the sutras were held
by later writers that whenever they had any new speculations to
CH. iv] Schools of Philosophy 63
offer, these were reconciled with the doctrines of one or other of
the existing systems, and put down as faithful interpretations of
the system in the form of commentaries. Such was the hold of
these systems upon scholars that all the orthodox teachers since
the foundation of the systems of philosophy belonged to one or
other of these schools. Their pupils were thus naturally brought
up in accordance with the views of their teachers. All the in
dependence of their thinking was limited and enchained by the
faith of the school to which they were attached. Instead of
producing a succession of free-lance thinkers having their own
systems to propound and establish, India had brought forth
schools of pupils who carried the traditionary views of particular
systems from generation to generation, who explained and ex
pounded them, and defended them against the attacks of other
rival schools which they constantly attacked in order to establish
the superiority of the system to which they adhered. To take an
example, the Nyaya system of philosophy consisting of a number
of half-sentences or sutras is attributed to Gautama, also called
Aksapada. The earliest commentary on these sutras, called the
Vdtsydyana bhdsya, was written by Vatsyayana. This work was
sharply criticized by the Buddhist Dinnaga, and to answer these
criticisms Udyotakara wrote a commentary on this commentary
called the Bhdsyavdttika 1 . As time went on the original force
of this work was lost, and it failed to maintain the old dignity of
the school. At this Vacaspati MiSra wrote a commentary called
Vdrttika-tdtparyatlkd on this second commentary, where he tried
to refute all objections against the Nyaya system made by other
rival schools and particularly by the Buddhists. This commentary,
called Nydya-tdtparyattkd, had another commentary called Nydya-
tdtparyatlkd-parisuddhi written by the great Udayana. This
commentary had another commentary called Nydya-nibandha-
prakdsa written by Varddhamana the son of the illustrious
Gangesa. This again had another commentary called Varddha-
mdnendu upon it by Padmanabha Misra, and this again had
another named Nydya-tdtparyamandana by &afikara Misra. The
names of Vatsyayana, Vacaspati, and Udayana are indeed very
great, but ever they contented themselves by writing com
mentaries on commentaries, and did not try to formulate any
1 I have preferred to spell Dinnaga after Vacaspati s Tdtparyattka (p. i) and net
Dignaga as it is generally spelt.
64 Observations on Systems of Indian Philosophy [CH.
original system. Even ankara, probably the greatest man of
India after Buddha, spent his life in writing commentaries on the
Brahma-sutras, the Upanisads, and the Bhagavadgltd.
As a system passed on it had to meet unexpected opponents
and troublesome criticisms for which it was not in the least pre
pared. Its adherents had therefore to use all their ingenuity and
subtlety in support of their own positions, and to discover the
defects of the rival schools that attacked them. A system as it was
originally formulated in the sutras had probably but few problems
to solve, but as it fought its way in the teeth of opposition of
other schools, it had to offer consistent opinions on other problems
in which the original views were more or less involved but to
which no attention had been given before.
The contributions of the successive commentators served to
make each system more and more complete in all its parts, and
stronger and stronger to enable it to hold its own successfully
against the opposition and attacks of the rival schools. A system
in the sutras is weak and shapeless as a newborn babe, but if
we take it along with its developments down to the beginning
of the seventeenth century it appears as a fully developed man
strong and harmonious in all its limbs. It is therefore not possible
to write any history of successive philosophies of India, but it is
necessary that each system should be studied and interpreted in
all the growth it has/ acquired through the successive ages of
history from its conflicts with the rival systems as one whole 1 .
In the history of Indian philosophy we have no place for systems
which had their importance only so long as they lived and were
then forgotten or remembered only as targets of criticism. Each
system grew and developed by the untiring energy of its adherents
through all the successive ages of history, and a history of this
growth is a history of its conflicts. No study of any Indian system
is therefore adequate unless it is taken throughout all the growth
it attained by the work of its champions, the commentators whose
selfless toil for it had kept it living through the ages of history.
1 In the case of some systems it is indeed possible to suggest one or two earlier
phases of the system, but this principle cannot be carried all through, for the supple
mentary information and arguments given by the later commentators often appear as
harmonious elaborations of the earlier writings and are very seldom in conflict with them.
iv] Growth of the Philosophic Literature 65
Growth of the Philosophic Literature.
It is difficult to say how the systems were originally formulated,
and what were the influences that led to it. We know that a
spirit of philosophic enquiry had already begun in the days of the
earliest Upanisads. The spirit of that enquiry was that the final
essence or truth was the atman, that a search after it was our
highest duty, and that until we are ultimately merged in it we
can only feel this truth and remain uncontented with everything
else and say that it is not the truth we want, it is not the truth we
want (neti neti}. Philosophical enquires were however continuing
in circles other than those of the Upanisads. Thus the Buddha
who closely followed the early Upanisad period, spoke of and enu
merated sixty-two kinds of heresies 1 , and these can hardly be
traced in the Upanisads. The Jaina activities were also probably
going on contemporaneously but in the Upanisads no reference
to these can be found. We may thus reasonably suppose that there
were different forms of philosophic enquiry in spheres other than
those of the Upanisad sages, of which we have but scanty records.
It seems probable that the Hindu systems of thought originated
among the sages who though attached chiefly to the Upanisad
circles used to take note of the discussions and views of the antago
nistic and heretical philosophic circles. In the assemblies of these
sages and their pupils, the views of the heretical circles were prob
ably discussed and refuted. So it continued probably for some time
when some illustrious member of the assembly such as Gautama
or Kanada collected the purport of these discussions on various
topics and problems, filled up many of the missing links, classified
and arranged these in the form of a system of philosophy and
recorded it in sutras. These sutras were intended probably for
people who had attended the elaborate oral discussions and thus
could easily follow the meaning of the suggestive phrases con
tained in the aphorisms. The sutras thus contain sometimes
allusions to the views of the rival schools and indicate the way in
which they could be refuted. The commentators were possessed
of the general drift of the different discussions alluded to and
conveyed from generation to generation through an unbroken
chain of succession of teachers and pupils. They were however
free to supplement these traditionary explanations with their own
1 Brahmajala-sutla, Digha, I. p. 12 ff.
D 5
66 Observations on Systems of Indian Philosophy [CH.
views or to modify and even suppress such of the traditionary
views with which they did not agree or which they found it diffi
cult to maintain. Brilliant oppositions from the opposing schools
often made it necessary for them to offer solutions to new problems
unthought of before, but put forward by some illustrious adherent
of a rival school. In order to reconcile these new solutions with
the other parts of the system, the commentators never hesitated to
offer such slight modifications of the doctrines as could harmonize
them into a complete whole. These elaborations or modifications
generally developed the traditionary system, but did not effect any
serious change in the system as expounded by the older teachers,
for the new exponents always bound themselves to the explana
tions of the older teachers and never contradicted them. They
would only interpret them to suit their own ideas, or say new things
only in those cases where the older teachers had remained silent.
It is not therefore possible to describe the growth of any system
by treating the contributions of the individual commentators sepa
rately. This would only mean unnecessary repetition. Except
when there is a specially new development, the system is to be
interpreted on the basis of the joint work of the commentators
treating their contributions as forming one whole.
The fact that each system had to contend with other rival
systems in order to hold its own has left its permanent mark
upon all the philosophic literatures of India which are always
written in the form of disputes, where the writer is supposed to
be always faced with objections from rival schools to whatever
he has got to say. At each step he supposes certain objections
put forth against him which he answers, and points out the defects
of the objector or shows that the objection itself is ill founded. It
is thus through interminable byways of objections, counter-objec
tions and their answers that the writer can wend his way to his
destination. Most often the objections of the rival schools are
referred to in so brief a manner that those only who know the
views can catch them. To add to these difficulties the Sanskrit
style of most of the commentaries is so condensed and different
from literary Sanskrit, and aims so much at precision and brevity,
leading to the use of technical words current in the diverse systems,
that a study of these becomes often impossible without the aid
of an expert preceptor; it is difficult therefore for all who are not
widely read in all the different systems to follow any advanced
iv] Different Types of Literature 67
work of any particular system, as the deliberations of that par
ticular system are expressed in such close interconnection with
the views of other systems that these can hardly be understood
without them. Each system of India has grown (at least in
particular epochs) in relation to and in opposition to the growth
of other systems of thought, and to be a thorough student of Indian
philosophy one should study all the systems in their mutual
opposition and relation from the earliest times to a period at
which they ceased to grow and came to a stop a purpose for
which a work like the present one may only be regarded as
forming a preliminary introduction.
Besides the sutras and their commentaries there are also in
dependent treatises on the systems in verse called kdrikds % which
try to summarize the important topics of any system in a succinct
manner; the Sdmkhya kdrikd may be mentioned as a work of this
kind. In addition to these there were also long dissertations,
commentaries, or general observations on any system written in
verses called the varttikas; the Slokavdrttika, of Kumarilaor the
Vdrttika of SuresVara may be mentioned as examples. All these
of course had their commentaries to explain them. In addition
to these there were also advanced treatises on the systems in prose
in which the writers either nominally followed some selected
sutras or proceeded independently of them. Of the former class
the Nydyamanjarl of Jayanta may be mentioned as an example
and of the latter the Prasastapdda bhdsya, the Advaitasiddhi of
Madhusudana Sarasvati or the Veddnta-paribhdsd of Dharmara-
jadhvarindra. The more remarkable of these treatises were of a
masterly nature in which the writers represented the systems they
adhered to in a highly forcible and logical manner by dint of
their own great mental powers and genius. These also had their
commentaries to explain and elaborate them. The period of the
growth of the philosophic literatures of India begins from about
500 B.C. (about the time of the Buddha) and practically ends in
the later half of the seventeenth century, though even now some
minor publications are seen to come out.
The Indian Systems of Philosophy.
The Hindus classify the systems of philosophy into two classes,
namely, the nastika and the dstika. The nastika (na asti "it is
not") views are those which neither regard the Vedas as infallible
52
68 Observations on Systems of Indian Philosophy [CH.
nor try to establish their own validity on their authority. These are
principally three in number, the Buddhist, Jaina and the Carvaka.
The astika-mata or orthodox schools are six in number, Samkhya,
Yoga, Vedanta, Mlmamsa, Nyaya and Vaisesika, generally known
as the six systems (saddarsana 1 }.
The Samkhya is ascribed to a mythical Kapila, but the
earliest works on the subject are probably now lost. The Yoga
system is attributed to Patafljali and the original sutras are called
the Pdtanjala Yoga sutras. The general metaphysical position
of these two systems with regard to soul, nature, cosmology and
the final goal is almost the same, and the difference lies in this
that the Yoga system acknowledges a god (Isvara) as distinct
from Atman and lays much importance on certain mystical
practices (commonly known as Yoga practices) for the achieve
ment of liberation, whereas the Samkhya denies the existence of
Isvara and thinks that sincere philosophic thought and culture
are sufficient to produce the true conviction of the truth and
thereby bring about liberation. It is probable that the system
of Samkhya associated with Kapila and the Yoga system
associated with Pataftjali are but two divergent modifications of
an original Samkhya school, of which we now get only references
here and there. These systems therefore though generally counted
as two should more properly be looked upon as two different
schools of the same Samkhya system one may be called the
Kapila Samkhya and the other Pataftjala Samkhya.
The Purva Mlmamsa (from the root man to think rational
conclusions) cannot properly be spoken of as a system of philo
sophy. It is a systematized code of principles in accordance with
which the Vedic texts are to be interpreted for purposes of sacrifices.
1 The word "darfana" in the sense of true philosophic knowledge has its earliest
use in the Vatiesika sutras of Kanada (IX. ii. 13) which I consider as pre- Buddhistic.
The Buddhist pitakas (400 B.C.) called the heretical opinions "ditthi" (Sanskrit drsti
from the same root drs from which darana is formed). Haribhadra (fifth century A.D.)
uses the word Dars"ana in the sense of systems of philosophy (sarvadarsancrvacyt?
rthah Saddarsanasamuccaya I.). Ratnakirtti (end of the tenth century A.D.) uses the
word also in the same sense (" Yadi nama darfane darfane nanaprakaram sattvalak-
sanam uktamasti." Ksanabhangasiddhi in Six Buddhist Nyaya tracts, p. 20). Madhava
(1331 A.D. ) calls his Compendium of all systems of philosophy, Sarvadarsanasamgraha.
The word "mata" (opinion or view) was also freely used in quoting the views of other
systems. But there is no word to denote philosophers in the technical sense. The
Buddhists used to call those who held heretical views " tairthika." The words "siddha,"
"jndnin" etc. do not denote philosophers in the modern sense, they are used rather in
the sense of " seers" or "perfects."
iv] Purva Mlmamsa 69
The Vedic texts were used as mantras (incantations) for sacrifices,
and people often disputed as to the relation of words in a
sentence or their mutual relative importance with reference to the
general drift of the sentence. There were also differences of view
with regard to the meaning of a sentence, the use to which it may
be applied as a mantra, its relative importance or the exact
nature of its connection with other similar sentences in a complex
Vedic context. The Mlmamsa formulated some principles accord
ing to which one could arrive at rational and uniform solutions
for all these difficulties. Preliminary to these its main objects, it
indulges in speculations with regard to the external world, soul,
perception, inference, the validity of the Vedas, or the like, for in
order that a man might perform sacrifices with mantras, a definite
order of the universe and its relation to man or the position and
nature of the mantras of the Veda must be demonstrated and
established. Though its interest in such abstract speculations is
but secondary yet it briefly discusses these in order to prepare a
rational ground for its doctrine of the mantras and their practical
utility for man. It is only so far as there are these preliminary
discussions in the Mlmamsa that it may be called a system of
philosophy. Its principles and maxims for the interpretation of
the import of words and sentences have a legal value even to this
day. The sutras of Mlmamsa are attributed to Jaimini, and abara
wrote a bhasya upon it. The two great names in the history of
Mlmamsa literature after Jaimini and abara are Kumarila Bhatta
and his pupil Prabhakara, who criticized the opinions of his master
so much, that the master used to call him guru (master) in sarcasm,
and to this day his opinions pass as guru-mata, whereas the views
of Kumarila Bhatta pass as bhatta-matd 1 . It may not be out of
place to mention here that Hindu Law (smrtt) accepts without
any reservation the maxims and principles settled and formulated
by the Mlmamsa.
1 There is a story that Kumarila could not understand the meaning of a Sanskrit
sentence " Atra tunoktam tatrapinoktam iti paunaruktam" (hence spoken twice).
Tunoktam phonetically admits of two combinations, tu noktam (but not said) and tuna
uktam (said by the particle tu) and tatrapi noktam as tatra api na uktam (not said also
there) and tatra apina uktam (said there by the particle apt). Under the first inter
pretation the sentence would mean, " Not spoken here, not spoken there, it is thus spoken
twice." This puzzled Kumarila, when Prabhakara taking the second meaning pointed
out to him that the meaning was here it is indicated by tu and there by api, and so it is
indicated twice." Kumarila was so pleased that he called his pupil "Guru" (master)
at this.
7o Observations on Systems of Indian Philosophy [CH.
The Veddnta sutras, also called Uttara Mlmamsa, written by
Badarayana, otherwise known as the Brahma-sutras, form the
original authoritative work of Vedanta. The word Vedanta means
"end of the Veda," i.e. the Upanisads, and the Veddnta sutras are
so called as they are but a summarized statement of the general
views of the Upanisads. This work is divided into four books or
adhyayas and each adhyaya is divided into four padas or chapters.
The first four sutras of the work commonly known as Catuhsutri
are (i) How to ask about Brahman, (2) From whom proceed birth
and decay, (3) This is because from him the Vedas have come forth,
(4) This is shown by the harmonious testimony of the Upanisads.
The whole of the first chapter of the second book is devoted to
justifying the position of the Vedanta against the attacks of the
rival schools. The second chapter of the second book is busy in
dealing blows at rival systems. All the other parts of the book are
devoted to settling the disputed interpretations of a number of in
dividual Upanisad texts. The really philosophical portion of the
work is thus limited to the first four sutras and the first arid second
chapters of the second book. The other portions are like com
mentaries to the Upanisads, which however contain many theo
logical views of the system. The first commentary of the Brahma-
siitra was probably written by Baudhayana, which however is not
available now. The earliest commentary that is now found is that
of the great Sankara. His interpretations of the Brahma-sutras
together with all the commentaries and other works that follow
his views are popularly known as Vedanta philosophy, though
this philosophy ought more properly to be called Visuddhadvaita-
vada school of Vedanta philosophy (i.e. the Vedanta philosophy
of the school of absolute monism). Variant forms of dualistic
philosophy as represented by the Vaisnavas, aivas, Ramayatas,
etc., also claim to express the original purport of the Brahma
sutras. We thus find that apostles of dualistic creeds such as
Ramanuja, Vallabha, Madhva, rlkantha, Baladeva, etc., have
written independent commentaries on the Brahma-sutra to show
that the philosophy as elaborated by themselves is the view of
the Upanisads and as summarized in the Brahma-sutras. These
differed largely and often vehemently attacked Sarikara s inter
pretations of the same sutras. These systems as expounded by
them also pass by the name of Vedanta as these are also claimed
to be the real interpretations intended by the Vedanta (Upanisads)
iv] Some Points of Agreement 7 i
and the Veddnta sutras. Of these the system of Ramanuja has
great philosophical importance.
The Ny ay a sutras attributed to Gautama, called also Aksapada,
and the VaiSesika sutras attributed to Kanada, called also Uluka,
represent the same system for all practical purposes. They are
in later times considered to differ only in a few points of minor
importance. So far as the sutras are concerned the Nydya sutras
lay particular stress on the cultivation of logic as an art, while
the Vaisesika sutras deal mostly with metaphysics and physics.
In addition to these six systems, the Tantras had also philoso
phies of their own, which however may generally be looked upon
largely as modifications of the Samkhya and Vedanta systems,
though their own contributions are also noteworthy.
Some fundamental Points of Agreement,
i. The Karma Theory.
It is, however, remarkable that with the exception of the
Carvaka materialists all the other systems agree on some funda
mental points of importance. The systems of philosophy in India
were not stirred up merely by the speculative demands of the
human mind which has a natural inclination for indulging in
abstract thought, but by a deep craving after the realization of
the religious purpose of life. It is surprising to note that the ]
postulates, aims and conditions for such a realization were found /
to be identical in all the conflicting systems. Whatever may be
their differences of opinion in other matters, so far as the general
postulates for the realization of the transcendent state, the summum
bonum of life, were concerned, all the systems were practically in
thorough agreement It may be worth while to note some of them
at this stage.
First, the theory of Karma and rebirth. All the Indian systems
agree in believing that whatever action is done by an individual
leaves behind it some sort of potency which has the power to
ordain for him joy or sorrow in the future according as it is good
or bad. When the fruits of the actions are such that they cannot
be enjoyed in the present life or in a human life, the individual
has to take another birth as a man or any other being in order to
suffer them.
The Vedic belief that the mantras uttered in the correct accent
at the sacrifices with the proper observance of all ritualistic
72 Observations on Systems of Indian Philosophy [CH.
details, exactly according to the directions without the slightest
error even in the smallest trifle, had something like a magical
virtue automatically to produce the desired object immediately
or after a lapse of time, was probably the earliest form of the
Karma doctrine. It postulates a semi-conscious belief that certain
mystical actions can produce at a distant time certain effects
without the ordinary process of the instrumentality of visible
agents of ordinary cause and effect When the sacrifice is per
formed, the action leaves such an unseen magical virtue, called
the adrsta (the unseen) or the apurva (new), that by it the desired
object will be achieved in a mysterious manner, for the modus
operandi of the apurva is unknown. There is also the notion
prevalent in the Samhitas, as we have already noticed, that he
who commits wicked deeds suffers in another world, whereas he
who performs good deeds enjoys the highest material pleasures.
These were probably associated with the conception of rta, the
inviolable order of things. Thus these are probably the elements
which built up the Karma theory which we find pretty well
established but not emphasized in the Upanisads, where it is said
that according to good or bad actions men will have good or bad
births.
To notice other relevant points in connection with the Karma
doctrine as established in the astika systems we find that it was
believed that the unseen {adrsta) potency of the action generally
required some time before it could be fit for giving the doer the
merited punishment or enjoyment These would often accumulate
and prepare the items of suffering and enjoyment for the doer in
his next life. Only the fruits of those actions which are extremely
wicked or particularly good could be reaped in this life. The
nature of the next birth of a man is determined by the nature of
pleasurable or painful experiences that have been made ready for
him by his maturing actions of this life. If the experiences deter
mined for him by his action are such that they are possible to be
realized in the life of a goat, the man will die and be born as a
goat. As there is no ultimate beginning in time of this world
process, so there is no time at which any person first began his
actions or experiences. Man has had an infinite number of past
lives of the most varied nature, and the instincts of each kind of
life exist dormant in the life of every individual, and thus when
ever he has any particular birth as this or that animal or man,
iv] Theory of Karma 73
the special instincts of that life (technically called vdsana) come
forth. In accordance with these vasanas the person passes through
the painful or pleasurable experiences as determined for him by
his action. The length of life is also determined by the number
and duration of experiences as preordained by the fructifying
actions of his past life. When once certain actions become fit for
giving certain experiences, these cannot be avoided, but those
actions which have not matured are uprooted once for all if the
person attains true knowledge as advocated by philosophy. But
even such an emancipated (muktd} person has to pass through
the pleasurable or painful experiences ordained for him by the
actions just ripened for giving their fruits. There are four kinds
of actions, white or virtuous (sukla), black or wicked (krsna),
white-black or partly virtuous and partly vicious (fukla-krsna) as
most of our actions are, neither black nor white (asuklakrsqa),
i.e. those acts of self-renunciation or meditation which are not
associated with any desires for the fruit. It is only when a person
can so restrain himself as to perform only the last kind of action
that he ceases to accumulate any new karma for giving fresh fruits.
He has thus only to enjoy the fruits of his previous karmas which
have ripened for giving fruits. If in the meantime he attains true
knowledge, all his past accumulated actions become destroyed,
and as his acts are only of the aSuklakrsna type no fresh karma
for ripening is accumulated, and thus he becomes divested of all
karma after enjoying the fruits of the ripened karmas alone.
The Jains think that through the actions of body, speech
and mind a kind of subtle matter technically called karma is pro
duced. The passions of a man act like a viscous substance that
attracts this karma matter, which thus pours into the soul and
sticks to it. The karma matter thus accumulated round the soul
during the infinite number of past lives is technically called kdr-
masartra,v/hich encircles the soul as it passes on from birth to birth.
This karma matter sticking to the soul gradually ripens and ex
hausts itself in ordaining the sufferance of pains or the enjoyment
of pleasures for the individual. While some karma matter is being
expended in this way, other karma matters are accumulating by
his activities, and thus keep him in a continuous process of
suffering and enjoyment. The karma matter thus accumulated
in the soul produces a kind of coloration called lesyd, such as
white, black, etc., which marks the character of the soul. The
74 Observations on Systems of Indian Philosophy [CH.
idea of the ukla and krsna karmas of the Yoga system was pro
bably suggested by the Jaina view. But when a man is free from
passions, and acts in strict compliance with the rules of conduct,
his actions produce karma which lasts but for a moment and is
then annihilated. Every karma that the sage has previously
earned has its predestined limits within which it must take effect
and be purged away. But when by contemplation and the strict
adherence to the five great vows, no new karma is generated, and
when all the karmas are exhausted the worldly existence of the
person rapidly draws towards its end. Thus in the last stage of
contemplation, all karma being annihilated, and all activities
having ceased, the soul leaves the body and goes up to the top
of the universe, where the liberated souls stay for ever.
Buddhism also contributes some new traits to the karma
theory which however being intimately connected with their
metaphysics will be treated later on.
2. The Doctrine of Mukti.
Not only do the Indian systems agree as to the cause of the
inequalities in the share of sufferings and enjoyments in the case
of different persons, and the manner in which the cycle of births
and rebirths has been kept going from beginningless time, on the
basis of the mysterious connection of one s actions with the
happenings of the world, but they also agree in believing that
this beginningless chain of karma and its fruits, of births and re
births, this running on from beginningless time has somewhere
its end. This end was not to be attained at some distant time or
in some distant kingdom, but was to be sought within us. Karma
leads us to this endless cycle, and if we could divest ourselves of
all such emotions, ideas or desires as lead us to action we should
find within us the actionless self which neither suffers nor enjoys,
neither works nor undergoes rebirth. When the Indians, wearied
by the endless bustle and turmoil of worldly events, sought for and
believed that somewhere a peaceful goal could be found, they
generally hit upon the self of man. The belief that the soul could
be realized in some stage as being permanently divested of all
action, feelings or ideas, led logically to the conclusion that the
connection of the soul with these worldly elements was extraneous,
artificial or even illusory. In its true nature the soul is untouched
by the impurities of our ordinary life, and it is through ignorance
iv] Pessimism and Optimism 75
and passion as inherited from the cycle of karma from beginning-
less time that we connect it with these. The realization of this
transcendent state is the goal and final achievement of this endless
cycle of births and rebirths through karma. The Buddhists did
not admit the existence of soul, but recognized that the final
realization of the process of karma is to be found in the ultimate
dissolution called Nirvana, the nature of which we shall discuss
latei on.
3. The Doctrine of Soul.
All the Indian systems except Buddhism admit the existence
of a permanent entity variously called atman, purusa or jlva.
As to the exact nature of this soul there are indeed diver
gences of view. Thus while the Nyaya calls it absolutely
qualityless and characterless, indeterminate unconscious entity,
Samkhya describes it as being of the nature of pure conscious
ness, the Vedanta says that it is that fundamental point of unity
implied in pure consciousness (cit\ pure bliss (dnanda), and pure
being (sat). But all agree in holding that it is pure and unsullied
in its nature and that all impurities of action or passion do not
form a real part of it. The summum bonum of life is attained
when all impurities are removed and the pure nature of the self
is thoroughly and permanently apprehended and all other ex
traneous connections with it are absolutely dissociated.
The Pessimistic Attitude towards the World and the
Optimistic Faith in the end.
Though the belief that the world is full of sorrow has not been
equally prominently emphasized in all systems, yet it may be
considered as being shared by all of them. It finds its strongest
utterance in Samkhya, Yoga, and Buddhism. This interminable
chain of pleasurable and painful experiences was looked upon as
nearing no peaceful end but embroiling and entangling us in the
meshes of karma, rebirth, and sorrow. What appear as pleasures
are but a mere appearance for the attempt to keep them steady is
painful, there is pain when we lose the pleasures or when we are
anxious to have them. When the pleasures are so much asso
ciated with pains they are but pains themselves. We are but duped
when we seek pleasures, for they are sure to lead us to pain. All
our experiences are essentially sorrowful and ultimately sorrow-
begetting. Sorrow is the ultimate truth of this process of the
76 Observations on Systems of Indian Philosophy [CH.
world. That which to an ordinary person seems pleasurable
appears to a wise person or to a yogin who has a clearer vision as
painful. The greater the knowledge the higher is the sensitiveness
to sorrow and dissatisfaction with world experiences. The yogin
is like the pupil of the eye to which even the smallest grain of dis
turbance is unbearable. This sorrow of worldly experiences cannot
be removed by bringing in remedies for each sorrow as it comes,
for the moment it is remedied another sorrow comes in. It cannot
also be avoided by mere inaction or suicide, for we are continually
being forced to action by our nature, and suicide will but lead to
another life of sorrow and rebirth. The only way to get rid of 1
it is by the culmination of moral greatness and true knowledge
which uproot sorrow once for all. It is our ignorance that the self 1
is intimately connected with the experiences of life or its pleasures,
that leads us to action and arouses passion in us for the enjoy
ment of pleasures and other emotions and activities. Through
the highest moral elevation a man may attain absolute dispassion
towards world-experiences and retire in body, mind, and speech
from all worldly concerns. When the mind is so purified, the self
shines in its true light, and its true nature is rightly conceived.
When this is once done the self can never again be associated
with passion or ignorance. It becomes at this stage ultimately
dissociated from citta which contains within it the root of all
emotions, ideas, and actions. Thus emancipated the self for ever
conquers all sorrow. It is important, however, to note in this
connection that emancipation is not based on a general aversion
to intercourse with the world or on such feelings as a disappointed
person may have, but on the appreciation of the state of mukti
as the supremely blessed one. The details of the pessimistic
creed of each system have developed from the logical necessity
peculiar to each system. There was never the slightest tendency
to shirk the duties of this life, but to rise above them through
right performance and right understanding. It is only when a
man rises to the highest pinnacle of moral glory that he is fit for
aspiring to that realization of selfhood in comparison with which
all worldly things or even the joys of Heaven would not only
shrink into insignificance, but appear in their true character as
sorrowful and loathsome. It is when his mind has thus turned from
all ordinary joys that he can strive towards his ideal of salvation.
In fact it seems to me that a sincere religious craving after some
iv] Unity in Sadhana 77
ideal blessedness and quiet of self-realization is indeed the funda
mental fact from which not only her philosophy but many of the
complex phenomena of the civilization of India can be logically
deduced. The sorrow around us has no fear for us if we remember
that we are naturally sorrowless and blessed in ourselves. The
pessimistic view loses all terror as it closes in absolute optimistic
confidence in one s own self and the ultimate destiny and goal of
emancipation.
Unity in Indian Sadhana (philosophical, religious
and ethical endeavours).
As might be expected the Indian systems are all agreed upon
the general principles of ethical conduct which must be followed
for the attainment of salvation. That all passions are to be con
trolled, no injury to life in any form should be done, and that all
desire for pleasures should be checked, are principles which are
almost universally acknowledged. When a man attains a very
high degree of moral greatness he has to strengthen and prepare
his mind for further purifying and steadying it for the attainment
of his ideal; and most of the Indian systems are unanimous with
regard to the means to be employed for the purpose. There are
indeed divergences in certain details or technical names, but the
means to be adopted for purification are almost everywhere essen
tially the same as those advocated by the Yoga system. It is only
in later times that devotion (bhaktf) is seen to occupy a more
prominent place specially in Vaisnava schools of thought. Thus
it was that though there were many differences among the various
systems, yet their goal of life, their attitude towards the world and
the means for the attainment of the goal (sadhana) being funda
mentally the same, there was a unique unity in the practical sadhana
of almost all the Indian systems. The religious craving has been
universal in India and this uniformity of sadhana has therefore
secured for India a unity in all her aspirations and strivings.
CHAPTER V
BUDDHIST PHILOSOPHY
MANY scholars are of opinion that the Samkhya and the Yoga
represent the earliest systematic speculations of India. It is also
suggested that Buddhism drew much of its inspiration from them.
It may be that there is some truth in such a view, but the
systematic Samkhya and Yoga treatises as we have them had
decidedly been written after Buddhism. Moreover it is well-known
to every student of Hindu philosophy that a conflict with the
Buddhists has largely stimulated philosophic enquiry in most of
the systems of Hindu thought. A knowledge of Buddhism is
therefore indispensable for a right understanding of the different
systems in their mutual relation and opposition to Buddhism. It
seems desirable therefore that I should begin with Buddhism
first
The State of Philosophy in India before the Buddha.
It is indeed difficult to give a short sketch of the different
philosophical speculations that were prevalent in India before
Buddhism. The doctrines of the Upanisads are well known, and
these have already been briefly described. But these were not the
only ones. Even in the Upanisads we find references to diverse
atheistical creeds 1 . We find there that the origin of the world
and its processes were sometimes discussed, and some thought
that " time " was the ultimate cause of all, others that all these
had sprung forth by their own nature (svabhdVa\ others that
everything had come forth in accordance with an inexorable
destiny or a fortuitous concourse of accidental happenings, or
through matter combinations in general. References to diverse
kinds of heresies are found in Buddhist literature also, but no
detailed accounts of these views are known. Of the Upanisad
type of materialists the two schools of Carvakas (Dhurtta and
SuSiksita) are referred to in later literature, though the time in
which these flourished cannot rightly be discovered 2 . But it seems
1 i->vetas"vatara, I. 2, kalah svabhabo niycUiryadrcchd bhutaniyonih purusa iti cintyam.
2 Lokayata (literally, that which is found among people in general) seems to have
been the name by which all carvaka doctrines were generally known. See Gunaratna
on the Lokayatas.
CH. v] C&rvakas 79
probable however that the allusion to the materialists contained
in the Upanisads refers to these or to similar schools. The
Carvakas did not believe in the authority of the Vedas or any
other holy scripture. According to them there was no soul. Life
and consciousness were the products of the combination of matter,
just as red colour was the result of mixing up white with
yellow or as the power of intoxication was generated in molasses
(madasakti). There is no after-life, and no reward of actions, as
there is neither virtue nor vice. Life is only for enjoyment. So
long as it lasts it is needless to think of anything else, as every
thing will end with death, for when at death the body is burnt
to ashes there cannot be any rebirth. They do not believe in
the validity of inference. Nothing is trustworthy but what can
be directly perceived, for it is impossible to determine that the
distribution of the middle term (hetu) has not depended upon
some extraneous condition, the absence of which might destroy
the validity of any particular piece of inference. If in any case
any inference comes to be true, it is only an accidental fact and
there is no certitude about it They were called Carvaka because
they would only eat but would not accept any other religious or
moral responsibility. The word comes from caru to eat. The
Dhurtta Carvakas held that there was nothing but the four
elements of earth, water, air and fire, and that the body was but the
result of atomic combination. There was no self or soul, no
virtue or vice. The Susiksita Carvakas held that there was
a soul apart from the body but that it also was destroyed with
the destruction of the body. The original work of the Carvakas
was written in sutras probably by Brhaspati. Jayanta and Gunar-
atna quote two sutras from it. Short accounts of this school may be
found in Jayanta s Nydyamanjari, Madhava s Sarvadarsanasam-
graha and Gunaratna s Tarkarahasyadipikd. Mahdbhdrata gives
an account of a man called Carvaka meeting Yudhisthira.
Side by side with the doctrine of the Carvaka materialists we
are reminded of the Ajlvakas of which Makkhali Gosala, probably
a renegade disciple of the Jain saint Mahavira and a contemporary
of Buddha and Mahavira, was the leader. This was a thorough
going determinism denying the free will of man and his moral
responsibility for any so-called good or evil. The essence of
Makkhali s system is this, that "there is no cause, either proximate
or remote, for the depravity of beings or for their purity. They
8o Buddhist Philosophy [CH.
become so without any cause. Nothing depends either on one s
own efforts or on the efforts of others, in short nothing depends
on any human effort, for there is no such thing as power or energy,
or human exertion. The varying conditions at any time are due
to fate, to their environment and their own nature 1 ."
Another sophistical school led by Ajita Kesakambali taught
that there was no fruit or result of good or evil deeds ; there is no
other world, nor was this one real; nor had parents nor any
former lives any efficacy with respect to this life. Nothing that
we can do prevents any of us alike from being, wholly brought to
an end at death 2 .
There were thus at least three currents of thought: firstly the
sacrificial Karma by the force of the magical rites of which any
person could attain anything he desired ; secondly the Upanisad
teaching that the Brahman^ the self, is the ultimate reality and
being, and all else but name and form which pass away but do
not abide. That which permanently abides without change is the
real and true, and this is self. .Thirdly the nihilistic conceptions
that there is no law, no abiding reality, that everything comes
into being by a fortuitous concourse of circumstances or by some
unknown fate. In each of these schools, philosophy had probably
come to a deadlock. There were the Yoga practices prevalent in
the country and these were accepted partly on the strength of
traditional custom among certain sections, and partly by virtue
of the great spiritual, intellectual and physical power which they
gave to those who performed them. But these had no rational
basis behind them on which they could lean for support. These
were probably then just tending towards being affiliated to the
nebulous Samkhya doctrines which had grown up among certain
sections. It was at this juncture that we find Buddha erecting
a new superstructure of thought on altogether original lines which
thenceforth opened up a new avenue of philosophy for all posterity
to come. If the Being of the Upanisads, the superlatively motion
less, was the only real, how could it offer scope for further new
speculations, as it had already discarded all other matters of
interest? If everything was due to a reasonless fortuitous con
course of circumstances, reason could not proceed further in the
direction to create any philosophy of the unreason. The magical
1 Samannaphaia-sutta, Digha, li. 20 Hoemle s article on the Ajivakas, E. R. E.
2 Sdmannaphala-sutta, II. 23.
v] Buddha s Life 81
force of the hocus-pocus of sorcery or sacrifice had but little that
was inviting for philosophy to proceed on. If we thus take into
account the state of Indian philosophic culture before Buddha,
we shall be better able to understand the value of the Buddhistic
contribution to philosophy.
Buddha : his Life.
Gautama the Buddha was born in or about the year 560 B.C.
in the Lumbini Grove near the ancient town of Kapilavastu in
the now dense terai region of Nepal. His father was Suddhodana,
a prince of the Sakya clan, and his mother Queen Mahamaya.
According to the legends it was foretold of him that he would
enter upon the ascetic life when he should see " A decrepit old
man, a diseased man, a dead man, and a monk." His father tried
his best to keep him away from these by marrying him and
surrounding him with luxuries. But on successive occasions,
issuing from the palace, he was confronted by those four
things, which filled him with amazement and distress, and
realizing the impermanence of all earthly things determined to
forsake his home and try if he could to discover some means to
immortality to remove the sufferings of men. He made his " Great
Renunciation " when he was twenty-nine years old. He travelled
on foot to Rajagrha (Rajgir) and thence to Uruvela, where in
company with other five ascetics he entered upon a course of
extreme self-discipline, carrying his austerities to such a length
that his body became utterly emaciated and he fell down sense
less and was believed to be dead. After six years of this great
struggle he was convinced that the truth was not to be won by
the way of extreme asceticism, and resuming an ordinary course
of life at last attained absolute and supreme enlightenment There
after the Buddha spent a life prolonged over forty-five years in
travelling from place to place and preaching the doctrine to
all who would listen. At the age of over eighty years Buddha
realized that the time drew near for him to die. He then entered
into Dhyana and passing through its successive stages attained
nirvana 1 . The vast developments which the system of this great
teacher underwent in the succeeding centuries in India and in
other countries have not been thoroughly studied, and it will
probably take yet many years more before even the materials for
1 Mahdparinibbanasutfanta, Dtgha, XVI. 6, 8, 9.
D. 6
82 Buddhist Philosophy [CH.
such a study can be collected. But from what we now possess
it is proved incontestably that it is one of the most wonderful and
subtle productions of human wisdom. It is impossible to over
estimate the debt that the philosophy, culture and civilization
of India owe to it in all her developments for many succeeding
centuries.
Early Buddhist Literature.
The BuddhistPali Scriptures containthree different collections :
the Sutta (relating to the doctrines), the Vinaya (relating to the
discipline of the monks) and the Abhidhamma (relating generally
to the same subjects as the suttas but dealing with them in a
scholastic and technical manner). Scholars of Buddhistic religious
history of modern times have failed as yet to fix any definite dates
for the collection or composition of the different parts of the
aforesaid canonical literature of the Buddhists. The suttas were
however composed before the Abhidhamma and it is very
probable that almost the whole of the canonical works were
completed before 241 B.C., the date of the third council during
the reign of King Asoka. The suttas mainly deal with the doctrine
(Dhamma) of the Buddhistic faith whereas the Vinaya deals
only with the regulations concerning the discipline of the monks.
The subject of the Abhidhamma is mostly the same as that
of the suttas, namely, the interpretation of the Dhamma.
Buddhaghosa in his introduction to Atthasdlinl^ the commentary
on the Dhammasangani, says that the Abhidhamma is so called
(abhi and dhamma) because it describes the same Dhammas as are
related in the suttas in a more intensified (dhammatirekd) and
specialized (dhammavisesatthend) manner. The Abhidhammas
do not give any new doctrines that are not in the suttas, but
they deal somewhat elaborately with those that are already found
in the suttas. Buddhaghosa in distinguishing the special features
of the suttas from the Abhidhammas says that the acquirement
of the former leads one to attain meditation (samadhi) whereas
the latter leads one to attain wisdom (panndsampadam). The force
of this statement probably lies in this, that the dialogues of the
suttas leave a chastening effect on the mind, the like of which is
not to be found in the Abhidhammas, which busy themselves in
enumerating the Buddhistic doctrines and defining them in a
technical manner, which is more fitted to produce a reasoned
v] Early Buddhist Literature 83
insight into the doctrines than directly to generate a craving
for following the path of meditation for the extinction of sorrow.
The Abhidhamma known as the Kathavatthu differs from the
other Abhidhammas in this, that it attempts to reduce the views
of the heterodox schools to absurdity. The discussions proceed
in the form of questions and answers, and the answers of the
opponents are often shown to be based on contradictory
assumptions.
The suttas contain five groups of collections called the Nikayas.
These are (i) Dlgha Nikdya, called so on account of the length
of the suttas contained in it; (2) Majjhima Nikaya (middling
Nikaya), called so on account of the middling extent of the
suttas contained in it ; (3) Samyutta Nikdya (Nikayas relating
to special meetings), called samyutta on account of their being
delivered owing to the meetings (samyogd) of special persons which
were the occasions for them ; (4) Anguttara Nikdya, so called be
cause in each succeeding book of this work the topics of discussion
increase by one 1 ; (5) Khuddaka Nikdya containing Khuddaka
patha, Dhammapada, Uddna, Itivuttaka, Sutta Nipdta, Vimdna-
vatthu, Petavatthu, Theragathd, Therlgdthd, Jdtaka, Niddesa,
Patisambhiddmagga, Apaddna, Buddhavamsa, Carydpitaka.
The Abhidhammas are Patthdna, Dhammasangani, Dhdtu-
kathd, Puggalapannatti, Vibhanga, Yamaka and Kathavatthu.
There exists also a large commentary literature on diverse parts
of the above works known as atthakatha. The work known as
Milinda Panha (questions of King Milinda), of uncertain date, is
of considerable philosophical value.
The doctrines and views incorporated in the above literature
is generally now known as Sthaviravada or Theravada. On the
origin of the name Theravada (the doctrine of the elders) Dlpa-
vamsa says that since the Theras (elders) met (at the first council)
and collected the doctrines it was known as the Thera Vada*. It
does not appear that Buddhism as it appears in this Pali litera
ture developed much since the time of Buddhaghosa (400 A.D.), the
writer of "Visuddhimagga (a compendium of theravada doctrines)
and the commentator of Dlghanikdya, Dhammasangani^ etc.
Hindu philosophy in later times seems to have been influenced
by the later offshoots of the different schools of Buddhism, but
it does not appear that Pali Buddhism had any share in it. I
1 See Buddhaghosa s Atthasdlini, p. 25. z Oldenberg s Dipavamsa, p. 31.
62
84 Buddhist Philosophy [CH.
have not been able to discover any old Hindu writer who could
be considered as being acquainted with Pali.
The Doctrine of Causal Connection of early Buddhism 1 .
The word Dhamma in the Buddhist scriptures is used generally
in four senses: (i) Scriptural texts, (2) quality (guna), (3) cause
(hetu) and (4) unsubstantial and soulless (nissatta nijjlva?). Of
these it is the last meaning which is particularly important from
the point of view of Buddhist philosophy. The early Buddhist
philosophy did not accept any fixed entity as determining all
reality; the only things with it were the unsubstantial pheno
mena and these were called jjharnmas. The question arises that
if there is no substance or reality how are we to account for the
phenomena? But the phenomena are happening and passing
away and the main point of interest with the Buddha was to find
out " What being what else is," " What happening what else
happens" and " What not being what else is not." The pheno
mena are happening in a series and we see that there being
certain phenomena there become some others; by the happening
of some events others also are produced. This is called (paticca-
samuppddd) dependent origination. But it is difficult to understand
what is the exact nature of this dependence. The question as
Samyutta Nikdya (II. 5) has it with which the Buddha started
before attaining Buddhahood was this: in what miserable condition
are the people ! they are born, they decay, they die, pass away
and are born again ; and they do not know the path of escape
i from this decay, death and misery.
How to know the way to escape from this misery of decay
and death. Then it occurred to him what being there, are decay
and death, depending on what do they come? As he thought
deeply into the root of the matter, it occurred to him that decay
and death can only occur when there is birth (jdti), so they depend
1 There are some differences of opinion as to whether one could take the doctrine
of the twelve links of causes as we find it in the Samyutta Nikdya as the earliest
Buddhist view, as Samyutta does not represent the oldest part of the suttas. But as
this doctrine of the twelve causes became regarded as a fundamental Buddhist doctrine
and as it gives us a start in philosophy I have not thought it fit to enter into conjec
tural discussions as to the earliest form. Dr E. J. Thomas drew my attention to this fact.
a Atthasdtini, p. 38. There are also other senses in which the word is used, as
dhamma desand where it means religious teaching. The Lankavat&rn described Dharmma
as gunadravyapurvaka dharmma, i.e. Dharmmas are those which are associated as attrii
butes and substances.
v] Doctrine of Causal Connection 85
on birth. What being there, is there birth, on what does birth
depend ? Then it occurred to him that birth could only be if
there were previous existence (bhava) 1 . But on what does this
existence depend, or what being there is there bhava. Then it
occurred to him that there could not be existence unless there
were holding fast (updddnd)*. But on what did upadana depend?
It occurred to him that it was desire (tanha) on which upadana
depended. There can be upadana if there is desire (tanha)*. But
what being there, can there be desire ? To this question it
occurred to him that there must be feeling (yedana) in order that
there may be desire. But on what does vedana depend, or rather
what must be there, that there may be feeling (vedanaft To this
it occurred to him that there must be a sense-contact (phassa)
in order that there may be feeling 4 . If there should be no sense-
contact there would be no feeling. But on what does sense-
contact depend ? It occurred to him that as there are six sense-
contacts, there are the six fields of contact (dyatana)*. But on
what do the six ayatanas depend ? It occurred to him that
there must be the mind and body (ndmariipa) in order that there
may be the six fields of contact 6 ; but on what does namarupa
depend ? It occurred to him that without consciousness (vinndnd)
there could be no namarupa 6 . But what being there would there
1 This word bhava is interpreted by Candraklrtti in his Madhyamika vrtti, p. 565
(La Vallee Poussin s edition) as the deed which brought about rebirth (punarbhava-
janakam karma samutthdpayati k.yena vdcd manasd ca).
2 Atthasalini, p. 385,upadanantidalhagahanarn. Candraklrtti in explaining upadana
says that whatever thing a man desires he holds fast to the materials necessary for
attaining it (yatra vastuni satrsnastasya vastuno rjandya vidhapandya updddnamupd-
datte tatra tatra prdrthayate). Madhyamika vrtti, p. 565.
3 Candraklrtti describes trsna as dsvddandbhinandanddhyavasdnasthdndddtmapri-
yarupairviyogo md bhut, nityamapantydgo bhavediti, yeyam prdrthand the desire
that there may not ever be any separation from those pleasures, etc., which are dear to
us. Ibid. 565.
4 We read also of phassayatana and phassakaya. M. N. II. 261, III. 280, etc. Can-
drakirtti says that sadbhirdyatanadvdraih krtyaprakriydh pravarttante prajAdyante.
tanndmarupapratyayam saddyatanamucyate. sadbhyafcdyatanebhyah satsparSakdydh
pravarttante. M. V. 565.
5 Ayatana means the six senses together with their objects. Ayatana literally is
" Field of operation." Salayatana means six senses as six fields of operation. Candra
klrtti has dyatanadvdraih.
8 I have followed the translation of Aung in rendering namarupa as mind and body,
Compendium, p. 271. This seems to me to be fairly correct. The four skandhas are called
nama in each birth. These together with rupa (matter) give us namarupa (mind
and body) which being developed render the activities through the six sense-gates
possible so that there may be knowledge. Cf.M. V. 564. Govindananda, the commentator
86 Buddhist Philosophy [CH.
be viftftana. Here it occurred to him that in order that there
might be viftftana there must be the conformations (sankhdra) 1 .
But what being there are there the sarikharas ? Here it occurred
to him that the sarikharas can only be if there is ignorance
(avijja). If avijja could be stopped then the sankharas will be
stopped, and if the sarikharas could be stopped viftflana could be
stopped and so on*.
It is indeed difficult to be definite as to what the Buddha
actually wished to mean by this cycle of dependence of existence
sometimes called Bhavacakra (wheel of existence). Decay and
death (jardmarand) could not have happened if there was no
birth*. This seems to be clear. But at this point the difficulty
begins. We must remember that the theory of rebirth was
on Sankara s bhasya on the Brahma-sutras (n. ii. 19), gives a different interpretation of
Namarupa which may probably refer to the Vijnanavada view though we have no means
at hand to verify it. He says To think the momentary as the permanent is Avidya;
from there come the samskaras of attachment, antipathy or anger, and infatuation ; from
there the first vijftana or thought of the foetus is produced ; from that alayavijfiana, and
the four elements (which are objects of name and are hence called nama) are produced,
and from those are produced the white and black, semen and blood called rupa.
Both Vacaspati and Amalananda agree with Govindananda in holding that nama
signifies the semen and the ovum while rupa means the visible physical body built out
of them. Vijflana entered the womb and on account of it namarupa were produced
through the association of previous karma. See Vedantakalpataru, pp. 274, 275. On
the doctrine of the entrance of vijfiana into the womb compare D. N. n. 63.
1 It is difficult to say what is the exact sense of the word here. The Buddha was
one of the first few earliest thinkers to introduce proper philosophical terms and phraseo
logy with a distinct philosophical method and he had often to use the same word in
more or less different senses. Some of the philosophical terms at least are therefore
rather elastic when compared with the terms of precise and definitemeaningwhichwe find
in later Sanskrit thought. Thus in S. N. III. p. 87, " Sankhatam abhisahkharonti"
sankhara means that which synthesises the complexes. In the Compendium it is trans
lated as will, action. Mr Aung thinks that it means the same as karma ; it is here used
in a different sense from what we find in the word sankhara khandha (viz. mentat
states). We get a list of 51 mental states forming sankhara khandha in Dhamma
Sangani, p. 18, and another different set of 40 mental states in Dharmasamgraha, p. 6.
In addition to these forty cittasamprayuktasamskara, it also counts thirteen cittavi-
prayuktasainskara. Candrakirtti interprets it as meaning attachment, antipathy and
infatuation, p. 563. Govindananda, the commentator on Sankara s Brahma-sutra (ll. ii.
19), also interprets the word in connection with the doctrine of Pratityasamutpada as
attachment, antipathy and infatuation.
a Samyutta Nikdya, II. 7-8.
3 Jara and marana bring in oka (grief), paridevana (lamentation), duhkha (suffer
ing), daurmanasya (feeling of wretchedness and miserableness) and upayasa (feeling of
extreme destitution) at the prospect of one s death or the death of other dear ones.
All these make up suffering and are the results of jati (birth). M. V. (B. T. S. p. ao8).
Sankara in his bhasya counted all the terms from jara, separately. The whole series
is to be taken as representing the entirety of duhkhaskandha.
v] Theory of Rebirth 87
enunciated in the Upanisads. The Brhadaranyaka says that just
as an insect going to the end of a leaf of grass by a new effort
collects itself in another so does the soul coming to the end of
this life collect itself in another. This life thus presupposes
another existence. So far as I remember there has seldom been
before or after Buddha any serious attempt to prove or disprove
the doctrine of rebirth 1 . All schools of philosophy except the
Carvakas believed in it and so little is known to us of the Car-
vaka sutras that it is difficult to say what they did to refute this
doctrine. The Buddha also accepts it as a fact and does not
criticize it. This life therefore comes only as one which had an
infinite number of lives before, and which except in the case of
a few emancipated ones would have an infinite number of them
in the future. It was strongly believed by all people, and the
Buddha also, when he came to think to what our present birth
might be due, had to fall back upon another existence (bhava).
If bhava means karma which brings rebirth as Candraklrtti takes
it to mean, then it would mean that the present birth could only
take place on account of the works of a previous existence which
determined it. Here also we are reminded of the Upanisad note I
N / < as a man does so will he be born " ( Yat karma kurute tadabhi-
sampadyate, Brh. IV. iv. 5). Candraklrtti s interpretation of "bhava"
as Karma (Jrunarbhavajanakam karma) seems to me to suit
better than " existence." The word was probably used rather
loosely for kammabhava. The word bhava is not found in the
earlier Upanisads and was used in the Pali scriptures for the
first time as a philosophical term. But on what does this
bhava depend ? There could not have been a previous existence
if people had not betaken themselves to things or works they
desired. This betaking oneself to actions or things in accord
ance with desire is called upadana. In the Upanisads we read,
" whatever one betakes himself to, so does he work" ( Yatkratur-
bhavati tatkarmma kurute, Brh. IV. iv. 5). As this betaking to
the thing depends upon desire (trsnd), it is said that in order
that there may be upadana there must be tanha. In the Upani
sads also we read "Whatever one desires so does he betake
himself to" (sa yathdkamo bhavati tatkraturbhavati). Neither
the word upadana nor trsna (the Sanskrit word corresponding
1 The attempts to prove the doctrine of rebirth in the Hindu philosophical works
such as the Nyaya, etc., are slight and inadequate.
88 Buddhist Philosophy [CH.
to tanha) is found in the earlier Upanisads, but the ideas contained
in them are similar to the words "kratu" and "kdma." Desire
(tanha) is then said to depend on feeling or sense-contact.
Sense-contact presupposes the six senses as fields of operation 1 .
These six senses or operating fields would again presuppose the
whole psychosis of the man (the body and the mind together)
called namarupa. We are familiar with this word in the Upani
sads but there it is used in the sense of determinate forms and
names as distinguished from the indeterminate indefinable
reality 2 . Buddhaghosa in the Visuddhimagga says that by
" Name " are meant the three groups beginning with sensation
(i.e. sensation, perception and the predisposition); by "Form"
the four elements and form derivative from the four elements 1 .
He further says that name by itself can produce physical changes,
such as eating, drinking, making movements or the like. So form
also cannot produce any of those changes by itself. But like
the cripple and the blind they mutually help one another and
effectuate the changes 4 .( But there exists no heap or collection
of material for the production of Name and Form ; " but just as
when a lute is played upon, there is no previous store of sound ;
and when the sound comes into existence it does not come from
any such store ; and when it ceases, it does not go to any of the
cardinal or intermediate points of the compass ;...in exactly the
same way all the elements of being both those with form and
those without, come into existence after having previously been
non-existent and having come into existence pass away 5 ." Nama
rupa taken in this sense will not mean the whole of mind and
body, but only the sense functions and the body which are found
to operate in the six doors of sense (saldyatand). If we take
namarupa in this sense, we can see that it may be said to depend
upon the vinflana (consciousness). Consciousness has been com
pared in the Milinda Panha with a watchman at the middle of
1 The word ayatana is found in many places in the earlier Upanisads in the sense
of "field or place," Cha. I. 5, Brh. in. 9. 10, but sadayatana does not occur.
2 Candraklrtti interprets nama as Vedanddayo rtipinas catvarah skandhdstatra tatra
bha-vt namayantiti nama. saha rupaskandhena ca ndma rupam ctti namarupamucyate.
The four skandhas in each specific birth act as name. These together with rupa make
namarupa. M. V. 564.
1 Warren s Buddhism in Translations, p. 184.
* Ibid. p. 185, Visuddhimagga, Ch. xvn.
* Ibid. pp. 185-186, Visuddhimagga, Ch. xvn.
v] Theory of Consciousness 89
the cross-roads beholding all that come from any direction 1 . Bud-
dhaghosa in the Atthasdlini also says that consciousness means
that which thinks its object. If we are to define its characteristics
we must say that it knows (vijdnana), goes in advance (pubbah-
gama\ connects (sandhdna), and stands on namarupa (ndmarupa-
padatthdnam). When the consciousness gets a door, at a place
the objects of sense are discerned (drammana-vibhdvanatthdne)
and it goes first as the precursor. When a visual object is seen
by the eye it is known only by the consciousness, and when the
dhammas are made the objects of (mind) mano, it is known only
by the consciousness 2 . Buddhaghosa also refers here to the passage
in the Milinda Pahha we have just referred to. He further goes
on to say that when states of consciousness rise one after another,
they leave no gap between the previous state and the later and
consciousness therefore appears as connected. When there are the
aggregates of the five khandhas it is lost ; but there are the four
aggregates as namarupa, it stands on nama and therefore it is
said that it stands on namarupa. He further asks, Is this con
sciousness the same as the previous consciousness or different
from it? He answers that it is the same. Just so, the sun shows
itself with all its colours, etc., but he is not different from those
in truth ; and it is said that just when the sun rises, its collected
heat and yellow colour also rise then, but it does not mean that
the sun is different from these. So the citta or consciousness
takes the phenomena of contact, etc., and cognizes them. So
though it is the same as they are yet in a sense it is different
from them*.
To go back to the chain of twelve causes, we find that jati
(birth) is the cause of decay and death, jardmarana, etc. Jati is
the appearance of the body or the totality of the five skandhas 4 .
Coming to bhava which determines jati, I cannot think of any
better rational explanation of bhava, than that I have already
1 Warren s Buddhism in Translations, p. 182. Milinda Panha (62 s ).
8 Atthasdlini, p. in.
1 Ibid. p. 113, Yathd hi rupddtni upaddya pannattd suriyddayo na atthato rupd-
dihi anne honti ten 1 eva yasmin samaye suriyo udeti tasmin samayc fossa tejd-san-
khdtam rupam piti evam vuccamdne pi na rupddihi anno suriyo ndma atthi. Tatha
cittam phassddayo dhammc upaddya pafinapiyati. Atthato pan ettha tehi annam eva.
Tena yasmin samaye cittam uppannam hoti ekamsen eva tasmin samaye phassadihi
atthato annad eva hoti ti.
4 "Jdtirdehajanma pancaskandhasamuddyah" Govindananda s Ratnaprabhd on
Sankara s bhasya, II. ii. 19.
9O Buddhist Philosophy [CH.
suggested, namely, the works (karma) which produce the birth 1 .
Upadana is an advanced trsna leading to positive clinging 2 . It
is produced by trsna (desire) which again is the result of vedana
(pleasure and pain). But this vedana is of course vedana with
ignorance (avtdyd), for an Arhat may have also vedana but as
he has no avidya, the vedana cannot produce trsna in turn. On
its development it immediately passes into upadana. Vedana
means pleasurable, painful or indifferent feeling. On the one
side it leads to trsna (desire) and on the other it is produced by
sense-contact (sparsa). Prof. De la Valise Poussin says that
Irmlabha distinguishes three processes in the production of
vedana. Thus first there is the contact between the sense and
the object ; then there is the knowledge of the object, and then
there is the vedana. Depending on Majjhima Nikdya, iii. 242,
Poussin gives the other opinion that just as in the case of two
sticks heat takes place simultaneously with rubbing, so here also
vedana takes place simultaneously with sparsa for they are
" produits par un meme complexe de causes (sdmagri)*"
Sparsa is produced by sadayatana, sadayatana by riamarupa,
and namarupa by vijfiana, and is said to descend in the womb
of the mother and produce the five skandhas as namarupa, out
of which the six senses are specialized.
Vijflana in this connection probably means the principle or
germ of consciousness in the womb of the mother upholding the
five elements of the new body there. It is the product of the
past karmas (sahkhdrd) of the dying man and of his past
consciousness too.
We sometimes find that the Buddhists believed that the last
thoughts of the dying man determined the nature of his next
1 Govindananda in his Ratnaprabha on ankara s bhasya, II. ii. 19, explains " bhava "
as that from which anything becomes, as merit and demerit (dkarmddi). See also
Vibhanga, p. 137 and Warren s Buddhism in Translations, p. 201. Mr Aung says in
Abhidhammatthasangaha, p. 189, that bhavo includes kamraabhavo (the active side of
an existence) and upapattibhavo (the passive side). And the commentators say that
bhava is a contraction of " kammabhava " or Karma becoming i.e. karmic activity.
2 Prof. De la Vallee Poussin in his Thtorie des Douse Causes, p. 26, says that
Salistambhasutra explains the word "upadana" as "trsnavaipulya" or hyper-trsna
and Candrakirtti also gives the same meaning, M. V. (B. T. S. p. 210). Govindananda
explains "upadana" as pravrtti (movement) generated by trsna (desire), i.e. the active
tendency in pursuance of desire. But if upadana means "support" it would denote all
the five skandhas. Thus Madhyamaka vrtti says upaddnam pancaskandhalaksanam . . .
pancopadanaskandhakhyam up&ddnam. M. V. xxvn. 6.
3 Poussin s Thorie des Douzt Causes, p. 23.
v] Consciousness and Rebirth 91
birth 1 . The manner in which the vijftana produced in the womb
is determined by the past vijnana of the previous existence is
according to some authorities of the nature of a reflected image,
like the transmission of learning from the teacher to the disciple,
like the lighting of a lamp from another lamp or like the impress
of a stamp on wax. As all the skandhas are changing in life,
so death also is but a similar change ; there is no great break,
but the same uniform sort of destruction and coming into being.
New skandhas are produced as simultaneously as the two scale
pans of a balance rise up and fall, in the same manner as a lamp
is lighted or an image is reflected. At the death of the man the
vijftana resulting from his previous karmas and vijftanas enters
into the womb of that mother (animal, man or the gods) in which
the next skandhas are to be matured. This vijftana thus forms
the principle of the new life. It is in this vijftana that name
(ndma) and form (rupd) become associated.
The vijftana is indeed a direct product of the samskaras and
the sort of birth in which vijftana should bring down (ndmayati)
the new existence (upapatti) is determined by the samskaras 8 , for
in reality the happening of death (maranabhavd) and the instil
lation of the vijftana as the beginning of the new life (upapatti-
bkava) cannot be simultaneous, but the latter succeeds just at
the next moment, and it is to signify this close succession that
they are said to be simultaneous. If the vijftana had not entered
the womb then no namarupa could have appeared*.
This chain of twelve causes extends over three lives. Thus
avidya and samskara of the past life produce the vijftana, nama-
1 The deities of the gardens, the woods, the trees and the plants, finding the
master of the house, Citta, ill said " make your resolution, May I be a cakravartti
king in a next existence, " Samyutta, iv. 303.
* "ja cedanandavijnanam matuhkuksim ndvakrameta, na tat kalalam kalalatvaya
sannivartteta" M. V, 552. Compare Caraka, $drtra, ill. 5-8, where he speaks of a
"upapaduka sattva" which connects the soul with body and by the absence of which
the character is changed, the senses become affected and life ceases, when it is in a
pure condition one can remember even the previous births ; character, purity, antipathy,
memory, fear, energy, all mental qualities are produced out of it. Just as a chariot is
made by the combination of many elements, so is the foetus.
8 Madhyamaka vrtti (B.T. S. 102-203). Poussin quotes from Dtgka t n. 63, "si le
vijnana ne descendait pas dans le sein maternel la namarupa s y constituerait-il ? "
Govindananda on Sankara s commentary on the Brahma-sutras (n. ii. 19) says that the
first consciousness (vijfiana) of the foetus is produced by the samskaras of the previous
birth, and from that the four elements (which he calls nama) and from that the white
and red, semen and ovum, and the first stage of the foetus (kalala-budbudavastha) is
produced.
92 Buddhist Philosophy [CH.
rupa, sadayatana, sparSa, vedana, trsna, upadana and the bhava
(leading to another life) of the present actual life. This bhava
produces the jati and jaramarana of the next life 1 .
It is interesting to note that these twelve links in the chain
extending in three sections over three lives are all but the
manifestations of sorrow to the bringing in of which they natur
ally determine one another. Thus Abhidhammatthasangaha
says " each of these twelve terms is a factor. For the composite
term sorrow, etc. is only meant to show incidental consequences
of birth. Again when ignorance and the actions of the
mind have been taken into account, craving (trmd\ grasping
(updddnd) and (karma) becoming (bhava} are implicitly ac
counted for also. In the same manner when craving, grasping
and (karma ) becoming have been taken into account, ignorance
and the actions of the mind are (implicitly) accounted for, also ;
and when birth, decay, and death are taken into account, even
the fivefold fruit, to wit (rebirth), consciousness, and the rest are
accounted for. And thus :
Five causes in the Past and Now a fivefold fruit.
Five causes Now and yet to come a fivefold fruit make up
the Twenty Modes, the Three Connections (i. sahkhara and
viftnana, 2. vedana and tanha, 3. bhava and jati) and the four
groups (one causal group in the Past, one resultant group in the
Present, one causal group in the Present and one resultant
group in the Future, each group consisting of five modes) 2 ."
These twelve interdependent links (dvddasahgd) represent
the paticcasamuppada {pratityasamutpdda) doctrines (dependent
origination) 3 which are themselves but sorrow and lead to cycles
of sorrow. The term paticcasamuppada or pratltyasamutpada
has been differently interpreted in later Buddhist literature 4 .
1 This explanation probably cannot be found in the early Pali texts ; but Buddha-
ghosa mentions it in Sumangalavilasini on Mahanidana suttanta. We find it also in
Abhidhammatthasangaha, vin. 3. Ignorance and the actions of the mind belong to
the past; "birth," "decay and death" to the future; the intermediate eight to the
present. It is styled as trikandaka (having three branches) in Abhidharmakoia, in.
20-14. Two in the past branch, two in the future and eight in the middle "sa
pratityasamutpado dvadajangastrikandakah purvaparantayordve dve madhyestau."
2 Aung and Mrs Rhys Davids translation of Abhidhammatthasangaha, pp. 189-190.
3 The twelve links are not always constant. Thus in the list given in the Dialogues
of the Buddha, n. 23 f., avijja and sankhara have been omitted and the start has been
made with consciousness, and it has been said that "Cognition turns back from name
and form ; it goes not beyond."
4 M. V. p. 5 f.
v] Avijja in Paticcasamuppada 93
Samutpada means appearance or arising (prddurbhdva) and pra-
titya means after getting (prati+i+ya)\ combining the two we
find, arising after getting (something). The elements, depending
on which there is some kind of arising, are called hetu (cause) and
paccaya (ground). These two words however are often used in
the same sense and are interchangeable. But paccaya is also
used in a specific sense. Thus when it is said that avijja is the
paccaya of sarikhara it is meant that avijja is the ground (thiti)
of the origin of the sarikharas, is the ground of their movement,
of the instrument through which they stand (nimittatthiti\ of
their ayuhana (conglomeration), of their interconnection, of their
intelligibility, of their conjoint arising, of their function as cause
and of their function as the ground with reference to those which
are determined by them. Avijja in all these nine ways is
the ground of sarikhara both in the past and also in the future,
thoug a avijja itself is determined in its turn by other grounds 1 .
When we take the hetu aspect of the causal chain, we cannot
think of anything else but succession, but when we take the
paccaya aspect we can have a better vision into the nature of the
cause as ground. Thus when avijja is said to be the ground
of the sarikharas in the nine ways mentioned above, it seems
reasonable to think that the sarikharas were in some sense
regarded as special manifestations of avijja 8 . But as this point
was not further developed in the early Buddhist texts it would
be unwise to proceed further with it.
The Khandhas.^
The word khandha (Skr. skandha) means the trunk of a tree
and is generally used to mean group or aggregate*. We have
seen that Buddha said that there was no atman (soul). He said
that when people held that they found the much spoken of soul,
they really only found the five khandhas together or any one of
them. The khandhas are aggregates of bodily and psychical
states which are immediate with us and are divided into five
1 See Patisambhiddmagga, vol. I. p. 50 ; see also Majjhima Nikaya, I. 67, san-
khara...avijjanidana avijjasamudaya avijjajatikd avijjapabhava.
2 In the Yoga derivation of asmita (egoism), raga (attachment), dvesa (antipathy)
and abhinivesa (self love) from avidya we find also that all the five are regarded as the
five special stages of the growth of avidya (pancaparva avidya}.
3 The word skandha is used in Chandogya, n. 23 (trayo dharmaskandhdh yajnah
adhyayanam ddnam) in the sense of branches and in almost the same sense in Maitri,
94 Buddhist Philosophy [CH.
classes: (i) rupa (four elements, the body, the senses), sense
data, etc., (2) vedana (feeling pleasurable, painful and in
different), (3) saflna (conceptual knowledge), (4) saiikhara (syn
thetic mental states and the synthetic functioning of compound
sense-affections, compound feelings and compound concepts),
(5) vinnana (consciousness) 1 .
All these states rise depending one upon the other (paticca-
samuppannd) and when a man says that he perceives the self he
only deludes himself, for he only perceives one or more of these.
The word rupa in rupakhandha stands for matter and material
qualities, the senses, and the sense data 2 . But " rupa " is also
used in the sense of pure organic affections or states of mind
as we find in the Khandha Yamaka, I. p. 16, and also in Sam-
yutta Nikdya, III. 86. Rupaskandha according to Dharma-
samgraha means the aggregate of five senses, the five sensations,
and the implicatory communications associated in sense per
ceptions (vijnapti).
The elaborate discussion of Dhammasangani begins by defin
ing rupa as " cattdro ca mahdbhiitd catunnanca mahdbhutdnam
updddya rupam" (the four mahabhutas or elements and that
proceeding from the grasping of that is called rupa) 3 . Buddha-
ghosa explains it by saying that rupa means the four maha
bhutas and those which arise depending (nissdyd) on them as
a modification of them. In the rupa the six senses including
their affections are also included. In explaining why the four
elements are called mahabhutas, Buddhaghosa says : "Just as a
magician (mdydkdrd) makes the water which is not hard appear
as hard, makes the stone which is not gold appear as gold ;
just as he himself though not a ghost nor a bird makes himself
appear as a ghost or a bird, so these elements though not them
selves blue make themselves appear as blue (nllam upddd rupam),
not yellow, red, or white make themselves appear as yellow, red
or white (pddtam updddrilpani), so on account of their similarity
to the appearances created by the magician they are called
mahabhuta 4 ."
In the Samyutta Nikdya we find that the Buddha says, "O
Bhikkhus it is called rupam because it manifests (rupyati}\ how
1 Samyutta Nikaya, ill. 86, etc.
2 Abhidhammatthasangaha, J. P. T. S. 1884, p. 27 ff.
3 Dhammasangani, pp. 124-179. 4 Atthasalini, p. 299.
v] Theory of Matter 95
does it manifest? It manifests as cold, and as heat, as hunger and
as thirst, it manifests as the touch of gnats, mosquitos, wind, the
sun and the snake; it manifests, therefore it is called rupa 1 ."
If we take the somewhat conflicting passages referred to above
for our consideration and try to combine them so as to understand
what is meant by rupa, I think we find that that which mani
fested itself to the senses and organs was called rupa No dis
tinction seems to have been made between the sense-data as
colours, smells, etc., as existing in the physical world and their
appearance as sensations. They were only numerically different
and the appearance of the sensations was dependent upon the
sense-data and the senses but the sense-data and the sensations
were " rupa." Under certain conditions the sense-data were fol
lowed by the sensations. Buddhism did not probably start with
the same kind of division of matter and mind as we now do.
And it may not be out of place to mention that such an opposi
tion and duality were found neither in the Upanisads nor in the
Samkhya system which is regarded by some as pre-Buddhistic.
The four elements manifested themselves in certain forms and
were therefore called rupa ; the forms of affection that appeared
were also called rupa ; many other mental states or features
which appeared with them were also called rupa 2 . The ayatanas
or the senses were also called rupa*. The mahabhutas or four
elements were themselves but changing manifestations, and they
together with all that appeared in association with them were
called rupa and formed the rupa khandha (the classes of sense-
materials, sense-data, senses and sensations).
In Samyutta Nikdya (ill. 101) it is said that "the four
mahabhutas were the hetu and the paccaya for the communica
tion of the rupakkhandha (rupakkhandhassa panndpandya). Con
tact (sense-contact, phassa) is the cause of the communication of
feelings (vedana) ; sense-contact was also the hetu and paccaya
for the communication of the sanftakkhandha ; sense-contact is
also the hetu and paccaya for the communication of the sahkhara-
kkhandha. But namarOpa is the hetu and the paccaya for the
communication of the viftnanakkhandha." Thus not only feelings
arise on account of the sense-contact but saftfia and sarikhara
also arise therefrom. Sanna is that where specific knowing or
1 Samyutta Nikaya, III. 86. 2 Khandhayamaka.
3 Dhammasangani, p. 124 ff.
g6 Buddhist Philosophy [CH.
conceiving takes place. This is the stage where the specific dis
tinctive knowledge as the yellow or the red takes place.
Mrs Rhys Davids writing on saftfta says: "In editing the
second book of the Abhidhamma pitaka I found a classification
distinguishing between sanfta as cognitive assimilation on occasion
of sense, and sanfta as cognitive assimilation of ideas by way of
naming. The former is called perception of resistance, or opposi
tion (patigha-safina). This, writes Buddhaghosa, is perception on
occasion of sight, hearing, etc., when consciousness is aware of the
impact of impressions ; of external things as different, we might
say. The latter is called perception of the equivalent word or
name (adhivackdnd-sannd) and is exercised by the sensus com-
munis (mano), when e.g. one is seated... and asks another who
is thoughtful : "What are you thinking of?" one perceives through
his speech. Thus there are two stages of saftfia-consciousness,
i. contemplating sense-impressions, 2. ability to know what they
are by naming 1 ."
About saiikhara we read in Samyutta Nikdya (ill. 87) that it
is called sankhara because it synthesises (abhisankharonti), it is
that which conglomerated rupa as rupa, conglomerated sanfta
as saftna, sankhara as sankhara and consciousness (vinndnd)
as consciousness. It is called sankhara because it synthesises
the conglomerated (sankhatam abhisankharonti). It is thus a
synthetic function which synthesises the passive rupa, saftna,
sankhara and viftftana elements. The fact that we hear of 52
sankhara states and also that the saiikhara exercises its syn
thetic activity on the conglomerated elements in it, goes to show
that probably the word sankhara is used in two senses, as mental
states and as synthetic activity.
Viftftana or consciousness meant according to Buddhaghosa,
as we have already seen in the previous section, both the stage
at which the intellectual process started and also the final
resulting consciousness.
Buddhaghosa in explainingthe process of Buddhist psychology
says that "consciousness (citta) first comes into touch (phassa) with
its object (arammana) and thereafter feeling, conception (sanna)
and volition (cetana) come in. This contact is like the pillars of
a palace, and the rest are but the superstructure built upon it
(dabbasambhdrasadisd). But it should not be thought that contact
1 Buddhist Psychology, pp. 49, 50.
v] Theory of Sense-contact 97
is the beginning of the psychological processes, for in one whole
consciousness (ekacittasmim) it cannot be said that this comes
first and that comes after, so we can take contact in association
with feeling (vedand), conceiving (sanna) or volition (cetana);
it is itself an immaterial state but yet since it comprehends
objects it is called contact." "There is no impinging on one side
of the object (as in physical contact), nevertheless contact causes
consciousness and object to be in collision, as visible object and
visual organs, sound and hearing; thus impact is Its function; or
it has impact as its essential property in the sense of attainment,
owing to the impact of the physical basis with the mental object.
For it is said in the Commentary: "contact in the four planes of
existence is never without the characteristic of touch with the
object; but the function of impact takes place in the five doors.
For to sense, or five-door contact, is given the name having the
characteristic of touch as well as having the function of impact.
But to contact in the mind-door there is only the characteristic
of touch, but not the function of impact. And then this Sutta is
quoted As if, sire, two rams were to fight, one ram to represent
the eye, the second the visible object, and their collision contact.
And as if, sire, two cymbals were to strike against each other, or
two hands were to clap against each other, one hand would
represent the eye, the second the visible object and their collision
contact. Thus contact has the characteristic of touch and the
function of impact 1 . Contact is the manifestation of the union
of the three (the object, the consciousness and the sense) and its
effect is feeling (vedana)\ though it is generated by the objects
it is felt in the consciousness and its chief feature is experiencing
(anubhavd) the taste of the object. As regards enjoying the
taste of an object, the remaining associated states enjoy it only
partially. Of contact there is (the function of) the mere touching,
of perception the mere noting or perceiving, of volition the mere
coordinating, of consciousness the mere cognizing. But feeling
alone, through governance, proficiency, mastery, enjoys the taste
of an object. For feeling is like the king, the remaining states
are like the cook. As the cook, when he has prepared food of
diverse tastes, puts it in a basket, seals it, takes it to the king,
breaks the seal, opens the basket, takes the best of all the soup
and curries, puts them in a dish, swallows (a portion) to find out
1 Atthasalini, p. 108; translation, pp. 143-144.
D. 7
98 Buddhist Philosophy [CH.
whether they are faulty or not and afterwards offers the food of
various excellent tastes to the king, and the king, being lord,
expert, and master, eats whatever he likes, even so the mere tasting
of the food by the cook is like the partial enjoyment of the object
by the remaining states, and as the cook tastes a portion of the
food, so the remaining states enjoy a portion of the object, and
as the king, being lord, expert and master, eats the meal according
to his pleasure so feeling being lord expert, and master, enjoys
the taste of the object and therefore it is said that enjoyment or
experience is its function 1 ."
The special feature of sanna is said to be the recognizing
(paccabhinna) by means of a sign (abhinndnend). According to
another explanation, a recognition takes place by the inclusion
of the totality (of aspects) sabbasahgahikavasena. The work of
volition (cetand} is said to be coordination or binding together
(abhisandahand), "Volition is exceedingly energetic and makes
a double effort, a double exertion. Hence the Ancients said
Volition is like the nature of a landowner, a cultivator who taking
fifty-five strong men, went down to the fields to reap. He was
exceedingly energetic and exceedingly strenuous ; he doubled his
strength and said "Take your sickles" and so forth, pointed out
the portion to be reaped, offered them drink, food, scent, flowers,
etc., and took an equal share of the work. The simile should be
thus applied: volition is like the cultivator, the fifty-five moral
states which arise as factors of consciousness are like the fifty-five
strong men; like the time of doubling strength, doubling effort
by the cultivator is the doubled strength, doubled effort of
volition as regards activity in moral and immoral acts 8 ." It
seems that probably the active side operating in sarikhara was
separately designated as cetana (volition).
"When one says I, what he does is that he refers either to
all the khandhas combined or any one of them and deludes him
self that that was I. Just as one could not say that the
fragrance of the lotus belonged to the petals, the colour or the
pollen, so one could not say that the rupa was I or that the
vedana was I or any of the other khandhas was I. There is
nowhere to be found in the khandhas I am 3 ."
1 Atthasalinl, pp. 109-110; translation, pp. 145-146.
2 Ibid. p. in ; translation, pp. 147-148.
3 Samyutta Nikaya, III. 130.
v] Ignorance 99
Avijja and Asava.
As to the question how the avijja (ignorance) first started
there can be no answer, for we could never say that either
ignorance or desire for existence ever has any beginning 1 . Its
fruition is seen in the cycle of existence and the sorrow that comes
in its train, and it comes and goes with them all. Thus as we
can never say that it has any beginning, it determines the elements
which bring about cycles of existence and is itself determined by
certain others. This mutual determination can only take place
in and through the changing series of dependent phenomena, for
there is nothing which can be said to have any absolute priority
in time or stability. It is said that it is through the coming into
being of the asavas or depravities that the avijja came into
being, and that through the destruction of the depravities (asava)
the avijja was- destroyed 2 . These asavas are classified in the
Dhammasangani as kamasava, bhavasava, ditthasava and avij-
jasava. Kamasava means desire, attachment, pleasure, and thirst
after the qualities associated with the senses; bhavasava means
desire, attachment and will for existence or birth; ditthasava
means the holding of heretical views, such as, the world is eternal
or non-eternal, or that the world will come to an end or will not
come to an end, or that the body and the soul are one or are
different; avijjasava means the ignorance of sorrow, its cause, its
extinction and its means of extinction. Dhammasangani adds
four more supplementary ones, viz. ignorance about the nature of
anterior mental khandhas, posterior mental khandhas, anterior
and posterior together, and their mutual dependence 8 . Kamasava
and bhavasava can as Buddhaghosa says be counted as one, for
they are both but depravities due to attachment 4 .
1 Warren s Buddhism in Translations (Visuddhimagga, chap, xvn.), p. 175.
2 M. N. i. p. 54. Childers translates "asava" as "depravities" and Mrs Rhys
Davids as " intoxicants." The word "asava" in Skr. means " old wine." It is derived
from "su" to produce by Buddhaghosa and the meaning that he gives to it is "cira
parivasikatthena" (on account of its being stored up for a long time like wine). They
work through the eye and the mind and continue to produce all beings up to Indra.
As those wines which are kept long are called "asavas" so these are also called
asavas for remaining a long time. The other alternative that Buddhaghosa gives is
that they are called asava on account of their producing samsaradukkha (sorrows of
the world), Atthasalini, p. 48. Contrast it with Jaina asrava (flowing in of karma
matter). Finding it difficult to translate it in one word after Buddhaghosa, I have
translated it as "depravities," after Childers.
3 See Dhammasangani, p. 195. 4 Buddhaghosa s Atthasdltni, p. 371.
72
ioo Buddhist Philosophy [CH.
The ditthasavas by clouding the mind with false metaphysical
views stand in the way of one s adopting the true Buddhistic doc
trines. The kamasavas stand in the way of one s entering into
the way of Nirvana (andgdmimagga} and the bhavasavas and
avijjasavas stand in the way of one s attaining arhattva or final
emancipation. When the Majjhima Nikdya says that from the
rise of the asavas avijja rises, it evidently counts avijja there as
in some sense separate from the other asavas, such as those of
attachment and desire of existence which veil the true know
ledge about sorrow.
The afflictions (kilesas} do not differ much from the asavas
for they are but the specific passions in forms ordinarily familiar
to us, such as covetousness (lob/ia), anger or hatred (dosa),
infatuation (moha), arrogance, pride or vanity (mdna), heresy
(ditthi), doubt or uncertainty (vicikicchd), idleness (thina), boast-
fulness (udhacca\ shamelessness (ahirikd) and hardness of heart
(anottapd); these kilesas proceed directly as a result of the asavas.
In spite of these varieties they are often counted as three (lobha,
dosa, moha) and these together are called kilesa. They are
associated with the vedanakkhandha, safifiakkhandha, sarikharak-
khandha and viftnanakkhandha. From these arise the three kinds
of actions, of speech, of body, and of mind 1 .
Sila and Samadhi.
We are intertwined all through outside and inside by the
tangles of desire (tanhd jatd), and the only way by which these
may be loosened is by the practice of right discipline (slid), con
centration (samddhi) and wisdom (panna). Sila briefly means
the desisting from committing all sinful deeds (sabbapdpassa
akaranam). With slla therefore the first start has to be made,
for by it one ceases to do all actions prompted by bad desires
and thereby removes the inrush of dangers and disturbances.
This serves to remove the kilesas, and therefore the proper per
formance of the slla would lead one to the first two successive
stages of sainthood, viz. the sotapannabhava (the stage in which
one is put in the right current) and the sakadagamibhava (the
stage when one has only one more birth to undergo). Samadhi
is a more advanced effort, for by it all the old roots of the old
kilesas are destroyed and the tanha or desire is removed and
1 Dhammasahgani) p. 180.
v] Right Conduct 101
by it one is led to the more advanced states of a saint. It
directly brings in panna (true wisdom) and by paftfia the saint
achieves final emancipation and becomes what is called an
arhat 1 . Wisdom {panna) is right knowledge about the four
ariya saccas, viz. sorrow, its cause, its destruction and its cause
of destruction.
Slla means those particular volitions and mental states, etc.
by which a man who desists from committing sinful actions
maintains himself on the right path. Slla thus means i. right
volition (cetana), 2. the associated mental states (cetasika\
3. mental control (samvara) and 4. the actual non-transgression
(in body and speech) of the course of conduct already in the mind
by the preceding three silas called avitikkama. Samvara is
spoken of as being of five kinds. I. Patimokkhasamvara (the
control which saves him who abides by it), 2. Satisamvara (the
control of mindfulness), 3. Nanasamvara (the control of know
ledge), 4. Khantisamvara (the control of patience), 5. Viriya-
samvara (the control of active self-restraint). Patimokkha
samvara means all self-control in general. Satisamvara means
the mindfulness by which one can bring in the right and good
associations when using one s cognitive senses. Even when
looking at any tempting object he will by virtue of his mindful-
ness (sati) control himself from being tempted by avoiding to
think of its tempting side and by thinking on such aspects of it
as may lead in the right direction. Khantisamvara is that by
which one can remain unperturbed in heat and cold. By the
proper adherence to slla all our bodily, mental and vocal activities
(kamma) are duly systematized, organized, stabilized (samddhd-
nam, upadhdranam, patittha)*.
The sage who adopts the full course should also follow a
number of healthy monastic rules with reference to dress, sitting,
dining, etc., which are called the dhutahgas or pure disciplinary
parts 8 . The practice of slla and the dhutaiigas help the sage to
adopt the course of samadhi. Samadhi as we have seen means
the concentration of the mind bent on right endeavours (kusala-
cittekaggatd samddhih) together with its states upon one parti
cular object (ekdrammana) so that they may completely cease to
shift and change (sammd ca avikkhipamdndy.
1 Visuddhimagga Niddnddikathd. 8 Visuddhimagga-silaniddeso, pp. 7 and 8.
3 Visuddhimajga, n. * Visuddhimagga, pp. 84-85.
IO2 Buddhist Philosophy [CH.
The man who has practised slla must train his mind first
in particular ways, so that it may be possible for him to acquire
the chief concentration of meditation called jhana (fixed and
steady meditation). These preliminary endeavours of the mind
for the acquirement of jhanasamadhi eventually lead to it
and are called upacara samadhi (preliminary samadhi) as dis
tinguished from the jhanasamadhi called the appanasamadhi
(achieved samadhi) 1 , Thus as a preparatory measure, firstly he
has to train his mind continually to view with disgust the appe
titive desires for eating and drinking (ahare pa(ikkulasafina) by
emphasizing in the mind the various troubles that are associated
in seeking food and drink and their ultimate loathsome trans
formations as various nauseating bodily elements. When a man
continually habituates himself to emphasize the disgusting
associations of food and drink, he ceases to have any attach
ment to them and simply takes them as an unavoidable evil,
only awaiting the day when the final dissolution of all sorrows
will come 8 . Secondly he has to habituate his mind to the idea
that all the parts of our body are made up of the four elements,
ksiti (earth), ap (water), tejas (fire) and wind (air), like the carcase
of a cow at the butcher s shop. This is technically called catu-
dhatuvavatthanabhavana (the meditation of the body as being
made up of the four elements) 3 . Thirdly he has to habituate his
mind to think again and again (anussati} about the virtues or
greatness of the Buddha, the sarigha (the monks following the
Buddha), the gods and the law (dhammd) of the Buddha, about
the good effects of slla, and the making of gifts (cdgdnussati),
about the nature of death (marandnussati) and about the deep
nature and qualities of the final extinction of all phenomena
(upasamanussati} 4 .
1 As it is not possible for me to enter into details, I follow what appears to me to
be the main line of division showing the interconnection of jhana (Skr. dhvana] vith
its accessory stages called parikammas (Visuddhimagga, pp. 85 f.).
2 Visuddhimagga, pp. 341-347; mark the intense pessimistic attitude, " 1 mart, ca
pana ahare patikulasaftflam anuyitttassa bhikkhuno rasatanhaya cittam patiliyati,
patikuttati, pativattati ; so, kantdranittharanatthiko viya piittamamsam vigatamado
aharam ahareti yavadeva dukkhassa nittharanatthdya" p. 347. The mind of him who
inspires himself with this supreme disgust to all food, becomes free from all desires for
palatable tastes, and turns its back to them and flies off from them. As a means of
getting rid of all sorrow he takes his food without any attachment as one would eat
the flesh of his own son to sustain himself in crossing a forest.
* Visuddhimagga, pp. 347-370. * Visuddhimagga, pp. 197-794.
v] Meditation \ 03
Advancing further from the preliminary meditations or pre
parations called the upacara samadhi we come to those other
sources of concentration and meditation called the appanasamadhi
which directly lead to the achievement of the highest samadhi.
The processes of purification and strengthening of the mind
continue in this stage also, but these represent the last attempts
which lead the mind to its final goal Nibbana. In the first part
of this stage the sage has to go to the cremation grounds and
notice the diverse horrifying changes of the human carcases and
think how nauseating, loathsome, unsightly and impure they are,
and from this he will turn his mind to the living human bodies
and convince himself that they being in essence the same as the
dead carcases are as loathsome as they 1 . This is called asubhakam-
matthana or the endeavour to perceive the impurity of our bodies.
He should think of the anatomical parts and constituents of the
body as well as their processes, and this will help him to enter
into the first jhana by leading his mind away from his body.
This is called the kayagatasati or the continual mindfulness
about the nature of the body 2 . As an aid to concentration the
sage should sit in a quiet place and fix his mind on the inhaling
(passdsa) and the exhaling (dssdsa) of his breath, so that instead
of breathing in a more or less unconscious manner he may be
aware whether he is breathing quickly or slowly; he ought to
mark it definitely by counting numbers, so that by fixing his
mind on the numbers counted he may fix his mind on the whole
process of inhalation and exhalation in all stages of its course.
This is called the anapanasati or the mindfulness of inhalation
and exhalation 3 .
Next to this we come to Brahmavihara, the fourfold medi
tation of metta (universal friendship), karuna (universal pity),
mudita (happiness in the prosperity and happiness of all) and
upekkha (indifference to any kind of preferment of oneself, his
friend, enemy or a third party). In order to habituate oneself to
the meditation on universal friendship, one should start with think
ing how he should himself like to root out all misery and become
happy, how he should himself like to avoid death and live cheer
fully, and then pass over to the idea that other beings would also
have the same desires. He should thus habituate himself to think
that his friends, his enemies, and all those with whom he is -ot
1 Vmiddhimagga, VI. 2 Ibid. pp. 239-266. 3 Ibid. pp. 266-192.
IO4 Buddhist Philosophy [CH.
connected might all live and become happy. He should fix himself
to such an extent in this meditation that he would not find any
difference between the happiness or safety of himself and of others.
He should never become angry with any person. Should he at any
time feel himself offended on account of the injuries inflicted on
him by his enemies, he should think of the futility of doubling
his sadness by becoming sorry or vexed on that account. He
should think that if he should allow himself to be affected by
anger, he would spoil all his sila which he was so carefully prac
tising. If anyone has done a vile action by inflicting injury,
should he himself also do the same by being angry at it ? If he
were finding fault with others for being angry, could he himself
indulge in anger? Moreover he should think that all the dhammas
are momentary (khanikatta) ; that there no longer existed the
khandhas which had inflicted the injury, and moreover the inflic
tion of any injury being only a joint product, the man who was
injured was himself an indispensable element in the production
of the infliction as much as the man who inflicted the injury, and
there could not thus be any special reason for making him re
sponsible and of being angry with him. If even after thinking
in this way the anger does not subside, he should think that by
indulging in anger he could only bring mischief on himself through
his bad deeds, and he should further think that the other man
by being angry was only producing mischief to himself but not
to him. By thinking in these ways the sage would be able to
free his mind from anger against his enemies and establish him
self in an attitude of universal friendship 1 . This is called the
metta-bhavana. In the meditation of universal pity (karuna)
also one should sympathize with the sorrows of his friends and
foes alike. The sage being more keen-sighted will feel pity for
those who are apparently leading a happy life, but are neither
acquiring merits nor endeavouring to proceed on the way to
Nibbana, for they are to suffer innumerable lives of sorrow 2 .
We next come to the jhanas with the help of material things
as objects of concentration called the Kasinam. These objects of
concentration may either be earth, water, fire, wind, blue colour,
yellow colour, red colour, white colour, light or limited space
(paricchinndkdsa). Thus the sage may take a brown ball of earth
and concentrate his mind upon it as an earth ball, sometimes
1 Visuddhimagga, pp. 295-314. 2 Ibid. pp. 314-315.
v] Meditation 105
with eyes open and sometimes with eyes shut. When he finds
that even in shutting his eyes he can visualize the object in his
mind, he may leave off the object and retire to another place to
concentrate upon the image of the earth ball in his mind.
In the first stages of the first meditation (pathamam jhdnani)
the mind is concentrated on the object in the way of understanding
it with its form and name and of comprehending it with its diverse
relations. This state of concentration is called vitakka (discursive
meditation). The next stage of the first meditation is that in
which the mind does not move in the object in relational terms
but becomes fixed and settled in it and penetrates into it without
any quivering. This state is called vicara (steadily moving). The
first stage vitakka has been compared in Buddhaghosa s Visud-
dhimagga to the flying of a kite with its wings flapping, whereas
the second stage is compared to its flying in a sweep without the
least quiver of its wings. These two stages are associated with
a buoyant exaltation (/z7z)and a steady inward bliss called sukha 1
instilling the mind. The formation of this first jhana roots out
five ties of avijja, kamacchando (dallying with desires), vyapado
(hatred), thlnamiddham (sloth and torpor), uddhaccakukkuccam
(pride and restlessness), and vicikiccha (doubt). The five elements
of which this jhana is constituted are vitakka, vicara, plti, sukham
and ekaggata (one pointedness).
When the sage masters the first jhana he finds it defective
and wants to enter into the second meditation (dutiyam jhdnam),
where there is neither any vitakka nor vicara of the first jhana,
but the mind is in one unruffled state (ekodibhavam). It is a
much steadier state and does not possess the movement which
characterized the vitakka and the vicara stages of the first jhana
and is therefore a very placid state (vitakka-vicdrakkhobha-
virahena ativiya acalatd suppasannata ca). It is however associ
ated with plti, sukha and ekaggata as the first jhana was.
When the second jhana is mastered the sage becomes disin
clined towards the enjoyment of the plti of that stage and becomes
indifferent to them (upekkhako). A sage in this stage sees the
objects but is neither pleased nor displeased. At this stage all
the asavas of the sage become loosened (khtndsavd). Th
enjoyment of sukha however still remains in the stage and th
1 Where there is plti there is sukha, but where there is sukha there may not
necessarily be piti. Visuddhimagga, p. 145.
106 Buddhist Philosophy [CH.
mind if not properly and carefully watched would like sometimes
to turn back to the enjoyment of piti again. The two character
istics of this jhana are sukha and ekaggata. It should however
be noted that though there is the feeling of highest sukha here,
the mind is not only not attached to it but is indifferent to it
(atimadhurasukhe sukhapdramippatte pi tatiyajjhdne upekkhako,
na tattha sukhdbhisangena dkaddhiyatiy . The earth ball (pathavi]
is however still the object of the jhana.
In the fourth or the last jhana both the sukha (happiness) and
the dukkha (misery) vanish away and all the roots of attachment
and antipathies are destroyed. This state is characterized by
supreme and absolute indifference (upekkhd) which was slowly
growing in all the various stages of the jhanas. The characteris
tics of this jhana are therefore upekkha and ekaggata. With the
mastery of this jhana comes final perfection and total extinction
of the citta called cetovimutti, and the sage becomes thereby an
arhat 2 . There is no further production of the khandhas,-no rebirth,
and there is the absolute cessation of all sorrows and sufferings
Nibbana.
Kamma.
In the Katha (II. 6) Yama says that "a fpol who is blinded
with the infatuation of riches does not believe in a future life; he
thinks that only this life exists and not any other, and thus he
comes again and again within my grasp." In the Dlgha Nikaya
also we read how Payasi was trying to give his reasons in support
of his belief that "Neither is there any other world, nor are there
beings, reborn otherwise than from parents, nor is there fruit or
result of deeds well done or ill done 3 ." Some of his arguments
were that neither th vicious nor the virtuous return to tell us
that they suffered or enjoyed happiness in the other world, that
if the virtuous had a better life in store, and if they believed
in it, they would certainly commit suicide in order to get it at
the earliest opportunity, that in spite of taking the best precau
tions we do not find at the time of the death of any person that
his soul goes out, or that his body weighs less on account of
the departure of his soul, and so on. Kassapa refutes his argu
ments with apt illustrations. But in spite of a few agnostics of
1 Visuddhimagga, p. 163.
2 Majjhima Nikaya, I. p. 296, and Visuddhimagja, pp. 167-168.
3 Dialogues of the Buddha, II. p. 349; D.N. II. pp. 317 ff.
v] Deeds and Desires 107
Payasi s type, we have every reason to believe that the doctrine
of rebirth in other worlds and in this was often spoken of in the
Upanisads and taken as an accepted fact by the Buddha. In
the Milinda Panha, we find Nagasena saying " it is through a
difference in their karma that men are not all alike, but some
long lived, some short lived, some healthy and some sickly, some
handsome and some ugly, some powerful and some weak, some
rich and some poor, some of high degree and some of low
degree, some wise and some foolish 1 ." We have seen in the
third chapter that the same sort of views was enunciated by the
Upanisad sages.
But karma could produce its effect in this life or any
other life only when there were covetousness, antipathy and in
fatuation. But " when a man s deeds are performed without
covetousness, arise without covetousness and are occasioned with
out covetousness, then inasmuch as covetousness is gone these
deeds are abandoned, uprooted, pulled out of the ground like a
palmyra tree and become non-existent and not liable to spring
up again in the future 2 ." Karma by itself without craving (tanha)
is incapable of bearing good or bad fruits. Thus we read in the
Mahdsatipatthana sutta, "even this craving, potent for rebirth,
that is accompanied by lust and self-indulgence, seeking satis
faction now here, now there, to wit, the craving for the life of
sense, the craving for becoming (renewed life) and the craving
for not becoming (for no new rebirth) 8 ." " Craving for things
visible, craving for things audible, craving for things that may
be smelt, tasted, touched, for things in memory recalled. These
are the things in this world that are dear, that are pleasant.
There does craving take its rise, there does it dwell 4 ." Pre-occu-
pation and deliberation of sensual gratification giving rise to
craving is the reason why sorrow comes. And this is the first
arya satya (noble truth).
The cessation of sorrow can only happen with "the utter
cessation of and disenchantment about that very craving, giving
it up, renouncing it and emancipation from it 8 ."
When the desire or craving (tanhd) has once ceased the
sage becomes an arhat, and the deeds that he may do after
that will bear no fruit. An arhat cannot have any good or bad
1 Warren s Buddhism in Translations, p. 215. 2 Ibid. pp. 216-217.
3 Dialogues of the Buddha, II. p. 340. 4 Ibid. p. 341. 8 Ibid. p. 341.
io8 Buddhist Philosophy [CH.
fruits of whatever he does. For it is through desire that karma
finds its scope of giving fruit. With the cessation of desire all
ignorance, antipathy and grasping cease and consequently there
is nothing which can determine rebirth. An arhat may suffer the
effects of the deeds done by him in some previous birth just as
Moggallana did, but in spite of the remnants of his past karma
an arhat was an emancipated man on account of the cessation of
his desire 1 .
Kammas are said to be of three kinds, of body, speech and
mind (kdyika, vacika and mdnasika). The root of this kamma
is however volition (cetana) and the states associated with it 2 . If
a man wishing to kill animals goes out into the forest in search of
them, but cannot get any of them there even after a long search,
his misconduct is not a bodily one, for he could not actually
commit the deed with his body. So if he gives an order for com
mitting a similar misdeed, and if it is not actually carried out
with the body, it would be a misdeed by speech (vacika) and not
by the body. But the merest bad thought or ill will alone whether
carried into effect or not would be a kamma of the mind (mdna-
sika)*. But the mental kamma must be present as the root of
all bodily and vocal kammas, for if this is absent, as in the case
of an arhat, there cannot be any kammas at all for him.
Kammas are divided from the point of view of effects into
four classes, viz. (i) those which are bad and produce impurity,
(2) those which are good and productive of purity, (3) those
which are partly good and partly bad and thus productive of
both purity and impurity, (4) those which are neither good nor
bad and productive neither of purity nor of impurity, but which
contribute to the destruction of kammas 4 .
Final extinction of sorrow (nibbdnd) takes place as the natural
result of the destruction of desires. Scholars of Buddhism have
tried to discover the meaning of this ultimate happening, and
various interpretations have been offered. Professor De la Valle"e
Poussin has pointed out that in the Pali texts Nibbana has
sometimes been represented as a happy state, as pure annihila
tion, as an inconceivable existence or as a changeless state 5 .
1 See Kathavatlhu and Warren s Buddhism in Translations, pp. 111 ff.
2 Atthasdlini) p. 88. * See Atthasalini, p. 90. 4 See Atthasalini, p. 89.
6 Prof. De la Vallee Poussin s article in the E. K. E. on Nirvana. See also
Cullavagga, ix. i. 4; Mrs Rhys Davids s Psalms of the early Buddhists, I. and n.,
Introduction, p. xxxvii; Digha, II. 15; Udana, vm. ; Samyutta, in. 109.
v] Nibbana 1 09
Mr Schrader, in discussing Nibbana in Pali Text Society Journal,
1905, says that the Buddha held that those who sought to become
identified after death with the soul of the world as infinite space
(akasa) or consciousness (yiiindna) attained to a state in which
they had a corresponding feeling of infiniteness without having
really lost their individuality. This latter interpretation of
Nibbana seems to me to be very new and quite against the spirit
of the Buddhistic texts. It seems to me to be a hopeless task
to explain Nibbana in terms of worldly experience, and there
is no way in which we can better indicate it than by saying that
it is a cessation of all sorrow; the stage at which all worldly
experiences have ceased can hardly be described either as positive
or negative. Whether we exist in some form eternally or do not
exist is not a proper Buddhistic question, for it is a heresy to
think of a Tathagata as existing eternally (sdsvatd) or not-
existing (asdsvata) or whether he is existing as well as not
existing or whether he is neither existing nor non-existing. Any
one who seeks to discuss whether Nibbana is either a positive
and eternal state or a mere state of non-existence or annihilation,
takes a view which has been discarded in Buddhism as heretical.
It is true that we in modern times are not satisfied with it, for
we want to know what it all means. But it is not possible to
give any answer since Buddhism regarded all these questions as
illegitimate.
Later Buddhistic writers like Nagarjuna and Candraklrtti
took advantage of this attitude of early Buddhism and inter
preted it as meaning the non-essential character of all existence.
Nothing existed, and therefore any question regarding the exist
ence or non-existence of anything would be meaningless. There
is no difference between the wordly stage (samsdra) and Nibbana,
for as all appearances are non-essential, they never existed during
the samsara so that they could not be annihilated in Nibbana.
Upanisads and Buddhism.
The Upanisads had discovered that the true self was ananda
(bliss) 1 . We could suppose that early Buddhism tacitly pre
supposes some such idea. It was probably thought that if there was
the self (atta) it must be bliss. The Upanisads had asserted that
the st\f(dtman) was indestructible and eternal*. If we are allowed
1 Tail. n. 5. 2 Brh. iv. 5. 14. Katha. v. 13.
no Buddhist Philosophy [CH.
to make explicit what was implicit in early Buddhism we could
conceive it as holding that if there was the self it must be bliss,
because it was eternal. This causal connection has not indeed
been anywhere definitely pronounced in the Upanisads, but he
who carefully reads the Upanisads cannot but think that the
reason why the Upanisads speak of the self as bliss is that it is
eternal. But the converse statement that what was not eternal
was sorrow does not appear to be emphasized clearly in the
Upanisads. The important postulate of the Buddha is that that
which is changing is sorrow, and whatever is sorrow is not self 1 .
The point at which Buddhism parted from the Upanisads lies
in the experiences of the self. The Upanisads doubtless con
sidered that there were many experiences which we often iden
tify with self, but which are impermanent. But the belief is
found in the Upanisads that there was associated with these a
permanent part as well, and that it was this permanent essence
which was the true and unchangeable self, the blissful. They con
sidered that this permanent self as pure bliss could not be defined
as this, but could only be indicated as .not this, not this (neti
netiy. But the early Pali scriptures hold that we could nowhere
find out such a permanent essence, any constant self, in our
changing experiences. All were but changing phenomena and
therefore sorrow and therefore non-self, and what was non-self
was not mine, neither I belonged to it, nor did it belong to me
as my self 8 .
The true self was with the Upanisads a matter of tran
scendental experience as it were, for they said that it could not
be described in terms of anything, but could only be pointed out
as " there," behind all the changing mental categories. The
Buddha looked into the mind and saw that it did not exist. But
how was it that the existence of this self was so widely spoken
of as demonstrated in experience ? To this the reply of the
Buddha was that what people perceived there when they said
that they perceived the self was but the mental experiences
either individually or together. The ignorant ordinary man did
not know the noble truths and was not trained in the way of wise
men, and considered himself to be endowed with form (rupa)
or found the forms in his self or the self in the forms. He
1 Samyutta Nikdya, in. pp. 44-45 if.
- See Brh. IV. iv. Chandogya, vin. 7-12. 3 Samyutta Nikaya, III. 45.
v] Upanisads and Buddhism 1 1 1
experienced the thought (of the moment) as it were the self or ex
perienced himself as being endowed with thought, or the thought
in the self or the self in the thought. It is these kinds of experi
ences that he considered as the perception of the self 1 .
The Upanisads did not try to establish any school of discipline
or systematic thought. They revealed throughout the dawn of an
experience of an immutable Reality as the self of man, as the only
abiding truth behind all changes. But Buddhism holds that this
immutable self of man is a delusion and a false knowledge.
The first postulate of the system is that impermanence is sorrow.
Ignorance about sorrow, ignorance about the way it originates,
ignorance about the nature of the extinction of sorrow, and ignorf-
ance about the means of bringing about this extinction represent
the fourfold ignorance (avijj d) 2 . The avidya, which is equivalent
to the Pali word avijja, occurs in the Upanisads also, but there!
it means ignorance about the atman doctrine, and it is sometimes
contrasted with vidya or true knowledge about the self (atmari)*.
With the Upanisads the highest truth was the permanent self,
the bliss, but with the Buddha there was nothing permanent; and
all was change; and all change and impermanence was sorrow 4 .
This is, then, the cardinal truth of Buddhism, and ignorance con
cerning it in the above fourfold ways represented the fourfold
ignorance which stood in the way of the right comprehension of
the fourfold cardinal truths (ariya saccd) sorrow, cause of the
origination of sorrow, extinction of sorrow, and the means thereto.
There is no Brahman or supreme permanent reality and no
self, and this ignorance does not belong to any ego or self as we
may ordinarily be led to suppose.
Thus it is said in the Visuddhimagga " inasmuch however
as ignorance is empty of stability from being subject to a coming
into existence and a disappearing from existence... and is empty
of a self-determining Ego from being subject to dependence,
...or in other words inasmuch as ignorance is not an Ego, and
similarly with reference to Karma and the rest therefore is it
to be understood of the wheel of existence that it is empty with
a twelvefold emptiness 8 ."
1 Samyutta Nikaya, III. 46. 2 Majjhima Nikdya, I. p. 54.
3 Cha. i. i. 10. Brh. iv. 3. 20. i here are some passages where vidya and avidya
have been used in a different and rather obscure sense, Is^i 9-1 r.
4 Ang. Nikdya, in. 85.
5 Warren s Budakism in Translations {Visuddhimagga, chap. xvn. ), p. 175.
1 1 2 Buddhist Philosophy [CH,
The Schools of Theravada Buddhism.
There is reason to believe that the oral instructions of the
Buddha were not collected until a few centuries after his death.
Serious quarrels arose amongst his disciples or rather amongst
the successive generations of the disciples of his disciples about
his doctrines and other monastic rules which he had enjoined
upon his followers. Thus we find that when the council of Vesali
decided against the Vrjin monks, called also the Vajjiputtakas,
they in their turn held another great meeting (Mahasarigha) and
came to their own decisions about certain monastic rules and thus
came to be called as the Mahasarighikas 1 . According to Vasu-
mitra as translated by Vassilief, the Mahasarighikas seceded in
400 B.C. and during the next one hundred years they gave rise
first to the three schools Ekavyavaharikas, Lokottaravadins, and
Kukkulikas and after that the Bahusrutlyas. In the course of the
next one hundred years, other schools rose out of it namely the
Prajfiaptivadins, Caittikas, Aparasailas and Uttarasailas. The
Theravada or the Sthaviravada school which had convened the
council of Vesali developed during the second and first century B.C.
into a number of schools, viz. the Haimavatas, Dharmaguptikas,
Mahlsasakas, Kasyaplyas, Sarikrantikas (more well known as
Sautrantikas)andtheVatsiputtrIyas which latter was again split up
into the Dharmottariyas, Bhadrayaniyas, Sammitlyas and Chan-
nagarikas. The main branch of the Theravada school was from
the second century downwards known as the Hetuvadins or
Sarvastivadins 2 . The Mahdbodhivamsa identifies the Theravada
school with the Vibhajjavadins. The commentator of the Kathd-
vatthu who probably lived according to Mrs Rhys Davids some
time in the fifth century A.D. mentions a few other schools of
Buddhists. But of all these Buddhist schools we know very little.
Vasumitra (100 A.D.) gives us some very meagre accounts of
1 The Mahavamsa. differs from Dipa-vamsa in holding that the Vajjiputtakas did
not develop into the Mahasanghikas, but it was the Mahasarighikas who first seceded
while the Vajjiputtakas seceded independently of them. The Mahdbodhivamsa, which
according to Professor Geiger was composed 975 A.D. IOOOA.D., follows the Maha
vamsa in holding the Mahasanghikas to be the first seceders and Vajjiputtakas to have
seceded independently.
Vasumitra confuses the council of Vesali with the third council of Pataliputra. See
introduction to translation of Kathavatthu by Mrs Rhys Davids.
2 For other accounts of the schism see Mr Aung and Mrs Rhys Davids s translation
of Kathavatthu, pp. xxxvi-xlv.
v] Schools of Buddhism 113
certain schools, of the Mahasarighikas, Lokottaravadins, Ekavya-
vaharikas, Kukkulikas, Prajfiaptivadins and Sarvastivadins, but
these accounts deal more with subsidiary matters of little philo
sophical importance. Some of the points of interest are (i) that the
Mahasarighikas were said to believe that the body was filled with
mind (cittd) which was represented as sitting, (2) that the Prajfiap
tivadins held that there was no agent in man, that there was no
untimely death, for it was caused by the previous deeds of man,
(3) that the Sarvastivadins believed that everything existed. From
the discussions found in the Kathdvatthu also we may know the
views of some of the schools on some points which are not always
devoid of philosophical interest. But there is nothing to be found
by which we can properly know the philosophy of these schools. It
is quite possible however that these so-called schools of Buddhism
were not so many different systems but only differed from one
another on some points of dogma or practice which were con
sidered as being of sufficient interest to them, but which to us now
appear to be quite trifling. But as we do not know any of their
literatures, it is better not to make any unwarrantable surmises.
These schools are however not very important for a history of later
Indian Philosophy, for none of them are even referred to in any
of the systems of Hindu thought. The only schools of Buddhism
with which other schools of philosophical thought came in direct
contact, are the Sarvastivadins including the Sautrantikas and
the Vaibhasikas, the Yogacara or the Vijfianavadins and the
Madhyamikas or the unyavadins. We do not know which of the
diverse smaller schools were taken up into these four great schools,
the Sautrantika, Vaibhasika, Yogacara and the Madhyamika
schools. But as these schools were most important in relation
to the development of the different systems in Hindu thought,
it is best that we should set ourselves to gather what we can
about these systems of Buddhistic thought.
When the Hindu writers refer to the Buddhist doctrine in
general terms such as "the Buddhists say" without calling
them the Vijflanavadins or the Yogacaras and the ^unyavadins,
they often refer to the Sarvastivadins by which they mean
both the Sautrantikas and the Vaibhasikas, ignoring the differ
ence that exists between these two schools. It is well to
mention that there is hardly any evidence to prove that the
Hindu writers were acquainted with the Theravada doctrines
D. 8
H4 Buddhist Philosophy [CH.
as expressed in the Pali works. The Vaibhasikas and the Sau
trantikas have been more or less associated with each other. Thus
the Abhidharmakosasdstra of Vasubandhu who was a Vaibhasika
was commented upon by Yasomitra who was a Sautrantika. The
difference between the Vaibhasikas and the Sautrantikas that
attracted the notice of the Hindu writers was this, that the former
believed that external objects were directly perceived, whereas
the latter believed that the existence of the external objects could
only be inferred from our diversified knowledge 1 . Gunaratna
(fourteenth century A.D.) in his commentary Tarkarahasyadipikd
QftSaddarsanasamuccaya says that the Vaibhasika was but another
name of the Aryasammitlya school. According to Gunaratna the
Vaibhasikas held that things existed for four moments, the
moment of production, the moment of existence, the moment of
decay and the moment of annihilation. It has been pointed out
in Vasubandhu s Abhidharmakosa that the Vaibhasikas believed
these to be four kinds of forces which by coming in combination
with the permanent essence of an entity produced its imperma
nent manifestations in life (see Prof. Stcherbatsky s translation
of Yasomitra on Abhidharmakosa kdrikd, V. 25). The self called
pudgala also possessed those characteristics. Knowledge was
formless and was produced along with its object by the very
same conditions (arthasahabhdsi ekasamdgryadhtnak). The Sau
trantikas according to Gunaratna held that there was no soul but
only the five skandhas. These skandhas transmigrated. The past,
the future, annihilation, dependence on cause, akasa and pudgala
are but names (samjndmdtram}, mere assertions (flrattjndmdtram),
mere limitations (samvrtamdtram) and mere phenomena (vya-
vaharamdtram). By pudgala they meant that which other people
called eternal and all pervasive soul. External objects are never
directly perceived but are only inferred as existing for explaining
the diversity of knowledge. Definite cognitions are valid; all
compounded things are momentary (ksanikdh sarvasamskdrd/i}.
1 Madhavacarya s Sarvadarfanasamgraha, chapter n. Sastradipika, the discussions
on Pratyaksa, Amalananda s commentary (on Bhamati} Vedantakalpataru, p. 286,
vaibhasikasya bahyo rthah pratyaksah, sautrantikasya jftanagatakarcmaicitryen
anumeyah." The nature of the inference of the Sautrantikas is shown thus by Amala-
nanda (1247-1260 A.D.) "ye yasmin satyapi kddacitkdh te tadatiriktapeksah" (those
(i.e. cognitions) which in spite ol certain unvaried conditions are of unaccounted
diversity must depend on other things in addition to these, i.e. the external objects)
Veddntakalpataru, p. 289.
v] Schools of Buddhism 115
The atoms of colour, taste, smell and touch, and cognition are
being destroyed every moment. The meanings of words always
imply the negations of all other things, excepting that which is
intended to be signified by that word (anydpohah sabdarthah).
Salvation (mok$a) comes as the result of the destruction of the
process of knowledge through continual meditation that there
is no soul 1 .
One of the main differences between the Vibhajjavadins, Sau-
trantikas and the Vaibhasikas or the Sarvastivadins appears to
refer to the notion of time which is a subject of great interest
with Buddhist philosophy. Thus Abhidharmakosa (v. 24...)
describes the Sarvastivadins as those who maintain the universal
existence of everything past, present and future. The Vibhajja
vadins are those " who maintain that the present elements and
those among the past that have not yet produced their fruition,
are existent, but they deny the existence of the future ones and
of those among the past that have already produced fruition."
There were four branches of this school represented by Dhar-
matrata, Ghosa, Vasumitra and Buddhadeva. Dharmatrata main
tained that when an element enters different times, its existence
changes but not its essence, just as when milk is changed into curd
or a golden vessel is broken, the form of the existence changes
though the essence remains the same. Ghosa held that " when
an element appears at different times, the past one retains its
past aspects without being severed from its future and present
aspects, the present likewise retains its present aspect without
completely losing its past and future aspects," just as a man in
passionate love with a woman does not lose his capacity to love
other women though he is not actually in love with them. Vasu
mitra held that an entity is called present, past and future accord
ing as it produces its efficiency, ceases to produce after having
once produced it or has not yet begun to produce it. Buddha
deva maintained the view that just as the same woman may
be called mother, daughter, wife, so the same entity may be
called present, past or future in accordance with its relation to the
preceding or the succeeding moment.
All these schools are in some sense Sarvastivadins, for they
maintain universal existence. But the Vaibhasika finds them all
defective excepting the view of Vasumitra. For Dharmatrata s
1 Gunaratna s TarkarahasyadJpika, pp. 46-47.
82
u6 Buddhist Philosophy [CH.
view is only a veiled Samkhya doctrine; that of Ghosa is a
confusion of the notion of time, since it presupposes the co
existence of all the aspects of an entity at the same time, and
that of Buddhadeva is also an impossible situation, since it would
suppose that all the three times were found together and included
in one of them. The Vaibhasika finds himself in agreement
with Vasumitra s view and holds that the difference in time
depends upon the difference of the function of an entity ; at the
time when an entity does not actually produce its function it is
future; when it produces it, it becomes present; when after having
produced it, it stops, it becomes past ; there is a real existence
of the past and the future as much as of the present. He thinks
that if the past did not exist and assert some efficiency it could
not have been the object of my knowledge, and deeds done in
past times could not have produced its effects in the present
time. The Sautrantika however thought that the Vaibhasika s
doctrine would imply the heretical doctrine of eternal existence,
for according to them the stuff remained the same and the time-
difference appeared in it. The true view according to him was,
that there was no difference between the efficiency of an entity,
the entity and the time of its appearance. Entities appeared
from non-existence, existed for a moment and again ceased to
exist. He objected to the Vaibhasika view that the past is to
be regarded as existent because it exerts efficiency in bringing
about the present on the ground that in that case there should
be no difference between the past and the present, since both
exerted efficiency. If a distinction is made between past, present
and future efficiency by a second grade of efficiencies, then we
should have to continue it and thus have a vicious infinite. We
can know non-existent entities as much as we can know existent
ones, and hence our knowledge of the past does not imply
that the past is exerting any efficiency. If a distinction is
made between an efficiency and an entity, then the reason why
efficiency started at any particular time and ceased at another
would be inexplicable. Once you admit that there is no dif
ference between efficiency and the entity, you at once find that
there is no time at all and the efficiency, the entity and the
moment are all one and the same. When we remember a thing
of the past we do not know it as existing in the past, but in the
same way in which we knew it when it was present. We are
v] Vasubandhu and the Vatsiputtriyas 117
never attracted to past passions as the Vaibhasika suggests, but
past passions leave residues which become the causes of new
passions of the present moment 1 .
Again we can have a glimpse of the respective positions of
the Vatsiputtriyas and the Sarvastivadins as represented by
Vasubandhu if we attend to the discussion on the subject of
the existence of soul in Abhidharmakosa, The argument of
Vasubandhu against the existence of soul is this, that though
it is true that the sense organs may be regarded as a deter
mining cause of perception, no such cause can be found which
may render the inference of the existence of soul necessary.
If soul actually exists, it must have an essence of its own and
must be something different from the elements or entities of a
personal life. Moreover, such an eternal, uncaused and un
changing being would be without any practical efficiency (artha-
kriydkdritva) which alone determines or proves existence. The
soul can thus be said to have a mere nominal existence as a
mere object of current usage. There is no soul, but there are
only the elements of a personal life. But the Vatslputtrlya
school held that just as fire could not be said to be either the
same as the burning wood or as different from it, and yet it is
separate from it, so the soul is an individual (pudgala) which has
a separate existence, though we could not say that it was
altogether different from the elements of a personal life or the
same as these. It exists as being conditioned by the elements
of personal life, but it cannot further be defined. But its existence
cannot be denied, for wherever there is an activity, there must
be an agent (e.g. Devadatta walks). To be conscious is likewise
an action, hence the agent who is conscious must also exist.
To this Vasubandhu replies that Devadatta (the name of a
person) does not represent an unity. " It is only an unbroken
continuity of momentary forces (flashing into existence), which
simple people believe to be a unity and to which they give the
name Devadatta. Their belief that Devadatta moves is con
ditioned, and is based on an analogy with their own experience,
but their own continuity of life consists in constantly moving
from one place to another. This movement, though regarded as
1 I am indebted for the above account to the unpublished translation from Tibetan
of a small portion of Abhidharmakota by my esteemed friend Prof. Th. Stcherbatsky
of Petrograd. I am grateful to him that he allowed me to utilize it.
1 1 8 Buddhist Philosophy [CH.
belonging to a permanent entity, is but a series of new produc
tions in different places, just as the expressions fire moves,
sound spreads have the meaning of continuities (of new pro
ductions in new places). They likewise use the words Devadatta
cognises in order to express the fact that a cognition (takes place
in the present moment) which has a cause (in the former moments,
these former moments coming in close succession being called
Devadatta)."
The problem of memory also does not bring any difficulty,
for the stream of consciousness being one throughout, it produces
its recollections when connected with a previous knowledge of
the remembered object under certain conditions of attention,
etc., and absence of distractive factors, such as bodily pains or
violent emotions. No agent is required in the phenomena of
memory. The cause of recollection is a suitable state of mind
and nothing else. When the Buddha told his birth stories saying
that he was such and such in such and such a life, he only
meant that his past and his present belonged to one and the
same lineage of momentary existences. Just as when we say
" this same fire which had been consuming that has reached this
object," we know that the fire is not identical at any two
moments, but yet we overlook the difference and say that it is
the same fire. Again, what we call an individual can only be
known by descriptions such as " this venerable man, having this
name, of such a caste, of such a family, of such an age, eating
such food, finding pleasure or displeasure in such things, of such
an age, the man who after a life of such length, will pass away
having reached an age." Only so much description can be
understood, but we have never a direct acquaintance with the
individual ; all that is perceived are the momentary elements of
sensations, images, feelings, etc., and these happening at the
former moments exert a pressure on the later ones. The in
dividual is thus only a fiction, a mere nominal existence, a mere
thing of description and not of acquaintance ; it cannot be
grasped either by the senses or by the action of pure intellect.
This becomes evident when we judge it by analogies from other
fields. Thus whenever we use any common noun, e.g. milk, we
sometimes falsely think that there is such an entity as milk, but
what really exists is only certain momentary colours, tastes, etc.,
fictitiously unified as milk; and "just as milk and water are
v] Sabbatthivadins 119
conventional names (for a set of independent elements) for some
colour, smell (taste and touch) taken together, so is the designa
tion individual but a common name for the different elements
of which it is composed."
The reason why the Buddha declined to decide the question
whether the " living being is identical with the body or not " is
just because there did not exist any living being as " individual,"
as is generally supposed. He did not declare that the living
being did not exist, because in that case the questioner would
have thought that the continuity of the elements of a life was
also denied. In truth the " living being " is only a conventional
name for a set of constantly changing elements 1 .
The only book of the Sammitlyas known to us and that by
name only is the Sammitlyasdstra translated into Chinese between
350 A.D. to 431 A.D.; the original Sanskrit works are however
probably lost 2 .
The Vaibhasikas are identified with the Sarvastivadins who
according to Dipavamsa V. 47, as pointed out by Takakusu,
branched off from the Mahiasakas, who in their turn had
separated from the Theravada school.
From the Kathdvatthu we know (i) that the Sabbatthivadins
believed that everything existed, (2) that the dawn of right attain
ment was not a momentary flash of insight but by a gradual
process, (3) that consciousness or even samadhi was nothing but
1 This account is based on the translation of Aftamakofasthananibaddhah pudgala-
viniscayah, a special appendix to the eighth chapter of Abhidharmakosa^ by Prof. Th.
Stcherbatsky, Bulletin de FAcadtmie des Sciences defiusste, 1919.
* Professor De la Vall6e Poussin has collected some of the points of this doctrine
in an article on the Sammitiyas in the . R. E. He there says that in the Abhidhar-
makoiavyakhya the Sammitiyas have been identified with the Vatsiputtriyas and that
many of its texts were admitted by the Vaibhasikas of a later age. Some of their views
are as follows: (i) An arhat in possession of nirvana can fall away; (i) there is an
intermediate state between death and rebirth called antarabhava ; (3) merit accrues not
only by gift (tyaganvaya) but also by the fact of the actual use and advantage reaped
by the man to whom the th*ng was given (paribhog&nvaya puny a) ; (4) not only
abstention from evil deeds but a declaration of intention to that end produces merit
by itself alone ; (5) they believe in a pudgala (soul) as distinct from the skandhas from
which it can be said to be either different or non-different. " The pudgala cannot be
said to be transitory (anitya) like the skandhas since it transmigrates laying down
the burden (skandhas) shouldering a new burden ; it cannot be said to be permanent,
since it is made of transitory constituents." This pudgala doctrine of the Sammitiyas
as sketched by Professor De la Valle e Poussin is not in full agreement with the
pudgala doctrine of the Sammitiyas as sketched by Gunaratna which we have noticed
above.
1 20 Buddhist Philosophy [CH.
a flux and (4) that an arhat (saint) may fall away 1 . The Sab-
batthivadins or Sarvastivadins have a vast Abhidharma literature
still existing in Chinese translations which is different from the
Abhidharma of the Theravada school which we have already
mentioned". These are I . Jndnaprasthdna Sdstra of Katyayanl-
puttra which passed by the name of Mahd Vibhdsd from which
the Sabbatthivadins who followed it are called Vaibhasikas 3 . This
work is said to have been given a literary form by Asvaghosa.
2. Dharmaskandlia by Sariputtra. 3. Dhdtukdya by Purna.
4. Prajnaptisdstra by Maudgalyayana. 5. Vijndnakdya by De-
vaksema. 6. Sangltiparyydya by Sariputtra and Prakaranapdda
by Vasumitra. Vasubandhu (420 A.D. 500 A.D.) wrote a work on
the Vaibhasika 4 system in verses (kdrikd) known as the Abhidhar-
makosa, to which he appended a commentary of his own which
passes by the name Abhidharma Kosabhdsya in which he pointed
out some of the defects of the Vaibhasika school from the Sau
trantika point of view 5 . This work was commented upon by
Vasumitra and Gunamati and later on by Ya^omitra who was
himself a Sautrantika and called his work Abhidharmakosa
vydkhyd ; Sanghabhadra a contemporary of Vasubandhu wrote
Samayapradipa and Nydydnusdra (Chinese translations of which
are available) on strict Vaibhasika lines. We hear also of other
Vaibhasika writers such as Dharmatrata, Ghosaka, Vasumitra
and Bhadanta, the writer of Samyuktdbhidharmasdstra and Ma-
hdvibhdsd. Dirinaga (480 A.D.), the celebrated logician, a Vaibhasika
or a Sautrantika and reputed to be a pupil of Vasubandhu, wrote
his famous work Pramdnasamuccaya in which he established
Buddhist logic and refuted many of the views of Vatsyayana
the celebrated commentator of the Nydya sutras; but we regret
1 See Mrs Rhys Davids s translation Kath&vatthu, p. xix, and Sections I. 6, 7 ;
ii. 9 and xi. 6.
z Mahavyutpatti gives two names for Sarvastivada, viz. Mulasarvastivada and Ary-
yasarvastivada. Itsing (671-695 A.D.) speaks of Aryyamulasarvastivada and Mulasar
vastivada. In his time he found it prevailing in Magadha, Guzrat, Sind, S. India,
E. India. Takakusu says (P. T.S. 1904-1905) that Paramartha, in his life of Vasu
bandhu, says that it was propagated from Kashmere to Middle India by Vasubhadra,
who studied it there.
8 Takakusu says (P. T.S. 1904-1905) that Katyayaniputtra s work was probably
a compilation from other Vibhasas which existed before the Chinese translations and
Vibhisa texts dated 383 A.D.
4 See Takak usu s article J.R. A.S. 1905.
5 The Sautrantikas did not regard the Abhidharmas of the Vaibhasikas as authentic
and laid stress on the suttanta doctrines as given in the Suttapitaka.
v] Sabbatthivadins 1 2 1
to say tnat none of the above works are available in Sanskrit,
nor have they been retranslated from Chinese or Tibetan into
any of the modern European or Indian languages.
The Japanese scholar Mr Yamakami Sogen, late lecturer at
Calcutta University, describes the doctrine of the Sabbatthivadins
from the Chinese versions of the Abhidharmakosa, Mahdvibhd-
sdsdstra, etc., rather elaborately 1 . The following is a short sketch,
which is borrowed mainly from the accounts given by Mr Sogen.
The Sabbatthivadins admitted the five skandhas, twelve
ayatanas, eighteen dhatus, the three asamskrta dharmas of
pratisamkhyanirodha apratisamkhyanirodha and akasa, and the
samskrta dharmas (things composite and interdependent) of rupa
(matter), citta (mind), caitta (mental) and cittaviprayukta (non-
mental) 11 . All effects are produced by the coming together
(samskrta) of a number of causes. The five skandhas, and the
rupa, citta, etc., are thus called samskrta dharmas (composite
things or collocations sambhuyakdri). The rupa dharmas are
eleven in number, one citta dharma, 46 caitta dharmas and 14
cittaviprayukta samskara dharmas (non-mental composite things);
adding to these the three asamskrta dharmas we have the seventy-
five dharmas. Rupa is that which has the capacity to obstruct the
sense organs. Matter is regarded as the collective organism or
collocation, consisting of the fourfold substratum of colour, smell,
taste and contact. The unit possessing this fourfold substratum
is known as paramanu, which is the minutest form of rupa. It
cannot be pierced through or picked up or thrown away. It is
indivisible, unanalysable, invisible, inaudible, untastable and in
tangible. But yet it is not permanent, but is like a momentary
flash into being. The simple atoms are called dravyaparamdyu
and the compound ones samghataparamaqu. In the words of
Prof. Stcherbatsky " the universal elements of matter are mani
fested in their actions or functions. They are consequently more
energies than substances." The organs of sense are also regarded
as modifications of atomic matter. Seven such paramanus com
bine together to form an anu, and it is in this combined form
only that they become perceptible. The combination takes
place in the form of a cluster having one atom at the centre and
1 Systems of Buddhistic Thought, published by the Calcutta University.
8 Sankara in his meagre sketch of the doctrine of the Sarvastivadins in his bhasya
on the Brahma-sutras n. ? notices some of the categories mentioned by Sogen.
122 Buddhist Philosophy [CH.
others around it. The point which must be remembered in con
nection with the conception of matter is this, that the qualities
of all the mahabhutas are inherent in the paramanus. The special
characteristics of roughness (which naturally belongs to earth),
viscousness (which naturally belongs to water), heat (belonging
to fire), movableness (belonging to wind), combine together to
form each of the elements ; the difference between the different
elements consists only in this, that in each of them its own special
characteristics were predominant and active, and other charac
teristics though present remained only in a potential form. The
mutual resistance of material things is due to the quality of
earth or the solidness inherent in them ; the mutual attraction of
things is due to moisture or the quality of water, and so forth.
The four elements are to be observed from three aspects, namely,
(i) as things, (2) from the point of view of their natures (such as
activity, moisture, etc.), and (3) function (such as dhrti or attrac
tion, samgraha or cohesion, pakti or chemical heat, and vyuliana
or clustering and collecting). These combine together naturally
by other conditions or causes. The main point of distinction
between the Vaibhasika Sarvastivadins and other forms of Bud
dhism is this, that here the five skandhas and matter are re
garded as permanent and eternal ; they are said to be momentary
only in the sense that they are changing their phases constantly,
owing to their constant change of combination. Avidya is not
regarded here as a link in the chain of the causal series of
pratltyasamutpada ; nor is it ignorance of any particular in
dividual, but is rather identical with " moha " or delusion and
represents the ultimate state of immaterial dharmas. Avidya,
which through samskara, etc., produces namarupa in the case of
a particular individual, is not his avidya in the present existence
but the avidya of his past existence bearing fruit in the present
life.
" The cause never perishes but only changes its name, when
it becomes an effect, having changed its state." For example,
clay becomes jar, having changed its state ; and in this case the
name clay is lost and the name jar arises 1 . The Sarvastivadins
allowed simultaneousness between cause and effect only in the
case of composite things (samprayukta hettt} and in the case of
1 Sogen s quotation from Kumarajlva s Chinese version of Aryyadeva s commentary
on the Aladhyamika Jastra (chapter XX. Karika 9).
v] Sabbatthivadins 123
the interaction of mental and material things. The substratum
of "vijftana" or "consciousness" is regarded as permanent and
the aggregate of the five senses (indriyas) is called the perceiver.
It must be remembered that the indriyas being material had a
permanent substratum, and their aggregate had therefore also a
substratum formed of them.
The sense of sight grasps the four main colours of blue, yellow,
red, white, and their combinations, as also the visual forms of
appearance (samsthdna) of long, short, round, square, high, low,
straight, and crooked. The sense of touch (kdyendriya) has for
its object the four elements and the qualities of smoothness,
roughness, lightness, heaviness, cold, hunger and thirst. These
qualities represent the feelings generated in sentient beings by
the objects of touch> hunger, thirst, etc., and are also counted
under it, as they are the organic effects produced by a touch
which excites the physical frame at a time when the energy of
wind becomes active in our body and predominates over other
energies ; so also the feeling of thirst is caused by a touch which
excites the physical frame when the energy of the element of fire
becomes active and predominates over the other energies. The
indriyas (senses) can after grasping the external objects arouse
thought (vijndna) ; each of the five senses is an agent without
which none of the five vijftanas would become capable of per
ceiving an external object. The essence of the senses is entirely
material. Each sense has two subdivisions, namely, the principal
sense and the auxiliary sense. The substratum of the principal
senses consists of a combination of paramanus, which are ex
tremely pure and minute, while the substratum of the latter is
the flesh, made of grosser materials. The five senses differ from
one another with respect to the manner and form of their respec
tive atomic combinations. In all sense-acts, whenever an act is
performed and an idea is impressed, a latent energy is impressed
on our person which is designated as avijftapti rupa. It is called
rupa because it is a result or effect of rupa-contact ; it is called
avijftapti because it is latent and unconscious ; this latent energy
is bound sooner or later to express itself in karma effects and is
the only bridge which connects the cause and the effect of karma
done by body or speech. Karma in this school is considered
as twofold, namely, that as thought (cetana karma) and that as
activity (caitasika karma}. This last, again, is of two kinds, viz.
1 24 Buddhist Philosophy [CH.
that due to body-motion (kdyika karma) and speech (vdcika
karma). Both these may again be latent (avijnapti) and patent
(yijnapti), giving us the kayika-vijftapti karma, kayikavijftapti
karma, vacika-vijfiapti karma and vacikavijftapti karma. Avijflapti
rupa and avijflapti karma are what we should call in modern
phraseology sub-conscious ideas, feelings and activity. Corre
sponding to each conscious sensation, feeling, thought or activity
there is another similar sub-conscious state which expresses itself
in future thoughts and actions ; as these are not directly known but
are similar to those which are known, they are called avijflapti.
The mind, says Vasubandhu, is called cittam, because it
wills (cetati), manas because it thinks (manvate) and vijftana
because it discriminates (nirdisati). The discrimination may be
of three kinds: (i) svabhava nirdesa (natural perceptual discrimi
nation), (2) prayoga nirdeSa (actual discrimination as present,
past and future), and (3) anusmrti nirdesa (reminiscent discrimi
nation referring only to the past). The senses only possess the
svabhava nzrdesa,the other two belong exclusively to manovijftana.
Each of the vijflanas as associated with its specific sense dis
criminates its particular object and perceives its general charac
teristics; the six vijflanas combine to form what is known as the
Vijftanaskandha, which is presided over by mind (mano). There
are forty-six caitta samskrta dharmas. Of the three asamskrta
dharmas akasa (ether) is in essence the freedom from obstruction,
establishing it as a permanent omnipresent immaterial substance
(nirupdkhya, non-rupa). The second asamskrta dharma, aprati-
samkhya nirodha, means the non-perception of dharmas caused
by the absence of pratyayas or conditions. Thus when I fix my
attention on one thing, other things are not seen then, not because
they are non-existent but because the conditions which would
have made them visible were absent. The third asamskrta
dharma, pratisamkhya nirodha, is the final deliverance from
bondage. Its essential characteristic is everlastingness. These
are called asamskrta because being of the nature of negation
they are non-collocative and hence have no production or dis
solution. The eightfold noble path which leads to this state
consists of right views, right aspirations, right speech, right con
duct, right livelihood, right effort, right mindfulness, right rapture 1 .
1 Mr Sogen mentions the name of another Buddhist Hlnayana thinker (about
750 A. D.), Harivarman, who founded a school known as Satyasiddhi school, which
v] Mahay anism 125
Mahay anism.
It is difficult to say precisely at what time Mahayanism took
its rise. But there is reason to think that as the Mahasanghikas
separated themselves from the Theravadins probably some time in
400 B.C. and split themselves up into eight different schools, those
elements of thoughts and ideas which in later days came to be
labelled as Mahayana were gradually on the way to taking their
first inception. We hear in about 100 A.D. of a number of works
which are regarded as various Mahayana sutras, some of which
are probably as old as at least 100 B.C. (if not earlier) and others
as late as 300 or 400 A.D. 1 . These Mahayanasutras, also called
the Vaipulyasutras, are generally all in the form of instructions
given by the Buddha. Nothing is known about their authors or
compilers, but they are all written in some form of Sanskrit and
were probably written by those who seceded from the Theravada
school.
The word Hlnayana refers to the schools of Theravada, and
as such it is contrasted with Mahayana. The words are generally
translated as small vehicle (hma= small, ydna= vehicle) and great
vehicle (mahd great, ydna vehicle). But this translation by
no means expresses what is meant by Mahayana and Hlna
yana 3 . Asahga (480 A.D.) in his Mahay anasutrdlamkdra gives
propounded the same sort of doctrines as those preached by Nagarjuna. None of his
works are available in Sanskrit and I have never come across any allusion to his name
by Sanskrit writers.
1 Quotations and references to many of these sutras are found in Candraklrtti s com
mentary on the Mddkyamtka karikas of Nagarjuna ; some of these are the following :
Astasdhasrikdprajndpdramitd (translated into Chinese 164 A.D.-i67 A.D.), Satasahas-
rikdprajndpdramitd, Gaganaganja, Samddhisutra, Tathdgataguhyasutra y Drdhddhyd-
Sayasancodandsutra, Dhydyitamusttsutra, Pitdputrasamdgamasutra, Mahay anasutra,
Mtlradamanasutra, Ratnakutasutra, Ratnacutldpariprcchasutra, Ratnameghasutra,
RatnardSisutra, Ratndkarasutra, Rdstrapdlapariprcchdsutra, Lankdvatdrasutra,
Lalitavistarasutra, Vajracchedikasutra, VimalakirttinirdeSasutra, Salistambhasutra,
Samddhirajasutra, Sukhavativyuha, SuvarnaprabkasasiUra, Saddharmapundarika
(translated into Chinese A.D. 255), Amitdyurdkydnasutra, Haslikdkhyasutra, etc.
3 The word Yana is generally translated as vehicle, but a consideration of numerous
contexts in which the word occurs seems to suggest that it means career or course or
way, rather than vehicle (Lalitavistara, pp. 25, 38; Prajn¶mitd^ pp. 24, 319;
Samddkirdjasutra, p. i ; Karundpundarika, p. 67; Lankavatarasutra, pp. 68, 108, 132).
The word Yana is as old as the Upanisads where we read of Devayana and Pitryana.
There is no reason why this word should be taken in a different sense. We hear in
Lankdvatdra of Sravakayana (career of the 6ravakas or the Theravadin Buddhists),
Pratyekabuddhayana (the career of saints before the coming of the Buddha), Buddha
yana (career of the Buddhas), Ekayana (one career), Devayana (career of the gods),
126 Buddhist Philosophy [CH.
us the reason why one school was called Hinayana whereas the
other, which he professed, was called Mahayana. He says that,
considered from the point of view of the ultimate goal of religion,
the instructions, attempts, realization, and time, the Hlnayana
occupies a lower and smaller place than the other called Maha
(great) Yana, and hence it is branded as Hlna (small, or low).
This brings us to one of the fundamental points of distinction
between Hlnayana and Mahayana. The ultimate good of an
adherent of the Hlnayana is to attain his own nirvana or salva
tion, whereas the ultimate goal of those who professed the Maha
yana creed was not to seek their own salvation but to seek the
salvation of all beings. So the Hlnayana goal was lower, and in
consequence of that the instructions that its followers received,
the attempts they undertook, and the results they achieved were
narrower than that of the Mahayana adherents. A Hlnayana man
had only a short business in attaining his own salvation, and this
could be done in three lives, whereas a Mahayana adherent was
prepared to work for infinite time in helping all beings to attain
salvation. So the Hlnayana adherents required only a short period
of work and may from that point of view also be called hma, or
lower.
This point, though important from the point of view of the
difference in the creed of the two schools, is not so from the point
of view of philosophy. But there is another trait of the Maha-
yanists which distinguishes them from the Hmayanists from the
philosophical point of view. The Mahayanists believed that all
things were of a non-essential and indefinable character and
void at bottom, whereas the Hmayanists only believed in the
impermanence of all things, but did not proceed further than
that.
It is sometimes erroneously thought that Nagarjuna first
preached the doctrine of 6unyavada (essencelessness or voidness
of all appearance), but in reality almost all the Mahayana sutras
either definitely preach this doctrine or allude to it. Thus if we
take some of those sutras which were in all probability earlier than
Nagarjuna, we find that the doctrine which Nagarjuna expounded
Brahmayana (career of becoming a Brahma), Tathagatayana (career of a Tathagata).
In one place Lankavatara says that ordinarily distinction is made between the three
careers and one career and no career, but these distinctions are only for the ignorant
(Lankavatara, p. 68).
v] Mahay ana Philosophy 127
with all the rigour of his powerful dialectic was quietly accepted
as an indisputable truth. Thus we find Subhuti saying to
the Buddha that vedana (feeling), samjfta (concepts) and the
samskaras (conformations) are all maya (illusion) 1 . All the
skandhas, dhatus (elements) and ayatanas are void and absolute
cessation. The highest knowledge of everything as pure void
is not different from the skandhas, dhatus and ayatanas, and this
absolute cessation of dharmas is regarded as the highest know
ledge (prajndpdramita)*. Everything being void there is in reality
no process and no cessation. The truth is neither eternal (sdsvata)
nor non-eternal (asdsvata) but pure void. It should be the object
of a saint s endeavour to put himself in the " thatncss" (tat/tatd) and
consider all things as void. The saint (bodhisatlvd) has to estab
lish himself in all the virtues (pdramita}, benevolence (dana-
pdramitd\ the virtue of character (silapdramitd\ the virtue of
forbearance (ksdntipdramitd), the virtue of tenacity and strength
(ylryyapdramitd) and the virtue of meditation (dhydnapdra-
mitd). The saint (bodhisattvd) is firmly determined that he will
help an infinite number of souls to attain nirvana. In reality,
however, there are no beings, there is no bondage, no salva
tion ; and the saint knows it but too well, yet he is not afraid
of this high truth, but proceeds on his career of attaining for
all illusory beings illusory emancipation from illusory bondage.
The saint is actuated with that feeling and proceeds in his
work on the strength of his paramitas, though in reality there
is no one who is to attain salvation in reality and no one who
is to help him to attain it*. The true prajnaparamita is the
absolute cessation of all appearance (yah anupalambhah sarva-
dharmdndm sa prajndpdramitd ityucyate) .
The Mahayana doctrine has developed on two lines, viz. that
of unyavada or the Madhyamika doctrine and Vijftanavada.
The difference between ^unyavada and Vijftanavada (the theory
that there is only the appearance of phenomena of consciousness)
is not fundamental, but is rather one of method. Both of them
agree in holding that there is no truth in anything, everything
is only passing appearance akin to dream or magic. But
while the unyavadins were more busy in showing this indefin-
ableness of all phenomena, the Vijftanavadins, tacitly accepting
1 Astasahasrikaprajnaparamita, p. 16. a Ibid. p. 177.
8 Ibid. p. 21. 4 Ibid. p. 177.
128 Buddhist Philosophy [CH.
the truth preached by the Sunyavadins, interested themselves in
explaining the phenomena of consciousness by their theory of
beginningless illusory root-ideas or instincts of the mind (vasana).
Asvaghosa (100 A.D.) seems to have been the greatest teacher
of a new type of idealism (vijhdnavddd) known as the Tathata
philosophy. Trusting in Suzuki s identification of a quotation in
Asvaghosa s Sraddhotpddasdstra as being made from Lankdva-
tdrasiitra, we should think of the Lankdvatdrasutra as being one
of the early works of the Vijnanavadins 1 . The greatest later writer
of the Vijfianavada school was Asariga (400 A.D.), to whom are
attributed the Saptadasabhumi sutra, Mahdydna sutra, Upadesa,
Mahay dnasamparigraha sdstra, Yogdcdrabhumi sdstra and
Mahay dnasutrdlamkdra. None of these works excepting the
last one is available to readers who have no access to the
Chinese and Tibetan manuscripts, as the Sanskrit originals are
in all probability lost. The Vijfianavada school is known to
Hindu writers by another name also, viz. Yogacara, and it does
not seem an improbable supposition that Asanga s Yogdcdra
bhumi Sdstra was responsible for the new name. Vasubandhu,
a younger brother of Asanga, was, as Paramartha (499-569) tells
us, at first a liberal Sarvastivadin, but was converted to Vijfia
navada, late in his life, by Asanga. Thus Vasubandhu, who
wrote in his early life the great standard work of the Sarvasti-
vadins, Abhidharmakosa, devoted himself in his later life to Vijfia
navada 2 . He is said to have commented upon a number of
Mahayana sutras, such zsAvatamsaka, Nirvana, Saddharmapun-
darlka, Prajndpdramitd, Vimalaklrtti and Srtmdldsimhandda, and
compiled some Mahayana sutras, such as Vijndnamdtrasiddhi,
Ratnatraya, etc. The school of Vijfianavada continued for at
least a century or two after Vasubandhu, but we are not in
possession of any work of great fame of this school after him.
We have already noticed that the Sunyavada formed the fun
damental principle of all schools of Mahayana. The most powerful
exponent of this doctrine was Nagarjuna (100 A.D.), a brief account
of whose system will be given in its proper place. Nagarjuna s
karikas (verses) were commented upon by Aryyadeva, a disciple
of his, Kumarajlva (383 A.D.), Buddhapalita and Candraklrtti
(55OA.D.). Aryyadeva in addition to this commentary wrote at
1 Dr S. C. Vidyabhushana thinks that Lankavatara belongs to about 300 A.D.
2 Takakusu s "A study of the Paramartha s life of Vasubandhu, " J. R.A. S. 1905.
vj Aryyadevas Philosophy 129
least three other books, viz. Catuhsataka, Hastabdlaprakarana-
vrtti and Cittavisuddhiprakarana^. In the small work called
Hastabdlaprakaranavrtti Aryyadeva says that whatever depends
for its existence on anything else may be proved to be illusory ;
all our notions of external objects depend on space perceptions
and notions of part and whole and should therefore be regarded
as mere appearance. Knowing therefore that all that is depen
dent on others for establishing itself is illusory, no wise man
should feel attachment or antipathy towards these mere phe
nomenal appearances. In his Cittavisuddhiprakaratia he says
that just as a crystal appears to be coloured, catching the reflec
tion of a coloured object, even so the mind though in itself
colourless appears to show diverse colours by coloration of ima
gination (vikalpa). In reality the mind (citta) without a touch
of imagination (kalpand) in it is the pure reality.
It does not seem however that the unyavadins could produce
any great writers after Candraklrtti. References to unyavada
show that it was a living philosophy amongst the Hindu writers
until the time of the great Mlmamsa authority Kumarila who
flourished in the eighth century; but in later times the Sunyavadins
were no longer occupying the position of strong and active dis
putants.
The Tathata Philosophy of ASvaghosa (SoA.D.) 2 .
Asvaghosa was the son of a Brahmin named Saimhaguhya
who spent his early days in travelling over the different parts of
India and defeating the Buddhists in open debates. He was pro
bably converted to Buddhism by Parva who was an important
person in the third Buddhist Council promoted, according to
some authorities, by the King of Kashmere and according to other
authorities by Punyayaas 8 .
1 Aryyadeva s Hastabalaprakaranavrtti has been reclaimed by Dr F. W. Thomas.
Fragmentary portions of his CittavUuddhiprakarana were published by Mahamahopad-
hyaya Haraprasada s astri in the Bengal Asiatic Society s journal, 1898.
2 The above section is based on) the Awakening of Faith, an English trans
lation by Suzuki of the Chinese version of Sraddhotpadaiastra by Asvaghosa, the
Sanskrit original of which appears to have been lost. Suzuki has brought forward a
mass of evidence to show that Asvaghosa was a contemporary of Kaniska.
* Taranatha says that he was converted by Aryadeva, a disciple of Nagarjuna,
Geschichte des Buddhismus, German translation by Schiefner, pp. 84-85. See Suzuki s
Awakening of Faith, pp. 24-32. Asvaghosa wrote the Buddkacaritakavya, of great
poetical excellence, and the Mahtilatnkilrahlstra. He was also a musician and had
130 Buddhist Philosophy [CH.
He held that in the soul two aspects may be distinguished
the aspect as thatness (bhutatathata) and the aspect as the cycle
of birth and death (samsdra). The soul as bhutatathata means
the oneness of the totality of all things (dharmadhdtu). Its essen
tial nature is uncreate and external. All things simply on account
of the beginningless traces of the incipient and unconscious
memory of our past experiences of many previous lives (smrti)
appear under the forms of individuation 1 . If we could overcome
this smrti "the signs of individuation would disappear and there
would be no trace of a world of objects." "All things in their
fundamental nature are not nameable or explicable. They can
not be adequately expressed in any form of language. They
possess absolute sameness (samatd}. They are subject neither to
transformation nor to destruction. They are nothing but one soul "
thatness (bhutatathata). This "thatness" has no attribute and
it can only be somehow pointed out in speech as "thatness."
As soon as you understand that when the totality of existence is
spoken of or thought of, there is neither that which speaks nor
that which is spoken of, there is neither that which thinks nor
that which is thought of, "this is the stage of thatness." This
bhutatathata is neither that which is existence, nor that which is
non-existence, nor that which is at once existence and non-
existence, nor that which is not at once existence and non-exist
ence; it is neither that which is plurality, nor that which is
at once unity and plurality, nor that which is not at once unity
and plurality. It is a negative concept in the sense that it is
beyond all that is conditional and yet it is a positive concept
in the sense that it holds all within it. It cannot be compre
hended by any kind of particularization or distinction. It is
only by transcending the range of our intellectual categories of
the comprehension of the limited range of finite phenomena that
we can get a glimpse of it. It cannot be comprehended by the
particularizing consciousness of all beings, and we thus may call
it negation, "sunyata," in this sense. The truth is that which
invented a musical instrument called Rastavara that he might by that means convert the
people of the city. " Its melody was classical, mournful, and melodious, inducing the
audience to ponder on the misery, emptiness, and non-atmanness of life." Suzuki, p. 35.
1 I have ventured to translate "smrti" in the sense of vasana in preference to
Suzuki s "confused subjectivity" because smrti in the sense of vasana is not unlamiliar
to the readers of such Buddhist works as Lankavatara* The word "subjectivity"
seems to be too European a term to be used as a word to represent the Buddhist sense.
v] Asvagkosds Absolutism 131
subjectively does not exist by itself, that the negation (sunyata) is
also void (sunya) in its nature, that neither that which is negated
nor that which negates is an independent entity. It is the pure
soul that manifests itself as eternal, permanent, immutable, and
completely holds all things within it. On that account it may be
called affirmation. But yet there is no trace of affirmation in it,
because it is not the product of the creative instinctive memory
(smrti) of conceptual thought and the only way of grasping the
truth the thatness, is by transcending all conceptual creations.
"The soul as birth and death (samsdra) comes forth from
the Tathagata womb (tathdgatagarbha\ the ultimate reality.
But the immortal and the mortal coincide with each other.
Though they are not identical they are not duality either. Thus
when the absolute soul assumes a relative aspect by its self-
affirmation it is called the all-conserving mind (dlayavijndnd).
It embraces two principles, (i) enlightenment, (2) non -enlighten
ment. Enlightenment is the perfection of the mind when it is
free from thje corruptions of the creative instinctive incipient
memory (smrti). It penetrates all and is the unity of all (dharma-
dhdtu). That is to say, it is the universal dharmakaya of all
Tathagatas constituting the ultimate foundation of existence.
"When it is said that all consciousness starts from this funda
mental truth, it should not be thought that consciousness had any
real origin, for it was merely phenomenal existence a mere ima
ginary creation of the perceivers under the influence of the
delusive smrti. The multitude of people (bahujand) are said to be
lacking in enlightenment, because ignorance (avidya) prevails,
there from all eternity, because there is a constant succession of
smrti (past confused memory working as instinct) from which
they have never been emancipated. But when they are divested
of this smrti they can then recognize that no states of mentation,
viz. their appearance, presence, change and disappearance, have
any reality. They are neither in a temporal nor in a spatial relation
with the one soul, for they are not self-existent.
"This high enlightenment shows itself imperfectly in our cor
rupted phenomenal experience as prajfta (wisdom) and karma
(incomprehensible activity of life). By pure wisdom we under
stand that when one, by virtue of the perfuming power of dharma,
disciplines himself truthfully (i.e. according to the dharma) and
accomplishes meritorious deeds, the mind (i.e. the dlayavijndnd)
92
132 Buddhist Philosophy [CH.
which implicates itself with birth and death will be broken down
and the modes of the evolving consciousness will be annulled, and
the pure and the genuine wisdom of the Dharmakaya will manifest
itself. Though all modes of consciousness and mentation are
mere products of ignorance, ignorance in its ultimate nature is
identical and non-identical with enlightenment; and therefore
ignorance is in one sense destructible, though in another sense
it is indestructible. This may be illustrated by the simile of the
water and the waves which are stirred up in the ocean. Here
the water can be said to be both identical and non-identical
with the waves. The waves are stirred up by the wind, but the
water remains the same. When the wind ceases the motion of
the waves subsides, but the water remains the same. Likewise
when the mind of all creatures, which in its own nature is pure and
clean, is stirred up by the wind of ignorance (avidya), the waves
of mentality (vijndna) make their appearance. These three (i.e.
the mind, ignorance, and mentality) however have no existence,
and they are neither unity nor plurality. When the ignorance is
annihilated, the awakened mentality is tranquillized, whilst the
essence of the wisdom remains unmolested." The truth or the
enlightenment "is absolutely unobtainable by any modes of rela
tivity or by any outward signs of enlightenment. All events in
the phenomenal world are reflected in enlightenment, so that they
neither pass out of it, nor enter into it, and they neither disappear
nor are destroyed." It is for ever cut off from the hindrances both
affectional (klesdvarand) and intellectual (jneydvarana), as well
as from the mind (i.e. dlayavijnana) which implicates itself with
birth and death, since it is in its true nature clean, pure, eternal,
calm, and immutable. The truth again is such that it transforms
and unfolds itself wherever conditions are favourable in the form
of a tathagata or in some other forms, in order that all beings
may be induced thereby to bring their virtue to maturity.
"Non-elightenment has no existence of its own aside from its
relation with enlightenment a priori? But enlightenment a priori
is spoken of only in contrast to non-enlightenment, and as non-
enlightenment is a non-entity, true enlightenment in turn loses
its significance too. They are distinguished only in mutual rela
tion as enlightenment or non-enlightenment. The manifestations
of non-enlightenment are made in three ways: (i) as a disturb
ance of the mind (dlayavijnana), by the avidyakarma (ignorant
v] Theory of world-construction 133
action), producing misery (duhkhd); (2) by the appearance of an
ego or of a perceiver ; and (3) by the creation of an external world
which does not exist in itself, independent of the perceiver. Con
ditioned by the unreal external world six kinds of phenomena
arise in succession. The first phenomenon is intelligence (sensa
tion); being affected by the external world the mind becomes
conscious of the difference between the agreeable and the disagree
able. The second phenomenon is succession. Following upon
intelligence, memory retains the sensations, agreeable as well
as disagreeable, in a continuous succession of subjective states.
The third phenomenon is clinging. Through the retention and
succession of sensations, agreeable as well as disagreeable, there
arises the desire of clinging. The fourth phenomenon is an attach
ment to names or ideas (samjnd\ etc. By clinging the mind
hypostatizes all names whereby to give definitions to all things.
The fifth phenomenon is the performance of deeds (karma). On
account of attachment to names, etc., there arise all the variations
of deeds, productive of individuality. "The sixth phenomenon
is the suffering due to the fetter of deeds. Through deeds suffering
arises in which the mind finds itself entangled and curtailed of
its freedom." All these phenomena have thus sprung forth through
avidya.
The relation between this truth and avidya is in one sense
a mere identity and may be illustrated by the simile of all kinds
of pottery which though different are all made of the same clay 1 .
Likewise the undefiled (andsrava} and ignorance (avidya} and
their various transient forms all come from one and the same
entity. Therefore Buddha teaches that all beings are from all
eternity abiding in Nirvana.
It is by the touch of ignorance (avidya} that this truth assumes
all the phenomenal forms of existence.
In the all-conserving mind (alayavijndnd) ignorance manifests
itself; and from non-enlightenment starts that which sees, that
which represents, that which apprehends an objective world, and
that which constantly particularizes. This is called ego (manas).
Five different names are given to the ego (according to its dif
ferent modes of operation). The first name is activity-conscious
ness (karmavijndnd) in the sense that through the agency of
ignorance an unenlightened mind begins to be disturbed (or
1 Compare Chandogya, vi. i. 4.
1 34 Buddhist Philosophy [CH.
awakened). The second name is evolving-consciousness (pravrtti-
vijndnd) in the sense that when the mind is disturbed, there
evolves that which sees an external world. The third name is
representation-consciousness in the sense that the ego (manas)
represents (or reflects) an external world. As a clean mirror
reflects the images of all description, it is even so with the repre
sentation-consciousness. When it is confronted, for instance, with
the objects of the five senses, it represents them instantaneously
and without effort. The fourth is particularization-consciousness,
in the sense that it discriminates between different things defiled
as well as pure. The fifth name is succession-consciousness, in the
sense that continuously directed by the awakening consciousness
of attention (manaskdrd) it (manas) retains all experiences and
never loses or suffers the destruction of any karma, good as well
as evil, which had been sown in the past, and whose retribution,
painful or agreeable, it never fails to mature, be it in the present
or in the future, and also in the sense that it unconsciously
recollects things gone by and in imagination anticipates things
to come. Therefore the three domains (kdmaloka, domain of
feeling rupaloka, domain of bodily existence arupaloka, domain
of incorporeality) are nothing but the self manifestation of the
mind (i.e. dlayavijndna which is practically identical with bhuta-
tathata). Since all things, owing the principle of their existence
to the mind (dlayavijndna), are produced by smrti, all the modes
of particularization are the self-particularizations of the mind. The
mind in itself (or the soul) being however free from all attributes
is not differentiated. Therefore we come to the conclusion that
all things and conditions in the phenomenal world, hypostatized
and established only through ignorance (avidya) and memory
(smrti), have no more reality than the images in a mirror. They
arise simply from the ideality of a particularizing mind. When
the mind is disturbed, the multiplicity of things is produced; but
when the mind is quieted, the multiplicity of things disappears.
By ego-consciousness (manovijndnd) we mean the ignorant mind
which by its succession-consciousness clings to the conception of
I and Not-I and misapprehends the nature of the six objects of
sense. The ego-consciousness is also called separation-conscious
ness, because it is nourished by the perfuming influence of the
prejudices (dsrava\ intellectual as well as affectional. Thus believ
ing in the external world produced by memory, the mind becomes
v] Theory of Good and Evil 135
oblivious of the principle of sameness (samata) that underlies all
things which are one and perfectly calm and tranquil and show no
sign of becoming.
Non-enlightenment is the raison d etre of samsara. When
this is annihilated the conditions the external world are also
annihilated and with them the state of an interrelated mind is also
annihilated. But this annihilation does not mean the annihilation
of the mind but of its modes only. It becomes calm like an un
ruffled sea when all winds which were disturbing it and producing
the waves have been annihilated.
In describing the relation of the interaction of avidya (ignor
ance), karmavijftana (activity-consciousness the subjective mind),
visaya (external world represented by the senses) and the tathata
(suchness), Asvaghosa says that there is an interperfuming of
these elements. Thus AsVaghosa says, "By perfuming we mean
that while our worldly clothes (viz. those which we wear) have no
odour of their own, neither offensive nor agreeable, they can yet
acquire one or the other odour according to the nature of the sub
stance with which they are perfumed. Suchness (tathata) is likewise
a pure dharma free from all defilements caused by the perfuming
power of ignorance. On the other hand ignorance has nothing to
do with purity. Nevertheless we speak of its being able to do the
work of purity because it in its turn is perfumed by suchness.
Determined by suchness ignorance becomes the raison d etre of
all forms of defilement. And this ignorance perfumes suchness
and produces smrti. This smrti in its turn perfumes ignorance.
On account of this (reciprocal) perfuming, the truth is misunder
stood. On account of its being misunderstood an external world
of subjectivity appears. Further, on account of the perfuming
power of memory, various modes of individuation are produced.
And by clinging to them various deeds are done, and we suffer
as the result miseries mentally as well as bodily." Again "such-
ness perfumes ignorance, and in consequence of this perfuming
the individual in subjectivity is caused to loathe the misery of
birth and death and to seek after the blessing of Nirvana. This
longing and loathing on the part of the subjective mind in turn
perfumes suchness. On account of this perfuming influence we
are enabled to believe that we are in possession within ourselves
of suchness whose essential nature is pure and immaculate; and
we also recognize that all phenomena in the world are nothing
1 36 Buddhist Philosophy [CH.
but the illusory manifestations of the mind (alayavijndna) and
have no reality of their own. Since we thus rightly understand
the truth, we can practise the means of liberation, can perform
those actions which are in accordance with the dharma. We
should neither particularize, nor cling to objects of desire. By
virtue of this discipline and habituation during the lapse of innu
merable asarikhyeyakalpas 1 we get ignorance annihilated. As
ignorance is thus annihilated, the mind (dlayavijndna) is no longer
disturbed, so as to be subject to individuation. As the mind is no
longer disturbed, the particularization of the surrounding world
is annihilated. When in this wise the principle and the condition
of defilement, their products, and the mental disturbances are all
annihilated, it is said that we attain Nirvana and that various
spontaneous displays of activity are accomplished." The Nirvana
of the tathata philosophy is not nothingness, but tathata (suchness
or thatness) in its purity unassociated with any kind of disturbance
which produces all the diversity of experience.
To the question that if all beings are uniformly in possession
of suchness and are therefore equally perfumed by it, how is it
that there are some who do not believe in it, while others do,
AsVaghosa s reply is that though all beings are uniformly in
possession of suchness, the intensity of ignorance and the prin
ciple of individuation, that work from all eternity, vary in such
manifold grades as to outnumber the sands of the Ganges, and
hence the difference. There is an inherent perfuming principle
in one s own being which, embraced and protected by the love
(maitrt) and compassion (karuna) of all Buddhas and Bodhisatt-
vas, is caused to loathe the misery of birth and death, to believe
in nirvana, to cultivate the root of merit (kusalamula), to habit
uate oneself to it and to bring it to maturity. In consequence
of this, one is enabled to see all Buddhas and Bodhisattvas and, re
ceiving instructions from them, is benefited, gladdened and induced
to practise good deeds, etc., till one can attain to Buddhahood and
enter into Nirvana. This implies that all beings have such perfum
ing power in them that they may be affected by the good wishes
of the Buddhas and Bodhisattvas for leading them to the path
of virtue, and thus it is that sometimes hearing the Bodhisattvas
and sometimes seeing them, "all beings thereby acquire (spiritual)
benefits (hitatd}" and "entering into the samadhi of purity, they
1 Technical name for a very vast period of time.
v] Theory of Good and Evil 137
destroy hindrances wherever they are met with and obtain all-
penetrating insight that enables them to become conscious of
the absolute oneness (samata) of the universe (sarvalokd) and to
see innumerable Buddhas and Bodhisattvas."
There is a difference between the perfuming which is not in
unison with suchness, as in the case of sravakas (theravadin
monks), pratyekabuddhas and the novice bodhisattvas, who only
continue their religious discipline but do not attain to the state
of non-particularization in unison with the essence of suchness.
But those bodhisattvas whose perfuming is already in unison with
suchness attain to the state of non-particularization and allow
themselves to be influenced only by the power of the dharma.
The incessant perfuming of the defiled dharma (ignorance from
all eternity) works on, but when one attains to Buddhahood one
at once puts an end to it. The perfuming of the pure dharma
(i.e. suchness) however works on to eternity without any interrup
tion. For this suchness or thatness is the effulgence of great
wisdom, the universal illumination of the dharmadhatu (universe),
the true and adequate knowledge, the mind pure and clean in its
own nature, the eternal, the blessed, the self-regulating and the
pure, the tranquil, the inimitable and the free, and this is called
the tathagatagarbha or the dharmakaya. It may be objected that
since thatness or suchness has been described as being without
characteristics, it is now a contradiction to speak of it as embracing
all merits, but it is held, that in spite of its embracing all merits,
it is free in its nature from all forms of distinction, because all
objects in the world are of one and the same taste; and being
of one reality they have nothing to do with the modes of par-
ticularization or of dualistic character. "Though all things in their
(metaphysical) origin come from the soul alone and in truth are
free from particularization, yet on account of non-enlightenment
there originates a subjective mind (alayavijndnd) that becomes
conscious of an external world." This is called ignorance or
avidya. Nevertheless the pure essence of the mind is perfectly
pure and there is no awakening of ignorance in it. Hence we assign
to suchness this quality, the effulgence of great wisdom. It is
called universal illumination, because there is nothing for it to
illumine. This perfuming of suchness therefore continues for ever,
though the stage of the perfuming of avidya comes to an end with
the Buddhas when they attain to nirvana. All Buddhas while at
138 Buddhist Philosophy [CH.
the stage of discipline feel a deep compassion (mahdkaruna) for all
beings, practise all virtues (pdramitds) and many other meritorious
deeds, treat others as their own selves, and wish to work out a
universal salvation of mankind in ages to come, through limitless
numbers of kalpas, recognize truthfully and adequately the
principle of equality (samatd) among people; and do not cling
to the individual existence of a sentient being. This is what is
meant by the activity of tathata. The main idea of this tathata
philosophy seems to be this, that this transcendent "thatness" is
at once the quintessence of all thought and activity; as avidya veils
it or perfumes it, the world-appearance springs forth, but as the
pure thatness also perfumes the avidya there is a striving for the
good as well. As the stage of avidya is passed its luminous
character shines forth, for it is the ultimate truth which only
illusorily appeared as the many of the world.
This doctrine seems to be more in agreement with the view
of an absolute unchangeable reality as the ultimate truth than
that of the nihilistic idealism of Lankdvatdra. Considering the
fact that Asvaghosa was a learned Brahmin scholar in his early
life, it is easy to guess that there was much Upanisad influence in
this interpretation of Buddhism, which compares so favourably
with the Vedanta as interpreted by Sarikara. The Lankdvatdra
admitted a reality only as a make-believe to attract the Tairthikas
(heretics) who had a prejudice in favour of an unchangeable self
(dtman). But Asvaghosa plainly admitted an unspeakable reality
as the ultimate truth. Nagarjuna s Madhyamika doctrines which
eclipsed the profound philosophy of AsVaghosa seem to be more
faithful to the traditional Buddhist creed and to the Vijftanavada
creed of Buddhism as explained in the Lankdvatdra 1 .
The Madhyamika or the Sunyavada school. Nihilism.
Candrakirtti, the commentator of Nagarjuna s verses known as
"Madhyamika kdrikd" in explaining the doctrine of dependent
origination (pratltyasamutpdda) as described by Nagarjuna starts
with two interpretations of the word. According to one the word
pratltyasamutpada means the origination (utpdda) of the non
existent (abhdvd) depending on (pratttya) reasons and causes
1 As I have no access to the Chinese translation of A^vaghosa s Sraddhotpdda
Sastra, I had to depend entirely on Suzuki s expressions as they appear in his trans
lation.
v] Pratltyasamutpada 1 39
(hetupratyaya). According to the other interpretation pratltya
means each and every destructible individual and pratltyasamut
pada means the origination of each and every destructible in
dividual. But he disapproves of both these meanings. The
second meaning does not suit the context in which the Pali
Scriptures generally speak of pratltyasamutpada (e.g. caksuh
pratltya rupdni ca utpadyante caksurvijndnam) for it does not
mean the origination of each and every destructible individual,
but the originating of specific individual phenomena (e.g. per
ception of form by the operation in connection with the eye)
depending upon certain specific conditions.
The first meaning also is equally unsuitable. Thus for example
if we take the case of any origination, e.g. that of the visual per
cept, we see that there cannot be any contact between visual
knowledge and physical sense, the eye, and so it would not be
intelligible that the former should depend upon the latter. If we
interpret the maxim of pratltyasamutpada as this happening that
happens, that would not explain any specific origination. All
origination is false, for a thing can neither originate by itself nor
by others, nor by a co-operation of both nor without any reason.
For if a thing exists already it cannot originate again by itself.
To suppose that it is originated by others would also mean
that the origination was of a thing already existing. If again
without any further qualification it is said that depending on
one the other comes into being, then depending on anything any
other thing could come into being from light we could have dark
ness! Since a thing could not originate from itself or by others,
it could not also be originated by a combination of both of them
together. A thing also could not originate without any cause,
for then all things could come into being at all times. It is there
fore to be acknowledged that wherever the Buddha spoke of this
so-called dependent origination {pratltyasamutpada} it was re
ferred to as illusory manifestations appearing to intellects and
senses stricken with ignorance. This dependent origination is
not thus a real law, but only an appearance due to ignorance
(avidyd}. The only thing which is not lost (amosadharma) is
nirvana; but all other forms of knowledge and phenomena
(samskdras) are false and are lost with their appearances (sarva-
samskdrdsca mrsdmosadhanndnaK).
It is sometimes objected to this doctrine that if all appear-
140 Buddhist Philosophy [CH.
ances are false, then they do not exist at all. There are then no
good or bad works and no cycle of existence, and if such is the
case, then it may be argued that no philosophical discussion
should be attempted. But the reply to such an objection is that the
nihilistic doctrine is engaged in destroying the misplaced con
fidence of the people that things are true. Those who are really
wise do not find anything either false or true, for to them clearly
they do not exist at all and they do not trouble themselves with
the question of their truth or falsehood. For him who knows thus
there are neither works nor cycles of births (samsdra) and also he
does not trouble himself about the existence or non-existence of
any of the appearances. Thus it is said in the Ratnakutasutra that
howsoever carefully one may search one cannot discover conscious
ness (citta)\ what cannot be perceived cannot be said to exist,
and what does not exist is neither past, nor future, nor present, and
as such it cannot be said to have any nature at all ; and that which
has no nature is subject neither to origination nor to extinction.
He who through his false knowledge (viparyydsa) does not com
prehend the falsehood of all appearances, but thinks them to be
real, works and suffers the cycles of rebirth (samsdra}. Like all
illusions, though false these appearances can produce all the harm
of rebirth and sorrow.
It may again be objected that if there is nothing true
according to the nihilists (sunyavddins), then their statement that
there is no origination or extinction is also not true. Candraklrtti
in replying to this says that with sunyavadins the truth is absolute
silence. When the Sunyavadin sages argue, they only accept for
the moment what other people regard as reasons, and deal with
them in their own manner to help them to come to a right
comprehension of all appearances. It is of no use to say, in spite
of all arguments tending to show the falsehood of all appearances,
that they are testified by our experience, for the whole thing that
we call "our experience" is but false illusion inasmuch as these
phenomena have no true essence.
When the doctrine of pratltyasamutpada is described as "this
being that is," what is really meant is that things can only be
indicated as mere appearances one after another, for they have
no essence or true nature. Nihilism (sunyavdda) also means just
this. The true meaning of pratltyasamutpada or sunyavada is
this, that there is no truth, no essence in all phenomena that
v] Essencelessness \ 4 1
appear 1 . As the phenomena have no essence they are neither
produced nor destroyed ; they really neither come nor go. They
are merely the appearance of maya or illusion. The void (sunya)
does not mean pure negation, for that is relative to some kind of
position. It simply means that none of the appearances have any
intrinsic nature of their own (nihsvabhdvatvam).
The Madhyamaka or unya system does not hold that any
thing has any essence or nature (svabhdvd) of its own; even
heat cannot be said to be the essence of fire; for both the heat
and the fire are the result of the combination of many conditions,
and what depends on many conditions cannot be said to be the
nature or essence of the thing. That alone may be said to be the
true essence or nature of anything which does not depend on
anything else, and sipce no such essence or nature can be pointed
out which stands independently by itself we cannot say that it
exists. If a thing has no essence or existence of its own, we can
not affirm the essence of other things to it (parabhdvd). If we
cannot affirm anything of anything as positive, we cannot conse
quently assert anything of anything as negative. If anyone first
believes in things positive and afterwards discovers that they are
not so, he no doubt thus takes his stand on a negation (abhdva),
but in reality since we cannot speak of anything positive, we can
not speak of anything negative either*.
It is again objected that we nevertheless perceive a process
going on. To this the Madhyamaka reply is that a process of
change could not be affirmed of things that are permanent. But we
can hardly speak of a process with reference to momentary things;
for those which are momentary are destroyed the next moment
after they appear, and so there is nothing which can continue to
justify a process. That which appears as being neither comes
from anywhere nor goes anywhere, and that which appears as de
stroyed also does not come from anywhere nor go anywhere,
and so a process (samsdra) cannot be affirmed of them. It cannot
be that when the second moment arose, the first moment had
suffered a change in the process, for it was not the same as the
second, as there is no so-called cause-effect connection. In fact
there being no relation between the two, the temporal determina
tion as prior and later is wrong. The supposition that there is a
self which suffers changes is also not valid, for howsoever we
1 See Madhyamikavrtti (B.T.S.), p. 50. 2 Ibid. pp. 93-100.
142 Buddhist Philosophy [CH.
may search we find the five skandhas but no self. Moreover if
the soul is a unity it cannot undergo any process or progression,
for that would presuppose that the soul abandons one character
and takes up another at the same identical moment which is
inconceivable 1 .
But then again the question arises that if there is no process,
and no cycle of worldly existence of thousands of afflictions, what
is then the nirvana which is described as the final extinction of
all afflictions (klesa)t To this the Madhyamaka reply is that it does
not agree to such a definition of nirvana. Nirvana on the Madhya
maka theory is the absence of the essence of all phenomena, that
which cannot be conceived either as anything which has ceased
or as anything which is produced (aniruddham anutpannam). In
nirvana all phenomena are lost; we say that the phenomena cease
to exist in nirvana, but like the illusory snake in the rope they
never existed*. Nirvana cannot be any positive thing or any sort
of state of being (bhdva), for all positive states or things are joint
products of combined causes (samskrta) and are liable to decay
and destruction. Neither can it be a negative existence, for since
we cannot speak of any positive existence, we cannot speak of a
negative existence either. The appearances or the phenomena are
communicated as being in a state of change and process coming
one after another, but beyond that no essence, existence, or truth
can be affirmed of them. Phenomena sometimes appear to be
produced and sometimes to be destroyed, but they cannot be
determined as existent or non-existent. Nirvana is merely the
cessation of the seeming phenomenal flow (prapancapravrttf). It
cannot therefore be designated either as positive or as negative for
these conceptions belong to phenomena (na cdpravrttimdtram
bhdvdbhdveti parikalpitum pdryyate evam na bhdvabhdvanir-
vanam, M.V. 197). In this state there is nothing which is known,
and even the knowledge that the phenomena have ceased to
appear is not found. Even the Buddha himself is a phenomenon,
a mirage or a dream, and so are all his teachings .
It is easy to see that in this system there cannot exist any
bondage or emancipation ; all phenomena are like shadows, like
the mirage, the dream, the maya, and the magic without any real
nature (nihsvabhdvd). It is mere false knowledge to suppose that
1 See Madhyamikavrtti (B.T.S.), pp. 101-101. 3 Ibid. p. 194.
3 Ibid. pp. 162 and 201.
v] Causal conditions 143
one is trying to win a real nirvana 1 . It is this false egoism that
is to be considered as avidya. When considered deeply it is found
that there is not even the slightest trace of any positive existence.
Thus it is seen that if there were no ignorance- (avidya), there
would have been no conformations (samskaras}, and if there were
no conformations there would have been no consciousness, and so
on ; but it cannot be said of the ignorance " I am generating the
samskaras," and it can be said of the samskaras "we are being
produced by the avidya." But there being avidya, there come the
samskaras and so on with other categories too. This character of
the pratltyasamutpada is known as the coming of the consequent
depending on an antecedent reason (hetupanibandha).
It can be viewed from another aspect, namely that of depend
ence on conglomeration or combination (pratyayopanibandhd).
It is by the combination (samavdyd) of the four elements, space
(dkdsa) and consciousness (yijndnd) that a man is made. It is
due to earth (prthivi) that the body becomes solid, it is due to
water that there is fat in the body, it is due to fire that there is
digestion, it is due to wind that there is respiration; it is due
to akaa that there is porosity, and it is due to vijfiana that
there is mind-consciousness. It is by their mutual combination
that we find a man as he is. But none of these elements think
that they have done any of the functions that are considered to be
allotted to them. None of these are real substances or beings or
souls. It is by ignorance that these are thought of as existents and
attachment is generated for them. Through ignorance thus come
the samskaras, consisting of attachment, antipathy and thought
lessness (rdga, dvesa, moha) ; from these proceed the vijfiana and
the four skandhas. These with the four elements bring about name
and form (ndmarupd), from these proceed the senses (sadayatana),
from the coming together of those three comes contact (sparsd) ;
from that feelings, from that comes desire (trsnd) and so on.
These flow on like the stream of a river, but there is no essence
or truth behind them all or as the ground of them all 8 . The
phenomena therefore cannot be said to be either existent or
non-existent, and no truth can be affirmed of either eternalism
(sasvatavdda) or nihilism (ucchedavddd), and it is for this reason
1 See Madhyamikavrtti (B.T.S.), pp. 101-108.
* Ibid. pp. 209-211, quoted from Salistambhasutra. Vacaspatimis ra also quotes
this passage in his Bhamati on Sankara s Brahmaputra.
144 Buddhist Philosophy [CH.
that this doctrine is called the middle doctrine (madhyamakci) 1 .
Existence and non-existence have only a relative truth (sam-
vrtisatya) in them, as in all phenomena, but there is no true
reality (paramdrthasatya) in them or anything else. Morality
plays as high a part in this nihilistic system as it does in any
other Indian system. I quote below some stanzas from Nagar-
juna s Suhrllekha as translated by Wenzel (P.T.S. 1886) from
the Tibetan translation.
6. Knowing that riches are unstable and void (asard) give according to
the moral precepts, to Bhikshus, Brahmins, the poor and friends for there is
no better friend than giving.
7. Exhibit morality (Silo) faultless and sublime, unmixed and spotless,
for morality is the supporting ground of all eminence, as the earth is of the
moving and immovable.
8. Exercise the imponderable, transcendental virtues of charity, morality,
patience, energy, meditation, and likewise wisdom, in order that, having
reached the farther shore of the sea of existence, you may become a Jina
prince.
9. View as enemies, avarice (matsaryya], deceit (Jsathya), duplicity (mdya\
lust, indolence (kausidya), pride (mana), greed (raga), hatred \dvesa) and
pride (mada) concerning family, figure, glory, youth, or power.
15. Since nothing is so difficult of attainment as patience, open no door
for anger ; the Buddha has pronounced that he who renounces anger shall
attain the degree of an anagamin (a saint who never suffers rebirth).
21. Do not look after another s wife; but if you see her, regard her,
according to age, like your mother, daughter or sinter.
24. Of him who has conquered the unstable, ever moving objects of the
six senses and him who has overcome the mass of his enemies in battle, the
wise praise the first as the greater hero.
29. Thou who knowest the world, be equanimous against the eight worldly
conditions, gain and loss, happiness and suffering, fame and dishonour, blame
and praise, for they are not objects for your thoughts.
37. But one (a woman) that is gentle as a sister, winning as a friend,
careful of your well being as a mother, obedient as a servant her (you must)
honour as the guardian god(dess) of the family.
40. Always perfectly meditate on (turn your thoughts to) kindness, pity,
joy and indifference ; then if you do not obtain a higher degree you (certainly)
will obtain the happiness of Brahman s world (brahmavihara).
41. By the four dhyanas completely abandoning desire (kama\ reflection
(vicara), joy (flrttt), and happiness and pain (sukha, duhkhd) you will obtain
as fruit the lot of a Brahman.
49. If you say "I am not the form, you thereby will understand I am
not endowed with form, I do not dwell in form, the form does not dwell in me ;
and in like manner you will understand the voidness of the other four aggre
gates."
50. The aggregates do not arise from desire, nor from time, nor from
1 See Madhyamikavrtti (B.T.S.), p. 160.
v] Vijnanavada 145
nature (J>rakrti), not from themselves (svabkdvat), nor from the Lord (isvara),
nor yet are they without cause ; know that they arise from ignorance (avidyd)
and desire (trsnti).
51. Know that attachment to religious ceremonies (Silabrataparamarsd),
wrong views (mithyadrstf) and doubt (vicikitsa) are the three fetters.
53. Steadily instruct yourself (more and more) in the highest morality,
the highest wisdom and the highest thought, for the hundred and fifty one
rules (of the Pra timoksci) are combined perfectly in these three.
58. Because thus (as demonstrated) all this is unstable (anitya) without
substance (andtma) without help (asarana) without protector (an&tha) and
without abode (asthana) thou O Lord of men must become discontented with
this worthless (asara) kadali-tree of the orb.
104. If a fire were to seize your head or your dress you would extinguish
and subdue it, even then endeavour to annihilate desire, for there is no other
higher necessity than this.
105. By morality, knowledge and contemplation, attain the spotless dig
nity of the quieting and the subduing nirvana not subject to age, death or
decay, devoid of earth, water, fire, wind, sun and moon.
107. Where there is no wisdom (prajna) there is also no contemplation
(dhyana\ where there is no contemplation there is also no wisdom ; but know
that for him who possesses these two the sea of existence is like a grove.
Uncompromising Idealism or the School
of Vijnanavada Buddhism.
The school of Buddhist philosophy known as the Vijftanavada
or Yogacara has often been referred to by such prominent teachers
of Hindu thought as Kumarila and Sarikara. It agrees to a great
extent with the ^unyavadins whom we have already described.
All the dharmas (qualities and substances) are but imaginary
constructions of ignorant minds. There is no movement in the
so-called external world as we suppose, for it does not exist. We
construct it ourselves and then are ourselves deluded that it exists
\yy\\.s&\f(nirmmitapratimohiy. There are two functions involved
in our consciousness, viz. that which holds the perceptions (khydti
vijndna), and that which orders them by imaginary constructions
(vastuprativikalpavijndnd). The two functions however mutually
determine each other and cannot be separately distinguished
(abhinnalaksane anyonyahetuke). These functions are set to work
on account of the beginningless instinctive tendencies inherent
in them in relation to the world of appearance (anddikdla-pra-
panca-vdsandhetukancd) 2 .
All sense knowledge can be stopped only when the diverse
1 Lankavatdrasutra, pp. 21-22. 3 Ibid. p. 44.
D. 10
1 46 Buddhist Philosophy [CH.
unmanifested instincts of imagination are stopped (abkuta-
parikalpa-vasand-vaicitra-nirodhdy. All our phenomenal know
ledge is without any essence or truth (nihsvabkdva) and is but a
creation of maya, a mirage or a dream. There is-nothing which
may be called external, but all is the imaginary creation of the
mind (svacittd), which has been accustomed to create imaginary
appearances from beginningless time. This mind by whose move
ment these creations take place as subject and object has no
appearance in itself and is thus without any origination, existence
and extinction (utpddasthitibhahgavarjjam) and is called the alaya-
vijflana. The reason why this alayavijftana itself is said to be
without origination, existence, and extinction is probably this,
that it is always a hypothetical state which merely explains all
the phenomenal states that appear, and therefore it has no exist
ence in the sense in which the term is used and we could not
affirm any special essence of it.
We do not realize that all visible phenomena are of nothing
external but of our own mind (svacitta), and there is also the begin
ningless tendency for believing and creating a phenomenal world
of appearance. There is also the nature of knowledge (which
takes things as the perceiver and the perceived) and there is also
the instinct in the mind to experience diverse forms. On account
of these four reasons there are produced in the alayavijftana (mind)
the ripples of our sense experiences (pravrttivijndna) as in a lake,
and these are manifested as sense experiences. All the five skan-
dhas called pancavijhdnakdya thus appear in a proper synthetic
form. None of the phenomenal knowledge that appears is either
identical or different from the alayavijftana just as the waves can
not be said to be either identical or different from the ocean. As
the ocean dances on in waves so the citta or the alayavijftana
is also dancing as it were in its diverse operations (vrtti). As
citta it collects all movements (karma) within it, as manas it
synthesizes (vidhiyate) and as vijftana it constructs the fivefold
perceptions (yijUanen vijdndti drsyam kalpate pancabhih)" 1 .
It is only due to maya (illusion) that the phenomena appear
in their twofold aspect as subject and object. This must always
be regarded as an appearance (sarnvrtisatyatd) whereas in the real
aspect we could never say whether they existed (bhdva) or did not
exist 8 .
1 Lankavatdrasiitra, p. 44. 8 Ibid. pp. 50-55.
8 Asanga s MahayHnasutralamk&ra, pp. 58-59.
v] Vijnanavada and Vedanta 147
All phenomena both being and non-being are illusory (sada-
santah mdyopamdk). When we look deeply into them we find that
there is an absolute negation of all appearances, including even
all negations, for they are also appearances. This would make the
ultimate truth positive. But this is not so, for it is that in which
the positive and negative are one and the same (bhdvdbhdvasa-
mdnatd} 1 . Such a state which is complete in itself and has no
name and no substance had been described in the Larikavatara-
sutra as thatness (tathata)" . This state is also described in another
place in the Lankdvatdra as voidness (sunyatd) which is one and
has no origination and no essence 3 . In another place it is also
designated as tathagatagarbha 4 .
It may be supposed that this doctrine of an unqualified
ultimate truth comes near to the Vedantic atman or Brahman
like the tathata doctrine of Asvaghosa; and we find in Larika-
vatara that Havana asks the Buddha " How can you say that
your doctrine of tathagatagarbha was not the same as the atman
doctrine of the other schools of philosophers, for those heretics
also consider the atman as eternal, agent, unqualified, all-per
vading and unchanged?" To this the Buddha is found to reply
thus "Our doctrine is not the same as the doctrine of those
heretics; it is in consideration of the fact that the instruction
of a philosophy which considered that there was no soul or sub
stance in anything (nairatmya) would frighten the disciples, that
I say that all things are in reality the tathagatagarbha. This
should not be regarded as atman. Just as a lump of clay is made
into various shapes, so it is the non-essential nature of all
phenomena and their freedom from all characteristics (sarvavikal-
palaksanavinivrttam) that is variously described as the garbha
or the nairatmya (essencelessness). This explanation of tathaga
tagarbha as the ultimate truth and reality is given in order to
attract to our creed those heretics who are superstitiously inclined
to believe in the atman doctrine 6 ."
So far as the appearance of the phenomena was concerned
the idealistic Buddhists (yijndnavddins) agreed to the doctrine of
pratltyasamutpada with certain modifications. There was with
them an external pratltyasamutpada just as it appeared in the
1 Asanga s Mahdydnasutr&lamkdra, p. 65.
2 Lankavatarasutra, p. 70. 8 Ibid. p. 78.
4 Ibid. p. 80. 8 Ibid. pp. 80-81.
102
148 Buddhist Philosophy [CH.
objective aspect and an internal pratityasamutpada. The external
pratityasamutpada (dependent origination) is represented in the
way in which material things (e.g. a jug) came into being by the
co-operation of diverse elements the lump of clay, the potter,
the wheel, etc. The internal (adhydtmikd) pratityasamutpada
was represented by avidya, trsna, karma, the skandhas, and the
ayatanas produced out of them 1 .
Our understanding is composed of two categories called the
pravicayabuddhi and the vikalpalaksanagrahdbhinivesapratisthd-
pikabuddhi. The pravicayabuddhi is that which always seeks to
take things in either of the following four ways, that they are
either this or the other (ekatvdnyatvd}\ either both or not both
(ubhaydnubhayd), either are or are not (astindsti\ either eternal
or non-eternal (nitydnityd). But in reality none of these can be
affirmed of the phenomena. The second category consists of that
habit of the mind by virtue of which it constructs diversities and
arranges them (created in their turn by its own constructive activity
parikalpa} in a logical order of diverse relations of subject and
predicate, causal and other relations. He who knows the nature
of these two categories of the mind knows that there is no external
world of matter and that they are all experienced only in the;
mind. There is no water, but it is the sense construction of
smoothness (snehd) that constructs the water as an external sub
stance; it is the sense construction df activity or energy that
constructs the external substance of fire; it is the sense construc
tion of movement that constructs the external substance of air.
In this way through the false habit of taking the unreal as the
real (mithydsatydbhinivesa) five skandhas appear. If these were
to appear all together, we could not speak of any kind of causal
relations, and if they appeared in succession there could be
no connection between them, as there is nothing to bind them
together. In reality there is nothing which is produced or
destroyed, it is only our constructive imagination that builds up
things as perceived with all their relations, and ourselves as per-
ceivers. It is simply a convention (yyavahdra) to speak of things
as known 2 . Whatever we designate by speech is mere speech-
construction (ydgvikalpa} and unreal. In speech one could not
speak of anything without relating things in some kind of causal
1 Lankdvatdrasutra, p. 85.
a Lankdvatdrasutra, p. 87, compare the term " vyavaharika " as used of the pheno
menal and the conventional world in almost the same sense by Sahkara.
v] Voidness of all phenomena 149
relation, but none of these characters may be said to be true;
the real truth (paramdrtha) can never be referred to by such
speech-construction.
The nothingness (siinyata) of things may be viewed from
seven aspects (i) that they are alwaysjnterdependent, and hence
have no special characteristics by themselves, and as they cannot
be determined in themselves they cannot be determined in terms
of others, for, their own nature being undetermined, a reference
to an " other " is also undetermined, and hence they are all in
definable (laksanasunyata) ; (2) that they haygjno positive jssence
(bhdvasvabhdvasunyata), since they spring up from a natural non-
existence (svabhdvdbhdvotpatti); (3) that they are_oLaO--unkr4Own
type of noji-exjstence (apracaritasiinyata), since all the skandhas
vanish in the nirvana; (4) that they appear phenomenally as^con-
nected though non-existent (pracaritasunyatd), for their skandhas
have no reality in themselves nor are they related to others, but
yet they appear to be somehow causally connected ; (5) that none
of the things can be described as having any definite nature,
they are all undemonstrable by language (nirabhilapyasunyata) ;
(6) that there cannot be any knowledge^aliQiiLlherrL except that
which is brought about by the long-standing defects of desires
which pollute all our vision ; (7) that things are also non-existent
in the sense that we affirm them to be in a particular place and
time in which they are not (itaretarasunyatd).
There is thus only non-existence, which again is neither eternal
nor destructible, and the world is but a dream and a maya ; the
two kinds of negation (nirodhd) are akasa (space) and nirvana ;
things which are neither existent nor non-existent are only
imagined to be existent by fools.
This view apparently comes into conflict with the doctrine of
this school, that the reality is called the tathagatagarbha (the
womb of all that is merged in thatness) and all the phenomenal
appearances of the clusters (skandhas}, elements (dhdtus), and
fields of sense operation (dyatanas) only serve to veil it with
impurities, and this would bring it nearer to the assumption of a
universal soul as the reality. But the Lankdvatdra attempts to
explain away this conflict by suggesting that the reference to
the tathagatagarbha as the reality is only a sort of false bait to
attract those who are afraid of listening to the nairatmya (non-
soul) doctrine 1 .
1 Lank&vatarasutra, p. 80.
1 50 Buddhist Philosophy [CH.
The Bodhisattvas may attain their highest by the fourfold
knowledge of (i) svacittadrsyabhdvand, (2) utpddasthitibhanga-
vivarjjanata, (3) bdhyabhavabhavopalaksanata and (4) svapra-
tydryyajndnddhigamdbhinnalaksanatd. The first means that all
things are but creations of the imagination of one s mind. The
second means that as things have no essence there is no origina
tion, existence or destruction. The third means that one should
know the distinctive sense in which all external things are said
either to be existent or non-existent, for their existence is merely
like the mirage which is produced by the beginningless desire
(vdsana) of creating and perceiving the manifold. This brings us
to the fourth one, which means the right comprehension of the
nature of all things.
The four dhyanas spoken of in the Lankdvatdra seem to be
different from those which have been described in connection with
the Theravada Buddhism. These dhyanas are called (i) bdlo-
pacdrika, (2) arthapravicaya, (3) tathatalambana and (4) tathd-
gata. The first one is said to be that practised by the ravakas
and the pratyekabuddhas. It consists in concentrating upon the
doctrine that there is no soul (pudgalanairdtmyd), and that every
thing is transitory, miserable and impure. When considering all
things in this way from beginning to end the sage advances on
till all conceptual knowing ceases (dsamjndnirodhdt); we have
what is called the valopacarika dhyana (the meditation for be
ginners).
The second is the advanced state where not only there is
full consciousness that there is no self, but there is also the com
prehension that neither these nor the doctrines of other heretics
may be said to exist, and that there is none of the dharmas that
appears. This is called the arthapravicayadkydna, for the sage
concentrates here on the subject of thoroughly seeking out (pra-
vicayd) the nature of all things (arthd).
The third dhyana, that in which the mind realizes that the
thought that there is no self nor that there are the appearances,
is itself the result of imagination and thus lapses into the thatness
(tathata). This dhyana is called tathatalambana^ because it has for
its object tathata or thatness.
The last or the fourth dhyana is that in which the lapse of
the mind into the state of thatness is such that the nothingness
and incomprehensibility of all phenomena is perfectly realized;
v] Ultimate goal 1 5 1
and nirvana is that in which all root desires (vdsana) manifesting
themselves in knowledge are destroyed and the mind with know
ledge and perceptions, making false creations, ceases to work. This
cannot be called death, for it will not have any rebirth and it can
not be called destruction, for only compounded things (samskrtd)
suffer destruction, so that it is different from either death or
destruction. This nirvana is different from that of the s"ravakas
and the pratyekabuddhas for they are satisfied to call that state
nirvana, in which by the knowledge of the general characteristics
of all things (transitoriness and misery) they are not attached to
things and cease to make erroneous judgments 1 .
Thus we see that there is no cause (in the sense of ground)
of all these phenomena as other heretics maintain. When it is
said that the world is maya or illusion, what is meant to be
emphasized is this, that there is no cause, no ground. The pheno
mena that seem to originate, stay, and be destroyed are mere
constructions of tainted imagination, and the tathata or thatness
is nothing but the turning away of this constructive activity or
nature of the imagination (vikalpa) tainted with the associations
of beginningless root desires (vasana)*. The tathata has no
separate reality from illusion, but it is illusion itself when the
course of the construction of illusion has ceased. It is therefore
also spoken of as that which is cut off or detached from the mind
(cittavimukta\ for here there is no construction of imagination
(sarvakalpandvirahitam)*.
Sautrantika Theory of Perception.
Dharmottara (847 A.D.), a commentator of Dharmakirtti s 4
(about 635 A.D.) Nydyabindu, a Sautrantika logical and episte-
mological work, describes right knowledge (samyagjnana) as an
invariable antecedent to the accomplishment of all that a man
1 Lankdvatdrasutra, p. 100. 2 Ibid. p. 109.
8 This account of the Vijftanavada school is collected mainly from Lankavatara-
sutra, as no other authentic work of the Vijfianavada school is available. Hindu
accounts and criticisms of this school may be had in such books as Rumania s Sloka
vdrttika or Sahkara s bhasya, II. ii, etc. Asanga s Mahayanasutralamkara deals more
with the duties concerning the career of a saint (Bodhisattva) than with the metaphysics
of the system.
4 Dharmaklrtti calls himself an adherent of Vijnanavada in his Santdndntara-
siddhi, a treatise on solipsism, but his Nyayabitidu seems rightly to have been considered
by the author of Nyayabindutikdtippani (p. 19) as being written from the Sautrantika
point of view.
152 Buddhist Philosophy [CH.
desires to have (samyagjitdnapurvikd sarvapurusdrthasiddhiy.
When on proceeding, in accordance with the presentation of % any
knowledge, we get a thing as presented by it we call it right
knowledge. Right knowledge is thus the knowledge by which one
can practically acquire the thing he wants to acquire (arthddhi-
gati). The process of knowledge, therefore, starts with the per
ceptual presentation and ends with the attainment of the thing
represented by it and the fulfilment of the practical need by it
(arthddhigamdt samdptah pramdnavydpdrati). Thus there are
three moments in the perceptual acquirement of knowledge :
(i) the presentation, (2) our prompting in accordance with it,
and (3) the final realization of the object in accordance with
our endeavour following the direction of knowledge. Inference
is also to be called right knowledge, as it also serves our practical
need by representing the presence of objects in certain connec
tions and helping us to realize them. In perception this presen
tation is direct, while in inference this is brought about indirectly
through the liriga (reason). Knowledge is sought by men for the
realization of their ends, and the subject of knowledge is dis
cussed in philosophical works only because knowledge is sought
by men. Any knowledge, therefore, which will not lead us to
the realization of the object represented by it could not be called
right knowledge. All illusory perceptions, therefore, such as the
perception of a white conch-shell as yellow or dream perceptions,
are not right knowledge, since they do not lead to the realization
of such objects as are presented by them. It is true no doubt
that since all objects are momentary, the object which was per
ceived at the moment of perception was not the same as that
which was realized at a later moment. But the series of existents
which started with the first perception of a blue object finds itself
realized by the realization of other existents of the same series
(nllddau ya eva santdnah paricchinno nllajndnena sa eva tena
prdpitah tena nllajndnam pramdnam}*.
When it is said that right knowledge is an invariable ante
cedent of the realization of any desirable thing or the retarding
of any undesirable thing, it must be noted that it is not meant
1 Brief extracts from the opinions of two other commentators of Nyayabindu,
Vinltadeva and 6antabha.dra (seventh century), are found in Nyayabindutikatippani,
a commentary of Nyayabindutika of Dharmmottara, but their texts are not available
to us.
2 Nyayabindutikatippani, p. n.
v] Theory of Perception 153
that right knowledge is directly the cause of it ; for, with the rise
of any right perception there is a memory of past experiences,
desire is aroused, through desire an endeavour in accordance with
it is launched, and as a result of that there is realization of the
object of desire. Thus, looked at from this point of view, right
knowledge is not directly the cause of the realization of the object.
Right knowledge of course directly indicates the presentation, the
object of desire, but so far as the object is a mere presentation it
is not a subject of enquiry. It becomes a subject of enquiry only in
connection with our achieving the object presented by perception.
Perception (pratyaksd) has been defined by Dharmaklrtti as
a presentation, which is generated by the objects alone, unasso-
ciated by any names or relations (kalpand} and which is not
erroneous (kalpandpodhamabhrdntamy. This definition does not
indeed represent the actual nature (svarufa) of perception, but only
shows the condition which must be fulfilled in order that anything
may be valid perception. What is meant by saying that a per
ception is not erroneous is simply this, that it will be such that
if one engages himself in an endeavour in accordance with it,
he will not be baffled in the object which was presented to him
by his perception (tasmddgrdhye qrthe vasturiipe yadaviparyastam
tadabhrdntamiha veditavyam). It is said that a right perception
could not be associated with names (kalpand or abhildpd). This
qualification is added only with a view of leaving out all that is not
directly generated by the object. A name is given to a thing
only when it is associated in the mind, through memory, as being
the same as perceived before. This cannot, therefore, be regarded
as being produced by the object of perception. The senses present
the objects by coming in contact with them, and the objects also
must of necessity allow themselves to be presented as they are
when they are in contact with the proper senses. But the work
of recognition or giving names is not what is directly produced
by the objects themselves, for this involves the unification of
previous experiences, and this is certainly not what is presented
1 The definition first given in the Pramanasamuccaya (not available in Sanskrit) of
Dinnaga (500 A.D.) was " Kalpanapodham." According to Dharmakirtti it is the in
determinate knowledge (nirvikalpa j fldna) consisting only of the copy of the object
presented to the senses that constitutes the valid element presented to perception.
The determinate knowledge (savikalpajftdna), as formed by the conceptual activity of
the mind identifying the object with what has been experienced before, cannot be
regarded as truly representing what is really presented to the senses.
1 54 Buddhist Philosophy [CH.
to the sense (purvadrstdparadrstancdrthamekikurvadvijndnam-
asannihitavisayam purvadrstasydsannihitatvdf). In all illusory
perceptions it is the sense which is affected either by extraneous
or by inherent physiological causes. If the senses are not per
verted they are bound to present the object correctly. Perception
thus means the correct presentation through the senses of an
object in its own uniqueness as containing only those features
which are its and its alone (svalaksanam). The validity of know
ledge consists in the sameness that it has with the objects presented
by it (arthena saha yatsdrupyam sddrsyamasya jndnasya tatpra-
mdnamiha). But the objection here is that if our percept is only
similar to the external object then this similarity is a thing which
is different from the presentation, and thus perception becomes
invalid. But the similarity is not different from the percept which
appears as being similar to the object It is by virtue of their
sameness that we refer to the object by the percept (taditi sdrupyam
tasya vasdt) and our perception of the object becomes possible.
It is because we have an awareness of blueness that we speak of
having perceived a blue object. The relation, however, between
the notion of similarity of the perception with the blue object and
the indefinite awareness of blue in perception is not one of
causation but of a determinant and a determinate (yyavasthdpya-
vyavasthdpakabhdvena). Thus it is the same cognition which in
one form stands as signifying the similarity with the object of
perception and is in another indefinite form the awareness as the
percept (tata ekasya vastunah kincidrupam pramdnam kincitpra-
mdnaphalam na virudhyate). It is on account of this similarity
with the object that a cognition can be a determinant of the
definite awareness (yyavasthdpanaheturhi sdrupyam), so that by
the determinate we know the determinant and thus by the
similarity of the sense-datum with the object (pramdna) we come
to think that our awareness has this particular form as "blue"
(pramdnaphala). If this sameness between the knowledge and its
object was not felt we could not have spoken of the object from
the awareness (sdrupyamanubhutam vyavasthdpanahetuft). The
object generates an awareness similar to itself, and it is this
correspondence that can lead us to the realization of the object
so presented by right knowledge 1 .
1 See also pp. 340 and 409. It is unfortunate that, excepting the Nydyabindu,
Nydyabindutikd, Nydyabindutikatippani (St Petersburg, 1909), no other works dealing
with this interesting doctrine of perception are available to us. Nydyabindu is probably
v] Inference 155
Sautrantika theory of Inference 1 .
According to the Sautrantika doctrine of Buddhism as de
scribed by Dharmaklrtti and Dharmmottara which is probably the
only account of systematic Buddhist logic that is now available to
us in Sanskrit, inference (anumdna) is divided into two classes,
called svarthanumana (inferential knowledge attained by a person
arguing in his own mind or judgments), and pararthanumana (in
ference through the help of articulated propositions for convincing
others in a debate). The validity of inference depended, like the
validity of perception, on copying the actually existing facts of
the external world. Inference copied external realities as much
as perception did ; just as the validity of the immediate perception
of blue depends upon its similarity to the external blue thing
perceived, so the validity of the inference of a blue thing also,
so far as it is knowledge, depends upon its resemblance to the
external fact thus inferred (sdrupyavasaddhi tannllapratitirupam
sidhyati}.
The reason by which an inference is made should be such
that it may be present only in those cases where the thing to
be inferred exists, and absent in every case where it does not
exist. It is only when the reason is tested by both these joint
conditions that an unfailing connection ( prattbandha) between
the reason and the thing to be inferred can be established. It is
not enough that the reason should be present in all cases where
the thing to be inferred exists and absent where it does not
exist, but it is necessary that it should be present only in the
above case. This law (niyamd) is essential for establishing
the unfailing condition necessary for inference 2 . This unfailing
natural connection (svabhdvapratibandhd) is found in two types
one of the earliest works in which we hear of the doctrine of arthakriyakaritva (practical
fulfilment of our desire as a criterion of right knowledge). Later on it was regarded
as a criterion of existence, as Ratnakirtti s works and the profuse references by Hindu
writers to the Buddhistic doctrines prove. The word arthakriyd is found in Candra-
klrtti s commentary on Nagarjunaand also in such early works as Lalitavistara (pointed
out to me by Dr E. J. Thomas of the Cambridge University Library) but the word
has no philosophical significance there.
1 As the Pramanasamuccaya of Dihnaga is not available in Sanskrit, we can hardly
know anything of developed Buddhist logic except what can be got from the Nyaya-
bindutika of Dharmmottara.
2 tasmat niyamauatorevdnvayavyatirekayoh prayogah karttavyah yena pratibandko
gamy eta sadhanyasa sddhyena. Nyayabindutika, p. 44.
156 Buddhist Philosophy [CH.
of cases. The first is that where the nature of the reason is con
tained in the thing to be inferred as a part of its nature, i.e. where
the reason stands for a species of which the thing to be inferred
is a genus; thus a stupid person living in a place full of tall pines
may come to think that pines are called trees because they are
tall and it may be useful to point out to him that even a small
pine plant is a tree because it is pine; the quality of pineness
forms a part of the essence of treeness, for the former being
a species is contained in the latter as a genus ; the nature of the
species being identical with the nature of the genus, one could
infer the latter from the former but not vice versa; this is called
the unfailing natural connection of identity of nature (tdddtmyd).
The second is that where the cause is inferred from the effect
which stands as the reason of the former. Thus from the smoke
the fire which has produced it may be inferred. The ground of
these inferences is that reason is naturally indissolubly connected
with the thing to be inferred, and unless this is the case, no
inference is warrantable.
This natural indissoluble connection (svabhdvapratibandha),
be it of the nature of identity of essence of the species in the
genus or inseparable connection of the effect with the cause, is
the ground of all inference 1 . The svabhavapratibandha deter
mines the inseparability of connection (avinabhavaniyama) and
the inference is made not through a series of premisses but
directly by the liriga (reason) which has the inseparable con
nection 8 .
The second type of inference known as pararthanumana
agrees with svarthanumana in all essential characteristics; the
main difference between the two is this, that in the case of
pararthanumana, the inferential process has to be put verbally in
premisses.
Pandit Ratnakarasanti, probably of the ninth or the tenth cen
tury A.D., wrote a paper named Antarvyaptisamarthana in which
1 na hi yo yalra svabhavena na pratibaddhah sa tarn apratibaddhavisayamavaiya-
meva na vyabhicaratiti nasti tayoravyabhicaraniyamah. Nyayabindutika, p. 29.
2 The inseparable connection determining inference is only possible when the
linga satisfies the three following conditions, viz. (i) paksasattva (existence of the
linga in the paksa the thing about which something is inferred) ; (2) sapaksasattva
(existence of the linga in those cases where the sadhya or probandum existed), and
(3) vipaksasattva (its non-existence in all those places where the sadhya did not exist).
The Buddhists admitted three propositions in a syllogism, e.g. The hill has fire, because
it has smoke, like a kitchen but unlike a lake.
v] Inference 157
he tried to show that the concomitance is not between those
cases which possess the liriga or reason with the cases which
possess the sadhya (probandum) but between that which has the
characteristics of the liriga with that which has the characteristics
of the sadhya (probandum); or in other words the concomitance
is not between the places containing the smoke such as kitchen,
etc., and the places containing fire but between that which has the
characteristic of the liriga, viz. the smoke, and that which has the
characteristic of the sadhya, viz. the fire. This view of the nature
of concomitance is known as inner concomitance (antarvyapti),
whereas the former, viz. the concomitance between the thing
possessing liriga and that possessing sadhya, is known as outer
concomitance (bahirvyapti} and generally accepted by the Nyaya
school of thought. This antarvyapti doctrine of concomitance is
indeed a later Buddhist doctrine.
It may not be out of place here to remark that evidences of
some form of Buddhist logic probably go back at least as early
as the Kathdvatthu (200 B.C.). Thus Aung on the evidence of
the Yamaka points out that Buddhist logic a t the time of Asoka
"was conversant with the distribution of terms" and the process
of conversion. He further points out that the logical premisses
such as the udaharana ( Yo yo aggimd so so dhumava whatever is
fiery is -smoky), the upanayana (ayam pabbato dhumava this
hill is smoky) and the niggama (tasmddayam aggimd therefore
that is fiery) were also known. (Aung further sums up the
method of the arguments which are found in the Kathdvatthu as
follows:
"Adherent. Is A J3? (thdpana).
Opponent. Yes.
Adherent. Is CD} (pdpand).
Opponent. No.
Adherent. But if A be B then (you should have said) C is D.
That B can be affirmed of A but D of C is false.
Hence your first answer is refuted.")
The antecedent of the hypothetical major premiss is termed
thapana, because the opponent s position, A is , is conditionally
established for the purpose of refutation.
The consequent of the hypothetical major premiss is termed
papana because it is got from the antecedent. And the con-
158 Buddhist Philosophy [CH.
elusion is termed ropana because the regulation is placed on the
opponent. Next:
"If D be derived of C.
Then B should have been derived of A.
But you affirmed B of A.
(therefore) That B can be affirmed of A but not of D or C is
wrong."
This is the patiloma, inverse or indirect method, as contrasted
with the former or direct method, anuloma. In both methods the
consequent is derived. But if we reverse the hypothetical major
in the latter method we get
If A is B CisD.
But A is B.
Therefore C is D.
By this indirect method the opponent s second answer is re
established 1 ."
The Doctrine of Momentariness.
Ratnakirtti (950 A.D.) sought to prove the momentariness of
all existence (sattva), first, by the concomitance discovered by the
method of agreement in presence (anvayavydpti), and then by the
method of difference by proving that the production of effects
could not be justified on the assumption of things being per
manent and hence accepting the doctrine of momentariness
as the only alternative. Existence is defined as the capacity of
producing anything (arthakriydkaritva). The form of the first
type of argument by anvayavyapti may be given thus: "What
ever exists is momentary, by virtue of its existence, as for example
the jug; all things about the momentariness of which we are dis
cussing are existents and are therefore momentary." It cannot
be said that the jug which has been chosen as an example of an
existent is not momentary; for the jug is producing certain
effects at the present moment; and it cannot be held that these
are all identical in the past and the future or that it is producing
no effect at all in the past and future, for the first is impossible,
for those which are done now could not be done again in the
future; the second is impossible, for if it has any capacity to
1 See introduction to the translation of Kathavatthu (Points of Controversy) by
Mrs Rhys Davids.
v] Momentariness 159
produce effects it must not cease doing so, as in thai case one
might as well expect that there should not be any effect even at
the present moment. Whatever has the capacity of producing
anything at any time must of necessity do it. So if it does pro
duce at one moment and does not produce at another, this
contradiction will prove the supposition that the things were
different at the different moments. If it is held that the nature
of production varies at different moments, then also the thing at
those two moments must be different, for a thing could not have
in it two contradictory capacities.
Since the jug does not produce at the present moment the
work of the past and the future moments, it cannot evidently do
so, and hence is not identical with the jug in the past and in the
future, for the fact that the jug has the capacity and has not the
capacity as well, proves that it is not the same jug at the two
moments (saktdsaktasvabhdvatayd pratiksanam bhedati). The
capacity of producing effects (arthakriydsakti), which is but the
other name of existence, is universally concomitant with momen-
tariness (ksanikatvavydpta).
The Nyaya school of philosophy objects to this view and says
that the capacity of anything cannot be known until the effect
produced is known, and if capacity to produce effects be regarded
as existence or being, then the being or existence of the effect
cannot be known, until that has produced another effect and
that another ad infinitum. Since there can be no being that has
not capacity of producing effects, and as this capacity can
demonstrate itself only in an infinite chain, it will be impossible
to know any being or to affirm the capacity of producing effects
as the definition of existence. Moreover if all things were
momentary there would be no permanent perceiver to observe
the change, and there being nothing fixed there could hardly be
any means even of taking to any kind of inference. To this
Ratnaklrtti replies that capacity (sdmarthyd) cannot be denied,
for it is demonstrated even in making the denial. The observation
of any concomitance in agreement in presence, or agreement in
absence, does not require any permanent observer, for under
certain conditions of agreement there is the knowledge of the
concomitance of agreement in presence, and in other conditions
there is the knowledge of the concomitance in absence. This
knowledge of concomitance atthe succeeding momentholds within
160 Buddhist Philosophy [CH.
itself the experience of the conditions of the preceding moment,
and this alone is what we find and not any permanent observer.
The Buddhist definition of being or existence (sattva) is
indeed capacity, and we arrived at this when it was observed that
in all proved cases capacity was all that could be defined of
being; seed was but the capacity of producing shoots, and
even if this capacity should require further capacity to produce
effects, the fact which has been perceived still remains, viz. that
the existence of seeds is nothing but the capacity of producing
the shoots and thus there is no vicious infinite 1 . Though things are
momentary, yet we could have concomitance between things only
so long as their apparent forms are not different (atadriipa-
pardvrttayoreva sddhyasddhanayoh pratyaksena vydptigrahandf).
The vyapti or concomitance of any two things (e.g. the fire and
the smoke) is based on extreme similarity and not on identity.
Another objection raised against the doctrine of momentariness
is this, that a cause (e.g. seed) must wait for a number of other
collocations of earth, water, etc., before it can produce the effect
(e.g. the shoots) and hence the doctrine must fail. To this Ratna-
klrtti replies that the seed does not exist before and produce the
effect when joined by other collocations, but such is the special
effectiveness of a particular seed-moment, that it produces both
the collocations or conditions as well as the effect, the shoot.
How a special seed-moment became endowed with such special
effectiveness is to be sought in other causal moments which
preceded it, and on which it was dependent. Ratnaklrtti wishes to
draw attention to the fact that as one perceptual moment reveals
a number of objects, so one causal moment may produce a number
of effects. Thus he says that the inference that whatever has
being is momentary is valid and free from any fallacy.
It is not important to enlarge upon the second part of
Ratnaklrtti s arguments in which he tries to show that the pro
duction of effects could not be explained if we did not suppose
1 The distinction between vicious and harmless infinites was known to the Indians
at least as early as the sixth or the seventh century. Jayanta quotes a passage which
differentiates the two clearly (Nydyamanjari, p. 22) :
" mulaksatikarimahuranavastham hi dusanam.
mulasiddhau tvarucydpi ndnavasthd nivdryate."
The infinite regress that has to be gone through in order to arrive at the root
matter awaiting to be solved destroys the root and is hence vicious, whereas if the
root is saved there is no harm in a regress though one may not be willing to have it.
v] Momentariness 1 6 1
all things to be momentary, for this is more an attempt to refute
the doctrines of Nyaya than an elaboration of the Buddhist
principles.
The doctrine of momentariness ought to be a direct corollary
of the Buddhist metaphysics. But it is curious that though all
dharmas were regarded as changing, the fact that they were all
strictly momentary (ksanika i.e. existing only for one moment)
was not emphasized in early Pali literature. Asvaghosa in his
Sraddhotpadasastra speaks of all skandhas as ksanika (Suzuki s
translation, p. 105). Buddhaghosa also speaks of the meditation
of the khandhas as khanika in his Visuddhimagga. But from the
seventh century A.D. till the tenth century this doctrine together
with the doctrine of arthakriyakaritva received great attention at
the hands of the Sautrantikas and the Vaibhasikas. All the
Nyaya and Vedanta literature of this period is full of refutations
and criticisms of these doctrines. The only Buddhist account
available of the doctrine of momentariness is from the pen of
Ratnaklrtti. Some of the general features of his argument in
favour of the view have been given above. Elaborate accounts of it
may be found in any of the important Nyaya works of this period
such as NyQyamaftjari, Tdtparyyatlkd of Vacaspati Misra, etc.
Buddhism did not at any time believe anything to be per
manent. With the development of this doctrine they gave great
emphasis to this point. Things came to view at one moment and
the next moment they were destroyed. Whatever is existent is
momentary. It is said that our notion of permanence is derived
from the notion of permanence of ourselves, but Buddhism denied
the existence of any such permanent selves. What appears as
self is but the bundle of ideas, emotions, and active tendencies
manifesting at any particular moment. The next moment these
dissolve, and new bundles determined by the preceding ones
appear and so on. The present thought is thus the only thinker.
Apart from the emotions, ideas, and active tendencies, we cannot
discover any separate self or soul. It is the combined product of
these ideas, emotions, etc., that yield the illusory appearance of
self at any moment. The consciousness of self is the resultant pro
duct as it were of the combination of ideas, emotions, etc., at any
particular moment. As these ideas, emotions, etc., change every
moment there is no such thing as a permanent self.
The fact that I remember that I have been existing for
D. II
1 62 Buddhist Philosophy [CH.
a long time past does not prove that a permanent self has been
existing for such a long period. When I say this is that book, I
perceive the book with my eye at the present moment, but that
"this book" is the same as "that book" (i.e. the book arising in
memory), cannot be perceived by the senses. It is evident
that the "that book" of memory refers to a book seen in the
past, whereas "this book " refers to the book which is before
my eyes. The feeling of identity which is adduced to prove per
manence is thus due to a confusion between an object of memory
referring to a past and different object with the object as perceived
at the present moment by the senses 1 . This is true not only of
all recognition of identity and permanence of external objects but
also of the perception of the identity of self, for the perception of
self-identity results from the confusion of certain ideas or emotions
arising in memory with similar ideas of the present moment. But
since memory points to an object of past perception, and the per
ception to another object of the present moment, identity cannot
be proved by a confusion of the two. Every moment all objects
of the world are suffering dissolution and destruction, but yet
things appear to persist, and destruction cannot often be noticed.
Our hair and nails grow and are cut, but yet we think that we
have the same hair and nail that we had before, in place of old
hairs new ones similar to them have sprung forth, and they leave
the impression as if the old ones were persisting. So it is that
though things are destroyed every moment, others similar to
these often rise into being and are destroyed the next moment
and so on, and these similar things succeeding in a series produce
the impression that it is one and the same thing which has been
persisting through all the passing moments 2 . Just as the flame
of a candle is changing every moment and yet it seems to us as
if we have been perceiving the same flame all the while, so
all our bodies, our ideas, emotions, etc., all external objects
around us are being destroyed every moment, and new ones are
being generated at every succeeding moment, but so long as the
objects of the succeeding moments are similar to those of the
preceding moments, it appears to us that things have remained
the same and no destruction has taken place.
1 See pratyabhijnanirasa of the Buddhists, Nyayamanjari, V.S. Series, pp. 449, etc.
2 See Tarkarahasyadipikd of Gunaratna, p. 30, and also Nyayamanjari, V.S.
edition, p. 450.
v] Causal Efficiency 1 63
The Doctrine of Momentariness and the Doctrine
of Causal Efficiency (Arthakriyakaritva).
It appears that a thing or a phenomenon may be defined from
the Buddhist point of view as being the combination of diverse
characteristics 1 . What we call a thing is but a conglomeration of
diverse characteristics which are found to affect, determine or
influence other conglomerations appearing as sentient or as
inanimate bodies. So long as the characteristics forming the
elements of any conglomeration remain perfectly the same, the
conglomeration may be said to be the same. As soon as any of
these characteristics is supplanted by any other new characteristic,
the conglomeration is to be called a new one 2 . Existence or
being of things means the work that any conglomeration does or
the influence that it exerts on other conglomerations. This in
Sanskrit is called arthakriydkdritva which literally translated
means the power of performing actions and purposes of some
kind 3 . The criterion of existence or being is the performance of
certain specific actions, or rather existence means that a certain
effect has been produced in some way (causal efficiency). That
which has produced such an effect is then called existent or sat.
Any change in the effect thus produced means a corresponding
change of existence. Now, that selfsame definite specific effect
1 Compare Milindapanha, n. i. i The Chariot Simile.
2 Compare Tarkarahasyadipika of Gunaratna, A. S. s edition, pp. 34, 28 and
Nyayamanjarf, V.S. edition, pp. 445, etc., and also the paper on Ksanabhanga-
siddhi by Ratnaklrtti in Six Buddhist Nyaya tracts.
3 This meaning of the word "arthakriyakaritva" is different from the meaning of
the word as we found in the section "sautrantika theory of perception." But we find
the development of this meaning both in Ratnaklrtti as well as in Nyaya writers who
referred to this doctrine. With Vinitadeva (seventh century A. D.) the word " arthakriya-
siddhi" meant the fulfilment of any need such as the cooking of rice by fire (artha-
Sabdena prayojanamucyate purusasya prayojanam darupakadi tasya siddhih nispattih
the word artha means need ; the need of man such as cooking by logs, etc. ; siddhi of
that, means accomplishment). With Dharmottara who flourished about a century and
a half later arlhasiddhi means action (anusthiti) with reference to undesirable and
desirable objects (heyopadeyarthavisaya). But with Ratnaklrtti (950 A.D.) the word
arthakriyakaritva has an entirely different sense. It means with him efficiency of
producing any action or event, and as such it is regarded as the characteristic definition
of existence (sattva). Thus he says in his Ksanabhangasiddhi, pp. 20, 21, that though
in different philosophies there are different definitions of existence or being, he will
open his argument with the universally accepted definition of existence as arthakriya
karitva (efficiency of causing any action or event). Whenever Hindu writers after
Ratnakirtti refer to the Buddhist doctrine of arthakriyakaritva they usually refer to this
doctrine in Ratnakirtti s sense.
II 2
164 Buddhist Philosophy [CH.
which is produced now was never produced before, and cannot
be repeated in the future, for that identical effect which is once
produced cannot be produced again. So the effects produced in
us by objects at different moments of time may be similar but
cannot be identical. Each moment is associated with a new effect
and each new effect thus produced means in each case the coming
into being of a correspondingly new existence of things. If things
were permanent there would be no reason why they should be
performing different effects at different points of time. Any
difference in the effect produced, whether due to the thing itself
or its combination with other accessories, justifies us in asserting
that the thing has changed and a new one has come in its place.
The existence of a jug for example is known by the power it
has of forcing itself upon our minds; if it had no such power
then we could not have said that it existed. We can have no
notion of the meaning of existence other than the impression
produced on us; this impression is nothing else but the power
exerted by things on us, for there is no reason why one should
hold that beyond such powers as are associated with the pro
duction of impressions or effects there should be some other
permanent entity to which the power adhered, and which existed
even when the power was not exerted. We perceive the power
of producing effects and define each unit of such power as
amounting to a unit of existence. And as there would be
different units of power at different moments, there should also
be as many new existences, i.e. existents must be regarded as
momentary, existing at each moment that exerts a new power.
This definition of existence naturally brings in the doctrine of
momentariness shown by Ratnaklrtti.
Some Ontological Problems on which the
Different Indian Systems Diverged.
We cannot close our examination of Buddhist philosophy
without briefly referring to its views on some ontological problems
which were favourite subjects of discussion in almost all philo
sophical circles of India. These are in brief: (i) the relation of
cause and effect, (2) the relation of the whole (avayavi} and the
part (avayava\ (3) the relation of generality (s&mdnya) to the
specific individuals, (4) the relation of attributes or qualities and
the substance and the problem of the relation of inherence, (5) the
v] Ontological Problems 165
relation of power (sakti) to the power-possessor (saktimdri). Thus
on the relation of cause and effect, &arikara held that cause alone
was permanent, real, and all effects as such were but impermanent
illusions due to ignorance, Samkhya held that there was no
difference between cause and effect, except that the former was
only the earlier stage which when transformed through certain
changes became the effect. The history of any causal activity is
the history of the transformation of the cause into the effects.
Buddhism holds everything to be momentary, so neither cause nor
effect can abide. One is called the effect because its momentary
existence has been determined by the destruction of its momen
tary antecedent called the cause. There is no permanent reality
which undergoes the change, but one change is determined by
another and this determination is nothing more than "that
happening, this happened." On the relation of parts to whole,
Buddhism does not believe in the existence of wholes. According
to it, it is the parts which illusorily appear as the whole, the
individual atoms rise into being and die the next moment and
thus there is no such thing as " whole 1 ." The Buddhists hold again
that there are no universals, for it is the individuals alone which
come and go. There are my five fingers as individuals but there
is no such thing as fingerness (angulitva) as the abstract universal
of the fingers. On the relation of attributes and substance we
know that the Sautrantika Buddhists did not believe in the exist
ence of any substance apart from its attributes ; what we call a
substance is but a unit capable of producing a unit of sensation.
In the external world there are as many individual simple units
(atoms) as there are points of sensations. Corresponding to each
unit of sensation there is a separate simple unit in the objective
world. Our perception of a thing is thus the perception of the
assemblage of these sensations. In the objective world also there
are no substances but atoms or reals, each representing a unit of
sensation, force or attribute, rising into being and dying the next
moment. Buddhism thus denies the existence of any such rela
tion as that of inherence (samavayd) in which relation the attri
butes are said to exist in the substance, for since there are no
separate substances there is no necessity for admitting the relation
of inherence. Following the same logic Buddhism also does not
1 See Avayavinirdkarana, Six Buddhist Nydya tracts, Bibliotheca Indica, Calcutta,
1910.
1 66 Buddhist Philosophy [CH.
believe in the existence of a power-possessor separate from the
power.
Brief survey of the evolution of Buddhist Thought.
In the earliest period of Buddhism more attention was paid
to the four noble truths than to systematic metaphysics. What
was sorrow, what was the cause of sorrow, what was the cessation
of sorrow and what could lead to it ? The doctrine of paticcasa-
muppdda was offered only to explain how sorrow came in and
not with a view to the solving of a metaphysical problem. The
discussion of ultimate metaphysical problems, such as whether
the world was eternal or non-eternal, or whether a Tathagata
existed after death or not, were considered as heresies in early
Buddhism. Great emphasis was laid on slla, samadhi and pafifia
and the doctrine that there was no soul. The Abhidhammas
hardly give us any new philosophy which was not contained in
the Suttas. They only elaborated the materials of the suttas with
enumerations and definitions. With the evolution of Mahaynna
scriptures from some time about 200 B.C. the doctrine of the non-
essentialness and voidness of all dhammas began to be preached.
This doctrine, which was taken up and elaborated by Nagarjuna,
Aryyadeva, Kumarajlva and Candraklrtti, is more or less a co
rollary from the older doctrine of Buddhism. If one could not
say whether the world was eternal or non-eternal, or whether a
Tathagata existed or did not exist after death, and if there was
no permanent soul and all the dhammas were changing, the only
legitimate way of thinking about all things appeared to be to
think of them as mere void and non-essential appearances. These
appearances appear as being mutually related but apart from
their appearance they have no other essence, no being or reality.
The Tathata doctrine which was preached by Asvaghosa oscillated
between the position of this absolute non-essentialness of all
dhammas and the Brahminic idea that something existed as the
background of all these non-essential dhammas. This he called
tathata, but he could not consistently say that any such per
manent entity could exist. The Vijflanavada doctrine which also
took its rise at this time appears to me to be a mixture of the
Sunyavada doctrine and the Tathata doctrine; but when carefully
examined it seems to be nothing but Sunyavada, with an attempt
at explaining all the observed phenomena. If everything was
v] Buddhist Schools 167
non-essential howdid it originate? Vijftanavada proposes to give an
answer, and says that these phenomena are all but ideas of the mind
generated by the beginningless vasana (desire) of the mind. The
difficulty which is felt with regard to the Tathata doctrine that
there must be some reality which is generating all these ideas
appearing as phenomena, is the same as that in the Vijflanavada
doctrine. The Vijftanavadins could not admit the existence of such
a reality, but yet their doctrines led them to it. They could not
properly solve the difficulty, and admitted that their doctrine was
some sort of a compromise with the Brahminical doctrines of
heresy, but they s aid that this was a compromise to make the
doctrine intelligible to the heretics; in truth however the reality
assumed in the doctrine was also non-essential. The Vijflanavada
literature that is available to us is very scanty and from that we
are not in a position to judge what answers Vijflanavada could give
on the point. These three doctrines developed almost about the
same time and the difficulty of conceiving Sunya (void), tathata,
(thatness) and the alayavijftana of Vijflanavada is more or less
the same.
The Tathata doctrine of ASvaghosa practically ceased with
him. But the unyavada and the Vijflanavada doctrines which
originated probably about 200 B.C. continued to develop probably
till the eighth century A.D. Vigorous disputes with Sunyavada
doctrines are rarely made in any independent work of Hindu
philosophy, after Kumarila and Sankara. From the third or
ihe fourth century A.D. some Buddhists took to the study of
systematic logic and began to criticize the doctrine of the Hindu
logicians. Dirinaga the Buddhist logician (500 A.D.) probably
started these hostile criticisms by trying to refute the doctrines
of the great Hindu logician Vatsyayana, in his Pramana-
samuccaya. In association with this logical activity we find the
activity of two other schools of Buddhism, viz. the Sarvastivadins
(known also as Vaibhasikas) and the Sautrantikas. Both the
Vaibhasikas and the Sautrantikas accepted the existence of the
external world, and they were generally in conflict with the
Hindu schools of thought Nyaya-Vaisesika and Samkhya which
also admitted the existence of the external world. Vasubandhu
(420-500 A.D.) was one of the most illustrious names of this school.
We have from this time forth a number of great Buddhist
thinkers such as Yasomitra (commentator of Vasubandhu s work),
1 68 Buddhist Philosophy [CH. v
Dharmmaklrtti (writer of Nyayabindu 635 A.D.), Vinltadeva and
Santabhadra (commentators of Nyayabindu), Dharmmottara
(commentator of Nyayabindu 847 A.D.), Ratnaklrtti (950 A.D.),
Pandita Asoka, and Ratnakara Santi, some of whose contributious
have been published in the Six Buddhist Nydya Tracts, published
in Calcutta in the Bibliotheca Indica series. These Buddhist
writers were mainly interested in discussions regarding the nature
of perception, inference, the doctrine of momentariness, and
the doctrine of causal efficiency (arthakriydkaritva) as demon
strating the nature of existence. On the negative side they were
interested in denying the ontological theories of Nyaya and
Samkhya with regard to the nature of class-concepts, negation,
relation of whole and part, connotation of terms, etc. These
problems hardly attracted any notice in the non-Sautrantika and
non-Vaibhasika schools of Buddhism of earlier times. They of
course agreed with the earlier Buddhists in denying the existence
of a permanent soul, but this they did with the help of their
doctrine of causal efficiency. The points of disagreement between
Hindu thought up to Sarikara (800 A.D.) and Buddhist thought
till the time of Sarikara consisted mainly in the denial by the
Buddhists of a permanent soul and the permanent external world.
For Hindu thought was more or less realistic, and even the
Vedanta of Sarikara admitted the existence of the permanent
external world in some sense. With Sankara the forms of the
external world were no doubt illusory, but they all had a per
manent background in the Brahman, which was the only reality
behind all mental and the physical phenomena. The Sautrantikas
admitted the existence of the external world and so their quarrel
with Nyaya and Samkhya was with regard to their doctrine
of momentariness; their denial of soul and their views on the
different ontological problems were in accordance with their
doctrine of momentariness. After the twelfth century we do not
hear much of any new disputes with the Buddhists. From this
time the disputes were mainly between the different systems of
Hindu philosophers, viz. Nyaya, the Vedanta of the school of
Sarikara and the Theistic Vedanta of Ramanuja, Madhva, etc.
CHAPTER VI
THE JAINA PHILOSOPHY
The Origin of Jainism.
NOTWITHSTANDING the radical differences in their philosophical
notions Jainism and Buddhism, which were originally both orders
of monks outside the pale of Brahmanism, present some re
semblance in outward appearance, and some European scholars
who became acquainted with Jainism through inadequate samples
of Jaina literature easily persuaded themselves that it was an off
shoot of Buddhism, and even Indians unacquainted with Jaina
literature are often found to commit the same mistake. But it
has now been proved beyond doubt that this idea is wrong
and Jainism is at least as old as Buddhism, The oldest Buddhist
works frequently mention the Jains as a rival sect, under their
old name Jjjgantha and their leader Nataputta Varddhamana
Mahavira, the last prophet of the Jains. The canonical books of
the Jains mention as contemporaries of Mahavira the same kings
as reigned during Buddha s career.
Thus Mahavira was a contemporary of Buddha, but unlike
Buddha he was neither the author of the religion nor the founder
of the sect, but a monk who having espoused the Jaina creed
afterwards became the seer and the last prophet (Tlrtharikara) of
Jainism 1 . His predecessor ParSva, the last Tlrtharikara but one,
is said to have died 250 years before Mahavira, while Parsva s
predecessor Aristanemi is said to have died 84,000 years before
Mahavlra s Nirvana. The story in Uttarddkyayan&sutra that a
disciple of ParSva met a disciple of Mahavira and brought about
the union of the old Jainism and that propounded by Mahavira
seems to suggest that this ParsVa was probably a historical person.
According to the belief of the orthodox Jains, the Jaina religion
is eternal, and it has been revealed again and again in every one
of the endless succeeding periods of the world by innumerable
Tlrtharikaras. In the present period the first Tlrtharikara was
Rsabha and the last, the 24th, was Vardham5na Mahavira. All
1 See Jacobi s article on Jainism, E. R. .
170 The Jaina Philosophy [CH.
Tlrtharikaras have reached moksa at their death, and they
neither care for nor have any influence on worldly affairs, but yet
they are regarded as "Gods" by the Jains and are worshipped 1
Two Sects of Jainism 2 .
There are two main sects of Jains, Svetambaras (wearers of
white cloths) and Digambaras (the naked). They are generally
agreed on all the fundamental principles of Jainism. The tenets
peculiar to the Digambaras are firstly that perfect saints such as
the Tlrtharikaras live without food, secondly that the embryo of
Mahavira was not removed from the womb of Devananda to that
of Trisala as the Svetambaras contend, thirdly that a monk
who owns any property and wears clothes cannot reach Moksa,
fourthly that no woman can reach Moksa 3 . The Digambaras
deny the canonical works of the Svetambaras and assert that
these had been lost immediately after Mahavira. The origin of
the Digambaras is attributed to Sivabhuti (A.D. 83) by the
Svetambaras as due to a schism in the old Svetambara church,
of which there had already been previous to that seven other
schisms. The Digambaras in their turn deny this, and say that
they themselves alone have preserved the original practices, and
that under Bhadrabahu, the eighth sage after Mahavira, the last
Tlrtharikara, there rose the sect of Ardhaphalakas with laxer
principles, from which developed the present sect of Svetambaras
(A.D. 80). The Digambaras having separated in early times
from the Svetambaras developed peculiar religious ceremonies of
their own, and have a different ecclesiastical and literary history,
though there is practically no difference about the main creed.
It may not be out of place here to mention that the Sanskrit
works of the Digambaras go back to a greater antiquity than
those of the Svetambaras, if we except the canonical books of
the latter. It may be noted in this connection that there developed
in later times about 84 different schools of Jainism differing from
one another only in minute details of conduct. These were called
gacchas, and the most important of these is the Kharatara Gaccha,
which had split into many minor gacchas. Both sects of Jains have
1 See " Digumbara Jain Iconography (\. A, xxxii [1903] p. 459" of J. Burgess, and
Biihler s "Specimens of Jina sculptures from Mathura," in Epigraphica Indica, II.
pp. 31 1 etc. See also Jacobi s article on Jainism, E. R. E.
2 See Jacohi s article on Jainism, E. R. E,
3 See Gunaratna s commentary on Jainism in Saddartanasamuccaya.
vi] Jama Literature 171
preserved a list of the succession of their teachers from Mahavlra
(sthavirdvali, pattdvali, gurvdvali) and also many legends about
them such as those in the Kalpasiitra, the Paris ista-parvan of
Hemacandra, etc.
The Canonical and other Literature of the Jains.
According to the Jains there were originally two kinds of
sacred books, the fourteen Purvas and the eleven Arigas. The
Purvas continued to be transmitted for some time but were
gradually lost. The works known as the eleven Arigas are now
the oldest parts of the existing Jain canon. The names of these
are Acdra, Sutrakrta, Sthdna, Samavdya Bhagavati, Jndtadhar^
makathds, Updsakadasds, Antakrtadasds Anuttaraupapdtikadasds,
Prasnavydkarana, Vipdka. In addition to these there are the twelve
Updngas 1 , the ten Prakirnas*, six Chedasutras 3 , Ndndl and Anu-
yogadvdra and four Mulasutras (Uttarddhyayana, Avasyaka^
Dasavaikdlika, and Pindaniryukti], The Digambaras however
assert that these original works have all been lost, and that the
present works which pass by the old names are spurious. The
original language of these according to the Jains was Ardhama-
gadhl, but these suffered attempts at modernization and it is best
to call the language of the sacred texts Jaina Prakrit and that
of the later works Jaina Maharastn. A large literature of glosses
and commentaries has grown up round the sacred texts. And
besides these, the Jains possess separate works, which contain
systematic expositions of their faith in Prakrit and Sanskrit.
Many commentaries have also been written upon these indepen
dent treatises. One of the oldest of these treatises is Umasvati s
Tattvarthadhigamasutra (1-85 A.D. ). Some of the most important
later Jaina works on which this chapter is based are Visesdva-
syakabhdsya, Jaina Tarkavdrttika, with the commentary of
antyacaryya, Dravyasamgraha of Nemicandra (1150 A.D.),
Syddvddamanjari of Mallisena (1292 A.D.), Nydydvatdra of
Siddhasena Divakara (533 A.D.), Partksdmukhasutralaghuvrtti of
Anantavlryya (1039 A.D.), Prameyakamalamdrtanda of Prabha-
1 Aupafidttka, Rajapratnlya, Jivdbhigama, Prajn&pana, [ambudvipaprajnapti,
Candraprajnapti, Suryaprajnapti, Niraydvali, fCalpdvatamsikd, Puspikd, Puspaculikd,
Vrsnidcdas.
3 CatuhSarana, Samstdra, Aturapratydkhydna, Bhaktdparijnd, Tandulavaiydlf,
Canddvija, Devendraslava, Ganivija, Mahapratydkhydna, Virastava.
3 NiJitAa, Mahdniiitha, Vyavahdra, Datairutaskandha, Brhatkalpa, Pancakalpa,
172 The Jaina Philosophy [CH.
candra(825 A.D.), Yogasastrasi Hemacandra(io88-i i72A.D.),and
Pramdnanayatattvdlokdlamkdra of Deva Suri (1086-1 169 A.D.).
I am indebted for these dates to Vidyabhusana s Indian Logic.
It may here be mentioned that the Jains also possess a secular
literature of their own in poetry and prose, both Sanskrit and
Prakrit. There are also many moral tales (e.g. Samardicca-kahd,
Upamitabhavaprapanca-kathd in Prakrit, and the Yasastilaka of
Somadevaand Dhanapala s Tilakamanjarl}; Jaina Sanskrit poems
both in the Purana and Kavya style and hymns in Prakrit and
Sanskrit are also very numerous. There are also many Jaina
dramas. The Jaina authors have also contributed many works,
original treatises as well as commentaries, to the scientific litera
ture of India in its various branches: grammar, biography, metrics,
poetics, philosophy, etc. The contributions of the Jains to logic
deserve special notice 1 .
Some General Characteristics of the Jains.
The Jains exist only in India and their number is a little less
than a million and a half. The Digambaras are found chiefly in
Southern India but also in the North, in the North-western pro
vinces, Eastern Rajputana and the Punjab. The head-quarters of
the Svetambaras are in Gujarat and Western Rajputana, but they
are to be found also all over Northern and Central India.
The outfit of a monk, as Jacobi describes it, is restricted to
bare necessaries, and these he must beg clothes, a blanket, an alms-
bowl, a stick, a broom to sweep the ground, a piece of cloth to cover
his mouth when speaking lest insects should enter it 2 . The outfit of
nuns is the same except that they have additional clothes. The
Digambaras have a similar outfit, but keep no clothes, use brooms
of peacock s feathers or hairs of the tail of a cow (cdmara) 3 . The
monks shave the head or remove the hair by plucking it out The
latter method of getting rid of the hair is to be preferred, and is
regarded sometimes as an essential rite. The duties of monks
are very hard. They should sleep only three hours and spend
the rest of the time in repenting of and expiating sins, meditating,
studying, begging alms (in the afternoon), and careful inspection of
their clothes and other things for the removal of insects. The lay
men should try to approach the ideal of conduct of the monks
1 See Jacobi s article on Jainism, E. R. . a See Jacobi, loc. cit.
3 See Saddartanasamuccaya, chapter IV.
vi] Mahavtra 173
by taking upon themselves particular vows, and the monks are
required to deliver sermons and explain the sacred texts in
the upasrayas (separate buildings for monks like the Buddhist
viharas). The principle of extreme carefulness not to destroy any
living being has been in monastic life carried out to its very
last consequences, and has shaped the conduct of the laity in a
great measure. No layman will intentionally kill any living being,
not even an insect, however troublesome. He will remove it care
fully without hurting it. The principle of not hurting any living
being thus bars them from many professions such as agriculture,
etc., and has thrust them into commerce 1 .
Life of Mahavira.
Mahavlra, the last prophet of the Jains, was a Ksattriya of
the Jftata clan and a native of Vaisali (modern Besarh, 27 miles
north of Patna). He was the second son of Siddhartha and Trisala.
The ^vetambaras maintain that the embryo of the Tlrthahkara
which first entered the womb of the Brahmin lady Devananda
was then transferred to the womb of Trisala. This story the
Digambaras do not believe as we have already seen. His parents
were the worshippers of Parsva and gave him the name Varddha-
mana (Vlra or Mahavlra). He married Yasoda and had a daughter
by her. In his thirtieth year his parents died and with the per
mission of his brother Nandivardhana he became a monk. After
twelve years of self-mortification and meditation he attained
omniscience (kevala, cf. bodhi of the Buddhists). He lived to
preach for forty-two years more, and attained moksa (emanci
pation) some years before Buddha in about 480 B.C. 8 .
The Fundamental Ideas of Jaina Ontology.
A thing (such as clay) is seen to assume various shapes and
to undergo diverse changes (such as the form of a jug, or
pan, etc.), and we have seen that the Chandogya Upanisad held
that since in all changes the clay-matter remained permanent,
that alone was true, whereas the changes of form and state
were but appearances, the nature of which cannot be rationally
1 See Jacobi s article on Jainism, E. R. .
* See Hoernle s translation of Uvasagadasao, Jacobi, loc. ctt., and Hoernle s article
on the Ajlvakas, E. R. E. The S-ivetambaras, however, say that this date was 527 B.C.,
and the Digambaras place it eighteen years later.
174 The Jaina Philosophy [CH.
demonstrated or explained. The unchangeable substance (e.g.
the clay-matter) alone is true, and the changing forms are mere
illusions of the senses, mere objects of name (ndma-rupay. What
we call tangibility, visibility, or other sense-qualities, have no real
existence, for they are always changing, and are like mere phan
toms of which no conception can be made by the light of reason.
The Buddhists hold that changing qualities can alone be per
ceived and that there is no unchanging substance behind them.
What we perceive as clay is but some specific quality, what we
perceive as jug is also some quality. Apart from these qualities
we do not perceive any qualitiless substance, which the Upan-
isads regard as permanent and unchangeable. The permanent
and unchangeable substance is thus a mere fiction of ignorance,
as there are only the passing collocations of qualities. Qualities
do not imply that there are substances to which they adhere,
for the so-called pure substance does not exist, as it can neither
be perceived by the senses nor inferred. There are only the
momentary passing qualities. We should regard each change of
quality as a new existence.
The Jains we know were the contemporaries of Buddha and
possibly of some of the Upanisads too, and they had also a solu
tion to offer. They held that it was not true that substance
alone was true and qualities were mere false and illusory ap
pearances. Further it was not true as the Buddhists said that
there was no permanent substance but merely the change of
passing qualities, for both these represent two extreme views
and are contrary to experience. Both of them, however, contain
some elements of truth but not the whole truth as given in
experience. Experience shows that in all changes there are
three elements: (i) that some collocations of qualities appear
to remain unchanged; (2) that some new qualities are generated ;
(3) that some old qualities are destroyed. It is true that qualities
of things are changing every minute, but all qualities are not
changing. Thus when a jug is made, it means that the clay-lump
has been destroyed, a jug has been generated and the clay is
permanent, i.e. all production means that some old qualities have
been lost, some new ones brought in, and there is some part in
it which is permanent The clay has become lost in some form,
has generated itself in another, and remained permanent in still
1 See Chandogya, vi. i.
vi] Relative Pluralism 175
another form. It is by virtue of these unchanged qualities that a
thing is said to be permanent though undergoing change. Thus
when a lump of gold is turned into a rod or a ring, all the specific
qualities which come under the connotation of the word "gold"
are seen to continue, though the forms are successively changed,
and with each such change some of its qualities are lost and some
new ones are acquired. Such being the case, the truth comes to
this, that there is always a permanent entity as represented by the
permanence of such qualities as lead us to call it a substance in
spite of all its diverse changes. The nature of being (sat) then is
neither the absolutely unchangeable, nor the momentary changing
qualities or existences, but involves them both. Being then, as is
testified by experience, is that which involves a permanent unit,
which is incessantly every moment losing some qualities and
gaining new ones. The notion of being involves a permanent
(dhruva) accession of some new qualities (utpadd) and loss of
some old qualities (vyaydy. The solution of Jainism is thus a re
conciliation of the two extremes of Vedantism and Buddhism on
grounds of common-sense experience.
The Doctrine of Relative Pluralism (anekantavada).
This conception of being as the union of the permanent and
change brings us naturally to the doctrine of Anekantavada or
what we may call relative pluralism as against the extreme abso
lutism of the Upanisads and the pluralism of the Buddhists.
The Jains regarded all things as anekdnta (na-ekdnta\ or in
other words they held that nothing could be affirmed absolutely,
as all affirmations were true only under certain conditions and
limitations. Thus speaking of a gold jug, we see that its exist
ence as a substance (dravyd) is of the nature of a collocation
of atoms and not as any other substance such as space (akdsa),
i.e. a gold jug is a dravya only in one sense of the term and
not in every sense; so it is a dravya in the sense that it is a
collocation of atoms and not a dravya in the sense of space or
time (kdla). It is thus both a dravya and not a dravya at one
and the same time. Again it is atomic in the sense that it is a
composite of earth-atoms and not atomic in the sense that it is
1 See Tattvdrthadkigamasutra, and Gunaratna s treatment of Jainism in Saddar-
ianasamuccaya.
176 The jaina Philosophy [CH.
not a composite of water-atoms. Again it is a composite of earth-
atoms only in the sense that gold is a metallic modification of
earth, and not any other modification of earth as clay or stone.
Its being constituted of metal-atoms is again true in the sense
that it is made up of gold-atoms and not of iron-atoms. It
is made up again of gold-atoms in the sense of melted and un
sullied gold and not as gold in the natural condition. It is again
made up of such unsullied and melted gold as has been hammered
and shaped by the goldsmith Devadatta and not by Yajnadatta.
Its being made up of atoms conditioned as above is again only
true in the sense that the collocation has been shaped as a jug
and not as a pot and so on. Thus proceeding in a similar manner
the Jains say that all affirmations are true of a thing only in a
certain limited sense. All things (vastu) thus possess an infinite
number of qualities (anantadharmdtmakam vastu}, each of which
can only be affirmed in a particular sense. Such an ordinary thing
as a jug will be found to be the object of an infinite number of
affirmations and the possessor of an infinite number 6f qualities
from infinite points of view, which are all true in certain restricted
senses and not absolutely 1 . Thus in the positive relation riches
cannot be affirmed of poverty but in the negative relation such
an affirmation is possible as when we say "the poor man has no
riches." The poor man possesses riches not in a positive but in
a negative way. Thus in some relation or other anything may be
affirmed of any other thing, and again in other relations the very
same thing cannot be affirmed of it. The different standpoints
from which things (though possessed of infinite determinations)
can be spoken of as possessing this or that quality or as ap
pearing in relation to this or that, are technically called naya*.
The Doctrine of Nayas.
In framing judgments about things there are two ways open
to us, firstly we may notice the manifold qualities and character
istics of anything but view them as unified in the thing; thus when
we say "this is a book" we do not look at its characteristic
qualities as being different from it, but rather the qualities or
characteristics are perceived as having no separate existence from
1 See Gunaratna on Jainaniata in SaddarSanasamuccaya, pp. 211, etc., and also
Tattvarthadhigamasiitra.
2 See Tattvarthadhigamasutra, and Vitesavatyaka bhdsya, pp. 895-923.
vi] Standpoints of Judgment 177
the thing. Secondly we may notice the qualities separately and
regard the thing as a mere non-existent fiction (cf. the Buddhist
view); thus I may speak of the different qualities of the book
separately and hold that the qualities of things are alone percep
tible and the book apart from these cannot be found. These two
points of view are respectively called dravyanaya&fr&paryayanaya>.
The dravyanaya again shows itself in three forms, and paryaya-
naya in four forms, of which the first form only is important for
our purposes, the other three being important rather from the
point of view of grammar and language had better be omitted
here. The three nayas under dravyanaya are called naigama-naya,
samgraha-naya and vyavahara-naya.
When we speak of a thing from a purely common sense point
of view, we do not make our ideas clear or precise. Thus I may
hold a book in my hand and when asked whether my hands are
empty, I may say, no, I have something in my hand, or I may say,
I have a book in my hand. It is evident that in the first answer
I looked at the book from the widest and most general point of
view as a "thing," whereas in the second I looked at it in its
special existence as a book. Again I may be reading a page of
a book, and I may say I am reading a book, but in reality I was
reading only one of the pages of the book. I may be scribbling
on loose sheets, and may say this is my book on Jaina philosophy,
whereas in reality there were no books but merely some loose
sheets. This looking at things from the loose common sense view,
in which we do not consider them from the point of view of their
most general characteristic as "being" or as any of their special
characteristics, but simply as they appear at first sight, is techni
cally called the naigama standpoint. This empirical view probably
proceeds on the assumption that a thing possesses the most
general as well as the most special qualities, and hence we may
lay stress on any one of these at any time and ignore the other
ones. This is the point of view from which according to the
Jains the Nyaya and Vaiesika schools interpret experience.
Samgraha-naya is the looking at things merely from the
most general point of view. Thus we may speak of all individual
things from their most general and fundamental aspect as "being."
This according to the Jains is the Vedanta way of looking at
things.
1 Syadvddamanjart, pp. 171-173.
D. 12
178 The Jaina Philosophy [CH.
The vyavahSra-naya standpoint holds that the real essence
of things is to be regarded from the point of view of actual prac
tical experience of the thing, which unifies within it some general
as well as some special traits, which has been existing from past
times and remain in the future, but yet suffer trifling changes
all the while, changes which are serviceable to us in a thousand
ways. Thus a "book" has no doubt some general traits, shared
by all books, but it has some special traits as well. Its atoms are
continually suffering some displacement and rearrangement, but
yet it has been existing as a book for some time past and will
exist for some time in the future as well. All these characteristics,
go to make up the essence of the "book" of our everyday ex
perience, and none of these can be separated and held up as being
the concept of a "book." This according to the Jains is the
Samkhya way of looking at things.
The first view of paryaya-naya called rjusutra is the Buddhist
view which does not believe in the existence of the thing in the
past or in the future, but holds that a thing is a mere conglomera
tion of characteristics which may be said to produce effects at
any given moment. At each new moment there are new colloca
tions of new qualities and it is these which may be regarded as
the true essence of our notion of things 1 .
The nayas as we have already said are but points of view, or
aspects of looking at things, and as such are infinite in number.
The above four represent only a broad classification of these. The
Jains hold that the Nyaya-Vais"esika, the Vedanta, the Samkhya,
and the Buddhist, have each tried to interpret and systematize
experience from one of the above four points of view, and each re
gards the interpretation from his point of view as being absolutely
true to the exclusion of all other points of view. This is their error
(naydbhdsa\ for each standpoint represents only one of the many
points of view from which a thing can be looked at. The affirma
tions from any point of view are thus true in a limited sense and
under limited conditions. Infinite numbers of affirmations may
be made of things from infinite points of view. Affirmations or
judgments according to any naya or standpoint cannot therefore
be absolute, for even contrary affirmations of the very selfsame
1 The other standpoints of paryaya-naya, which represent grammatical and lin
guistic points of view, are fabda-naya, samabhirudha-naya, and cvambhuta-naya. See
Viies&vaiyaka bhdsya, pp. 895-923.
vi] Syadvada 179
things may be held to be true from other points of view. The
truth of each affirmation is thus only conditional, and incon
ceivable from the absolute point of view. To guarantee correctness
therefore each affirmation should be preceded by the phrase sydt
(may be). This will indicate that the affirmation is only relative,
made somehow, from some point of view and under some reser
vations and not in any sense absolute. There is no judgment
which is absolutely true, and no judgment which is absolutely
false. All judgments are true in some sense and false in another.
This brings us to the famous Jaina doctrine of Syadvada 1 .
The Doctrine of Syadvada.
The doctrine of Syadvada holds that since the most contrary
characteristics of infinite variety may be associated with a thing,
affirmation made from whatever standpoint (nayd) cannot be re
garded as absolute. All affirmations are true (in some syddasti or
"may be it is" sense); all affirmations are false in some sense;
all affirmations are indefinite or inconceivable in some sense
(syddavaktavya) ; all affirmations are true as well as false in some
sense (syddasti sydnndsti) ; all affirmations are true as well as in
definite (syddasti cdvaktavyascd) ; all affirmations are false as well
as indefinite; all affirmations are true and false and indefinite in
some sense (syddasti sydnndsti syddavaktavyasca). Thus we may
say "the jug is" or the jug has being, but it is more correct to
say explicitly that "may be (sydt) that the jug is," otherwise if
"being" here is taken absolutely of any and every kind of being,
it might also mean that there is a lump of clay or a pillar, or a
cloth or any other thing. The existence here is limited and defined
by the form of the jug. "The jug is" does not mean absolute
existence but a limited kind of existence as determined by the
form of the jug, "The jug is" thus means that a limited kind of
existence, namely the jug-existence is affirmed and not existence
in general in the absolute or unlimited sense, for then the sentence
"the jug is" might as well mean "the clay is," "the tree is," "the
cloth is," etc. Again the existence of the jug is determined by the
negation of all other things in the world ; each quality or charac
teristic (such as red colour) of the jug is apprehended and defined
by the negation of all the infinite varieties (such as black, blue,
golden), etc., of its class, and it is by the combined negation of all
1 See VifesavaSyaka bhdsya, pp. 895, etc., and Syadvadamanjari, pp. 170, etc.
12 2
180 The Jaina Philosophy [CH.
the infinite number of characteristics or qualities other than those
constituting the jug that a jug may be apprehended or defined.
What we call the being of the jug is thus the non-being of all the
rest except itself. Thus though looked at from one point of view
the judgment "the jug is" may mean affirmation of being, looked
at from another point of view it means an affirmation of non-being
(of all other objects). Thus of the judgment "the jug is" one may
say, may be it is an affirmation of being (syddasti), may be it is a
negation of being (sydnndsti}; or I may proceed in quite another
way and say that "the jug is" means "this jug is here," which
naturally indicates that "this jug is not there" and thus the judg
ment "the jug is" (i.e. is here) also means that "the jug is not
there," and so we see that the affirmation of the being of the jug
is true only of this place and false of another, and this justifies us
in saying that "may be that in some sense the jug is," and "may
be in some sense that the jug is not." Combining these two
aspects we may say that in some sense "may be that the jug is,"
and in some sense "may be that the jug is not." We understood
here that if we put emphasis on the side of the characteristics
constituting being, we may say "the jug is," but if we put emphasis
on the other side, we may as well say "the jug is not." Both the
affirmations hold good of the jug according as the emphasis is
put on either side. But if without emphasis on either side we try
to comprehend the two opposite and contradictory judgments
regarding the jug, we see that the nature of the jug or of the ex
istence of the jug is indefinite, unspeakable and inconceivable
avaktavya, for how can we affirm both being and non-being of
the same thing, and yet such is the nature of things that we cannot
but do it. Thus all affirmations are true, are not true, are both
true and untrue, and are thus unspeakable, inconceivable, and
indefinite. Combining these four again we derive another three,
(i) that in some sense it may be that the jug is, and (2) is yet
unspeakable, or (3) that the jug is not and is unspeakable, or
finally that the jug is, is not, and is unspeakable. Thus the Jains
hold that no affirmation, or judgment, is absolute in its nature, each
is true in its own limited sense only, and for each one of them any
of the above seven alternatives (technically called saptabhangl}
holds good 1 . The Jains say that other Indian systems each from
its own point of view asserts itself to be the absolute and the only
1 See Syadvadamanjari, with Hemacandra s commentary, pp. 166, etc.
vi] Relativity of Judgments 181
point of view. They do not perceive that the nature of reality
is such that the truth of any assertion is merely conditional,
and holds good only in certain conditions, circumstances, or
senses (upddhi). It is thus impossible to make any affirmation
which is universally and absolutely valid. For a contrary or
contradictory affirmation will always be found to hold good of
any judgment in some sense or other. As all reality is partly
permanent and partly exposed to change of the form of losing
and gaining old and new qualities, and is thus relatively perma
nent and changeful, so all our affirmations regarding truth are also
only relatively valid and invalid. Being, non-being and indefinite,
the three categories of logic, are all equally available in some sense
or other in all their permutations for any and every kind of
judgment. There is no universal and absolute position or negation,
and all judgments are valid only conditionally. The relation of
the naya doctrine with the syadvada doctrine is therefore this, that
for any judgment according to any and every naya there are as
many alternatives as are indicated by syadvada. The validity of
such a judgment is therefore only conditional. If this is borne
in mind when making any judgment according to any naya,
the naya is rightly used. If, however, the judgments are made ab
solutely according to any particular naya without any reference to
other nayas as required by the syadvada doctrine the nayas are
wrongly used as in the case of other systems, and then such
judgments are false and should therefore be called false nayas
(naydbhdsa) \
Knowledge, its value for us.
The Buddhist Dharmottara in his commentary on Nydyabindu
says that people who are anxious to fulfil some purpose or end in
which they are interested, value the knowledge which helps them
to attain that purpose. It is because knowledge is thus found
to be useful and sought by men that philosophy takes upon it the
task of examining the nature of true knowledge (samyagjiidna or
pramdna). The main test of true knowledge is that it helps us
to attain our purpose. The Jains also are in general agreement
with the above view of knowledge of the Buddhists 2 . They also
1 The earliest mention of the doctrine of syadvada and saptabhahgi probably occurs
in Bhadrabahu s (433-357 B.C.) commentary Sutrakrtanganiryukti.
2 See Pramana-naya-tattvalokalamkdra (Benares), p. 16 , also Partksa-mukha-
sutra-vrtti (Asiatic Society), ch. I.
1 82 The Jaina Philosophy [CH.
say that knowledge is not to be valued for its own sake. The
validity (prdmdnyd) of anything consists in this, that it directly
helps us to get what is good for us and to avoid what is bad
for us. Knowledge alone has this capacity, for by it we can
adapt ourselves to our environments and try to acquire what
is good for us and avoid what is bad 1 . The conditions that
lead to the production of such knowledge (such as the presence
of full light and proximity to the eye in the case of seeing an
object by visual perception) have but little relevancy in this con
nection. For we are not concerned with how a cognition is
produced, as it can be of no help to us in serving our purposes.
It is enough for us to know that external objects under certain
conditions assume such a special fitness (yogyatd} that we can
have knowledge of them. We have no guarantee that they
generate knowledge in us, for we are only aware that under
certain conditions we know a thing, whereas under other con
ditions we do not know it 2 . The enquiry as to the nature of the
special fitness of things which makes knowledge of them pos
sible does not concern us. Those conditions which confer such
a special fitness on things as to render them perceivable have but
little to do with us; for our purposes which consist only in the
acquirement of good and avoidance of evil, can only be served by
knowledge and not by those conditions of external objects.
Knowledge reveals our own self as a knowing subject as well
as the objects that are known by us. We have no reason to
suppose (like the Buddhists) that all knowledge by perception of
external objects is in the first instance indefinite and indeterminate,
and that all our determinate notions of form, colour, size and other
characteristics of the thing are not directly given in our perceptual
experience, but are derived only by imagination (utpreksd), and
that therefore true perceptual knowledge only certifies the validity
of the indefinite and indeterminate crude sense data (nirvikalpa
jfidna). Experience shows that true knowledge on the one hand
reveals us as subjects or knowers, and on the other hand gives
a correct sketch of the external objects in all the diversity of
their characteristics. It is for this reason that knowledge is our
immediate and most prominent means of serving our purposes.
1 Pramdna-naya-tattvdlokdlamkara, p. 26.
2 See Pariksa-mukha-sutra, II. 9, and its vrtti, and also the concluding vrtti of
ch. II.
vi] Knowledge 183
Of course knowledge cannot directly and immediately bring to
us the good we want, but since it faithfully communicates to us
the nature of the objects around us, it renders our actions for the
attainment of good and the avoidance of evil, possible; for if
knowledge did not possess these functions, this would have been
impossible. The validity of knowledge thus consists in this, that
it is the most direct, immediate, and indispensable means for
serving our purposes. So long as any knowledge is uncontra-
dicted it should be held as true. False knowledge is that
which represents things in relations in which they do not exist.
When a rope in a badly lighted place gives rise to the illusion of
a snake, the illusion consists in taking the rope to be a snake, i.e.
perceiving a snake where it does not exist. Snakes exist and
ropes also exist, there is no untruth in that 1 . The error thus con
sists in this, that the snake is perceived where the rope exists.
The perception of a snake under relations and environments in
which it was not then existing is what is meant by error here.
What was at first perceived as a snake was later on contradicted
and thus found false. Falsehood therefore consists in the mis
representation of objective facts in experience. True knowledge
therefore is that which gives such a correct and faithful repre
sentation of its object as is never afterwards found to be contra
dicted. Thus knowledge when imparted directly in association
with the organs in sense-perception is very clear, vivid, and
distinct, and is called perceptional (pralyaksa); when attained
otherwise the knowledge is not so clear and vivid and is then
called non-perceptional (parok$a*).
Theory of Perception.
The main difference of the Jains from the Buddhists in the
theory of perception lies, as we have already seen, in this, that the
Jains think that perception (pratyak^a) reveals to us the external
objects just as they are with most of their diverse characteristics of
colour, form, etc., and also in this, that knowledge arises in the soul
1 Illusion consists in attributing such spatial, temporal or other kinds of relations
to the objects of our judgment as do not actually exist, but the objects themselves
actually exist in other relations. When I mistake the rope for the snake, the snake
actually exists though its relationing with the " this " as " this is a snake " does not
exist, for the snake is not the rope. This illusion is thus called satkhyati or misrelationing
of existents (sat).
a See Jaina-tarka-varttika of Siddhasena, ch. I., and vrtti by Santyacarya,
Pramananayatattvalokalamkara, ch. I., Pariksd-mukha-sutra-vrtti, ch. I.
184 The Jaina Philosophy [CH.
from within it as if by removing a veil which had been covering it
before. Objects are also not mere forms of knowledge (as the Vi-
jflanavadin Buddhist thinks) but are actually existing. Knowledge
of external objects by perception is gained through the senses.
The exterior physical sense such as the eye must be distinguished
from the invisible faculty or power of vision of the soul, which
alone deserves the name of sense. We have five such cognitive
senses. But the Jains think that since by our experience we are
only aware of five kinds of sense knowledge corresponding to the
five senses, it is better to say that it is the "self" which gains of
itself those different kinds of sense-knowledge in association with
those exterior senses as if by removal of a covering, on account
of the existence of which the knowledge could not reveal itself
before. The process of external perception does not thus involve
the exercise of any separate and distinct sense, though the rise
of the sense-knowledge in the soul takes place in association with
the particular sense-organ such as eye, etc. The soul is in touch
with all parts of the body, and visual knowledge is that knowledge
which is generated in the soul through that part of it which is
associated with, or is in touch with the eye. To take an example,
I look before me and see a rose. Before looking at it the know
ledge of rose was in me, but only in a covered condition, and
hence could not get itself manifested. The act of looking at the
rose means that such a fitness has come into the rose and into
myself that the rose is made visible, and the veil over my know
ledge of rose is removed. When visual knowledge arises, this
happens in association with the eye ; I say that I see through
the visual sense, whereas in reality experience shows that I have
only a knowledge of the visual type (associated with eye). As
experience does not reveal the separate senses, it is unwarrantable
to assert that they have an existence apart from the self. Pro
ceeding in a similar way the Jains discard the separate existence
of manas (mind-organ) also, for manas also is not given in ex
perience, and the hypothesis of its existence is unnecessary, as
self alone can serve its purpose 1 . Perception of an object means
1 Tanna indriyam bhautikam kim lu atma ca indriyam.. .anupahatataksuradidesesu
eva atmanah karmaksayopcdamastenasthagitagavaksattilyani caksuradini upakaranani.
faina-Vattika-Vrtfi, n. p. 98. In many places, however, the five senses, such as
eye, ear, etc., are mentioned as senses, and living beings are often classified according
>o the number of senses they possess. (See Pramanamimamsa. See also Tatlfartha-
Jhii^at? asutra, ch. n. etc.) But this is with reference to the sense organs. The denial
vi] Non-perceptual Knowledge 185
that the veil of ignorance upon the "self" regarding the object has
been removed. Inwardly this removal is determined by the
karma of the individual, outwardly it is determined by the pre
sence of the object of perception, light, the capacity of the sense
organs, and such other conditions. Contrary to the Buddhists
and many other Indian systems, the Jains denied the existence
of any nirvikalpa (indeterminate) stage preceding the final savi-
kalpa (determinate) stage of perception. There was a direct
revelation of objects from within and no indeterminate sense-
materials were necessary for the development of determinate
perceptions. We must contrast this with the Buddhists who
regarded that the first stage consisting of the presentation of in
determinate sense materials was the only valid part of perception.
The determinate stage with them is the result of the application
of mental categories, such as imagination, memory, etc., and hence
does not truly represent the presentative part 1 .
Non-Perceptual Knowledge.
Non-perceptual knowledge (parokfa) differs from pratyaksa
in this, that it does not give us so vivid a picture of objects as the
latter. Since the Jains do not admit that the senses had any func
tion in determining the cognitions of the soul, the only distinction
they could draw between perception and other forms of knowledge
was that the knowledge of the former kind (perception) gave us
clearer features and characteristics of objects than the latter.
Paroksa thus includes inference, recognition, implication, memory,
etc. ; and this knowledge is decidedly less vivid than perception.
Regarding inference, the Jains hold that it is unnecessary to
have five propositions, such as: (i) "the hill is fiery," (2) "because
of smoke," (3) "wherever there is smoke there is fire, such as the
kitchen," (4) "this hill is smoky," (5) "therefore it is fiery," called
respectively pralijnd, hetu, drstdnla, upanaya and nigamana, ex
cept for the purpose of explicitness. It is only the first two
propositions which actually enter into the inferential process
(Prameyakamalamdrtanda, pp. 108, 109). When we make an
of separate senses is with reference to admitting them as entities or capacities having
a distinct and separate category of existence from the soul. The sense organs are like
windows for the soul to look out. They cannot thus modify the sense-knowledge
which rises in the soul hy inward determination ; for it is already existent in it ; the
perceptual process only means that the veil which was observing it is removed.
1 Prameyakamalamartanda, pp. 8-n.
1 86 The Jaina Philosophy [CH.
inference we do not proceed through the five propositions as
above. They who know that the reason is inseparably connected
with the probandum either as coexistence (sahabhdva) or as in
variable antecedence (kramabhdva) will from the mere statement
of the existence of the reason (e.g. smoke) in the hill jump to the
conclusion that the hill has got fire. A syllogism consisting of
five propositions is rather for explaining the matter to a child
than for representing the actual state of the mind in making an
inference 1 .
As regards proof by testimony the Jains do not admit the
authority of the Vedas, but believe that the Jaina scriptures give
us right knowledge, for these are the utterances of persons who
have lived a worldly life but afterwards by right actions and
right knowledge have conquered all passions and removed all
ignorance 2 .
Knowledge as Revelation.
The Buddhists had affirmed that the proof of the existence of
anything depended upon the effect that it could produce on us.
That which could produce any effect on us was existent, and that
1 As regards concomitance (vydpti) some of the Jaina logicians like the Buddhists
prefer antarvyapti (between smoke and fire) to bahirvyapti (the place containing smoke
with the place containing fire). They also divide inference into two classes, svartha-
numdna for one s own self and pardrthdnumdna for convincing others. It may rot
be out of place to note that the earliest Jaina view as maintained by Bhadrabahu in his
Das"avaikalikaniryukti was in favour of ten propositions for making an inference ;
(i) Pratijnd (e.g. non-injury to life is the greatest virtue), (2) Pratijftavibhakti (non-in
jury to life is the greatest virtue according to Jaina scriptures), (3) Hetu (because those
who adhere to non-injury are loved by gods and it is meritorious to do them honour),
(4) Hetu vibhakti (those who do so are the only persons who can live in the highest
places of virtue), (5) Vipaksa (but even by doing injury one may prosper and even by
reviling Jaina scriptures one may attain merit as is the case with Brahmins), (6) Vipaksa
pratisedha (it is not so, it is impossible that those who despise Jaina scriptures should
be loved by gods or should deserve honour), (7) Drstdnta (the Arhats take food from
householders as they do not like to cook themselves for fear of killing insects), (8) As-
arika (but the sins of the householders should touch the arhats, for they cook for them),
(9) Asankdpratisedha (this cannot be, for the arhats go to certain houses unexpectedly,
so it could not be said that the cooking was undertaken for them), (10) Naigamana
(non-injury is therefore the greatest virtue) (Vidyabhusana s Indian Logic). These are
persuasive statements which are often actually adopted in a discussion, but from a
formal point of view many of these are irrelevant. When Vatsyayana in his Nyaya-
sutrabkdsya, I. i. 32, says that Gautama introduced the doctrine of five propositions as
against the doctrine of ten propositions as held by other logicians, he probably had
this Jaina view in his mind.
2 See Jainatarkavdrttika, and Pariksaniukhasutravrtti, and Saddarfanasamuccaya
with Gunaratna on Jainism.
vi] Theory of Being 187
which could not non-existent. In fact production of effect was
with them the only definition of existence (being). Theoretically
each unit of effect being different from any other unit of effect,
they supposed that there was a succession of different units of
effect or, what is the same thing, acknowledged a succession of
new substances every moment. All things were thus momentary.
The Jains urged that the reason why the production of effect
may be regarded as the only proof of being is that we can assert
only that thing the existence of which is indicated by a corre
sponding experience. When we have a unit of experience we
suppose the existence of the object as its ground. This being so,
the theoretical analysis of the Buddhists that each unit of effect
produced in us is not exactly the same at each new point of time,
and that therefore all things are momentary, is fallacious; for ex
perience shows that not all of an object is found to be changing
every moment ; some part of it (e.g. gold in a gold ornament) is
found to remain permanent while other parts (e.g. its form as ear
rings or bangles) are seen to undergo change. How in the face
of such an experience can we assert that the whole thing vanishes
every moment and that new things are being renewed at each
succeeding moment? Hence leaving aside mere abstract and
unfounded speculations, if we look to experience we find that the
conception of being or existence involves a notion of permanence
associated with change parydya (acquirement of new qualities
and the loss of old ones). The Jains hold that the defects of other
systems lie in this, that they interpret experience only from one
particular standpoint (nayd) whereas they alone carefully weigh
experience from all points of view and acquiesce in the truths
indicated by it, not absolutely but under proper reservations and
limitations. The Jains hold that in formulating the doctrine of
arthakriydkdritva the Buddhists at first showed signs of starting
on their enquiry on the evidence of experience, but soon they
became one-sided in their analysis and indulged in unwarrantable
abstract speculations which went directly against experience.
Thus if we go by experience we can neither reject the self nor
the external world as some Buddhists did. Knowledge which
reveals to us the clear-cut features of the external world certifies
at the same time that such knowledge is part and parcel of myself
as the subject. Knowledge is thus felt to be an expression of my
own self. We do not perceive in experience that knowledge
1 88 The Jaina Philosophy [CH.
in us is generated by the external world, but there is in us the
rise of knowledge and of certain objects made known to us by it.
The rise of knowledge is thus only parallel to certain objective
collocations of things which somehow have the special fitness
that they and they alone are perceived at that particular moment.
Looked at from this point of view all our experiences are centred
in ourselves, for determined somehow, our experiences come to us
as modifications of our own self. Knowledge being a character
of the self, it shows itself as manifestations of the self independent
of the senses. No distinction should be made between a conscious
and an unconscious element in knowledge as Samkhya does. Nor
should knowledge be regarded as a copy of the objects which it
reveals, as the Sautrantikas think, for then by copying the materi
ality of the object, knowledge would itself become material.
Knowledge should thus be regarded as a formless quality of the
self revealing all objects by itself. But the Mlmamsa view that the
validity (pramanyd) of all knowledge is proved by knowledge it-
self (svatahprdmdnya) is wrong. Both logically and psychologically
the validity of knowledge depends upon outward correspondence
(sanivdda} with facts. But in those cases where by previous
knowledge of correspondence a right belief has been produced
there may be a psychological ascertainment of validity without
reference to objective facts (prdmdnyamutpattau parata eva
jnaptau svakdrye ca svatah paratasca abhydsdnabhydsdpeksayaj 1 .
The objective world exists as it is certified by experience. But
that it generates knowledge in us is an unwarrantable hypo
thesis, for knowledge appears as a revelation of our own self. This
brings us to a consideration of Jaina metaphysics.
The JIvas.
The Jains say that experience shows that all things may be
divided into the living (jtva) and the non-living (ajlva\ The
principle of life is entirely distinct from the body, and it is most
erroneous to think that life is either the product or the property
of the body 2 . It is on account of this life-principle that the body
appears to be living This principle is the soul. The soul is
directly perceived (by introspection) just as the external things
are. It is not a mere symbolical object indicated by a phrase or
1 Prameyakamalamdrtanifa, pp. 38-43.
2 See Jaina Vdrttika, p. 60.
vi] Souls 189
a description. This is directly against the view of the great
Mlmamsa authority Prabhakara 1 . The soul in its pure state is
possessed of infinite perception (ananta-darsand), infinite know
ledge (ananta-jftdna\ infinite bliss (ananta-sukhd) and infinite
power (ananta-vlrya)*. It is all perfect. Ordinarily however, with
the exception of a few released pure souls (mukta-jwd), all the
other jlvas (samsdriri) have all their purity and power covered with
a thin veil of karma matter which has been accumulating in them
from beginningless time. These souls are infinite in number. They
are substances and are eternal. They in reality occupy innumer
able space-points in our mundane world (lokdkdsa}, have a limited
size (madhyama-parimdna) and are neither all-pervasive (yibhii)
nor atomic (anu); it is on account of this that jwa is called
Jivdstikdya. The word astikdya means anything that occupies
space or has some pervasiveness; but these souls expand and
contract themselves according to the dimensions of the body
which they occupy at any time (bigger in the elephant and
smaller in the ant life). It is well to remember that according to
the Jains the soul occupies the whole of the body in which it
lives, so that from the tip of the hair to the nail of the foot,
wherever there may be any cause of sensation, it can at once feel
it. The manner in which the soul occupies the body is often ex
plained as being similar to the manner in which a lamp illumines
the whole room though remaining in one corner of the room. The
Jains divide the jlvas according to the number of sense-organs
they possess. The lowest class consists of plants, which possess
only the sense-organ of touch. The next higher class is that
of worms, which possess two sense-organs of touch and taste.
Next come the ants, etc., which possess touch, taste, and smell.
The next higher one that of bees, etc., possessing vision in
addition to touch, taste, and smell. The vertebrates possess all
the five sense-organs. The higher animals among these, namely
men, denizens of hell, and the gods possess in addition to these
an inner sense-organ namely manas by virtue of which they are
1 See Prameyakamalamartanda, p. 33.
2 The Jains distinguish between dariana a.ndjftana. Dars"ana is the knowledge of
things without their details, e.g. I see a cloth. Jnana means the knowledge of details,
e.g. I not only see the cloth, but know to whom it belongs, of what quality it is,
where it was prepared, etc. In all cognition we have first dars"ana and then jflana.
The pure souls possess infinite general perception of all things as well as infinite
knowledge of all things in all their details.
190 The Jaina Philosophy [CH.
called rational (samjniri) while the lower animals have no reason
and are called asamjnin.
Proceeding towards the lowest animal we find that the Jains
regard all the four elements (earth, water, air, fire) as being ani
mated by souls. Thus particles of earth, etc., are the bodies of
souls, called earth-lives, etc. These we may call elementary lives;
they live and die and are born again in another elementary body.
These elementary lives are either gross or subtle; in the latter case
they are invisible. The last class of one-organ lives are plants.
Of some plants each is the body of one soul only; but of other
plants, each is an aggregation of embodied souls, which have all
the functions of life such as respiration and nutrition in common.
Plants in which only one soul is embodied are always gross ; they
exist in the habitable part of the world only. But those plants
of which each is a colony of plant lives may also be subtle and
invisible, and in that case they are distributed all over the world.
The whole universe is full of minute beings called nigodas; they
are groups of infinite number of souls forming very small clusters,
having respiration and nutrition in common and experiencing ex
treme pains. The whole space of the world is closely packed with
them like a box filled with powder. The nigodas furnish the supply
of souls in place of those that have reached Moksa. But an
infinitesimally small fraction of one single nigoda has sufficed to
replace the vacancy caused in the world by the Nirvana of all the
souls that have been liberated from beginningless past down to
the present. Thus it is evident the samsara will never be empty
of living beings. Those of the nigodas who long for development
come out and contiune their course of progress through successive
stages 1 .
Karma Theory.
It is on account of their merits or demerits that the jlvas are
born as gods, men, animals, or denizens of hell. We have already
noticed in Chapter III that the cause of the embodiment of soul
is the presence in it of karma matter. The natural perfections of
the pure soul are sullied by the different kinds of karma matter.
Those which obscure right knowledge of details (jndna) are
called jndnavaraniya, those which obscure right perception
(darsana) as in sleep are called darsandvaraniya, those which
1 See Jacobi s article on Jainism, E. R. ., and Lokaprakdfa, vi. pp. 31 ff.
vi] Effects of Karma 191
obscure the bliss-nature of the soul and thus produce pleasure and
pain are vedaniya, and those which obscure the right attitude of the
soul towards faith and right conduct mohaniya 1 . In addition to
these four kinds of karma there are other four kinds of karma which
determine (i) the length of life in any birth, (2) the peculiar body
with its general and special qualities and faculties, (3) the nation
ality, caste, family, social standing, etc., (4) the inborn energy of the
soul by the obstruction of which it prevents the doing of a good
action when there is a desire to do it. These are respectively called
(l) dynska karma, (2) ndma karma, (3) gotra karma, (4) antardya
karma. By our actions of mind, speech and body, we are con
tinually producing certain subtle karma matter which in the first
instance is called bhdva karma, which transforms itself into dravya
karma and pours itself into the soul and sticks there by coming
into contact with the passions (kasdya} of the soul. These act like
viscous substances in retaining the inpouring karma matter. This
matter acts in eight different ways and it is accordingly divided
into eight classes, as we have already noticed. This karma is the
cause of bondage and sorrow. According as good or bad karma
matter sticks to the soul it gets itself coloured respectively as
golden, lotus-pink, white and black, blue and grey and they are
called the lesyds. The feelings generated by the accumulation of
the karma-matter are called bhdva-lesya and the actual coloration
of the soul by it is called dravya-lesyd. According as any karma
matter has been generated by good, bad, or indifferent actions, it
gives us pleasure, pain, or feeling of indifference. Even the know
ledge that we are constantly getting by perception, inference, etc.,
is but the result of the effect of karmas in accordance with which
the particular kind of veil which was obscuring any particular kind
of knowledge is removed at any time and we have a knowledge
of a corresponding nature. By our own karmas the veils over our
knowledge, feeling, etc., are so removed that we have just that
kind of knowledge and feeling that we deserved to have. All
knowledge, feeling, etc., are thus in one sense generated from
within, the external objects which are ordinarily said to be
generating them all being but mere coexistent external con
ditions.
1 The Jains acknowledge five kinds of knowledge : (r) matijfUna (ordinary cog
nition), (?) fruti (testimony), (3) avadhi (supernatural cognition), (4) manahparydya
(thought-reading), (5) kevala-jAHna (omniscience).
192 The Jaina Philosophy [CH.
After the effect of a particular karma matter (karma-vargana)
is once produced, it is discharged and purged from off the soul.
This process of purging off the karmas is called nirjard. If no
new karma matter should accumulate then, the gradual purging
off of the karmas might make the soul free of karma matter, but as
it is, while some karma matter is being purged off, other karma
matter is continually pouring in, and thus the purging and
binding processes continuing simultaneously force the soul to
continue its mundane cycle of existence, transmigration, and re
birth. After the death of each individual his soul, together with
its karmic body (kdrmanasarira), goes in a few moments to the
place of its new birth and there assumes a new body, expanding
or contracting in accordance with the dimensions of the latter.
In the ordinary course karma takes effect and produces its
proper results, and at such a stage the soul is said to be in the
audayika state. By proper efforts karma may however be pre
vented from taking effect, though it still continues to exist, and
this is said to be the aupasamika state of the soul. When karma
is not only prevented from operating but is annihilated, the soul
is said to be in the ksayika state, and it is from this state that
Moksa is attained. There is, however, a fourth state of ordinary
good men with whom some karma is annihilated, some neutralized,
and some active (ksdyopasamika) 1 .
Karma, Asrava and Nirjara.
It is on account of karma that the souls have to suffer all
the experiences of this world process, including births and re
births in diverse spheres of life as gods, men or animals, or insects.
The karmas are certain sorts of infra-atomic particles of matter
(karma-vargana). The influx of these karma particles into the
soul is called asrava in Jainism. These karmas are produced by
body, mind, and speech. The asravas represent the channels or
modes through which the karmas enter the soul, just like the
channels through which water enters into a pond. But the Jains
distinguish between the channels and the karmas which actually
1 The stages through which a developing soul passes are technically called guna-
sthdnas which are fourteen in number. The first three stages represent the growth of
faith in Jainism, the next five stages are those in which all the passions are controlled,
in the next four stages the ascetic practises yoga and destroys all his karmas, at the
thirteenth stage he is divested of all karmas but he still practises yoga and at the
fourteenth stage he attains liberation (see Dravyasarngrahavrtti, I3th verse).
vi] Influx of Karma 193
enter through those channels. Thus they distinguish two kinds
of asravas, bhavasrava and karmasrava. Bhavasrava means the
thought activities of the soul through which or on account of
which the karma particles enter the soul 1 . Thus Nemicandra
says that bhavasrava is that kind of change in the soul (which
is the contrary to what can destroy the karmasrava), by which
the karmas enter the soul 8 . Karmasrava, however, means the
actual entrance of the karma matter into the soul. These
bhavasravas are in general of five kinds, namely delusion
(mithydtva\ want of control (avirati), inadvertence (pramdda),
the activities of body, mind and speech (yoga) and the pas
sions (kasdyas). Delusion again is of five kinds, namely ekdnta
(a false belief unknowingly accepted and uncritically followed),
viparlta (uncertainty as to the exact nature of truth), vinaya
(retention of a belief knowing it to be false, due to old habit \
sarpsaya (doubt as to right or wrong) and ajndna (want of any
belief due to the want of application of reasoning powers).
Avirati is again of five kinds, injury (himsd), falsehood (anrta),
stealing (cauryya), incontinence (abrahma), and desire to have
things which one does not already possess (parigrahdkdnk$a).
Pramada or inadvertence is again of five kinds, namely bad con
versation (vikathd), passions (ka$dya\ bad use of the five senses
(indriya), sleep (nidrd\ attachment (rdgd)*.
Coming to dravyasrava we find that it means that actual in
flux of karma which affects the soul in eight different manners
in accordance with which these karmas are classed into eight
different kinds, namely jftanavaraniya, dars"anavaranlya, veda-
nlya, mohanlya, ayu, nama, gotra and antaraya. These actual
influxes take place only as a result of the bhavasrava, or the re
prehensible thought activities, or changes (parindma) of the soul.
The states of thought which condition the coming in of the karmas
is called bhavabandha and the actual bondage of the soul by the
actual impure connections of the karmas is technically called
dravyabandha. It is on account of bhavabandha that the actual
connection between the karmas and the soul can take place 4 . The
actual connections of the karmas with the soul are like the sticking
o
1 Dravyasamgraha, SI. 29.
2 Nemicandra s commentary on DravyasamgrahcL, Jsl. 39, edited by S. C. Gboshal,
Arrah, 1917.
3 See Nemicandra s commentary on SI. 30.
4 Nemicandra on 31, and Vardhamanapur&na xvi. 44, quoted by GhoshaL
D. 13
194 The Jaina Philosophy [CH
of dust on the body of a person who is besmeared all over with
oil. Thus Gunaratna says: "The influx of karma means the
contact of the particles of karma matter, in accordance with the
particular kind of karma, with the soul, just like the sticking of
dust on the body of a person besmeared with oil. In all parts of
the soul there being infinite number of karma atoms it becomes
so completely covered with them that in some sense when looked
at from that point of view the soul is sometimes regarded as a
material body during its samsara stage 1 ." From one point of
view the bondage of karma is only of punya and pdpa (good
and bad karmas) 2 . From another this bondage is of four kinds,
according to the nature of karma (prakrti), duration of bondage
(sthiti), intensity (anubhdgd) and extension (pradesa). The
nature of karma refers to the eight classes of karma already
mentioned, namely the jfianavaranlya karma which obscures the
infinite knowledge of the soul of all things in detail, darSana-
varanlya karma which obscures the infinite general .knowledge
of the soul, vedanlya karma which produces the feelings of
pleasure and pain in the soul, mohanlya karma, which so in
fatuates souls that they fail to distinguish what is right from
what is wrong, ayu karma, which determines the tenure of any
particular life, nama karma which gives them personalities, gotra
karma which brings about a particular kind of social surrounding
for the soul and antaraya karma which tends to oppose the per
formance of right actions by the soul. The duration of the stay
of any karma in the soul is called sthiti. Again a karma may be
intense, middling or mild, and this indicates the third principle
of division, anubhaga. Pradesa refers to the different parts of
the soul to which the karma particles attach themselves. The
duration of stay of any karma and its varying intensity are due
to the nature of the kasayas or passions of the soul, whereas the
different classification of karmas as jfianavaranlya, etc., are due to
the nature of specific contact of the soul with karma matter 3 .
Corresponding to the two modes of inrush of karmas (bhava-
srava and dravyasrava) are two kinds of control opposing this
inrush, by actual thought modification of a contrary nature and
by the actual stoppage of the inrush of karma particles, and
these are respectively called bhavasamvara and dravyasamvara 4 .
1 See Gunaratna, p. 181. 2 Ibid. 8 Nemicandra, 33.
4 Varddhamanapurana, XVI. 67-68, and Dravyasamgrahavrtti, Si. 35.
vi] Self-control 195
The bhavasamvaras are (i) the vows of non-injury, truthfulness,
abstinence from stealing, sex-control, and non-acceptance of objects
of desire, (2) samitis consisting of the use of trodden tracks in order
to avoid injury to insects (irya), gentle and holy talk (bhdsd\ re
ceiving proper alms (esand), etc., (3) guptis or restraints of body,
speech and mind, (4) dharmas consisting of habits of forgive
ness, humility, straightforwardness, truth, cleanliness, restraint,
penance, abandonment, indifference to any kind of gain or loss,
and supreme sex-control 1 , (5) anupreksd consisting of meditation
about the transient character of the world, about our helplessness
without the truth, about the cycles of world-existence, about our
own responsibilities for our good and bad actions, about the
difference between the soul and the non-soul, about the unclean-
liness of our body and all that is associated with it, about the in
flux of karma and its stoppage and the destruction of those
karmas which have already entered the soul, about soul, matter
and the substance of the universe, about the difficulty of attaining
true knowledge, faith, and conduct, and about the essential prin
ciples of the world 2 , (6) the parlsahajaya consisting of the con
quering of all kinds of physical troubles of heat, cold, etc., and
of feelings of discomforts of various kinds, (7) cdritra or right
conduct.
Next to this we come to nirjara or the purging off of the
karmas or rather their destruction. This nirjara also is of two
kinds, bhavanirjara and dravyanirjara. Bhavanirjara means that
change in the soul by virtue of which the karma particles are
destroyed. Dravyanirjara means the actual destruction of these
karma particles either by the reaping of their effects or by
penances before their time of fruition, called savipaka and avipaka
nirjaras respectively. When all the karmas are destroyed moksa
or liberation is effected.
Pudgala.
The ajlva (non-living) is divided into pudgaldstikdya, dharma
stikdya, adharmdstikdya, dkdsdstikdya, kdla, punya, pdpa. The
word pudgala means matter 3 , and it is called astikdya in the
sense that it occupies space. Pudgala is made up of atoms
1 Tattvarthadhigamasutra. 2 Ibid.
3 This is entirely different from the Buddhist sense. With the Buddhists pudgala
means an individual or a person.
132
196 The Jaina Philosophy [CH.
which are without size and eternal. Matter may exist in two
states, gross (such as things we see around us), and subtle (such
as the karma matter which sullies the soul). All material things
are ultimately produced by the combination of atoms. The
smallest indivisible particle of matter is called an atom (anu).
The atoms are all eternal and they all have touch, taste, smell,
and colour. The formation of different substances is due to the
different geometrical, spherical or cubical modes of the combi
nation of the atoms, to the diverse modes of their inner arrange
ment and to the existence of different degrees of inter-atomic
space (ghanapratarabhedena). Some combinations take place by
simple mutual contact at two points (yugmapradesa) whereas
in others the atoms are only held together by the points of at
tractive force (ojahpradesa) (Prajndpanopdngasiitra, pp. 10-12).
Two atoms form a compound (skandka), when the one is viscous
and the other dry or both are of different degrees of viscosity or
dryness. It must be noted that while the Buddhists thought that
there was no actual contact between the atoms the Jains regarded
the contact as essential and as testified by experience. These
compounds combine with other compounds and thus produce
the gross things of the world. They are, however, liable to
constant change (parindma) by which they lose some of their
old qualities (gunas) and acquire new ones. There are four
elements, earth, water, air, and fire, and the atoms of all these
are alike in character. The perception of grossness however
is not an error which is imposed upon the perception of the
atoms by our mind (as the Buddhists think) nor is it due to the
perception of atoms scattered spatially length wise and breadthwise
(as the Samkhya-Yoga supposes), but it is due to the accession of
a similar property of grossness, blueness or hardness in the com
bined atoms, so that such knowledge is generated in us as is given
in the perception of a gross, blue, or a hard thing. When a thing
appears as blue, what happens is this, that the atoms there have
all acquired the property of blueness and on the removal of the
darsanavaraniya and jfianavaranlya veil, there arises in the soul
the perception and knowledge of that blue thing. This sameness
(samdna-rupata) of the accession of a quality in an aggregate of
atoms by virtue of which it appears as one object (e.g. a cow)
is technically called tiryaksdmdnya. This samanya or generality
is thus neither an imposition of the mind nor an abstract entity
vi] Dharma 197
(as maintained by the Naiyayikas) but represents only the ac
cession of similar qualities by a similar development of qualities
of atoms forming an aggregate. So long as this similarity of
qualities continues we perceive the thing to be the same and
to continue for some length of time. When we think of a thing
to be permanent, we do so by referring to this sameness in the
developing tendencies of an aggregate of atoms resulting in the
relative permanence of similar qualities in them. According to
the Jains things are not momentary and in spite of the loss of
some old qualities and the accession of other ones, the thing as
a whole may remain more or less the same for some time. This
sameness of qualities in time is technically called urdhvasdmdnya 1 .
If the atoms are looked at from the point of view of the change
and accession of new qualities, they may be regarded as liable to
destruction, but if they are looked at from the point of view of
substance (dravyd) they are eternal.
Dharma, Adharma, Akasa.
The conception of dharma and adharma in Jainism is
absolutely different from what they mean in other systems of
Indian philosophy. Dharma is devoid of taste, touch, smell,
sound and colour; it is conterminous with the mundane universe
(lokdkasd) and pervades every part of it. The term astikdya
is therefore applied to it. It is the principle of motion, the ac
companying circumstance or cause which makes motion possible,
like water to a moving fish. The water is a passive condition
or circumstance of the movement of a fish, i.e. it is indifferent
or passive (uddslnd) and not an active or solicitous (preraka)
cause. The water cannot compel a fish at rest to move ; but if
the fish wants to move, water is then the necessary help to its
motion. Dharma cannot make the soul or matter move ; but
if they are to move, they cannot do so without the presence of
dharma. Hence at the extremity of the mundane world (lokd)
in the region of the liberated souls, there being no dharma, the
liberated souls attain perfect rest. They cannot move there
because there is not the necessary motion-element, dharma 2 .
Adharma is also regarded as a similar pervasive entity which
1 See Prameyakamalamartanda, pp. 136-143 ; Jainatarkavarttika, p. 106.
2 Dravyasamgrahavrtti, 17-20.
198 The Jaina Philosophy [CH.
helps jlvas and pudgalas to keep themselves at rest. No substance
could move if there were no dharma, or could remain at rest if
there were no adharma. The necessity of admitting these two
categories seems probably to have been felt by the Jains on
account of their notion that the inner activity of the jlva or the
atoms required for its exterior realization the help of some other
extraneous entity, without which this could not have been trans
formed into actual exterior motion. Moreover since the jlvas
were regarded as having activity inherent in them they would be
found to be moving even at the time of liberation (moksa), which
was undesirable; thus it was conceived that actual motion required
for its fulfilment the help of an extraneous entity which was absent
in the region of the liberated souls.
The category of akasa is that subtle entity which pervades
the mundane universe (loka) and the transcendent region of
liberated souls (aloka) which allows the subsistence of all other
substances such as dharma, adharma, jlva, pudgala. It. is not a
mere negation and absence of veil or obstruction, or mere empti
ness, but a positive entity which helps other things to inter
penetrate it. On account of its pervasive character it is called
akdsastikaya *.
Kala and Samaya.
Time (kala) in reality consists of those innumerable particles
which never mix with one another, but which help the happening
of the modification or accession of new qualities and the change
of qualities of the atoms. Kala does not bring about the changes
of qualities, in things, but just as akasa helps interpenetration
and dharma motion, so also kala helps the action of the transfor
mation of new qualities in things. Time perceived as moments,
hours, days, etc., is called samaya. This is the appearance of the
unchangeable kala in so many forms. Kala thus not only aids
the modifications of other things, but also allows its own modifi
cations as moments, hours, etc. It is thus a dravya (substance),
and the moments, hours, etc., are its paryayas. The unit of samaya
is the time required by an atom to traverse a unit of space by a
slow movement.
1 Dravyasamgrahavrtti, 19.
vi] Rules of Conduct 1 99
Jaina Cosmography.
According to the Jains, the world is eternal, without beginning
or end. Loka is that place in which happiness and misery are expe
rienced as results of virtue and vice. It is composed of three parts,
urdhva (where the gods reside), madhya (this world of ours), and
adho (where the denizens of hell reside). The mundane universe
(lokakasa) is pervaded with dharma which makes all movement
possible. Beyond the lokakasa there is no dharma and therefore
no movement, but only space (dkdsa). Surrounding this lokakasa
are three layers of air. The perfected soul rising straight over
the urdhvaloka goes to the top of this lokakasa and (there being
no dharma) remains motionless there.
Jaina Yoga.
Yoga according to Jainism is the cause of moksa (salvation).
This yoga consists of jflana (knowledge of reality as it is), sraddha
(faith in the teachings of the Jinas), and caritra (cessation from
doing all that is evil). This caritra consists of ahimsd (not
taking any life even by mistake or unmindfulness), sunrta
(speaking in such a way as is true, good and pleasing), asteya
(not taking anything which has not been given), brahmacaryya
(abandoning lust for all kinds of objects, in mind, speech and
body), and aparigraka (abandoning attachment for all things) 1 .
These strict rules of conduct only apply to ascetics who are bent
on attaining perfection. The standard proposed for the ordinary
householders is fairly workable. Thus it is said by Hemacandra,
that ordinary householders should earn money honestly, should
follow the customs of good people, should marry a good girl from
a good family, should follow the customs of the country and so
forth. These are just what we should expect from any good and
1 Certain external rules of conduct are also called caritra. These are : Iryya (to
go by the path already trodden by others and illuminated by the sun s rays, so that
proper precaution may be taken while walking to prevent oneself from treading on
insects, etc., which may be lying on the way), bkdfd (to speak well and pleasantly
to all beings), isana (to beg alms in the proper monastic manner), danasamiti (to
inspect carefully the seats avoiding all transgressions when taking or giving anything),
utsargasamiti (to take care that bodily refuse may not be thrown in such a way as to
injure any being), manogupti (to remove all false thoughts, to remain satisfied within
oneself, and hold all people to be the same in mind), vaggupti (absolute silence), and
kayagupti (absolute steadiness and fixity of the body). Five other kinds of caritra are
counted in Dravyasamgrahavrtti 35.
2oo The Jaina Philosophy [CH.
honest householder of the present day. Great stress is laid upon
the virtues of ahimsa, sunrta, asteya and brahmacaryya, but the
root of all these is ahimsa. The virtues of sunrta, asteya and
brahmacaryya are made to follow directly as secondary corrol-
laries of ahimsa. Ahimsa may thus be generalized as the funda
mental ethical virtue of Jainism ; judgment on all actions may be
passed in accordance with the standard of ahimsa ; sunrta, asteya
and brahmacaryya are regarded as virtues as their transgression
leads to himsa (injury to beings). A milder form of the practice
of these virtues is expected from ordinary householders and this
is called anubrata (small vows). But those who are struggling
for the attainment of emancipation must practise these virtues
according to the highest and strictest standard, and this is called
mahabrata (great vows). Thus for example brahmacaryya for a
householder according to the anubrata standard would be mere
cessation from adultery, whereas according to mahabrata it would
be absolute abstention from sex-thoughts, sex-words and sex-
acts. Ahimsa according to a householder, according to anubrata,
would require abstinence from killing any animals, but according
to mahavrata it would entail all the rigour and carefulness to
prevent oneself from being the cause of any kind of injury to
any living being in any way.
Many other minor duties are imposed upon householders, all
of which are based upon the cardinal virtue of ahimsa. These
are (i) digvirati (to carry out activities within a restricted area
and thereby desist from injuring living beings in different places),
(2) bhogopabhogamdna (to desist from drinking liquors, taking
flesh, butter, honey, figs, certain other kinds of plants, fruits, and
vegetables, to observe certain other kinds of restrictions regarding
time and place of taking meals), (3) anarthadanda consisting of
(a) apadhydna (cessation from inflicting any bodily injuries,
killing of one s enemies, etc.), (fr) pdpopadesa (desisting from
advising people to take to agriculture which leads to the killing
of so many insects), (c) himsopakdriddna (desisting from giving
implements of agriculture to people which will lead to the injury
of insects), (d) pramdddcarana (to desist from attending musical
parties, theatres, or reading sex-literature, gambling, etc.), ($)siksd-
padabrata consisting of (a) sdmayikabrata (to try to treat all
beings equally), (b) desdvakdsikabrata (gradually to practise the
digviratibrata more and more extensively), (c} posadhabrata
vi] Rules of Conduct 201
(certain other kinds of restriction), (d) atithisamvibhdgabrata (to
make gifts to guests). All transgressions of these virtues, called
aticdra, should be carefully avoided.
All perception, wisdom, and morals belong to the soul, and to
know the soul as possessing these is the right knowledge of the
soul. All sorrows proceeding out of want of self-knowledge can
be removed only by true self-knowledge. The soul in itself is
pure intelligence, and it becomes endowed with the body only on
account of its karma. When by meditation, all the karmas are
burnt (dhydndgnidagdhakarmd) the self becomes purified. The
soul is itself the samsara (the cycle of rebirths) when it is over
powered by the four kasayas (passions) and the senses. The four
kasayas are krodha (anger), mdna (vanity and pride), mdyd
(insincerity and the tendency to dupe others), and lobha (greed).
These kasayas cannot be removed except by a control of the
senses ; and self-control alone leads to the purity of the mind
(manahsuddhi). Without the control of the mind no one can
proceed in "the path of yoga. All our acts become controlled when
the mind is controlled, so those who seek emancipation should
make every effort to control the mind. No kind of asceticism
(tapas) can be of any good until the mind is purified. All attach
ment and antipathy (rdgadvesd) can be removed only by the
purification of the mind. It is by attachment and antipathy that
man loses his independence. It is thus necessary for the yogin
(sage) that he should be free from them and become independent
in the real sense of the term. When a man learns to look upon
all beings with equality (samalvd) he can effect such a conquest
over raga and dvesa as one could never do even by the strictest
asceticism through millions of years. In order to effect this
samatva towards all, we should take to the following kinds of
meditation (bhdvana) :
We should think of the transitoriness (anityata) of all things,
that what a thing was in the morning, it is not at mid-day,
what it was at mid-day it is not at night ; for all things are
transitory and changing. Our body, all our objects of pleasure,
wealth and youth all are fleeting like dreams, or cotton particles
in a whirlwind.
All, even the gods, are subject to death. All our relatives will
by their works fall a prey to death. This world is thus full of
misery and there is nothing which can support us in it. Thus in
2O2 The Jaina Philosophy [CH.
whatever way we look for anything, on which we can depend, we
find that it fails us. This is called aaranabhavana (the meditation
of helplessness).
Some are born in this world, some suffer, some reap the fruits
of the karma done in another life. We are all different from one
anothei by our surroundings, karma, by our separate bodies and
by all other gifts which each of us severally enjoy. To meditate
on these aspects is called ekatvabhavana and anyatvabhavana.
To think that the body is made up of defiled things, the flesh,
blood, and bones, and is therefore impure is called asucibhavana
(meditation of the impurity of the body).
To think that if the mind is purified by the thoughts of uni
versal friendship and compassion and the passions are removed,
then only will good (subha) accrue to me, but if on the contrary
I commit sinful deeds and transgress the virtues, then all evil
will befall me, is called asravabhavarra (meditation of the be
falling of evil). By the control of the asrava (inrush of karma)
comes the samvara (cessation of the influx of karma) and the
destruction of the karmas already accumulated leads to nirjara
(decay and destruction of karma matter).
Again one should think that the practice of the ten dharmas
(virtues) of self control (samyama\ truthfulness (sunrta), purity
(sauca), chastity (brahma), absolute want of greed (akiftcanatd\
asceticism (tapas), forbearance, patience (ksdnti), mildness
(mdrdava), sincerity (rjutd\ and freedom or emancipation from
all sins (mukti) can alone help us in the achievement of the
highest goal. These are the only supports to which we can
look. It is these which uphold the world-order. This is called
dharmasvakhyatatabhavana.
Again one should think of the Jaina cosmology and also
of the nature of the influence of karma in producing all the
diverse conditions of men. These two are called lokabhdvand
and bodhibhdvand.
When by the continual practice of the above thoughts man
becomes unattached to all things and adopts equality to all beings,
and becomes disinclined to all worldly enjoyments, then with a
mind full of peace he gets rid of all passions, and then he should
take to the performance of dhyana or meditation by deep concen
tration. The samatva or perfect equality of the mind and dhyana
are interdependent, so that without dhyana there is no samatva
vi] Anti-theistic Arguments 203
and without samatva there is no dhyana. In order to make the
mind steady by dhyana one should think of maitrt (universal
friendship), pramoda (the habit of emphasizing the good sides of
men), karund (universal compassion) and mddhyastha (indifference
to the wickedness of people, i.e. the habit of not taking any
note of sinners). The Jaina dhyana consists in concentrating
the mind on the syllables of the Jaina prayer phrases. The
dhyana however as we have seen is only practised as an aid to
making the mind steady and perfectly equal and undisturbed
towards all things. Emancipation comes only as the result of the
final extinction of the karma materials. Jaina yoga is thus a com
plete course of moral discipline which leads to the purification
of the mind and is hence different from the traditional Hindu
yoga of Patafijali or even of the Buddhists 1 .
Jaina Atheism 2 .
The Naiyayikas assert that as the world is of the nature of
an effect, it must have been created by an intelligent agent and
this agent is Isvara (God). To this the Jain replies, " What does
the Naiyayika mean when he says that the world is of the nature
of an effect"? Does he mean by "effect," (i) that which is made
up of parts (sdvayava), or, (2) the coinherence of the causes of a
non-existent thing, or, (3) that which is regarded by anyone as
having been made, or, (4) that which is liable to change (vtkdrit-
vam). Again, what is meant by being "made up of parts"? If it
means existence in parts, then the class-concepts (sdmdnya)
existing in the parts should also be regarded as effects, and hence
destructible, but these the Naiyayikas regard as being partless and
eternal. If it means "that which has parts," then even "space"
(dkdsd) has to be regarded as "effect," but the Naiyayika regards
it as eternal.
Again "effect" cannot mean "coinherence of the causes of a
thing which were previously non-existent," for in that case one
could not speak of the world as an effect, for the atoms of the
elements of earth, etc., are regarded as eternal.
Again if "effect" means "that which is regarded by anyone as
1 Yogatastra, by Heniacandra, edited by Windisch, in Zeitschrift der Deutschen
Morg. Gesellschaft, Leipsig, 1874, and Dravyasamgraha, edited by Ghoshal, 1917.
2 See Gunaratna s Tarkarahasyadipika.
204 The Jaina Philosophy [CH.
having been made," then it would apply even to space, for when
a man digs the ground he thinks that he has made new space in
the hollow which he dug.
If it means "that which is liable to change," then one could
suppose that God was also liable to change and he would require
another creator to create him and he another, and so on ad
infinitum. Moreover, if God creates he cannot but be liable to
change with reference to his creative activity.
Moreover, we know that those things which happen at some
time and do not happen at other times are regarded as "effects."
But the world as a whole exists always. If it is argued that things
contained within it such as trees, plants, etc., are "effects," then
that would apply even to this hypothetical God, for, his will and
thought must be diversely operating at diverse times and these
are contained in him. He also becomes a created being by virtue
of that. And even atoms would be "effects," for they also undergo
changes of colour by heat.
Let us grant for the sake of argument that the world as a
whole is an "effect." And every effect has a cause, and so the
world as a whole has a cause. But this does not mean that the
cause is an intelligent one, as God is supposed to be. If it is
argued that he is regarded as intelligent on the analogy of human
causation then he might also be regarded as imperfect as human
beings. If it is held that the world as a whole is not exactly
an effect of the type of effects produced by human beings
but is similar to those, this will lead to no inference. Because
water-vapour is similar to smoke, nobody will be justified in
inferring fire from water- vapour, as he would do from smoke.
If it is said that this is so different an effect that from it the
inference is possible, though nobody has ever been seen to pro
duce such an effect, well then, one could also infer on seeing
old houses ruined in course of time that these ruins were pro
duced by intelligent agents. For these are also effects of which
we do not know of any intelligent agent, for both are effects,
and the invisibility of the agent is present in both cases. If it is
said that the world is such that we have a sense that it has been
made by some one, then the question will be, whether you infer
the agency of God from this sense or infer the sense of its having
been made from the fact of its being made by God, and you have
a vicious circle (anyonydsrayd}.
vi] Anti-theistic Arguments 205
Again, even if we should grant that the world was created by
an agent, then such an agent should have a body, for we have
never seen any intelligent creator without a body. Jf it is held
that we should consider the general condition of agency only,
namely, that the agent is intelligent, the objection will be that
this is impossible, for agency is always associated with some kind
of body. If you take the instances of other kinds of effects such
as the shoots of corn growing in the fields, it will be found that
these had no intelligent agents behind them to create them. If it
is said that these are also made by God, then you have an
argument in a circle (cakrakd), for this was the very matter which
you sought to prove.
Let it be granted for the sake of argument that God exists.
Does his mere abstract existence produce the world? Well, in
that case, the abstract existence of a potter may also create the
world, for the abstract existence is the same in both cases. Does
he produce the world by knowledge and will? Well, that is im
possible, for there cannot be any knowledge and will without a
body. Does he produce the world by physical movement or any
other kind of movement? In any case that is impossible, for there
cannot be any movement without a body. If you suppose that
he is omniscient, you may do so, but that does not prove that
he can be all-creator.
Let us again grant for the sake of argument that a bodiless
God can create the world by his will and activity. Did he take
to creation through a personal whim? In that case there would
be no natural laws and order in the world. Did he take to it
in accordance with the moral and immoral actions of men? Then
he is guided by a moral order and is not independent. Is it
through mercy that he took to creation? Well then, we suppose
there should have been only happiness in the world and nothing
else. If it is said that it is by the past actions of men that they
suffer pains and enjoy pleasure, and if men are led to do vicious
actions by past deeds which work like blind destiny, then such
a blind destiny (adrsta) might take the place of God. If He took
to creation as mere play, then he must be a child who did things
without a purpose. If it was due to his desire of punishing certain
people and favouring others, then he must harbour favouritism
on behalf of some and hatred against others. If the creation took
place simply through his own nature, then, what is the good of
206 The Jaina Philosophy [CH.
admitting him at all ? You may rather say that the world came
into being out of its own nature.
It is preposterous to suppose that one God without the help
of any instruments or other accessories of any kind, could create
this world. This is against all experience.
Admitting for the sake of argument that such a God exists,
you could never justify the adjectives with which you wish to
qualify him. Thus you say that he is eternal. But since he has
no body, he must be of the nature of intelligence and will.
But this nature must have changed in diverse forms for the pro
duction of diverse kinds of worldly things, which are of so varied
a nature. If there were no change in his knowledge and will, then
there could not have been diverse kinds of creation and de
struction. Destruction and creation cannot be the result of one
unchangeable will and knowledge. Moreover it is the character
of knowledge to change, if the word is used in the sense in which
knowledge is applied to human beings, and surely we are not
aware of any other kind of knowledge. You say that God is
omniscient, but it is difficult to suppose how he can have any
knowledge at all, for as he has no organs he cannot have any
perception, and since he cannot have any perception he cannot
have any inference either. If it is said that without the supposi
tion of a God the variety of the world would be inexplicable, this
also is not true, for this implication would only be justified if
there were no other hypothesis left. But there are other supposi
tions also. Even without an omniscient God you could explain
all things merely by the doctrine of moral order or the law of
karma. If there were one God, there could be a society of Gods
too. You say that if there were many Gods, then there would be
quarrels and differences of opinion. This is like the story of
a miser who for fear of incurring expenses left all his sons and
wife and retired into the forest. When even ants and bees can
co-operate together and act harmoniously, the supposition that if
there were many Gods they would have fallen out, would indicate
that in spite of all the virtues that you ascribe to God you think
his nature to be quite unreliable, if not vicious. Thus in which
ever way one tries to justify the existence of God he finds that it
is absolutely a hopeless task. The best way then is to dispense
with the supposition altogether 1 .
1 See Saddarfanasamuccaya, Gunaratna on Jainism, pp. 115-124.
vi] Emancipation 207
Moksa (emancipation).
The motive which leads a man to strive for release (moksa} is
the avoidance of pain and the attainment of happiness, for the
state of mukti is the state of the soul in pure happiness. It is
also a state of pure and infinite knowledge (anantajndna) and infi
nite perception (anantadarsana). In the samsara state on account
of the karma veils this purity is sullied, and the veils are only worn
out imperfectly and thus reveal this and that object at this and
that time as ordinary knowledge (matt}, testimony (srutd), super
natural cognition, as in trance or hypnotism (avadhi), and direct
knowledge of the thoughts of others or thought reading (manah-
parydya). In the state of release however there is omniscience
{kevala-jftdna) and all things are simultaneously known to the
perfect (kevaliri) as they are. In the samsara stage the soul always
acquires new qualities, and thus suffers a continual change though
remaining the same in substance. But in the emancipated stage
the changes that a soul suffers are all exactly the same, and thus
it is that at this stage the soul appears to be the same in substance
as well as in its qualities of infinite knowledge, etc., the change
meaning in this state only the repetition of the same qualities.
It may not be out of place to mention here that though the
karmas of man are constantly determining him in various ways
yet there is in him infinite capacity or power for right action
(anantavirya), so that karma can never subdue this freedom and
infinite capacity, though this may be suppressed from time to time
by the influence of karma. It is thus that by an exercise of this
power man can overcome all karma and become finally liberated.
If man had not this anantavlrya in him he might have been eter
nally under the sway of the accumulated karma which secured
his bondage (bandhd). But since man is the repository of this
indomitable power the karmas can only throw obstacles and
produce sufferings, but can never prevent him from attaining his
highest good.
CHAPTER VII
THE KAPILA AND THE PATANJALA SAMKHYA (YOGA) 1 .
A Review.
THE examination of the two ancient Nastika schools of
Buddhism and Jainism of two different types ought to convince
us that serious philosophical speculations were indulged in, in
circles other than those of the Upanisad sages. That certain
practices known as Yoga were generally prevalent amongst the
wise seems very probable, for these are not only alluded to in some
of the Upanisads but were accepted by the two nastika schools
of Buddhism and Jainism. Whether we look at them from the
point of view of ethics or metaphysics, the two Nastika schools
appear to have arisen out of a reaction against the sacrificial
disciplines of the Brahmanas. Both these systems originated with
the Ksattriyas and were marked by a strong aversion against the
taking of animal life, and against the doctrine of offering animals
at the sacrifices.
The doctrine of the sacrifices supposed that a suitable com
bination of rites, rituals, and articles of sacrifice had the magical
power of producing the desired effect a shower of rain, the
birth of a son, the routing of a huge army, etc. The sacrifices
were enjoined generally not so much for any moral elevation, as
for the achievement of objects of practical welfare. The Vedas
were the eternal revelations which were competent so to dictate
a detailed procedure, that we could by following it proceed on a
certain course of action and refrain from other injurious courses
in such a manner that we might obtain the objects we desired
by the accurate performance of any sacrifice. If we are to define
truth in accordance with the philosophy of such a ritualistic
culture we might say that, that alone is true, in accordance with
which we may realize our objects in the world about us; the truth
of Vedic injunctions is shown by the practical attainment of our
1 This chapter is based on my Study of Patanjali, published by the Calcutta
University, and my Yoga philosophy in relation to other Indian Systems of thought,
awaiting publication with the same authority. The system has been treated in detail in
those two works.
CH. vn] Buddhism and Jainism 209
objects. Truth cannot be determined a priori but depends upon
the test of experience 1 .
It is interesting to notice that Buddhism and Jainism though
probably born out of a reactionary movement against this artificial
creed, yet could not but be influenced by some of its fundamental
principles which, whether distinctly formulated or not, were at
least tacitly implied in all sacrificial performances. Thus we see
that Buddhism regarded all production and destruction as being
due to the assemblage of conditions, and defined truth as that
which could produce any effect. But to such a logical extreme
did the Buddhists carry these doctrines that they ended in
formulating the doctrine of absolute momentariness 2 . Turning
to the Jains we find that they also regarded the value of know
ledge as consisting in the help that it offers in securing what is
good for us and avoiding what is evil; truth gives us such an
account of things that on proceeding according to its directions
we may verify it by actual experience. Proceeding on a correct
estimate of things we may easily avail ourselves of what is good
and avoid what is bad. The Jains also believed that changes
were produced by the assemblage of conditions, but they did not
carry this doctrine to its logical extreme. There was change in
the world as well as permanence. The Buddhists had gone so
far that they had even denied the existence of any permanent
soul. The Jains said that no ultimate, one-sided and absolute
view of things could be taken, and held that not only the happening
of events was conditional, but even all our judgments, are true
only in a limited sense. This is indeed true for common sense,
which we acknowledge as superior to mere a priori abstrac
tions, which lead to absolute and one-sided conclusions. By the
assemblage of conditions, old qualities in things disappeared, new
qualities came in, and a part remained permanent. But this
common-sense view, though in agreement with our ordinary
experience, could not satisfy our inner a priori demands for
finding out ultimate truth, which was true not relatively but
absolutely. When asked whether anything was true, Jainism
1 The philosophy of the Vedas as formulated by the Mimamsa of Kumarila and
Prabhakara holds the opposite view. Truth according to them is determined a priori
while error is determined by experience.
2 Historically the doctrine of momentariness is probably prior to the doctrine of
arthakriyakaritva. But the later Buddhists sought to prove that momentariness was
the logical result of the doctrine of arthakriy&karitva.
D. 14
2io The Kapila and the PataHjala Samkhya [CH.
would answer, "yes, this is true from this point of view, but
untrue from that point of view, while that is also true from such
a point of view and untrue from another." But such an answer
cannot satisfy the mind which seeks to reach a definite pro
nouncement, an absolute judgment.
The main departure of the systems of Jainism and Buddhism
from the sacrificial creed consisted in this, that they tried to formu
late a theory of the universe, the reality and the position of sentient
beings and more particularly of man. The sacrificial creed was
busy with individual rituals and sacrifices, and cared for principles
or maxims only so far as they were of use for the actual perform
ances of sacrifices. Again action with the newsystems did not mean
sacrifice but any general action that we always perform. Actions
were here considered bad or good according as they brought
about our moral elevation or not. The followers of the sacrificial
creed refrained from untruth not so much from a sense of personal
degradation, but because the Vedas had dictated that untruth
should not be spoken, and the Vedas must be obeyed. The
sacrificial creed wanted more and more happiness here or in the
other world. The systems of Buddhist and Jain philosophy turned
their backs upon ordinary happiness and wanted an ultimate and
unchangeable state where all pains and sorrows were for ever
dissolved (Buddhism) or where infinite happiness, ever unshaken,
was realized. A course of right conduct to be followed merely for
the moral elevation of the person had no place in the sacrificial
creed, for with it a course of right conduct could be followed
only if it was so dictated in the Vedas. Karma and the fruit of
karma (karmaphald) only meant the karma of sacrifice and its
fruits temporary happiness, such as was produced as the fruit
of sacrifices ; knowledge with them meant only the knowledge of
sacrifice and of the dictates of the Vedas. In the systems how
ever, karma, karmaphala, happiness, knowledge, all these were
taken in their widest and most universal sense. Happiness or
absolute extinction of sorrow was still the goal, but this was no
narrow sacrificial happiness but infinite and unchangeable happi
ness or destruction of sorrow ; karma was still the way, but not
sacrificial karma, for it meant all moral and immoral actions
performed by us ; knowledge here meant the knowledge of truth
or reality and not the knowledge of sacrifice.
Such an advance had however already begun in the Upa-
vi i] Samkhya in the Upanisads 211
nisads which had anticipated the new systems in all these
directions. The pioneers of these new systems probably drew
their suggestions both from the sacrificial creed and from the
Upanisads, and built their systems independently by their own
rational thinking. But if the suggestions of the Upanisads were
thus utilized by heretics who denied the authority of the Vedas,
it was natural to expect that we should find in the Hindu camp
such germs of rational thinking as might indicate an attempt to
harmonize the suggestions of the Upanisads and of the sacrificial
creed in such a manner as might lead to the construction of a con
sistent and well-worked system of thought. Our expectations are
indeed fulfilled in the Samkhya philosophy, germs of which may
be discovered in the Upanisads.
The Germs of Samkhya in the Upanisads.
It is indeed true that in the Upanisads there is a large number
of texts that describe the ultimate reality as the Brahrnan, the
infinite, knowledge, bliss, and speak of all else as mere changing
forms and names. The word Brahman originally meant in the
earliest Vedic literature, mantra, duly performed sacrifice, and
also the power of sacrifice which could bring about the desired re
sult 1 . In many passages of the Upanisads this Brahman appears
as the universal and supreme principle from which all others de
rived their powers. Such a Brahman is sought for in many passages
for personal gain or welfare. But through a gradual process of
development the conception of Brahman reached a superior level
in which the reality and truth of the world are tacitly ignored,
and the One, the infinite, knowledge, the real is regarded as the
only Truth. This type of thought gradually developed into the
monistic Vedanta as explained by aiikara. But there was
another line of thought which was developing alongside of it,
which regarded the world as having a reality and as being made
up of water, fire, and earth. There are also passages in veta-
svatara and particularly in MaitrayanI from which it appears
that the Samkhya line of thought had considerably developed, and
many of its technical terms were already in use 8 . But the date
of MaitrayanI has not yet been definitely settled, and the details
1 See Hillebrandt s article, " Brahman" (E. R. .).
1 Katha in. 10, v. 7. 6veta. v. 7, 8, 11, iv. 5, i. 3. This has been dealt with in
detail in my Yoga Philosophy in relation to other Indian Systems of Thought, in the first
chapter.
142
212 The Kapila and the Patanjala Samkhya [CH.
found there are also not such that we can form a distinct notion
of the Samkhya thought as it developed in the Upanisads. It is
not improbable that at this stage of development it also gave
some suggestions to Buddhism or Jainism, but the Samkhya-Yoga
philosophy as we now get it is a system in which are found all
the results of Buddhism and Jainism in such a manner that it
unites the doctrine of permanence of the Upanisads with the
doctrine of momentariness of the Buddhists and the doctrine of
relativism of the Jains.
Samkhya and Yoga Literature.
The main exposition of the system of Samkhya and Yoga in
this section has been based on the Samkhya kdrikd, the Sam
khya sutras, and the Yoga sutras of Patafljali with their commen
taries and sub-commentaries. The Samkhya kdrikd (about
200 A.D.) was written by Is"varakrsna. The account of Samkhya
given by Caraka (78 A.D.) represents probably an earlier school and
this has been treated separately. Vacaspati MiSra (ninth century
A.D.) wrote a commentary on it known as Tattvakaumudi. But
before him Gaudapada and Raja wrote commentaries on the
Samkhya kdrikd*. Narayanatlrtha wrote his Candrikd on Gauda-
pada s commentary. The Samkhya sutras which have been com
mented on by Vijftana Bhiksu (called Pravacanabhasya) of the
sixteenth century seems to be a work of some unknown author
after the ninth century. Aniruddha of the latter half of the
fifteenth century was the first man to write a commentary on the
Samkhya sutras. Vijftana Bhiksu wrote also another elementary
work on Samkhya known as Sdmkhyasdra. Another short work
of late origin is Tattvasamdsa (probably fourteenth century). Two
other works on Samkhya, viz. Slmananda s Sdmkhyatattvavivecana
and Bhavaganesa s Sdmkhyatattvayathdrthyadlpana (both later
than Vijftanabhiksu) of real philosophical value have also been
freely consulted. Pataftjali s Yoga sutra (not earlier than 147 B.C.)
was commented on by Vyasa (400 A.D.) and Vyasa s bhasya
commented on by Vacaspati Misra is called Tattvavaisdradl,
by Vijftana Bhiksu Yogavdrttika, by Bhoja in the tenth century
Bhojavrtti, and by Nagesa (seventeenth century) Chdydvyakhyd.
1 I suppose that Raja s commentary on the KarikS, was the same as Rajavarttika
quoted by Vacaspati. Raja s commentary on the Karika has been referred to by
Jayanta in his Nydyamattjari, p. 109. This book is probably now lost.
vn] Samkhya in Caraka 213
Amongst the modern works to which I owe an obligation I may
mention the two treatises Mechanical, physical and chemical theories
of the A ncient Hindus and \he Positive Sciences of the Ancient Hindus
by Dr B. N. Seal and my two works on Yoga Study ofPatanjali pub
lished by the Calcutta University, and Yoga Philosophy in relation
to other Indian Systems of Thought which is shortly to be published,
and my Natural Philosophy of the Ancient Hindus, awaiting publi
cation with the Calcutta University.
Gunaratna mentions two other authoritative Samkhya works,
viz. Mdtharabhasya and Atreyatantra. Of these the second is
probably the same as Caraka s treatment of Samkhya,.for we know
that the sage Atri is the speaker in Caraka s work and for that it
was called Atreyasamhitd or Atreyatantra, Nothing is known
of the Mdtharabhasya^.
An Early School of Samkhya.
It is important for the history of Samkhya philosophy that
Caraka s treatment of it, which so far as I know has never been
dealt with in any of the modern studies of Samkhya, should
be brought before the notice of the students of this philosophy.
According to Caraka there are six elements (dhdtus\ viz. the
five elements such as akaSa, vayu etc. and cetana, called also
purusa. From other points of view, the categories may be said to
be twenty-four only, viz. the ten senses (five cognitive and five
conative), manas, the five objects of senses and the eightfold
prakrti (prakrti, mahat, ahamkara and the five elements) 2 . The
manas works through the senses. It is atomic and its existence
is proved by the fact that in spite of the existence of the senses
there cannot be any knowledge unless manas is in touch with
them. There are two movements of manas as indeterminate
sensing (uhd) and conceiving (vicdra) before definite understanding
(buddhi) arises. Each of the five senses is the product of the
combination of five elements but the auditory sense is made with
a preponderance of akaSa, the sense of touch with a preponderance
1 Readers unacquainted with Samkhya- Yoga may omit the following three sections
at the time of first reading.
2 Purusa is here excluded from the list. Cakrapani, the commentator, says that
the prakrti and purusa both being unmanifested, the two together have been counted
as one. Prakrtivyatiriktancodasinam purusamavyaktatvasddharmyat avyaktdyam
prakrtaveva praksipya avyaktaSabdenaiva grhndti, Harinatha Vi&Lrada s edition of
Caraka, Sdrira, p. 4.
214 The Kapila and the Patanjala S&mkhya [CH.
of air, the visual sense with a preponderance of light, the taste with
a preponderance of water and the sense of smell with a preponder
ance of earth. Caraka does not mention the tanmatras at all 1 . The
conglomeration of the sense-objects (indriyarthd) or gross matter,
the ten senses, manas, the five subtle bhutas and prakrti, mahat
and ahamkara taking place through rajas make up what we call
man. When the sattva is at its height this conglomeration ceases.
All karma, the fruit of karma, cognition, pleasure, pain, ignorance,
life and death belongs to this conglomeration. But there is also
the purusa, for had it not been so there would be no birth, death,
bondage, or salvation. If the atman were not regarded as cause,
all illuminations of cognition would be without any reason. If a
permanent self were not recognized, then for the work of one
others would be responsible. This purusa, called a\so#aramdtman,
is beginningless and it has no cause beyond itself. The self is in
itself without consciousness. Consciousness can only come to it
through its connection with the sense organs and manas. By
ignorance, will, antipathy, and work, this conglomeration of purusa
and the other elements takes place. Knowledge, feeling, or action,
cannot be produced without this combination. All positive effects
are due to conglomerations of causes and not by a single cause, but
all destruction comes naturally and without cause. That which
is eternal is never the product of anything. Caraka identifies the
avyakta part of prakrti with purusa as forming one category.
The vikara or evolutionary products of prakrti are called ksetra,
whereas the avyakta part of prakrti is regarded as the ksetrajfia
(avyaktamasya ksetrasya ksetrajnamrsayo viduk). This avyakta
and cetan are one and the same entity. From this unmanifested
prakrti or cetana is derived the buddhi, and from the buddhi is
derived the ego (ahamkara) and from the ahamkara the five
elements and the senses are produced, and when this production
is complete, we say that creation has taken place. At the time
of pralaya (periodical cosmic dissolution) all the evolutes return
back to prakrti, and thus become unmanifest with it, whereas at the
time of a new creation from the purusa the unmanifest (avyakta)^
all the manifested forms the evolutes of buddhi, ahamkara, etc.
1 But some sort of subtle matter, different from gross matter, is referred to as
forming part of prakrti which is regarded as having eight elements in it (prakrtifca-
ftadh&tuki), viz. avyakta, mahat , ahamkara, and five other elements. In addition to these
elements forming part of the prakrti we hear of indriyartha, the five sense objects
which have evolved out of the prakrti.
vn] Samkhya in Caraka 215
appear 1 . This cycle of births or rebirths or of dissolution and
new creation acts through the influence of rajas and tamas, and
so those who can get rid of these two will never again suffer this
revolution in a cycle. The jnanas can only become active in asso
ciation with the self, which is the real agent This self of itself takes
rebirth in all kinds of lives according to its own wish, undeter
mined by anyone else. It works according to its own free will
and reaps the fruits of its karma. Though all the souls are pervasive,
yet they can only perceive in particular bodies where they are
associated with their own specific senses. All pleasures and pains
are felt by the conglomeration (rdsi), and not by the atman pre
siding over it From the enjoyment and suffering of pleasure and
pain comes desire (trsna) consisting of wish and antipathy, and
from desire again comes pleasure and pain. Moksa means complete
cessation of pleasure and pain, arising through the association
of the self with the manas, the sense, and sense-objects. If the
manas is settled steadily in the self, it is the state of yoga when
there is neither pleasure nor pain. When true knowledge dawns
that "all are produced by causes, are transitory, rise of them
selves, but are not produced by the self and are sorrow, and do
not belong to me the self," the self transcends all. This is the last
renunciation when all affections and knowledge become "finally
extinct. There remains no indication of any positive existence
of the self at this time, and the self can no longer be perceived*.
It is the state of Brahman. Those who know Brahman call this
state the Brahman, which is eternal and absolutely devoid of any
characteristic. This state is spoken of by the Samkhyas as their
goal, and also that of the Yogins. When rajas and tamas are
rooted out and the karma of the past whose fruits have to be
enjoyed are exhausted, and there is no new karma and new birth,
1 This passage has been differently explained in a commentary previous to Cakra-
pani as meaning that at the time of death these resolve back into the prakrti the
purusa and at the time of rebirth they become manifest again. See Cakrapani on
sarira, I. 46.
8 Though this state is called brahmabhuta, it is not in any sense like the Brahman
of Vedanta which is of the nature of pure being, pure intelligence and pure bliss. This
indescribable state is more like absolute annihilation without any sign of existence
(alaksanam), resembling Nagarjuna s Nirvana. Thus Caraka writes : tasmimScarama-
sannyase samuldhsarvcevedanah asamjft&jftanavijflanti nivrttim y&ntyaHtsatah. atah-
param brahmabhuto bhutatma nopalabhyate nihsrtah saruabhdvtbhyah cihnam yasya
tia vidyate, gatirbrahmaviddm brahma tatcdkfaramalakfanam. Caraka, Sarira 1.
98-100.
216 The Kapila and the Patanjala Samkhya [CH.
the state of moksa comes about. Various kinds of moral en
deavours in the shape of association with good people, abandoning
of desires, determined attempts at discovering the truth with fixed
attention, are spoken of as indispensable means. Truth (tattva)
thus discovered should be recalled again and again 1 and this will
ultimately effect the disunion of the body with the self. As the
self is avyakta (unmanifested) and has no specific nature or
character, this state can only be described as absolute cessation
(mokse nivrttirnihsesd).
The main features of the Samkhya doctrine as given by Caraka
are thus: I. Purusa is the state of avyakta. 2. By a conglomera-
of this avyakta with its later products a conglomeration is formed
which generates the so-called living being. 3. The tanmatras are
not mentioned. 4. Rajas and tamas represent the bad states of
the mind and sattva the good ones. 5. The ultimate state of
emancipation is either absolute annihilation or characterless abso
lute existence and it is spoken of as the Brahman state ; there is
no consciousness in this state, for consciousness is due to the con
glomeration of the self with its evolutes, buddhi, ahamkara etc.
6. The senses are formed of matter (bhautika).
This account of Samkhya agrees with the system of Samkhya
propounded by Paftcasikha (who is said to be the direct pupil of
Asuri the pupil of Kapila, the founder of the system) in the
Mahabharata XII. 219. Pancasikha of course does not describe
the system as elaborately as Caraka does. But even from what
little he says it may be supposed that the system of Samkhya
he sketches is the same as that of Caraka 2 . Paflcasikha speaks
of the ultimate truth as being avyakta (a term applied in all
Samkhya literature to prakrti) in the state of purusa (purusd-
vasthamavyaktam). If man is the product of a mere combination
of the different elements, then one may assume that all ceases
with death. Caraka in answer to such an objection introduces a
discussion, in which he tries to establish the existence of a self as
the postulate of all our duties and sense of moral responsibility.
The same discussion occurs in Paflcasikha also, and the proofs
1 Four causes are spoken of here as being causes of memory: (r) Thinking of the
cause leads to the remembering of the effect, (i) by similarity, (3) by opposite things,
and (4) by acute attempt to remember.
2 Some European scholars have experienced great difficulty in accepting Pan-
cas"ikha s doctrine as a genuine Samkhya doctrine. This may probably be due to the
fact that the Samkhya doctrines sketched in Caraka did not attract their notice.
vn] Samkhya of Pancafikha and Caraka 217
for the existence of the self are also the same. Like Caraka again
Paficasikha also says that all consciousness is due to the conditions
of the conglomeration of our physical body mind, and the
element of "cetas." They are mutually independent, and by such
independence carry on the process of life and work. None of the
phenomena produced by such a conglomeration are self. All our
suffering comes in because we think these to be the self. Moksa
is realized when we can practise absolute renunciation of these
phenomena. The gunas described by Paftcaikha are the different
kinds of good and bad qualities of the mind as Caraka has it.
The state of the conglomeration is spoken of as the ksetra, as
Caraka says, and there is no annihilation or eternality; and the
last state is described as being like that when all rivers lose
themselves in the ocean and it is called alinga (without any
characteristic) a term reserved for prakrti in later Samkhya.
This state is attainable by the doctrine of ultimate renuncia
tion which is also called the doctrine of complete destruction
(samyagbadha).
Gunaratna (fourteenth century A.D.), a commentator of Sad-
darsanasamuccaya, mentions two schools of Samkhya, the
Maulikya (original) and the Uttara or (later) 1 . Of these the
doctrine of the Maulikya Samkhya is said to be that which
believed that there was a separate pradhana for each atman
(maulikyasdmkhyd hydtmdnamdtmdnam prati prthak pradhdnam
vadanti). This seems to be a reference to the Samkhya doctrine
I have just sketched. I am therefore disposed to think that this
represents the earliest systematic doctrine of Samkhya.
In Mahdbhdrata XII. 318 three schools of Samkhya are
mentioned, viz. those who admitted twenty-four categories (the
school I have sketched above), those who admitted twenty-
five (the well-known orthodox Samkhya system) and those who
admitted twenty-six categories. This last school admitted a
supreme being in addition to purusa and this was the twenty-sixth
principle. This agrees with the orthodox Yoga system and the
form of Samkhya advocated in the Makubkzrata. The schools of
Samkhya of twenty-four and twenty-five categories are here
denounced as unsatisfactory. Doctrines similar to the school of
Samkhya we have sketched above are referred to in some of the
1 Gunaratna s Tarkarahasyadtpikd, p. 99.
2 1 8 The Kapila and tke Patanjala Samkhya [CH.
other chapters of the Makdbhdrata (xil. 203, 204). The self
apart from the body is described as the moon of the new moon
day; it is said that as Rahu (the shadow on the sun during an
eclipse) cannot be seen apart from the sun, so the self cannot be
seen apart from the body. The selfs (saririnaK) are spoken of as
manifesting from prakrti.
We do not know anything about Asuri the direct disciple
of Kapila 1 . But it seems probable that the system of SSmkhya
we have sketched here which appears in fundamentally the same
form in the Mahdbhdrata and has been attributed there to Paft-
caikha is probably the earliest form of Samkhya available to us
in a systematic form. Not only does Gunaratna s reference to the
school of Maulikya Samkhya justify it, but the fact that Caraka
(78 A.D.) does not refer to the Samkhya as described by Isvarak-
rsna and referred to in other parts of Mahdbhdrata is a definite
proof that Ivarakrsna s Samkhya is a later modification, which
was either non-existent in Caraka s time or was not regarded as
an authoritative old Samkhya view.
Wassilief says quoting Tibetan sources that Vindhyavasin al
tered the Samkhya according to his own views 8 . Takakusu thinks
that Vindhyavasin was a title of IsVarakrsna 8 and Garbe holds that
the date of ISvarakrsna was about 100 A.D. It seems to be a very
plausible view that IsVarakrsna was indebted for his karikas to
another work, which was probably written in a style different
from what he employs. The seventh verse of his Kdrikd seems to
be in purport the same as a passage which is found quoted in the
1 A verse attributed to Asuri is quoted by Gunaratna (Tarkarakasyadipika, p. 104).
The purport of this verse is that when buddhi is transformed in a particular manner,
it (purusa) has experience. It is like the reflection of the moon in transparent water.
3 Vassilief s Buddhismus, p. 240.
8 Takakusu s "A study of Paramartha s life of Vasubandhu," J. R.A.S., 1905.
This identification by Takakusu, however, appears to be extremely doubtful, for
Gunaratna mentions Kvarakrsna and Vindhyavasin as two different authorities ( 7 arka-
rahasyadipikd, pp. 102 and 104). The verse quoted from Vindhyavasin (p. 104) in
anustubh metre cannot be traced as belonging to Is"varakrsna. It appears that Kvara-
krsna wrote two books; one is the Samkhya k&rika and another an independent work
on Samkhya, a line from which, quoted by Gunaratna, stands as follows :
" Pratiniyatadhyavasayah Srotradisamuttha adhyaksam" (p. 108).
If Vacaspati s interpretation of the classification of anumana in his Tattvakaumwfi
be considered to be a correct explanation of Samkhya karika then IsVarakrsna must be
a different person from Vindhyavasin whose views on anumana as referred to in
Slokavarttika, p. 393, are altogether different. But Vacaspati s own statement in the
Tatparyyatika (pp. 109 and 131) shows that bis treatment there was not faithful.
vi i] Ihvarak^sna s Samkhya 219
Mahdbhdsya of Patafljali the grammarian (147 B.C.) 1 . The subject
of the two passages are the enumeration of reasons which frustrate
visual perception. This however is not a doctrine concerned with
the strictly technical part of SSmkhya, and it is just possible
that the book from which Pataftjali quoted the passage, and which
was probably paraphrased in the Arya metre by Isvarakrsna
was not a Samkhya book at all. But though the subject of the
verse is not one of the strictly technical parts of Samkhya, yet
since such an enumeration is not seen in any other system of
Indian philosophy, and as it has some special bearing as a safe
guard against certain objections against the Samkhya doctrine of
prakrti, the natural and plausible supposition is that it was the
verse of a Samkhya book which was paraphrased by Isvarakrsna.
The earliest descriptions of a Samkhya which agrees with
Isvarakrsna s Samkhya (but with an addition of Isvara) are to be
found in Patafljali s Yoga sutras and in the Mahdbhdrata ; but we
are pretty certain that the Samkhya of Caraka we have sketched
here was known to Pataftjali, for in Yoga sutra I. 19 a reference is
made to a view of Samkhya similar to this.
From the point of view of history of philosophy the Samkhya
of Caraka and Paflcasikha is very important ; for it shows a
transitional stage of thought between the Upanisad ideas and
the orthodox Samkhya doctrine as represented by Isvarakrsna.
On the one hand its doctrine that the senses are material, and
that effects are produced only as a result of collocations, and that
the purusa is unconscious, brings it in close relation with Nyaya,
and on the other its connections with Buddhism seem to be nearer
than the orthodox Samkhya.
We hear of a Sastitantrasastra as being one of the oldest Sam
khya works. This is described in the Ahirbudhnya Samhita as
containing two books of thirty-two and twenty-eight chapters*.
A quotation from Rajavdrttika (a work about which there is no
definite information) in Vacaspati Misra s commentary on the
Samkhya kdrika(j2) says that it was called the Sastitantra because
it dealt with the existence of prakrti, its oneness, its difference
from purusas, its purposefulness for purusas, the multiplicity of
purusas, connection and separation from purusas, the evolution of
1 Patafijali s Mahabhasya, IV. i. 3. Atisannikarsadativiprakarsat murttyantara-
vyavadhdnat tanuuavrtatvat indriyadaurvalyddatipram&dttt, etc. (Benares edition. )
J Ahirbudhnya. Samhita, pp. 108, no.
220 The Kapila and the Patanjala Samkhya [CH.
the categories, the inactivity of the purusas and the hveviparyyayas,
nine tustis, the defects of organs of twenty-eight kinds, and the
eight siddhis 1 .
But the content of the Sastitantra as given in Ahirbudhnya
Samhitdis different from it, and it appears from it that the Samkhya
of the Sastitantra referred to in the Ahirbudhnya Samhitd was of
a theistic character resembling the doctrine of the Paflcaratra
Vaisnavas and the Ahirbudhnya Samhitd says that Kapila s
theory of Samkhya was a Vaisnava one. Vijflana Bhiksu, the
greatest expounder of Samkhya, says in many places of his work
VijndndmrtaBhasya that Samkhya was originally theistic, and that
the atheistic Samkhya is only a praudhivdda (an exaggerated
attempt to show that no supposition of Isvara is necessary to
explain the world process) though the Mahdbhdrata points out
that the difference between Samkhya and Yoga is this, that the
former is atheistic, while the latter is theistic. The discrepancy
between the two accounts of Sastitantra suggests that the original
Sastitantra as referred to in the Ahirbudhnya Samhitd was sub
sequently revised and considerably changed. This supposition is
corroborated by the fact that Gunaratna does not mention among
the important Samkhya works Sastitantra but Sastitantroddhdra
1 The doctrine of the viparyyaya, tusti, defects of organs, and the siddhi are men
tioned in the Karika of Kvarakrsna, but I have omitted them in my account of
Samkhya as these have little philosophical importance. The viparyyaya (false know
ledge) are five, viz. avidya (ignorance), asmita (egoism), raga (attachment), dvesa (anti
pathy), abhinives"a (self-love), which are also called tamo, moha, mahdmoha, tamisrd,
and andhatamisra. These are of nine kinds of tusti, such as the idea that no exertion
is necessary, since prakrti will herself bring our salvation (ambhas), that it is not
necessary to meditate, for it is enough if we renounce the householder s life (salila),
that there is no hurry, salvation will come in time (megha), that salvation will be
worked out by fate (bhdgya), and the contentment leading to renunciation proceeding
from five kinds of causes, e.g. the troubles of earning (para), the troubles of protecting
the earned money (supara), the natural waste of things earned by enjoyment (para-
para), increase of desires leading to greater disappointments (anuttamambhas), all gain
leads to the injury of others (uttamdmbhas). This renunciation proceeds from external
considerations with those who consider prakrti and its evolutes as the self. The
siddhis or ways of success are eight in number, viz. (i) reading of scriptures (tdra),
(i) enquiry into their meaning (sutdra), (3) proper reasoning (tdratdra), (4) corrobo
rating one s own ideas with the ideas of the teachers and other workers of the same
field (ramyaka), (5) clearance of the mind by long-continued practice (saddmudita).
The three other siddhis called pramoda, mudita, and modamana lead directly to the
separation of the prakrti from the purusa. The twenty-eight sense defects are the
eleven defects of the eleven senses and seventeen kinds of defects of the understanding
corresponding to the absence of siddhis and the presence of tustis. The viparyyayas,
tustis and the defects of the organs are hindrances in the way of the achievement of
the Samkhya goal.
vi i] Changes in the Samkhya doctrine 221
(revised edition of Sastitantra)^. Probably the earlier Sastitantra
was lost even before Vacaspati s time.
If we believe the Sastitantra referred to in the Ahirbudhnya
Samhitd to be in all essential parts the same work which was
composed by Kapila and based faithfully on his teachings, then it
has to be assumed that Kapila s Samkhya was theistic 2 . It seems
probable that his disciple Asuri tried to popularise it. But it seems
that a great change occurred when Paflcasikha the disciple of
Asuri came to deal with it. For we know that his doctrine
differed from the traditional one in many important respects. It
is said in Samkhya kdrika (70) that the literature was divided by
him into many parts (tena bahudhdkrtam tantram). The exact
meaning of this reference is difficult to guess. It might mean that
the original Sastitantra was rewritten by him in various treatises.
It is a well-known fact that most of the schools of Vaisnavas
accepted the form of cosmology which is the same in most essen
tial parts as the Samkhya cosmology. This justifies the assump
tion that Kapila s doctrine was probably theistic. But there are
a few other points of difference between the Kapila and the
Patafljala Samkhya (Yoga). The only supposition that may
be ventured is that Paflcasikha probably modified Kapila s
work in an atheistic way and passed it as Kapila s work. If this
supposition is held reasonable, then we have three strata of
Samkhya, first a theistic one, the details of which are lost, but
which is kept in a modified form by the Patafljala school of Sam
khya, second an atheistic one as represented by PaftcaSikha, and
a third atheistic modification as the orthodox Samkhya system.
An important change in the Samkhya doctrine seems to have
been introduced by Vijflana Bhiksu (sixteenth century A.D.) by his
treatment of gunas as types of reals. I have myself accepted this
interpretation of Samkhya as the most rational and philosophical
one, and have therefore followed it in giving a connected system
of the accepted Kapila and the Patafljala school of Samkhya. But
it must be pointed out that originally the notion of gunas was
applied to different types of good and bad mental states, and then
they were supposed in some mysterious way by mutual increase
and decrease to form the objective world on the one hand and the
1 Tarkarahasyadtpika, p. 109.
1 evam sadvimfakam prahuh iariramih mdnavdh idmkhyam samkhy&tmakatv&cca
kapiladibhirucyate . Matsyapurana, IV. 28.
222 The Kapila and the Patanjala Samkhya [CH.
totality of human psychosis on the other. A systematic explana-
nation of the gunas was attempted in two, different lines by
Vijftana Bhiksu and the Vaisnava writer Venkata 1 . As the Yoga
philosophy compiled by Patafljali and commented on by Vyasa,
Vacaspati and Vijflana Bhiksu, agree with the Samkhya doctrine
as explained by Vacaspati and Vijflana Bhiksu in most points I
have preferred to call them the Kapila and the Patanjala schools
of Samkhya and have treated them together a principle which
was followed by Haribhadra in his Saddarsanasamuccaya.
The other important Samkhya teachers mentioned by Gauda-
p5da are Sanaka, Sananda, Sanatana and Vodhu. Nothing is
Known about their historicity or doctrines.
Sarnkhya karika, Samkhya sutra, Vacaspati Misra and
Vijftana Bhiksu.
A word of explanation is necessary as regards my inter
pretation of the Samkhya-Yoga system. The Samkhya kdrikd is
the oldest Samkhya text on which we have commentaries by
later writers. The Samkhya sutra was not referred to by any
writer until it was commented upon by Aniruddha (fifteenth
centrry A.D.). Even Gunaratna of the fourteenth century A.D. who
made allusions to a number of Sarnkhya works, did not make any
reference to the Samkhya sutra, and no other writer who is known
to have flourished before Gunaratna seems to have made any
reference to the Samkhya sutra. The natural conclusion therefore
is that these sutras were probably written some time after
the fourteenth century. But there is no positive evidence to
prove that it was so late a work as the fifteenth century. It is
said at the end of the Samkhya kdrikd of Isvarakrsna that the
karikas give an exposition of the Sarnkhya doctrine excluding
the refutations of the doctrines of other people and excluding the
parables attached to the original Samkhya works the Sastitan-
trasdstra. The Samkhya sutras contain refutations of other doc
trines and also a number of parables. It is not improbable that
these were collected from some earlier Sarnkhya work which is
now lost to us. It may be that it was done from some later edition
of the Sastitantrasdstra (Sastitantroddhdra as mentioned by
1 Verikata s philosophy will be dealt with in the second volume of the present
work.
vn] Interpretations of Samkhya 223
Gunaratna), but this is a mere conjecture. There is no reason to
suppose that the Samkhya doctrine found in the sutras differs in
any important way from the Samkhya doctrine as found in the
Samkhya kdrikd. The only point of importance is this, that the
Samkhya sutras hold that when the Upanisads spoke of one ab
solute pure intelligence they meant to speak of unity as involved
in the class of intelligent purusas as distinct from the class of
the gunas. As all purusas were of the nature of pure intelligence,
they were spoken of in the Upanisads as one, for they all form
the category or class of pure intelligence, and hence may in some
sense be regarded as one. This compromise cannot be found in
the Sdmkkya kdrikd. This is, however, a case of omission and not
of difference. Vijftana Bhiksu, the commentator of the Sam
khya sutra, was more inclined to theistic Samkhya or Yoga than
to atheistic Samkhya. This is proved by his own remarks in
his Sdmkhyapravacanabhdsya^ Yogavdrttika, and Vijnandmrta-
bhdsya (an independent commentary on the Brahmasutras of
Badarayana on theistic Samkhya lines). Vijflana Bhiksu s own
view could not properly be called a thorough Yoga view, for he
agreed more with the views of the Samkhya doctrine of the
Puranas, where both the diverse purusas and the prakrti are said
to be merged in the end in IsVara, by whose will the creative
process again began in the prakrti at the end of each pralaya.
He could not avoid the distinctively atheistic arguments of the
Samkhya sutras, but he remarked that these were used only with
a view to showing that the Samkhya system gave such a rational
explanation that even without the intervention of an Ivara it could
explain all facts. Vijflana Bhiksu in his interpretation of Samkhya
differed on many points from those of Vacaspati, and it is difficult
to say who is right Vijflana Bhiksu has this advantage that
he has boldly tried to give interpretations on some difficult points
on which Vacaspati remained silent. I refer principally to the
nature of the conception of the gunas, which I believe is the most
important thing in Samkhya. Vijflana Bhiksu described the
gunas as reals or super-subtle substances, but Vacaspati and
GaudapSda (the other commentator of the Samkhya kdrikd)
remained silent on the point. There is nothing, however, in their
interpretations which would militate against the interpretation of
Vijflana Bhiksu, but yet while they were silent as to any definite
explanations regarding the nature of the gunas, Bhiksu definitely
224 The Kapila and the Patanjala Samkhya [CH.
came forward with a very satisfactory and rational interpretation
of their nature.
Since no definite explanation of the gunas is found in any
other work before Bhiksu, it is quite probable that this matter
may not have been definitely worked out before. Neither Caraka
nor the Mahdbhdrata explains the nature of the gunas. But
Bhiksu s interpretation suits exceedingly well all that is known
of the manifestations and the workings of the gunas in all early
documents. I have therefore accepted the interpretation of Bhiksu
in giving my account of the nature of the gunas. The Kdrikd
speaks of the gunas as being of the nature of pleasure, pain, and
dullness (sattva, rajas and tamas). It also describes sattva as
being light and illuminating, rajas as of the nature of energy and
causing motion, and tamas as heavy and obstructing. Vacaspati
merely paraphrases this statement of \hzKdrikd but does not enter
into any further explanations. Bhiksu s interpretation fits in well
with all that is known of the gunas, though it is quite possible
that this view might not have been known before, and when the
original Samkhya doctrine was formulated there was a real vague
ness as to the conception of the gunas.
There are some other points in which Bhiksu s interpretation
differs from that of Vacaspati. The most important of these may
be mentioned here. The first is the nature of the connection of
the buddhi states with the purusa. Vacaspati holds that there is
no contact (samyogd) of any buddhi state with the purusa but that
a reflection of the purusa is caught in the state of buddhi by
virtue of which the buddhi state becomes intelligized and trans
formed into consciousness. But this view is open to the objection
that it does not explain how the purusa can be said to be the
experiencer of the conscious states of the buddhi, for its reflection
in the buddhi is merely an image, and there cannot be an ex
perience (bhogd) on the basis of that image alone without any
actual connection of the purusa with the buddhi. The answer of
Vacaspati Misra is that there is no contact of the two in space
and time, but that their proximity (sannidhf) means only a specific
kind of fitness (yogyatd) by virtue of which the purusa, though it
remains aloof, is yet felt to be united and identified in the buddhi,
and as a result of that the states of the buddhi appear as ascribed
to a person. Vijflana Bhiksu differs from Vacaspati and says that
if such a special kind of fitness be admitted, then there is no
vnj Interpretations of Bhiksu and Vacaspati 225
reason why purusa should be deprived of such a fitness at the time
of emancipation, and thus there would be no emancipation at all,
for the fitness being in the purusa, he could not be divested of it,
and he would continue to enjoy the experiences represented in
the buddhi for ever. Vijflana Bhiksu thus holds that there is a
real contact of the purusa with the buddhi state in any cognitive
state. Such a contact of the purusa and the buddhi does not
necessarily mean that the former will be liable to change on
account of it, for contact and change are not synonymous. Change
means the rise of new qualities. It is the buddhi which suffers
changes, and when these changes are reflected in the purusa, there
is the notion of a person or experiencer in the purusa, and when
the purusa is reflected back in the buddhi the buddhi state appears
as a conscious state. The second, is the difference between
Vacaspati and Bhiksu as regards the nature of the perceptual
process. Bhiksu thinks that the senses can directly perceive the
determinate qualities of things without any intervention of manas,
whereas Vacaspati ascribes to manas the power of arranging the
sense-data in a definite order and of making the indeterminate
sense-data determinate. With him the first stage of cognition is
the stage when indeterminate sense materials are first presented, at
the next stage there is assimilation, differentiation, and association
by which the indeterminate materials are ordered and classified
by the activity of manas called samkalpa which coordinates the
indeterminate sense materials into determinate perceptual and
conceptual forms as class notions with particular characteristics.
Bhiksu who supposes that the determinate character of things is
directly perceived by the senses has necessarily to assign a sub
ordinate position to manas as being only the faculty of desire,
doubt, and imagination.
It may not be out of place to mention here that there are
one or two passages in Vacaspati s commentary on the Sdmkhya
k&fikd which seem to suggest that he considered the ego (aham-
kdra) as producing the subjective series of the senses and the
objective series of the external world by a sort of desire or will,
but he did not work out this doctrine, and it is therefore not
necessary to enlarge upon it. There is also a difference of view
with regard to the evolution of the tanmatras from the mahat;
for contrary to the view of Vydsabhdsya and Vijflana Bhiksu etc.
Vacaspati holds that from the mahat there was ahamkara and
D. 15
226 The Kapila and the Patanjala Samkhya [CH.
from ahamkara the tanmatras 1 . Vijflana Bhiksu however holds that
both the separation of ahamkara and the evolution of the tanmatras
take place in the mahat, and as this appeared to me to be more
reasonable, I have followed this interpretation. There are some
other minor points of difference about the Yoga doctrines between
Vacaspati and Bhiksu which are not of much philosophical
importance.
Yoga and Patahjali.
The word yoga occurs in the Rg-Veda in various senses such
as yoking or harnessing, achieving the unachieved, connection,
and the like. The sense of yoking is not so frequent as the
other senses; but it is nevertheless true that the word was
used in this sense in Rg-Veda and in such later Vedic works as
the Satapatha Brahmana and the Brhadaranyaka Upanisad 3 . The
word has another derivative " yugya" in later Sanskrit literature 8 .
With the growth of religious and philosophical ideas in the
Rg-Veda, we find that the religious austerities were generally very
much valued. Tapas (asceticism) and brahmacarya (the holy vow
of celibacy and life-long study) were regarded as greatest virtues
and considered as being productive of the highest power 4 .
As these ideas of asceticism and self-control grew the force
of the flying passions was felt to be as uncontrollable as that of
a spirited steed, and thus the word yoga which was originally
applied to the control of steeds began to be applied to the control
of the senses 8 .
In Panini s time the word yoga had attained its technical
meaning, and he distinguished this root "yuj samddhau " (yuj
in the sense of concentration) from " yujir yoge " (root yujir in
the sense of connecting). Yuj in the first sense is seldom used as
a verb. It is more or less an imaginary root for the etymological
derivation of the word yoga 8 .
1 See my Study of Patanjali, p. 60 ff.
2 Compare R.V. i. 34. 9/vn. 67. 8/m. 27. n/x. 30. n/x. 114. 9/iv. 24. 4/1. 5.
3/1. 30. 7; Datapaths Brahmana 14. 7. i. 11.
3 It is probably an old word of the Aryan stock; compare German Joch, A.S.
geoc, Latin jugum.
4 See Chandogya in. 17. 4; Brh. I. 2. 6; Brh. in. 8. 10; Taitt. I. 9. i/m. i. i/ni.
3. i ; Taitt. Bran. n. 2. 3. 3 ; R.V. x. 129; Satap. Brah. xi. 5. 8. i.
6 Katha III. 4, indriyani hayanahuh visay&ttsugocaran. The senses are the horses
and whatever they grasp are their objects. Maitr. 2. 6. Karmendriyanyasya hayah
the conative senses are its horses.
6 Yugyah is used from the root of yujir yoge and not from yuja samddhau. A con
sideration of Panini s rule "Tadasya brahmacaryam," V. i. 94 shows that not only
vn] Antiquity of Yoga 227
In the Bhagavadgltd, we find that the word yoga has been
used not only in conformity with the root " yuj-samddhau " but
also with " yujir yoge" This has been the source of some confu
sion to the readers of the Bhagavadgltd. "Yogin" in the sense
of a person who has lost himself in meditation is there regarded
with extreme veneration. One of the main features of the use of
this word lies in this that the Bhagavadgitd tried to mark out a
middle path between the austere discipline of meditative abstrac
tion on the one hand and the course of duties of sacrificial action
of a Vedic worshipper in the life of a new type of Yogin (evidently
from yujir yoge} on the other, who should combine in himself the
best parts of the two paths, devote himself to his duties, and yet
abstract himself from all selfish motives associated with desires.
Kautilya in his A rthasdstra when enumerating the philosophic
sciences of study names Samkhya, Yoga, and Lokayata. The
oddest Buddhist sutras ^e.g. the Satipatthdna sutta) are fully
familiar with the stages of Yoga concentration. We may thus
infer that self-concentration and Yoga had developed as a tech
nical method of mystic absorption some time before the Buddha.
As regards the connection of Yoga with Samkhya, as we find
it in the Yoga sutras of Patafljali, it is indeed difficult to come to
any definite conclusion. The science of breath had attracted
notice in many of the earlier Upanisads, though there had not
probably developed any systematic form of pranayama (a system
of breath control) of the Yoga system. It is only when we
come to MaitrayanI that we find that the Yoga method had at
tained a systematic development. The other two Upanisads in
which the Yoga ideas can be traced are the vetasvatara and
the Katha. It is indeed curious to notice that these three
Upanisads of Krsna Yajurveda, where we find reference to Yoga
methods, are the only ones where we find clear references also to
the Samkhya tenets, though the Samkhya and Yoga ideas do not
appear there as related to each other or associated as parts of
the same system. But there is a remarkable passage in the
MaitrayanI in the conversation between akyayana and Brhad
ratha where we find that the Samkhya metaphysics was offered
different kinds of asceticism and rigour which passed by the name of brahmacarya
were prevalent in the country at the time (Panini as Goldstiicker has proved is pre-
buddhistic), but associated with these had grown up a definite system of mental
discipline which passed by the name of Yoga.
152
228 The Kapila and the Patanjala Samkhya [CH.
in some quarters to explain the validity of the Yoga processes,
and it seems therefore that the association and grafting of the
Samkhya metaphysics on the Yoga system as its basis, was the
work of the followers of this school of ideas which was subsequently
systematized by Pataftjali. Thus akyayana says : " Here some
say it is the guna which through the differences of nature goes
into bondage to the will, and that deliverance takes place when
the fault of the will has been removed, because he sees by the
mind; and all that we call desire, imagination, doubt, belief, un
belief, certainty, uncertainty, shame, thought, fear, all that is but
mind. Carried along by the waves of the qualities darkened in
his imagination, unstable, fickle, crippled, full of desires, vacil
lating he enters into belief, believing I am he, this is mine, and
he binds his self by his self as a bird with a net. Therefore, a
man being possessed of will, imagination and belief is a slave,
but he who is the opposite is free. For this reason let a man
stand free from will, imagination and belief this is the sign of
liberty, this is the path that leads to Brahman, this is the opening
of the door, and through it he will go to the other shore of dark
ness. All desires are there fulfilled. And for this, they quote a
verse: When the five instruments of knowledge stand still together
with the mind, and when the intellect does not move, that is called
the highest state 1 . "
An examination of such Yoga Upanisads as andilya, Yoga-
tattva, Dhyanabindu, Hamsa, Amrtanada, Varaha, Mandala
Brahmana, Nadabindu, and Yogakundall, shows that the Yoga
practices had undergone diverse changes in diverse schools, but
none of these show any predilection for the Samkhya. Thus the
Yoga practices grew in accordance with the doctrines of the
1 Vatsyayana, however, in his bhasya on Nyaya sutra, I. i. 19, distinguishes
Samkhya from Yoga in the following way: The Samkhya holds that nothing can
come into being nor be destroyed, there cannot be any change in the pure intelligence
(niratisayah cetandh). All changes are due to changes in the body, the senses, the
manas and the objects. Yoga holds that all creation is due to the karma of the purusa.
Dosas (passions) and the pravrtti (action) are the cause of karma. The intelligences
or souls (cetana) are associated with qualities. Non-being can come into being and
what is produced may be destroyed. The last view is indeed quite different from
the Yoga of Vyasabkdsya. It is closer to Nyaya in its doctrines. If Vatsyayana s
statement is correct, it would appear that the doctrine of there being a moral purpose
in creation was borrowed by Samkhya from Yoga. Udyotakara s remarks on the same
sutra do not indicate a difference but an agreement between Samkhya and Yoga on the
doctrine of the indriyas being " abkautika. " Curiously enough Vatsyayana quotes a
passage from Vyasabhasya, in. 13, in his bhasya, I. ii. 6, and criticizes it as self-con
tradictory (viruddha).
vn] Patanjali, a Compiler 229
Saivas and aktas and assumed a peculiar form as the Mantra-
yoga; they grew in another direction as the Hathayoga which
was supposed to produce mystic and magical feats through
constant practices of elaborate nervous exercises, which were also
associated with healing and other supernatural powers. The
Yogatattva Upanisad says that there are four kinds of yoga, the
Mantra Yoga, Laya Yoga, Hathayogaand Rajayoga 1 . Insomecases
we find that there was a great attempt even to associate Vedantism
with these mystic practices. The influence of these practices in
the development of Tantra and other modes of worship was also
very great, but we have to leave out these from our present
consideration as they have little philosophic importance and as
they are not connected with our present endeavour.
Of the Pataftjala school of Samkhya, which forms the subject of
the Yoga with which we are now dealing, Patafijali was probably
the most notable person for he not only collected the different
forms of Yoga practices, and gleaned the diverse ideas which
were or could be associated with the Yoga, but grafted them all
on the Samkhya metaphysics, and gave them the form in which
they have been handed down to us. Vacaspati and Vijflana
Bhiksu, the two great commentators on the Vydsabhdsya, agree
with us in holding that Patafljali was not the founder of the Yoga,
but an editor. Analytic study of the sutras also brings the con
viction that the sutras do not show any original attempt, but a
masterly and systematic compilation which was also supple
mented by fitting contributions. The systematic manner also
in which the first three chapters are written by way of definition
and classification shows that the materials were already in
existence and that Patafljali only systematized them. There was
no missionizing zeal, no attempt to overthrow the doctrines of
other systems, except as far as they might come in, by way of
explaining the system. Patafljali is not even anxious to establish
the system, but he is only engaged in systematizing the facts
as he had them. Most of the criticisms against the Buddhists
occur in the last chapter. The doctrines of the Yoga are
described in the first three chapters, and this part is separated
from the last chapter where the views of the Buddhists are
1 The Yoga writer Jaigisavya wrote " DhdranaJastra" which dealt with Yoga more
in the fashion of Tantra than that given by Patafijali. He mentions different places
in the body (e.g. heart, throat, tip of the nose, palate, forehead, centre of the brain)
which are centres of memory where concentration is to i made. See Vacaspati s
Tatparyatlkd or Vatsyayana s bhasya on Nyaya sutra, III. ii. 43.
230 The Kapila and the Patanjala Samkhya [CH.
criticized; the putting of an "iti" (the word to denote the conclu
sion of any work) at the end of the third chapter is evidently to
denote the conclusion of his Yoga compilation. There is of course
another " iti " at the end of the fourth chapter to denote the
conclusion of the whole work. The most legitimate hypothesis
seems to be that the last chapter is a subsequent addition by a
hand other than that of Patafijali who was anxious to supply
some new links of argument which were felt to be necessary for
the strengthening of the Yoga position from an internal point of
view, as well as for securing the strength of the Yoga from the
supposed attacks of Buddhist metaphysics. There is also a
marked change (due either to its supplementary character or
to the manipulation of a foreign hand) in the style of the last
chapter as compared with the style of the other three.
The sutras, 30-34, of the last chapter seem to repeat what
has already been said in the second chapter and some of the
topics introduced are such that they could well have been
dealt with in a more relevant manner in connection with similar
discussions in the preceding chapters. The extent of this chapter
is also disproportionately small, as it contains only 34 sutras,
whereas the average number of sutras in other chapters is between
51 toss.
We have now to meet the vexed question of the probable date
of this famous Yoga author Patafijali. Weber had tried to con
nect him with Kapya Patamchala of atapatha Brahmana 1 ; in
Katyayana s Vdrttika we get the name Patafijali which is ex
plained by later commentators as patantah anjalayah yasmai (for
whom the hands are folded as a mark of reverence), but it is indeed
difficult to come to any conclusion merely from the similarity of
names. There is however another theory which identifies the
writer of the great commentary on Panini called the Mahd-
bhdsya with the Patafijali of the Yoga sutra. This theory has been
accepted by many western scholars probably on the strength of
some Indian commentators who identified the two Patafijalis.
Of these one is the writer of the Patanjalicarita (Ramabhadra
Dlksita) who could not have flourished earlier than the eighteenth
century. The other is that cited in Sivarama s commentary on
Vdsavadatta which Aufrecht assigns to the eighteenth century.
The other two are king Bhoja of Dhar and Cakrapanidatta,
1 Weber s History of Indian Literature, p. 223 n.
vn] Identity of Pataftjali 231
the commentator of Caraka, who belonged to the eleventh
century A.D. Thus Cakrapani says that he adores the Ahipati
(mythical serpent chief) who removed the defects of mind, speech
and body by his Pdtahjala mahdbhdsya and the revision of
Caraka. Bhoja says : " Victory be to the luminous words of
that illustrious sovereign Ranarangamalla who by composing his
grammar, by writing his commentary on the Patafijala and by
producing a treatise on medicine called Rdjamrganka has like the
lord of the holder of serpents removed defilement from speech,
mind and body." The adoration hymn of Vyasa (which is con
sidered to be an interpolation even by orthodox scholars) is also
based upon the same tradition. It is not impossible therefore that
the later Indian commentators might have made some confusion
between the three Patafljalis, the grammarian, the Yoga editor,
and the medical writer to whom is ascribed the book known as
Pdtahjalatantra, and whq has been quoted by ivadasa in his
commentary on Cakradatta in connection with the heating of
metals.
Professor J. H. Woods of Harvard University is therefore
in a way justified in his unwillingness to identify the gram
marian and the Yoga editor on the slender evidence of these
commentators. It is indeed curious to notice that the great
commentators of the grammar school such as Bhartrhari, Kaiy-
yata, Vamana, Jayaditya, Nagea, etc. are silent on this point.
This is indeed a point against the identification of the two
Patafijalis by some Yoga and medical commentators of a later
age. And if other proofs are available which go against such
an identification, we could not think the grammarian and the
Yoga writer to be the same person.
Let us now see if Patafljali s grammatical work contains any
thing which may lead us to think that he was not the same
person as the writer on Yoga. Professor Woods supposes that the
philosophic concept of substance (dravya) of the two Patafljalis
differs and therefore they cannot be identified. He holds that
dravya is described in Vydsabhdsya in one place as being the
unity of species and qualities (sdmdnyavisesdtmaka), whereas
the Mahdbhdsya holds that a dravya denotes a genus and also
specific qualities according as the emphasis or stress is laid on
either side. I fail to see how these ideas are totally antago
nistic. Moreover, we know that these two views were held by
232 The Kapila and the Patanjala Samkhya [CH.
Vyadi and Vajapyayana (Vyadi holding that words denoted
qualities or dravya and Vajapyayana holding that words denoted
species 1 ). Even Panini had these two different ideas in "jdtydkhyd-
ydmekasmin bahuvacanamanyatarasydm" and " sar updnameka-
sesamekavibhaktau" and Patafljali the writer of the Mahdbhdsya
only combined these two views. This does not show that he
opposes the view of Vydsabhdsya, though we must remember
that even if he did, that would not prove anything with regard
to the writer of the sutras. Moreover, when we read that dravya
is spoken of in the Mahdbhdsya as that object which is the
specific kind of the conglomeration of its parts, just as a cow is
of its tail, hoofs, horns, etc. " yat sdsndldngulakakudakhura-
visdnyartharupam" we are reminded of its similarity with
" ayutasiddhdvayavabheddnugatah samuhah dravyam " (a con
glomeration of interrelated parts is called dravya) in the Vydsa-
bhdsya. So far as I have examined the Mahdbhdsya I have
not been able to discover anything there which can warrant us
in holding that the two Pataftjalis cannot be identified. There
are no doubt many apparent divergences of view, but even
in these it is only the traditional views of the old grammarians
that are exposed and reconciled, and it would be very un
warrantable for us to judge anything about the personal views
of the grammarian from them. I am also convinced that the
writer of the Mahdbkdsya knew most of the important points of
the Samkhya- Yoga metaphysics; as a few examples I may refer
to the guna theory (I. 2. 64, 4. I. 3), the Samkhya dictum of ex
nihilo nihil fit (i. I. 56), the ideas of time (2. 2. 5, 3. 2. 123), the
idea of the return of similars into similars (i. I. 50), the idea of
change vikdra as production of new qualities gundntarddhdna
(5. 1.2, 5. i. 3) and the distinction of indriya and Buddhi (3. 3. 1 33).
We may add to it that the Mahdbhdsya agrees with the Yoga
view as regards the Sphotavada, which is not held in common
by any other school of Indian philosophy. There is also this
external similarity, that unlike any other work they both begin
their works in a similar manner (atha yogdnusdsa nam and atha
sdbddnusdsanam) " now begins the compilation of the instruc
tions on Yoga" (Yoga sutrd) and "now begins the compilation
of the instructions of words" (Mahdbhdsya).
It may further be noticed in this connection that the arguments
1 Patafijali s Mahdbhdsya, I. 2. 64.
vi i] Kitab Patanjal 233
which Professor Woods has adduced to assign the date of the
Yoga sutra between 300 and 500 A.D. are not at all conclusive,
as they stand on a weak basis ; for firstly if the two Patafljalis
cannot be identified, it does not follow that the editor of the
Yoga should necessarily be made later; secondly, the supposed
Buddhist 1 reference is found in the fourth chapter which, as I
have shown above, is a later interpolation; thirdly, even if they
were written by Pataftjali it cannot be inferred that because
Vacaspati describes the opposite school as being of the Vijftana-
vadi type, we are to infer that the sutras refer to Vasubandhu or
even to Nagarjuna, for such ideas as have been refuted in the sutras
had been developing long before the time of Nagarjuna.
Thus we see that though the tradition of later commentators
may not be accepted as a sufficient ground to identify the two
Patafljalis, we cannot discover anything from a comparative
critical study of the Yoga sutras and the text of the Mahd-
bhdsya, which can lead us to say that the writer of the Yoga
sutras flourished at a later date than the other Pataftjali.
Postponing our views about the time of Pataftjali the Yoga
editor, I regret I have to increase the confusion by introducing
the other work Kitab Patanjal, of which Alberuni speaks, for
our consideration. Alberuni considers this work as a very famous
one and he translates it along with another book called Sdnka
(Samkhya) ascribed to Kapila. This book was written in the
form of dialogue between master and pupil, and it is certain that
this book was not the present Yoga sutra of Pataftjali, though it
had the same aim as the latter, namely the search for liberation
and for the union of the soul with the object of its meditation.
The book was called by Alberuni Kitab Patanjal, which is to
be translated as the book of Patafljala, because in another place,
speaking of its author, he puts in a Persian phrase which when
translated stands as "the author of the book of Patanjal." It
had also an elaborate commentary from which Alberuni quotes
many extracts, though he does not tell us the author s name. It
treats of God, soul, bondage, karma, salvation, etc., as we find in
the Yoga sutra, but the manner in which these are described (so
1 It is important to notice that the most important Buddhist reference nacaika-
cittatantram vastu tadapram&nakam tada kim syat (iv. 16) was probably a line of the
Vyasabhasya, as Bhoja, who had consulted many commentaries as he says in the
preface, does not count it as a sutra.
234 The Kapila and the Patanjala Samkhya [CH.
far as can be judged from the copious extracts supplied by
Alberuni) shows that these ideas had undergone some change
from what we find in the Yoga sutra. Following the idea of God
in Alberuni we find that he retains his character as a timeless
emancipated being, but he speaks, hands over the Vedas and
shows the way to Yoga and inspires men in such a way that they
could obtain by cogitation what he bestowed on them. The name
of God proves his existence, for there cannot exist anything of
which the name existed, but not the thing. The soul perceives
him and thought comprehends his qualities. Meditation is iden
tical with worshipping him exclusively, and by practising it
uninterruptedly the individual comes into supreme absorption
with him and beatitude is obtained 1 .
The idea of soul is the same as we find in the Yoga sutra.
The idea of metempsychosis is also the same. He speaks of the
eight siddhis (miraculous powers) at the first stage of meditation
on the unity of God. Then follow the other four stages of medi
tation corresponding to the four stages we have as in the Yoga
sutrc He gives four kinds of ways for the achievement of salvation,
of which the first is the abhydsa (habit) of Patafijali, and the
object of this abhyasa is unity with God 2 . The second stands
for vairagya ; the third is the worship of God with a view to seek
his favour in the attainment of salvation (cf. Yoga sutra, I. 23 and
I. 29). The fourth is a new introduction, namely that of rasa-
yana or alchemy. As regards liberation the view is almost the
same as in the Yoga sutra, II. 25 and IV. 34, but the liberated
state is spoken of in one place as absorption in God or being
one with him. The Brahman is conceived as an urddhvamula
avdksdkha asvattha (a tree with roots upwards and branches
below), after the Upanisad fashion, the upper root is pure
Brahman, the trunk is Veda, the branches are the different
doctrines and schools, its leaves are the different modes of inter
pretation. Its nourishment comes from the three forces ; the
1 Cf. Yoga sutra i. 23-29 and II. i, 45. The Yoga sutras speak of Is"vara (God)
as an eternally emancipated purusa, omniscient, and the teacher of all past teachers.
By meditating on him many of the obstacles such as illness, etc., which stand in the
way of Yoga practice are removed. He is regarded as one of the alternative objects
of concentration. The commentator Vyasa notes that he is the best object, for being
drawn towards the Yogin by his concentration He so wills that he can easily attain
concentration and through it salvation. No argument is given in the Yoga sutras of
the existence of God.
2 Cf. Yoga ii. i.
vn] Patanjali of Kitab Patanjal 235
object of the worshipper is to leave the tree and go back to the
roots.
The difference of this system from that of the Yoga sutra is :
(i) the conception of God has risen here to such an importance
that he has become the only object of meditation, and absorption
in him is the goal ; (2) the importance of the yama 1 and the
niyama has been reduced to the minimum ; (3) the value of the
Yoga discipline as a separate means of salvation apart from any
connection with God as we find in the Yoga sutra has been lost
sight of; (4) liberation and Yoga are defined as absorption in
God ; (5) the introduction of Brahman ; (6) the very significance
of Yoga as control of mental states (cittavrttinirodhd) is lost
sight of, and (7) rasayana (alchemy) is introduced as one of the
means of salvation.
From this we can fairly assume that this was a new modi
fication of the Yoga doctrine on the basis of Pataftjali s Yoga
sutra in the direction of Vedanta and Tantra, and as such it
probably stands as the transition link through which the Yoga
doctrine of the sutras entered into a new channel in such a way
that it could be easily assimilated from there by later develop
ments of Vedanta, Tantra and aiva doctrines 2 . As the author
mentions rasayana as a means of salvation, it is very probable
that he flourished after Nagarjuna and was probably the same
person who wrote Pdtanjala tantra, who has been quoted by
bivadasa in connection with alchemical matters and spoken of
by Nagesa as "Carake Patafijalih." We can also assume with some
degree of probability that it is with reference to this man that
Cakrapani and Bhoja made the confusion of identifying him with
the writer of the Mahdbhdsya, It is also very probable that Cakra
pani by his line " patanjalamahdbhdsyacarakapratisamskrtaih"
refers to this work which was called " Pataftjala." The commen
tator of this work gives some description of the lokas, dvlpas and
the sagaras, which runs counter to the descriptions given in the
Vydsabhdsya, III. 26, and from this we can infer that it was pro
bably written at a time when the VydsabJtdsya was not written
or had not attained any great sanctity or authority. Alberuni
1 Alberuni, in his account of the book of Samkhya, gives a list of commandments
which practically is the same as yama and niyama, but it is said that through them
one cannot attain salvation.
2 Cf. the account of Paiupatadariana in Saruadarianasamgraha.
236 The Kapila and the Patanjala Samkhya [CH.
also described the book as being very famous at the time, and
Bhoja and Cakrapani also probably confused him with Patafljali
the grammarian ; from this we can fairly assume that this book
of Patafijali was probably written by some other Patafljali within
the first 300 or 400 years of the Christian era; and it may not
be improbable that when Vydsabhdsya quotes in III. 44 as " iti
Patafijalih," he refers to this Patafljali.
The conception of Yoga as we meet it in the Maitrayana
Upanisad consisted of six angas or accessories, namely prana-
yama, pratyhara, dhyana, dharana, tarka and samadhi 1 . Com
paring this list with that of the list in the Yoga sutras we find
that two new elements have been added, and tarka has been
replaced by asana. Now from the account of the sixty-two
heresies given in the Brahmajdla sutta we know that there were
people who either from meditation of three degrees or through
logic and reasoning had come to believe that both the external
world as a whole and individual souls were eternal. From the
association of this last mentioned logical school with the Samadhi
or Dhyana school as belonging to one class of thinkers called
Sasvatavada, and from the inclusion of tarka as an anga in
samadhi, we can fairly assume that the last of the arigas given in
MaitrayanI Upanisad represents the oldest list of the Yoga doc
trine, when the Samkhya and the Yoga were in a process of being
grafted on each other, and when the Samkhya method of dis
cussion did not stand as a method independent of the Yoga. The
substitution of asana for tarka in the list of Patafljali shows that
the Yoga had developed a method separate from the Samkhya.
The introduction of ahimsa (non-injury), satya (truthfulness),
asteya (want of stealing), brahmacaryya (sex-control), aparigraha
(want of greed) as yama and sauca (purity), santosa (content
ment) as niyama, as a system of morality without which Yoga is
deemed impossible (for the first time in the sutras), probably
marks the period when the disputes between the Hindus and the
Buddhists had not become so keen. The introduction of maitrl,
karuna, mudita, upeksa is also equally significant, as we do not
find them mentioned in such a prominent form in any other
literature of the Hindus dealing with the subject of emancipa
tion. Beginning from the Acdrdhgasutra, Uttarddhyayanasutra,
1 prdndydmah pratydhdrah dhydnam dhdrand tarkah sam&dhih sadahga ityucyate
yogah (Maitr. 6. 8).
vn] Yoga and Buddhism 237
the Sutrakrtdngasutra, etc., and passing through Umasvati s Tat-
tvdrthddhigamasutra to Hemacandra s Yogasdstra we find that
the Jains had been founding their Yoga discipline mainly on the
basis of a system of morality indicated by the yamas, and the
opinion expressed in Alberuni s Pdtanjal that these cannot give
salvation marks the divergence of the Hindus in later days from
the Jains. Another important characteristic of Yoga is its
thoroughly pessimistic tone. Its treatment of sorrow in connec
tion with the statement of the scope and ideal of Yoga is the
same as that of the four sacred truths of the Buddhists, namely
suffering, origin of suffering, the removal of suffering; and of the
path to the removal of suffering 1 . Again, the metaphysics of the
samsara (rebirth) cycle in connection with sorrow, origination,
decease, rebirth, etc. is described with a remarkable degree of
similarity with the cycle of causes as described in early Buddhism.
Avidya is placed at the head of the group; yet this avidya should
not be confused with the Vedanta avidya of &ankara, as it is an
avidya of the Buddhist type ; it is not a cosmic power of illusion
nor anything like a mysterious original sin, but it is within the
range of earthly tangible reality. Yoga avidya is the ignorance
of the four sacred truths, as we have in the sutra " anitydsuciduh-
khdndtmasu nityasuciduhkhdtmakhydtiravidyd" (II. 5).
The ground of our existing is our will to live (abhiniveSd).
"This is our besetting sin that we will to be, that we will to be
ourselves, that we fondly will our being to blend with other kinds
of existence and extend. The negation of the will to be, cuts
off being for us at least 2 ." This is true as much of Buddhism as
of the Yoga abhiniveSa, which is a term coined and used in the
Yoga for the first time to suit the Buddhist idea, and which has
never been accepted, so far as I know, in any other Hindu
literature in this sense. My sole aim in pointing out these things
in this section is to show that the Yoga sutras proper (first three
chapters) were composed at a time when the later forms of
Buddhism had not developed, and when the quarrels between
the Hindus and the Buddhists and Jains had not reached such
1 Yoga sutra, II. 15, 16, 17. Yathdcikitsdfdstram caturuyukam rogo rogahttuh
Arogyam bhaifajyamiti evamidamapi Sastram caturvyuhameva ; tody at ha samsdrah,
samsarahetuh moksah moksopayah; duhkhabahulah samsaro heyah,pradhanapurusayok
satpyogo heyaketuh, saipyogasy&tyantiki nivrttirhanam hanop&yah samyagdarfanam,
Vydsabhdsya, n. 15
2 Oldenberg s Buddhism 1 .
238 The Kapila and the Patanjala Samkhya [CH.
a stage that they would not like to borrow from one another.
As this can only be held true of earlier Buddhism I am disposed
to think that the date of the first three chapters of the Yoga
sutras must be placed about the second century B.C. Since there
is no evidence which can stand in the way of identifying the
grammarian Pataftjali with the Yoga writer, I believe we may
take them as being identical 1 .
The Samkhya and the Yoga Doctrine of Soul or Purusa.
The Samkhya philosophy as we have it now admits two prin
ciples, souls and prakrti, the root principle of matter. Souls are
many, like the Jaina souls, but they are without parts and qualities.
They do not contract or expand according as they occupy a
smaller or a larger body, but are always all-pervasive, and are
not contained in the bodies in which they are manifested. But
the relation between body or rather the mind associated with it
and soul is such that whatever mental phenomena happen in the
mind are interpreted as the experience of its soul. The souls are
many, and had it not been so (the Samkhya argues) with the
birth of one all would have been born and with the death of one
all would have died 2 .
The exact nature of soul is however very difficult of compre
hension, and yet it is exactly this which one must thoroughly
grasp in order to understand the Samkhya philosophy. Unlike
the Jaina soul possessing anantajndna, anantadarsana, ananta-
sukka, and anantavlryya, the Samkhya soul is described as being
devoid of any and every characteristic; but its nature is abso
lute pure consciousness ( /). The Samkhya view differs from
the Vedanta, firstly in this that it does not consider the soul to
be of the nature of pure intelligence and bliss (anandd)*. Bliss
with Samkhya is but another name for pleasure and as such it
belongs to prakrti and does not constitute the nature of soul ;
secondly, according to Vedanta the individual souls (jiva) are
1 See S. N. Das Gupta, Yoga Philosophy in relation to other Indian systems of
thought, ch. II. The most important point in favour of this identification seems to be
that both the Patafijalis as against the other Indian systems admitted the doctrine of
sphota which was denied even by Samkhya. On the doctrine of Sphota see my Study
of Patanjali, Appendix I.
2 Karika, 18.
3 See Citsukha s Tattvapradipika, IV.
vn] Analysis of Knowledge 239
but illusory manifestations of one soul or pure consciousness the
Brahman, but according to Samkhya they are all real and many.
The most interesting feature of Samkhya as of Vedanta is
the analysis of knowledge. Samkhya holds that our knowledge
of things are mere ideational pictures or images. External things
are indeed material, but the sense data and images of the mind,
the coming and going of which is called knowledge, are also in
some sense matter-stuff, since they are limited in their nature
like the external things. The sense-data and images come and go,
they are often the prototypes, or photographs of external things,
and as such ought to be considered as in some sense material,
but the matter of which these are composed is the subtlest.
These images of the mind could not have appeared as conscious,
if there were no separate principles of consciousness in connec
tion with which the whole conscious plane could be interpreted
as the experience of a person 1 . We know that the Upanisads
consider the soul or atman as pure and infinite consciousness,
distinct from the forms of knowledge, the ideas, and the images.
In our ordinary ways of mental analysis we do not detect that
beneath the forms of knowledge there is some other principle
which has no change, no form, but which is like a light which
illumines the mute, pictorial forms which the mind assumes.
The self is nothing but this light. We all speak of our "self"
but we have no mental picture of the self as we have of other
things, yet in all our knowledge we seem to know our self. The
Jains had said that the soul was veiled by karma matter, and
every act of knowledge meant only the partial removal of the
veil. Samkhya says that the self cannot be found as an image
of knowledge, but that is because it is a distinct, transcendent
principle, whose real nature as such is behind or beyond the subtle
matter of knowledge. Our cognitions, so far as they are mere forms
or images, are merely compositions or complexes of subtle mind-
substance, and thus are like a sheet of painted canvas immersed
in darkness; as the canvas gets prints from outside and moves,
the pictures appear one by one before the light and are illu
minated. So it is with our knowledge. The special characteristic
of self is that it is like a light, without which all knowledge would
be blind. Form and motion are the characteristics of matter, and
1 Tattakaumudi,^; Yogavdrttika, IV. 11; Vijndndmrtabhdsya,^. 74; Yogavdrttika
and Tattvavaifdradi, I. 4, II. 6, 18, 20; Vydsabhdsya, I. 6, 7.
240 The Kapila and the Patanjala Samkhya [CH.
so far as knowledge is mere limited form and movement it is the
same as matter; but there is some other principle which enlivens
these knowledge-forms, by virtue of which they become con
scious. This principle of consciousness (cit) cannot indeed be
separately perceived per se, but the presence of this principle in
all our forms of knowledge is distinctly indicated by inference.
This principle of consciousness has no motion, no form, no quality,
no impurity 1 . The movement of the knowledge-stuff takes place
in relation to it, so that it is illuminated as consciousness by it,
and produces the appearance of itself as undergoing all changes
of knowledge and experiences of pleasure and pain. Each item
of knowledge so far as it is an image or a picture of some sort is
but a subtle knowledge-stuff which has been illumined by the
principle of consciousness, but so far as each item of knowledge
carries with it the awakening or the enlivening of consciousness,
it is the manifestation of the principle of consciousness. Know
ledge-revelation is not the unveiling or revelation of a particular
part of the self, as the Jains supposed, but it is a revelation of
the self only so far as knowledge is pure awakening, pure en
livening, pure consciousness. So far as the content of knowledge
or the image is concerned, it is not the revelation of self but is
the blind knowledge-stuff.
The Buddhists had analysed knowledge into its diverse con
stituent parts, and had held that the coming together of these
brought about the conscious states. This coming together was
to them the point of the illusory notion of self, since this unity
or coming together was not a permanent thing but a momentary
collocation. With Samkhya however the self, the pure cit, is
neither illusory nor an abstraction ; it is concrete but transcen
dent. Coming into touch with it gives unity to all the movements
of the knowledge-composites of subtle stuff, which would otherwise
have remained aimless and unintelligent. It is by coming into
connection with this principle of intelligence that they are inter
preted as the systematic and coherent experience of a person, and
may thus be said to be intelligized. Intelligizing means the ex
pression and interpretation of the events or the happenings of
1 It is important to note that Samkhya has two terms to denote the two aspects
involved in knowledge, viz. the relating element of awareness as such (cit), and the
content (buddhi) which is the form of the mind-stuff representing the sense-data and
the image. Cognition takes place by the reflection of the former in the latter.
vn] The Stuff of Thought and Matter 241
knowledge in connection with a person, so as to make them a
system of experience. This principle of intelligence is called
purusa. There is a separate purusa in Samkhya for each indi
vidual, and it is of the nature of pure intelligence. The Vedanta
atman however is different from the Samkhya purusa in this that
it is one and is of the nature of pure intelligence, pure being,
and pure bliss. It alone is the reality and by illusory maya it
appears as many.
Thought and Matter.
A question naturally arises, that if the knowledge forms are
made up of some sort of stuff as the objective forms of matter
are, why then should the purusa illuminate it and not external
material objects. The answer that Samkhya gives is that the
knowledge-complexes are certainly different from external ob
jects in this, that they are far subtler and have a preponderance
of a special quality of plasticity and translucence (sattva), which
resembles the light of purusa, and is thus fit for reflecting and
absorbing the light of the purusa. The two principal character
istics of external gross matter are mass and energy. But it
has also the other characteristic of allowing itself to be photo
graphed by our mind; this thought-photograph of matter has
again the special privilege of being so translucent as to be able
to catch the reflection of the cit the super-translucent transcen
dent principle of intelligence. The fundamental characteristic
of external gross matter is its mass; energy is common to
both gross matter and the subtle thought-stuff. But mass is
at its lowest minimum in thought-stuff, whereas the capacity
of translucence, or what may be otherwise designated as the
intelligence-stuff, is at its highest in thought-stuff. But if the
gross matter had none of the characteristics of translucence that
thought possesses, it could not have made itself an object of
thought; for thought transforms itself into the shape, colour,
and other characteristics of the thing which has been made its
object. Thought could not have copied the matter, if the matter
did not possess some of the essential substances of which the
copy was made up. But this plastic entity (sattva) which is
so predominant in thought is at its lowest limit of subordination
in matter. Similarly mass is not noticed in thought, but some
such notions as are associated with mass may be discernible in
D. 16
242 Tke Kapila and the Pdtanjala Samkhya [CH.
thought; thus the images of thought are limited, separate, have
movement, and have more or less clear cut forms. The images
do not extend in space, but they can represent space. The trans
lucent and plastic element of thought (sattva) in association with
movement (rajas] would have resulted in a simultaneous revelation
of all objects; it is on account of mass or tendency of obstruction
(tamas) that knowledge proceeds from image to image and dis
closes things in a successive manner. The buddhi (thought-stuff)
holds within it all knowledge immersed as it were in utter dark
ness, and actual knowledge comes before our view as though
by the removal of the darkness or veil, by the reflection of the
light of the purusa. This characteristic of knowledge, that all its
stores are hidden as if lost at any moment, and only one picture
or idea comes at a time to the arena of revelation, demonstrates
that in knowledge there is a factor of obstruction which manifests
itself in its full actuality in gross matter as mass. Thus both
thought and gross matter are made up of three elements, a
plasticity of intelligence-stuff (sattva), energy-stuff (rajas), and
mass-stuff (tamas), or the factor of obstruction. Of these the last
two are predominant in gross matter and the first two in thought.
Feelings, the Ultimate Substances 1 .
Another question that arises in this connection is the position
of feeling in such an analysis of thought and matter. Samkhya
holds that the three characteristic constituents that we have
analyzed just now are feeling substances. Feeling is the most
interesting side of our consciousness. It is in our feelings that
we think of our thoughts as being parts of ourselves. If \ve
should analyze any percept into the crude and undeveloped
sensations of which it is composed at the first moment of its
appearance, it comes more as a shock than as an image, and
we find that it is felt more as a feeling mass than as an image.
Even in our ordinary life the elements which precede an act of
knowledge are probably mere feelings. As we go lower down
the scale of evolution the automatic actions and relations of
matter are concomitant with crude manifestations of feeling
which never rise to the level of knowledge. The lower the scale
of evolution the less is the keenness of feeling, till at last there
comes a stage where matter-complexes do not give rise to feeling
1 Karika, 12, with Gaudpada and Narayanatirtha.
vn] The Gu%as 243
reactions but to mere physical reactions. Feelings thus mark
the earliest track of consciousness, whether we look at it from the
point of view of evolution or of the genesis of consciousness in
ordinary life. What we call matter complexes become at a certain
stage feeling-complexes and what we call feeling-complexes at
a certain stage of descent sink into mere matter-complexes with
matter reaction. The feelings are therefore the things-in-them-
selves, the ultimate substances of which consciousness and gross
matter are made up. Ordinarily a difficulty might be felt in
taking feelings to be the ultimate substances of which gross
matter and thought are made up; for we are more accustomed
to take feelings as being merely subjective, but if we remember
the Samkhya analysis, we find that it holds that thought and
matter are but two different modifications of certain subtle sub
stances which are in essence but three types of feeling entities.
The three principal characteristics of thought and matter that we
have noticed in the preceding section are but the manifestations
of three types of feeling substances. There is the class of feelings
that we call the sorrowful, there is another class of feelings that
we call pleasurable, and there is still another class which is neither
sorrowful nor pleasurable, but is one of ignorance, depression
(visdda) or dullness. Thus corresponding to these three types of
manifestations as pleasure, pain, and dullness, and materially as
shining (prakdsa), energy (pravrtti), obstruction (niyama), there
are three types of feeling-substances which must be regarded as
the ultimate things which make up all the diverse kinds of gross
matter and thought by their varying modifications.
The Gun as 1 .
These three types of ultimate subtle entities are technically
called guna in Samkhya philosophy. Guna in Sanskrit has three
meanings, namely (i) quality, (2) rope, (3) not primary. These
entities, however, are substances and not mere qualities. But it
may be mentioned in this connection that in Samkhya philosophy
there is no separate existence of qualities; it holds that each
and every unit of quality is but a unit of substance. What
we call quality is but a particular manifestation or appearance
of a subtle entity. Things do not possess quality, but quality
1 Yogav&rttika, II. 18; Bhavaga^e^a s Ta.ttvaydtharthyadipa.Tw, pp. 1-3; Vtjnd-
ndmrtabhdfya, p. 100; Tattvakaumudi, 13; also Gaudapada and Narayagatlrtha, 13.
1 6 2
244 The Kapila and the Patanjala Samkhya [CH.
signifies merely the manner in which a substance reacts ; any
object we see seems to possess many qualities, but the Samkhya
holds that corresponding to each and every new unit of quality,
however fine and subtle it may be, there is a corresponding
subtle entity, the reaction of which is interpreted by us as a
quality. This is true not only of qualities of external objects
but also of mental qualities as well. These ultimate entities
were thus called gunas probably to suggest that they are the
entities which by their various modifications manifest them
selves as gunas or qualities. These subtle entities may also be
called gunas in the sense of ropes because they are like ropes
by which the soul is chained down as if it were to thought and
matter. These may also be called gunas as things of secondary
importance, because though permanent and indestructible, they
continually suffer modifications and changes by their mutual
groupings and re-groupings, and thus not primarily and unalter
ably constant like the souls (purusd). Moreover the object of the
world process being the enjoyment and salvation of the purusas,
the matter-principle could not naturally be regarded as being of
primary importance. But in whatever senses we may be inclined
to justify the name guna as applied to these subtle entities, it
should be borne in mind that they are substantive entities or
subtle substances and not abstract qualities. These gunas are
infinite in number, but in accordance with their three main char
acteristics as described above they have been arranged in three
classes or types called sattva (intelligence-stuff"), rajas (energy-
stuff) and tamos (mass-stuff"). An infinite number of subtle sub
stances which agree in certain characteristics of self-shining or
plasticity are called the sattva-gunas and those which behave as
units of activity are called the rajo-gunas and those which behave
as factors of obstruction, mass or materiality are called tamo-gunas.
These subtle guna substances are united in different proportions
(e.g. a larger number of sattva substances with a lesser number of
rajas or tamas, or a larger number of tamas substances with a
smaller number of rajas and sattva substances and so on in
varying proportions), and as a result of this, different substances
with different qualities come into being. Though attached to one
another when united in different proportions, they mutually act
and react upon one another, and thus by their combined resultant
produce new characters, qualities and substances. There is how-
vn] Prakrti as Equilibrium of Gunas 245
ever one and only one stage in which the gunas are not com
pounded in varying proportions. In this state each of the guna
substances is opposed by each of the other guna substances, and
thus by their equal mutual opposition create an equilibrium, in
which none of the characters of the gunas manifest themselves.
This is a state which is so absolutely devoid of all characteristics
that it is absolutely incoherent, indeterminate, and indefinite. It
is a qualitiless simple homogeneity. It is a state of being which
is as it were non-being. This state of the mutual equilibrium
of the gunas is called prakrti 1 . This is a state which cannot be
said either to exist or to non-exist for it serves no purpose, but
it is hypothetically the mother of all things. This is however the
earliest stage, by the breaking of which, later on, all modifications
take place.
Prakrti and its Evolution.
Samkhya believes that before this world came into being there
was such a state of dissolution a state in which the guna com
pounds had disintegrated into a state of disunion and had by their
mutual opposition produced an equilibrium the prakrti. Then
later on disturbance arose in the prakrti, and as a result of that a
process of unequal aggregation of the gunas in varying proportions
took place, which brought forth the creation of the manifold.
Prakrti, the state of perfect homogeneity and incoherence of the
gunas, thus gradually evolved and became more and more deter
minate, differentiated, heterogeneous, and coherent. The gunas are
always uniting, separating, and uniting again 2 . Varying qualities
of essence, energy, and mass in varied groupings act on one another
and through their mutual interaction and interdependence evolve
from the indefinite or qualitatively indeterminate the definite or
qualitatively determinate. And though co-operating to produce
the world of effects, these diverse moments with diverse tendencies
never coalesce. Thus in the phenomenal product whatever energy
there is is due to the element of rajas and rajas alone; all matter,
resistance, stability, is due to tamas,and all conscious manifestation
to sattva. The particular guna which happens to be predominant
in any phenomenon becomes manifest in that phenomenon and
others become latent, though their presence is inferred by their
1 Yogavarttika, II. 19, and Pravacanabkdsya, I. 61.
* Kaumudi, 13-16; TattvavaiS&radi, II. 20, IV. 13, 14; also Yogavarttika, IV. 13, 14.
246 The Kapila and the Patanjala Samkhya [CH.
effect. Thus, for example, in a body at rest mass is patent, energy
latent and potentiality of conscious manifestation sublatent. In a
moving body, the rajas is predominant (kinetic) and the mass is
partially overcome. All these transformations of the groupings of
the gunas in different proportions presuppose the state of prakrti
as the starting point. It is at this stage that the tendencies to
conscious manifestation, as well as the powers of doing work, are
exactly counterbalanced by the resistance of inertia or mass,
and the process of cosmic evolution is at rest When this equi
librium is once destroyed, it is supposed that out of a natural
affinity of all the sattva reals for themselves, of rajas reals for other
reals of their type, of tamas reals for others of their type, there
arises an unequal aggregation of sattva, rajas, or tamas at differ
ent moments. When one guna is preponderant in any particular
collocation, the others are co-operant. This evolutionary series
beginning from the first disturbance of the prakrti to the final
transformation as the world- order, is subject to "a definite law
which it cannot overstep." In the words of Dr B. N. Seal 1 /" the pro
cess of evolution consists in the development of the differentiated
(yaisamya) within the undifferentiated (sdmydvasthd) of the deter
minate (visesa) within the indeterminate (avisesa) of the coherent
(yutastddha) within the incoherent (ayutasiddha). The order of
succession is neither from parts to whole nor from whole to the
parts, but ever from a relatively less differentiated, less deter
minate, less coherent whole to a relatively more differentiated,
more determinate, more coherent whole." The meaning of such
an evolution is this, that all the changes and modifications in
the shape of the evolving collocations of guna reals take place
within the body of the prakrti. Prakrti consisting of the in
finite reals is infinite, and that it has been disturbed does not
mean that the whole of it has been disturbed and upset, or
that the totality of the gunas in the prakrti has been unhinged
from a state of equilibrium. It means rather that a very vast
number of gunas constituting the worlds of thought and matter
has been upset. These gunas once thrown out of balance begin to
group themselves together first in one form, then in another, then
in another, and so on. But such a change in the formation of
aggregates should not be thought to take place in such a way
that the later aggregates appear in supersession of the former ones,
so that when the former comes into being the latter ceases to exist.
1 Dr B. N. Seal s Positive Sciences of the Ancient Hindtis, 19x5, p. 7.
vn] Prakrti and its Evolution 247
For the truth is that one stage is produced after another ; this
second stage is the result of a new aggregation of some of the
reals of the first stage. This deficiency of the reals of the first
stage which had gone forth to form the new aggregate as the
second stage is made good by a refilling from the prakrti. So also,
as the third stage of aggregation takes place from out of the reals
of the second stage, the deficiency of the reals of the second stage
is made good by a refilling from the first stage and that of the
first stage from the prakrti. Thus by a succession of refillings the
process of evolution proceeds, till we come to its last limit, where
there is no real evolution of new substance, but mere chemical
and physical changes of qualities in things which had already
evolved. Evolution (tattvdntaraparindmd) in Samkhya means the
development of categories of existence and not mere changes of
qualities of substances (physical, chemical, biological or mental).
Thus each of the stages of evolution remains as a permanent
category of being, and offers scope to the more and more differ
entiated and coherent groupings of the succeeding stages. Thus
it is said that the evolutionary process is regarded as a differen
tiation of new stages as integrated in previous stages (samsrsta-
vivekd).
Pralaya and the disturbance of the Prakrti Equilibrium.
But how or rather why prakrti should be disturbed is the most
knotty point in Samkhya. It is postulated that the prakrti or the
sum-total of the gunas is so connected with the purusas, and there
is such an inherent teleology or blind purpose in the lifeless prakrti,
that all its evolution and transformations take place for the sake
of the diverse purusas, to serve the enjoyment of pleasures and
sufferance of pain through experiences, and finally leading them
to absolute freedom or mukti. A return of this manifold world
into the quiescent state (pralaya) of prakrti takes place when the
karmas of all purusas collectively require that there should be
such a temporary cessation of all experience. At such a moment
the guna compounds are gradually broken.and there is a backward
movement (pratisancara) till everything is reduced to the gunas in
their elementary disintegrated state when their mutual opposition
brings about their equilibrium. This equilibrium however is not a
mere passive state, but one of utmost tension; there is intense
activity, but the activity here does not lead to the generation of
new things and qualities (visadrsa-parinamd); this course of new
248 The Kapila and the Patanjala Samkhya [CH.
production being suspended, the activity here repeats the same
state (sadrsa-parindmd) of equilibrium, so that there is no change
or new production. The state of pralaya thus is not a suspension
of the teleology or purpose of the gunas, or an absolute break of
the course of guna evolution ; for the state of pralaya, since it
has been generated to fulfil the demands of the accumulated
karmas of purusas, and since there is still the activity of the
gunas in keeping themselves in a state of suspended production,
is also a stage of the samsara cycle. The state of mukti (libera
tion) is of course quite different, for in that stage the movement
of the gunas ceases for ever with reference to the liberated soul.
But still the question remains, what breaksthe state of equilibrium ?
The Samkhya answer is that it is due to the transcendental (non-
mechanical) influence of the purusa 1 . This influence of the purusa
again, if it means anything, means that there is inherent in the
gunas a teleology that all their movements or modifications should
take place in such a way that these may serve the purposes of the
purusas. Thus when the karmas of the purusas had demanded
that there should be a suspension of all experience, for a period
there was a pralaya. At the end of it, it is the same inherent pur
pose of the prakrti that wakes it up for the formation of a suitable
world for the experiences of the purusas by which its quiescent
state is disturbed. This is but another way of looking at the
inherent teleology of the prakrti, which demands that a state of
pralaya should cease and a state of world-framing activity should
begin. Since there is a purpose in the gunas which brought
them to a state of equilibrium, the state of equilibrium also pre
supposes that it also may be broken up again when the purpose
so demands. Thus the inherent purpose of the prakrti brought
about the state of pralaya and then broke it up for the creative
work again, and it is this natural change in the prakrti that may
be regarded from another point of view as the transcendental
influence of the purusas.
Mahat and Ahamkara.
The first evolute of the prakrti is generated by a preponderance
of the sattva (intelligence-stuff). This is indeed the earliest state
from which all the rest of the world has sprung forth ; and it is a
state in which the stuff of sattva predominates. It thus holds
1 The Yoga answer is of course different. It believes that the disturbance of the
equilibrium of the prakrti for new creation takes place by the will of IsVara (God).
vii] Evolution of Mahat 249
within it the minds (buddhi) of all purusas which were lost in the
prakrti during the pralaya. The very first work of the evolution
of prakrti to serve the purusas is thus manifested by the separating
out of the old buddhis or minds (of the purusas) which hold within
themselves the old specific ignorance (avidya) inherent in them
with reference to each purusa with which any particular buddhi
is associated from beginningless time before the pralaya. This
state of evolution consisting of all the collected minds (buddhi)
of all the purusas is therefore called buddhitattva. It is a state
which holds or comprehends within it the buddhis of all indi
viduals. The individual buddhis of individual purusas are on one
hand integrated with the buddhitattva and on the other associated
with their specific purusas. When some buddhis once begin to
be separated from the prakrti, other buddhi evolutions take
place. In other words, we are to understand that once the trans
formation of buddhis is effected for the service of the purusas,
all the other direct transformations that take place from the
prakrti take the same line, i.e. a preponderance of sattva being
once created by the bringing out of some buddhis, other trans
formations of prakrti that follow them have also the sattva pre
ponderance, which thus have exactly the same composition as the
first buddhis. Thus the first transformation from prakrti becomes
buddhi-transformation. This stage of buddhis may thus be re
garded as the most universal stage, which comprehends within it
all the buddhis of individuals and potentially all the matter of
which the gross world is formed. Looked at from this point of
view it has the widest and most universal existence comprising
all creation, and is thus called mahat (fas. great one). It is called
linga (sign), as the other later existences or evolutes give us the
ground of inferring its existence, and as such must be distin
guished from the prakrti which is called alinga, i.e. of which no
linga or characteristic may be affirmed.
This mahat-tattva being once produced, further modifications
begin to take place in three lines by three different kinds of
undulations representing the sattva preponderance, rajas pre
ponderance and tamas preponderance. This state when the mahat
is disturbed by the three parallel tendencies of a preponderance of
tamas, rajas and sattva is called ahamkdra, and the above three
tendencies are respectively called tdmasika ahamkdra or bhutddi,
rdjasika or taijasa ahamkdra, and vaikdrika ahamkdra. The raja-
sika ahamkara cannot mark a new preponderance by itself; it only
250 The Kapila and the Patanjala Samkhya [CH.
helps (sahakdri) the transformations of the sattva preponderance
and the tamas preponderance. The development of the former
preponderance, as is easy to see, is only the assumption of a more
and more determinate character of the buddhi, for we remember
that buddhi itself has been the resulting transformation of a sattva
preponderance. Further development with the help of rajas on
the line of sattva development could only take place when the
buddhi as mind determined itself in specific ways. The first
development of the buddhi on this line is called sdttvika or vai-
kdrika ahamkara. This ahamkara represents the development
in buddhi to produce a consciousness-stuff as I or rather "mine,"
and must thus be distinguished from the first stage as buddhi, the
function of which is a mere understanding and general datum as
thisness.
The ego or ahamkara (abhimdna-dravyd) is the specific expres
sion of the general consciousness which takes experience as mine.
The function of the ego is therefore called abhimdna (self-asser
tion). From this again come the five cognitive senses of vision,
touch, smell, taste, and hearing, the five conative senses of speech,
handling, foot-movement, the ejective sense and the generative
sense; the prdnas (bio-motor force) which help both conation and
cognition are but aspects of buddhi-movement as life. The indi
vidual ahamkaras and senses are related to the individual buddhis
by the developing sattva determinations from which they had come
into being. Each buddhi with its own group of ahamkara (ego)
and sense-evolutes thus forms a microcosm separate from similar
other buddhis with their associated groups. So far therefore as
knowledge is subject to sense-influence and the ego, it is different
for each individual, but so far as a general mind (kdrana buddhi)
apart from sense knowledge is concerned, there is a community of
all buddhis in the buddhitattva. Even there however each buddhi
is separated from other buddhis by its own peculiarly associated
ignorance (avidyd). The buddhi and its sattva evolutes of aham
kara and the senses are so related that though they are different
from buddhi in their functions, they are all comprehended in the
buddhi, and mark only its gradual differentiations and modes. We
must again remember in this connection the doctrine of refilling,
for as buddhi exhausts its part in giving rise to ahamkara, the de
ficiency of buddhi is made good by prakrti ; again as ahamkara
partially exhausts itself in generating sense-faculties, the defi-
vn] Evolution of Infra-atoms 251
ciency is made good by a refilling from the buddhi. Thus the
change and wastage of each of the stadia are always made good
and kept constant by a constant refilling from each higher state
and finally from prakrti.
The Tanmatras and the Paramanus 1 .
The other tendency, namely that of tamas, has to be helped
by the liberated rajas of ahamkara, in order to make itself pre
ponderant, and this state in which the tamas succeeds in over
coming the sattva side which was so preponderant in the buddhi,
is called bhutadi. From this bhutadi with the help of rajas are
generated the tanmdtras, the immediately preceding causes of the
gross elements. The bhutadi thus represents only the intermediate
stage through which the differentiations and regroupings of tamas
reals in the mahat proceed for the generation of the tanmatras.
There has been some controversy between Samkhya and Yoga
as to whether the tanmatras are generated from the mahat or from
ahamkara. The situation becomes intelligible if we remember that
evolution here does not mean coming out or emanation, but in
creasing differentiation in integration within the evolving whole.
Thus the regroupings of tamas reals marks the differentiation
which takes place within the mahat but through its stage as
bhutadi. Bhutadi is absolutely homogeneous and inert, devoid
of all physical and chemical characters except quantum or mass.
The second stadium tanmatra represents subtle matter, vibratory,
impingent, radiant, instinct with potential energy. These "poten
tials" arise from the unequal aggregation of the original mass-units
in different proportions and collocations with an unequal distribu
tion of the original energy (rajas). The tanmatras possess some
thing more than quantum of mass and energy; they possess
physical characters, some of them penetrability, others powers of
impact or pressure, others radiant heat, others again capability of
viscous and cohesive attraction*.
In intimate relation with those physical characters they also
possess the potentials of the energies represented by sound, touch,
colour, taste, and smell ; but, being subtle matter, they are devoid
1 I have accepted in this section and in the next many of the translations of Sanskrit
terms and expressions of Dr Seal and am largely indebted to him for his illuminating
exposition of this subject as given in Ray s Hindu Chemistry. The credit of explaining
Samkhya physics in the light of the text belongs entirely to him.
8 Dr Seal s Positive Sciences of the Ancient Hindus.
252 The Kapila and the Patanjala Samkhya [CH.
of the peculiar forms which these "potentials" assume in particles
of gross matter like the atoms and their aggregates. In other
words, the potentials lodged in subtle matter must undergo peculiar
transformations by new groupings or collocations before they can
act as sensory stimuli as gross matter, though in the minutest
particles thereof the sensory stimuli may be infra-sensible (atln-
driya but not anudbhutcty.
Of the tanmatras the sabda or dkdsa tanmdtra (the sound-
potential) is first generated directly from the bhutadi. Next
comes the sparsa or the vdyu tanmdtra (touch-potential) which is
generated by the union of a unit of tamas from bhutadi with the
akasa tanmatra. The rupa tanmdtra (colour-potential) is generated
similarly by the accretion of a unit of tamas from bhutadi ; the
rasa tanmdtra (taste-potential) or the ap tanmdtra is also similarly
formed. This ap tanmatra again by its union with a unit of tamas
from bhutadi produces the gandha tanmdtra (smell-potential) or
the ksiti tanmdtra 2 . The difference of tanmatras or infra-atomic
units and atoms (paramdnu} is this, that the tanmatras have only
the potential power of affecting our senses, which must be grouped
and regrouped in a particular form to constitute a new existence
as atoms before they can have the power of affecting our senses.
It is important in this connection to point out that the classifica
tion of all gross objects as ksiti, ap, tejas, marut and vyoman is
not based upon a chemical analysis, but from the points of view
of the five senses through which knowledge of them could be
brought home to us. Each of our senses can only apprehend a
particular quality and thus five different ultimate substances are
said to exist corresponding to the five qualities which may be
grasped by the five senses. In accordance with the existence of
these five elements, the existence of the five potential states or
tanmatras was also conceived to exist as the ground of the five
gross forms.
The five classes of atoms are generated from the tanmatras as
follows: the sound-potential, with accretion of rudiment matter
from bhutadi generates the akasa-atom. The touch-potentials com
bine with the vibratory particles (sound-potential) to generate the
1 Dr Seal s Positive Sciences of the Ancient Hindus.
2 There were various ways in which the genesis of tanmatras and atoms were ex
plained in literatures other than Samkhya ; for some account of it see Dr Seal s Positive
Sciences of the Ancient Hindus.
vn] Evolution of Atoms 253
vayu-atom. The light-and-heat potentials combine with touch-
potentials and sound-potentials to produce the tejas-atom. The
taste-potentials combine with light-and-heat potentials, touch-
potentials and sound-potentials to generate the ap-atom and the
smell-potentials combine with the preceding potentials to generate
the earth-atom. The akasa-atom possesses penetrability, the vayu-
atom impact or mechanical pressure, the tejas-atom radiant heat
and light, the ap-atom viscous attraction and the earth-atom
cohesive attraction. The akaa we have seen forms the transition
link from the bhutadi to the tanmatra and from the tanmatra to
the atomic production ; it therefore deserves a special notice at
this stage. Samkhya distinguishes between a karana-akasa and
karyakasa. The karana-akaa (non-atomic and all-pervasive)
is the formless tamas the mass in prakrti or bhutadi; it is
indeed all-pervasive, and is not a mere negation, a mere un-
occupiedness (avarandbhdva) or vacuum 1 . When energy is first
associated with this tamas element it gives rise to the sound-
potential ; the atomic akasa is the result of the integration of the
original mass-units from bhutadi with this sound-potential (sabda
tanmatra). Such an akasa-atom is called the karyakasa; it is
formed everywhere and held up in the original karana akasa as
the medium for the development of vayu atoms. Being atomic
it occupies limited space.
The ahamkara and the five tanmatras are technically called
avisesa or indeterminate, for further determinations or differentia
tions of them for the formation of newer categories of existence
are possible. The eleven senses and the five atoms are called
visesa, i.e. determinate, for they cannot further be so determined
as to form a new category of existence. It is thus that the course
of evolution which started in the prakrti reaches its furthest limit
in the production of the senses on the one side and the atoms
on the other. Changes no doubt take place in bodies having
atomic constitution, but these changes are changes of quality due
to spatial changes in the position of the atoms or to the intro
duction of new atoms and their re-arrangement. But these are
not such that a newer category of existence could be formed by
them which was substantially different from the combined atoms.
1 Dr B. N. Seal in describing this akas a says " Akas a corresponds in some respects
to the ether of the physicists and in others to what may be called proto-atom (protyle)."
Ray s History of Hindu Chemistry, p. 88.
254 The Kapila and the Patanjala Samkhya [CH.
The changes that take place in the atomic constitution of things
certainly deserve to be noticed. But before we go on to this, it
will be better to enquire about the principle of causation accord
ing to which the Samkhya -Yoga evolution should be compre
hended or interpreted.
Principle of Causation and Conservation of Energy 1 .
The question is raised, how can the prakrti supply the de-
ficiences made in its evolutes by the formation of other evolutes
from them ? When from mahat some tanmatras have evolved, or
when from the tanmatras some atoms have evolved, how can the
deficiency in mahat and the tanmatras be made good by the
prakrti ?
Or again, what is the principle that guides the transformations
that take place in the atomic stage when one gross body, say milk,
changes into curd, and so on? Samkhya says that "as the total
energy remains the same while the world is constantly evolving,
cause and effect are only more or less evolved forms of the same
ultimate Energy. The sum of effects exists in the sum of causes
in a potential form. The grouping or collocation alone changes,
and this brings on the manifestation of the latent powers of the
gunas, but without creation of anything new. What is called the
(material) cause is only the power which is efficient in the pro
duction or rather the vehicle of the power. This power is the
unmanifested (or potential) form of the Energy set free (udbhuta-
vrtti) in the effect. But the concomitant conditions are necessary
to call forth the so-called material cause into activity 2 ." The
appearance of an effect (such as the manifestation of the figure
of the statue in the marble block by the causal efficiency of the
sculptor s art) is only its passage from potentiality to actuality
and the concomitant conditions (sahakdri-sakti} or efficient cause
(nimitta-kdrana, such as the sculptor s art) is a sort of mechanical
help or instrumental help to this passage or the transition 3 . The
refilling from prakrti thus means nothing more than this, that
by the inherent teleology of the prakrti, the reals there are so
collocated as to be transformed into mahat as those of the mahat
have been collocated to form the bhutadi or the tanmatras.
1 Vyasabhasya and Yogavarttika, IV. 3 ; Tattvavaifaradi, IV. 3.
2 Ray, History of Hindu Chemistry, p. 72. 3 Ibid. p. 73.
vn] Conservation of Energy and Change 255
Yoga however explains this more vividly on the basis of
transformation of the liberated potential energy. The sum of
material causes potentially contains the energy manifested in the
sum of effects. When the effectuating condition is added to the
sum of material conditions in a given collocation, all that happens
is that a stimulus is imparted which removes the arrest, disturbs
the relatively stable equilibrium, and brings on a liberation of
energy together with a fresh collocation (gunasannivesavisesd).
As the owner of an adjacent field in transferring water from one
field to another of the same or lower level has only to remove
the obstructing mud barriers, whereupon the water flows of itself
to the other field, so when the efficient or instrumental causes
(such as the sculptor s art) remove the barrier inherent in any
collocation against its transformation into any other collocation,
the energy from that collocation flows out in a corresponding
manner and determines the collocation. Thus for example the
energy which collocated the milk-atoms to form milk was in a
state of arrest in the milk state. If by heat or other causes this
barrier is removed, the energy naturally changes direction in a
corresponding manner and collocates the atoms accordingly for
the formation of curd. So also as soon as the barriers are removed
from the prakrti, guided by the constant will of Isvara, the reals
in equilibrium in the state of prakrti leave their state of arrest
and evolve themselves into mahat, etc.
Change as the formation of new collocations.
It is easy to see from what we have already said that any
collocation of atoms forming a thing could not change its form,
unless the barrier inherent or caused by the formation of the
present collocation could be removed by some other extraneous
instrumental cause. All gross things are formed by the colloca
tion of the five atoms of ksiti, ap, tejas, marut, and vyoman. The
difference between one thing and another is simply this, that its
collocation of atoms or the arrangement or grouping of atoms
is different from that in another. The formation of a collocation
has an inherent barrier against any change, which keeps that
collocation in a state of equilibrium, and it is easy to see that
these barriers exist in infinite directions in which all the other
infinite objects of the world exist. From whichever side the barrier
is removed, the energy flows in that direction and helps the
256 The Kapila and the Patanjala Samkhya [CH.
formation of a corresponding object. Provided the suitable barriers
could be removed, anything could be changed into any other thing.
And it is believed that the Yogins can acquire the powers by
which they can remove any barriers, and thus make anything out of
any other thing. But generally in the normal course of events the
line of evolution follows "a definite law which cannot be over
stepped" (parindmakramaniya-ma) or in other words there are
some natural barriers which cannot be removed, and thus the
evolutionary course has to take a path to the exclusion of those
lines where the barriers could not be removed. Thus saffron grows
in countries like Kashmere and not in Bengal, this is limitation of
countries (deSdpabandhd) ; certain kinds of paddy grow in the rainy
season only, this is limitation of season or time (kaldpabandhd);
deer cannot beget men, this is limitation by form (dkdrdpabandha) ;
curd can come out of milk, this is the limitation of causes (nimit-
tdpabandhd). The evolutionary course can thus follow only that
path which is not barricaded by any of these limitations or natural
obstructions 1 .
Change is taking place everywhere, from the smallest and least
to the highest. Atoms and reals are continually vibrating and
changing places in any and every object. At each moment the
whole universe is undergoing change, and the collocation of atoms
at any moment is different from what it was at the previous
moment. When these changes are perceivable, they are perceived
as dharmaparindma or changes of dharma or quality; but per
ceived or unperceived the changes are continually going on. This
change of appearance may be viewed from another aspect by
virtue of which we may call it present or past, and old or new,
and these are respectively called the laksanaparindma a^idavasthd-
parindma. At every moment every object of the world is under
going evolution or change, change as past, present and future,
as new, old or unborn. When any change is in a potential state
we call it future, when manifested present, when it becomes sub-
latent again it is said to be past. Thus it is that the potential,
manifest, and sub-latent changes of a thing are called future,
present and past 2 .
1 Vyasabhasya, Tattvavaifaradi and Yogavdrttika, in. 14.
2 It is well to note in this connection that Samkhya-yoga does not admit the exist
ence of time as an independent entity like the Nyaya-VaiSesika. Time represents the
order of moments in which the mind grasps the phenomenal changes. It is hence a
construction of the mind (buddhi-nirmana). The time required by an atom to move
vn] Theory of Causation 257
Causation as Satkaryavada (the theory that the effect poten
tially exists before it is generated by the movement of
the cause).
The above consideration brings us to an important aspect of
the Samkhya view of causation as satkdryavdda. Samkhya holds
that there can be no production of a thing previously non-existent;
causation means the appearance or manifestation of a quality due
to certain changes of collocations in the causes which were already
held in them in a potential form. Production of effect only means
an internal change of the arrangement of atoms in the cause, and
this exists in it in a potential form, and just a little loosening of
the barrier which was standing in the way of the happening of
such a change of arrangement will produce the desired new col
location the effect. This doctrine is called satkdryavdda, i.e.
that the karya or effect is sat or existent even before the causal
operation to produce the effect was launched. The oil exists in
the sesamum, the statue in the stone, the curd in the milk. The
causal operation (karakavydpdra) only renders that manifest
(dvirbhuta) which was formerly in an unmanifested condition
(tirohitdf.
The Buddhists also believed in change, as much as Samkhya
did, but with them there was no background to the change;
every change was thus absolutely a new one, and when it was
past, the next moment the change was lost absolutely. There
were only the passing dharmas or manifestations of forms and
qualities, but there was no permanent underlying dharma or sub
stance. Samkhya also holds in the continual change of dharmas,
but it also holds that these dharmas represent only the conditions
of the permanent reals. The conditions and collocations of the reals
change constantly, but the reals themselves are unchangeable.
The effect according to the Buddhists was non-existent, it came
into being for a moment and was lost. On account of this theory
of causation and also on account of their doctrine of unya, they
were called vaindsikas (nihilists) by the Vedantins. This doctrine
is therefore contrasted to Samkhya doctrine as asatkdryavdda.
its own measure of space is called a moment (kfana) or one unit of time. Vijfiana
Bhiksu regards one unit movement of the gunas or reals as a moment. When by
true wisdom the gunas are perceived as they are both the illusory notions of time and
space vanish. Vyasabhasya, Tattvavaifdradi, and Yogavdrttika, in. 51 and III. 13.
1 Tattvakaumudi, 9.
D. I 7
258 The Kapila and the Patanjala Samkhya [CH.
The Jain view holds that both these views are relatively true and
that from one point of view satkaryavada is true and from another
asatkaryavada. The Samkhya view that the cause is continually
transforming itself into its effects is technically called parindma-
vdda as against the Vedanta view called the vivarttavdda: that
cause remains ever the same, and what we call effects are but
illusory impositions of mere unreal appearance of name and form
mere Maya 1 .
SSmkhya Atheism and Yoga Theism.
Granted that the interchange of the positions of the infinite
number of reals produce all the world and its transformations ;
whence comes this fixed order of the universe, the fixed order of
cause and effect, the fixed order of the so-called barriers which
prevent the transformation of any cause into any effect or the
first disturbance of the equilibrium of the prakrti? Samkhya
denies the existence of IsVara(God) or any other exterior influence,
and holds that there is an inherent tendency in these reals which
guides all their movements. This tendency or teleology demands
that the movements of the reals should be in such a manner that
they may render some service to the souls either in the direction
of enjoyment or salvation. It is by the natural course of such a
tendency that prakrti is disturbed, and the gunas develop on two
lines on the mental plane, citta or mind comprising the sense
faculties, and on the objective plane as material objects ; and it is
in fulfilment of the demands of this tendency that on the one
hand take place subjective experiences as the changes of the
buddhi and on the other the infinite modes of the changes of ob
jective things. It is this tendency to be of service to the purusas
(purusdrthatd) that guides all the movements of the reals, restrains
all disorder, renders the world a fit object of experience, and
finally rouses them to turn back from the world and seek to attain
liberation from the association of prakrti and its gratuitous service,
which causes us all this trouble of samsara.
Yoga here asks, how the blind tendency of the non-intelligent
1 Both the Vedanta and the Samkhya theories of causation are sometimes loosely
called satkaryyavada. But correctly speaking as some discerning commentators have
pointed out, the Vedanta theory of causation should be called satkaranavada for ac
cording to it the karana (cause) alone exists (sat) and all karyyas (effects) are illusory
appearances of the karana ; but according to Samkhya the karyya exists in a potential
state in the karana and is hence always existing and real.
vi i] Yoga Theism 259
prakrti can bring forth this order and harmony of the universe,
how can it determine what course of evolution will be of the best
service to the purusas, how can it remove its own barriers and
lend itself to the evolutionary process from the state of prakrti
equilibrium? How too can this blind tendency so regulate the
evolutionary order that all men must suffer pains according to
their bad karmas, and happiness according to their good ones?
There must be some intelligent Being who should help the course
of evolution in such a way that this system of order and harmony
may be attained. This Being is Isvara. IsVara is a purusa who
had never been subject to ignorance, afflictions, or passions. His
body is of pure sattva quality which can never be touched by
ignorance. He is all knowledge and all powerful. He has a per
manent wish that those barriers in the course of the evolution of
the reals by which the evolution of the gunas may best serve the
double interest of the purusa s experience (bhoga) and liberation
(apavarga) should be removed. It is according to this perma
nent will of IsVara that the proper barriers are removed and the
gunas follow naturally an intelligent course of evolution for the
service of the best interests of the purusas. IsVara has not created
the prakrti ; he only disturbs the equilibrium of the prakrti in its
quiescent state, and later on helps it to follow an intelligent order
by which the fruits of karma are properly distributed and the order
of the world is brought about. This acknowledgement of IsVara
in Yoga and its denial by Samkhya marks the main theoretic
difference between the two according to which the Yoga and
Samkhya are distinguished as SesVara Samkhya (Samkhya with
IsVara) and NirlsVara Samkhya (Atheistic Samkhya) 1 .
Buddhi and Purusa.
The question again arises that though purusa is pure intel
ligence, the gunas are non-intelligent subtle substances, how
can the latter come into touch with the former? Moreover,
the purusa is pure inactive intelligence without any touch of
impurity and what service or need can such a purusa have of
the gunas? This difficulty is anticipated by Samkhya, which has
already made room for its answer by assuming that one class of
the gunas called sattva is such that it resembles the purity and
the intelligence of the purusa to a very high degree, so much so
1 Tattvavaifdradi, IV. 3; Yogavarttika, \. 14; and Pravacanabhdsya, v. 1-12.
17 2
260 The Kapila and the Patanjala Samkhya [CH.
that it can reflect the intelligence of the purusa, and thus render
its non-intelligent transformations to appear as if they were in
telligent. Thus all our thoughts and other emotional or volitional
operations are really the non-intelligent transformations of the
buddhi or citta having a large sattva preponderance; but by virtue
of the reflection of the purusa in the buddhi, these appear as if
they are intelligent. The self (purusa) according to Samkhya-
Yoga is not directly demonstrated by self-consciousness. Its
existence is a matter of inference on teleological grounds and
grounds of moral responsibility. The self cannot be directly
noticed as being separate from the buddhi modifications. Through
beginningless ignorance there is a confusion and the changing
states of buddhi are regarded as conscious. These buddhi changes
are further so associated with the reflection of the purusa in the
buddhi that they are interpreted as the experiences of the purusa.
This association of the buddhi with the reflection of the purusa
in the buddhi has such a special fitness (yogyatd) that it is inter
preted as the experience of the purusa. This explanation of
Vacaspati of the situation is objected to by Vijfiana Bhiksu.
Vijftana Bhiksu says that the association of the buddhi with the
image of the purusa cannot give us the notion of a real person
who undergoes the experiences. It is to be supposed therefore
that when the buddhi is intelligized by the reflection of the purusa,
it is then superimposed upon the purusa, and we have the notion
of an abiding person who experiences 1 . Whatever may be the
explanation, it seems that the union of the buddhi with the purusa
is somewhat mystical. As a result of this reflection of cit on
buddhi and the superimposition of the buddhi the purusa cannot
realize that the transformations of the buddhi are not its own.
Buddhi resembles purusa in transparency, and the purusa fails to
differentiate itself from the modifications of the buddhi, and as
a result of this non-distinction the purusa becomes bound down
to the buddhi, always failing to recognize the truth that the
buddhi and its transformations are wholly alien to it. This non-
distinction of purusa from buddhi which is itself a mode of buddhi
is what is meant by avidyd (non-knowledge) in Samkhya, and is
the root of all experience and all misery 2 .
1 Tattvavaisaradi and Yogavarttika, I. 4.
2 This indicates the nature of the analysis of illusion with Samkhya. It is the
non-apprehension of the distinction of two things (e.g. the snake and the rope) that
vn] Ignorance and Illusion 261
Yoga holds a slightly different view and supposes that the
purusa not only fails to distinguish the difference between it
self and the buddhi but positively takes the transformations of
buddhi as its own. It is no non-perception of the difference
but positively false knowledge, that we take the purusa to be
that which it is not (anyathdkhydti). It takes the changing,
impure, sorrowful, and objective prakrti or buddhi to be the
changeless, pure, happiness-begetting subject. It wrongly thinks
buddhi to be the self and regards it as pure, permanent and
capable of giving us happiness. This is the avidya of Yoga.
A buddhi associated with a purusa is dominated by such an
avidya, and when birth after birth the same buddhi is associated
with the same purusa, it cannot easily get rid of this avidya.
If in the meantime pralaya takes place, the buddhi is submerged
in the prakrti, and the avidya also sleeps with it. When at the
beginning of the next creation the individual buddhis associated
with the purusas emerge, the old avidyas also become manifest
by virtue of it and the buddhis associate themselves with the
purusas to which they were attached before the pralaya. Thus
proceeds the course of samsara. When the avidya of a person
is rooted out by the rise of true knowledge, the buddhi fails to
attach itself to the purusa and is forever dissociated from it, and
this is the state of mukti.
The Cognitive Process and some characteristics of Citta.
It has been said that buddhi and the internal objects have
evolved in order to giving scope to the experience of the purusa.
What is the process of this experience? Samkhya (as explained
by Vacaspati) holds that through the senses the buddhi comes
into touch with external objects. At the first moment of this
touch there is an indeterminate consciousness in which the parti
culars of the thing cannot be noticed. This is called nirmkalpa
pratyaksa (indeterminate perception). At the next moment by
the function of the samkalpa (synthesis) and vikalpa (abstraction
or imagination) of manas (mind-organ) the thing is perceived in
all its determinate character; the manas differentiates, integrates,
and associates the sense-data received through the senses, and
is the cause of illusion ; it is therefore called the akhyati (non-apprehension) theory of
illusion which must be distinguished from the anyathdkhydti (misapprehension) theory
of illusion of Yoga which consists in positively misapprehending one (e.g. the rope)
for the other (e.g. snake). Yogavdrttika, I. 8.
262 The Kapila and the Patanjala Samkhya [CH.
thus generates the determinate perception, which when intelligized
by the purusa and associated with it becomes interpreted as the
experience of the person. The action of the senses, ahamkara,
and buddhi, may take place sometimes successively and at other
times as in cases of sudden fear simultaneously. Vijfiana Bhiksu
differs from this view of Vacaspati, and denies the synthetic
activity of the mind-organ (manas), and says that the buddhi
directly comes into touch with the objects through the senses.
At the first moment of touch the perception is indeterminate,
but at the second moment it becomes clear and determinate 1 .
It is evident that on this view the importance of manas is reduced
to a minimum and it is regarded as being only the faculty of de
sire, doubt and imagination.
Buddhi, including ahamkara and the senses, often called citta
in Yoga, is always incessantly suffering changes like the flame
of a lamp; it is made up of a large preponderance of the pure
sattva substances, and is constantly moulding itself from one con
tent to another. These images by the dual reflection of buddhi
and purusa are constantly becoming conscious, and are being
interpreted as the experiences of a person. The existence of the
purusa is to be postulated for explaining the illumination of con
sciousness and for explaining experience and moral endeavour.
The buddhi is spread all over the body, as it were, for it is by its
functions that the life of the body is kept up; for the Samkhya
does not admit any separate prana vayu (vital breath) to keep the
body living. What are called vdyus (bio-motor force) in Vedanta
are but the different modes of operation of this category of
buddhi, which acts all through the body and by its diverse move
ments performs the life-functions and sense-functions of the body.
1 As the contact of the buddhi with the external objects takes place through the
senses, the sense-data of colours, etc., are modified by the senses if they are defective.
The spatial qualities of things are however perceived by the senses directly, but the
time-order is a scheme of the citta or the buddhi. Generally speaking Yoga holds
that the external objects are faithfully copied by the buddhi in which they are reflected,
like trees in a lake :
" tasmtmfca darpane sphare samasta vastudrstayah
imastah pratibimbanti sarasiva tatadrumah" Yogavarttika, I. 4.
The buddhi assumes the form of the object which is reflected on it by the senses,
or rather the mind flows out through the senses to the external objects and assumes
their forms : indriyanyeva pranalikd cittasancaranamargah taih samyujya tadgola-
kadvdrd bahyavastusuparaktasya cittasyendriyasdhityenaivarthdkdrah parindmo
bhavati." Yogav&rttika, I. vi. 7. Contrast Tattvakaumudi, 27 and 30.
vn] Instinct and Desire 263
Apart from the perceptions and the life-functions, buddhi, or
rather citta as Yoga describes it, contains within it the root im
pressions (samskaras) and the tastes and instincts or tendencies
of all past lives (vdsand) 1 . These sarnskaras are revived under suit
able associations. Every man had had infinite numbers of births in
their past lives as man and as some animal. In all these lives the
same citta was always following him. The citta has thus collected
within itself the instincts and tendencies -of all those different
animal lives. It is knotted with these vasanas like a net. If a man
passes into a dog life by rebirth, the vasanas of a dog life, which
the man must have had in some of his previous infinite number of
births, are revived, and the man s tendencies become like those of
a dog. He forgets the experiences of his previous life and becomes
attached to enjoyment in the manner of a dog. It is by the revival
of the vasana suitable to each particular birth that there cannot be
any collision such as might have occurred if the instincts and
tendencies of a previous dog-life were active when any one was
born as man.
The samskaras represent the root impressions by which any
habit of life that man has lived through, or any pleasure in
which he took delight for some time, or any passions which were
1 The word samskara is used by Panini who probably preceded Buddha in three
different senses : (i) improving a thing as distinguished from generating a new quality
(Sata utkarsadhanam samskdrah, Kas ika on Panini, vi. ii. 16), (i) conglomeration
or aggregation, and (3) adornment (Panini, vi. i. 137, 138). In the Pitakas the word
sankhara is used in various senses such as constructing, preparing, perfecting, embel
lishing, aggregation, matter, karma, the skandhas (collected by Childers). In fact
sankhara stands for almost anything of which impermanence could be predicated.
But in spite of so many diversities of meaning I venture to suggest that the meaning
of aggregation (samavaya of Panini) is prominent. The word satnskaroti is used in
Kausltaki, n. 6, Chandogya, IV. xvi. 2, 3, 4, viii. 8, 5, and Brhadaranyaka, VI. iii. i,
in the sense of improving. I have not yet come across any literary use of the second
meaning in Sanskrit. The meaning of samskara in Hindu philosophy is altogether
different. It means the impressions (which exist sub-consciously in the mind) of the
objects experienced. All our experiences whether cognitive, emotional or conative
exist in sub-conscious states and may under suitable conditions be* reproduced as
memory (smrti). The word vasana ( Yoga sutra, iv. 24) seems to be a later word. The
earlier Upanisads do not mention it and so far as I know it is not mentioned in the Palj
puakas. Abhidhanappadtpika of Moggallana mentions it, and it occurs in the Muktika
Upanisad. It comes from the root "vas" to stay. It is often loosely used in the sense
of samskara, and in Vydsabhdsya they are identified in iv. 9. But vasana generally
refers to the tendencies of past lives most of which lie dormant in the mind. Only those
appear which can find scope in this life. But samskaras are the sub-conscious states
which are being constantly generated by experience. Vasanas are innate samskaras not
acquired in this life. See Vydsabhasya, TattvavaiSaradi and Yogavarttika, II. 13.
264 The Kapila and the Patanjala Samkhya [CH.
engrossing to him, tend to be revived, for though these might
not now be experienced, yet the fact that they were experienced
before has so moulded and given shape to the citta that the
citta will try to reproduce them by its own nature even without
any such effort on our part. To safeguard against the revival of
any undesirable idea or tendency it is therefore necessary that its
roots as already left in the citta in the form of samskaras should
be eradicated completely by the formation of the habit of a con
trary tendency, which if made sufficiently strong will by its own
samskara naturally stop the revival of the previous undesirable
samskaras.
Apart from these the citta possesses volitional activity (cesta)
by which the conative senses are brought into relation to their
objects. There is also the reserved potent power (sakti) of citta,
by which it can restrain itself and change its courses or continue
to persist in any one direction. These characteristics are involved
in the very essence of citta, and form the groundwork of the Yoga
method of practice, which consists in steadying a particular state
of mind to the exclusion of others.
Merit or demerit (punya, pdpd) also is imbedded in the citta
as its tendencies, regulating the mode of its movements, and
giving pleasures and pains in accordance with it.
Sorrow and its Dissolution 1 .
Samkhya and the Yoga, like the Buddhists, hold that all
experience is sorrowful. Tamas, we know, represents the pain
substance. As tamas must be present in some degree in all com
binations, all intellectual operations are fraught with some degree
of painful feeling. Moreover even in states of temporary pleasure,
we had sorrow at the previous moment when we had solicited
it, and we have sorrow even when we enjoy it, for we have the
fear that we may lose it. The sum total of sorrows is thus much
greater than the pleasures, and the pleasures only strengthen the
keenness of the sorrow. The wiser the man the greater is his
capacity of realizing that the world and our experiences are all full
of sorrow. For unless a man is convinced of this great truth that
all is sorrow, and that temporary pleasures, whether generated by
ordinary worldly experience or by enjoying heavenly experiences
through the performance of Vedic sacrifices, are quite unable to
1 Tattuavaifaradi and Yogavarttika, II. 15, and Tattvakaurmtdi, i.
vn] Sorrow and its Dissolution 265
eradicate the roots of sorrow, he will not be anxious for mukti or
the final uprooting of pains. A man must feel that all pleasures
lead to sorrow, and that the ordinary ways of removing
sorrows by seeking enjoyment cannot remove them ultimately ;
he must turn his back on the pleasures of the world and on the
pleasures of paradise. The performances of sacrifices according
to the Vedic rites may indeed give happiness, but as these involve
the sacrifice of animals they must involve some sins and hence also
some pains. Thus the performance of these cannot be regarded
as desirable. It is when a man ceases from seeking pleasures
that he thinks how best he can eradicate the roots of sorrow.
Philosophy shows how extensive is sorrow, why sorrow comes,
what is the way to uproot it, and what is the state when it is
uprooted. The man who has resolved to uproot sorrow turns to
philosophy to find out the means of doing it.
The way of eradicating the root of sorrow is thus the practical
enquiry of the Samkhya philosophy 1 . All experiences are sorrow.
Therefore some means must be discovered by which all experi
ences may be shut out for ever. Death cannot bring it, for after
death we shall have rebirth. So long as citta (mind) and purusa
are associated with each other, the sufferings will continue.
Citta must be dissociated from purusa. Citta or buddhi, Sam
khya says, is associated with purusa because of the non-dis
tinction of itself from buddhi 2 . It is necessary therefore that in
buddhi we should be able to generate the true conception of the
nature of purusa ; when this true conception of purusa arises in
the buddhi it feels itself to be different, and distinct, from and
quite unrelated to purusa, and thus ignorance is destroyed. As
a result of that, buddhi turns its back on purusa and can no
longer bind it to its experiences, which are all irrevocably con
nected with sorrow, and thus the purusa remains in its true
form. This according to Samkhya philosophy is alone adequate
to bring about the liberation of the purusa. Prakrti which was
leading us through cycles of experiences from birth to birth, fulfils
its final purpose when this true knowledge arises differentiating
1 Yoga puts it in a slightly modified form. Its object is the cessation of the rebirth-
process which is so much associated with sorrow (duhkhabahulah samsarah heya/i).
2 The word citta is a Yoga term. It is so called because it is the repository of all
sub-conscious states. Samkhya generally uses the word buddhi. Both the words mean
the same substance, the mind, but they emphasize its two different functions. Buddhi
means intellection.
266 The Kapila and the Patanjala Samkhya [CH.
purusa from prakrti. This final purpose being attained the
prakrti can never again bind the purusa with reference to whom
this right knowledge was generated ; for other purusas however
the bondage remains as before, and they continue their experi
ences from one birth to another in an endless cycle.
Yoga, however, thinks that mere philosophy is not sufficient.
In order to bring about liberation it is not enough that a true
knowledge differentiating purusa and buddhi should arise, but it
is necessary that all the old habits of experience of buddhi, all
its samskaras should be once for all destroyed never to be revived
again. At this stage the buddhi is transformed into its purest
state, reflecting steadily the true nature of the purusa. This is
the kevala (oneness) state of existence after which (all samskaras,
all avidya being altogether uprooted) the citta is impotent any
longer to hold on to the purusa, and like a stone hurled from a
mountain top, gravitates back into the prakrti 1 . To destroy the
old samskaras, knowledge alone not being sufficient, a graduated
course of practice is necessary. This graduated practice should
be so arranged that by generating the practice of living higher
and better modes of life, and steadying the mind on its subtler
states, the habits of ordinary life may be removed. As the yogin
advances he has to give up what he had adopted as good and
try for that which is still better. Continuing thus he reaches the
state when the buddhi is in its ultimate perfection and purity.
At this stage the buddhi assumes the form of the purusa, and
final liberation takes place.
Karmas in Yoga are divided into four classes : ( I ) sukla or
white (punya, those that produce happiness), (2) krsna or black
(pdpa, those that produce sorrow), (3) sukla-krsna (punya-pdpa,
most of our ordinary actions are partly virtuous and partly vicious
as they involve, if not anything else, at least the death of many
insects), (4) asuklakrma (those inner acts of self-abnegation, and
meditation which are devoid of any fruits as pleasures or pains).
All external actions involve some sins, for it is difficult to work
in the world and avoid taking the Ijves of insects 2 . All karmas
1 Both Samkhya and Yoga speak of this emancipated state as Kaivalya (alone-ness) ,
the former because all sorrows have been absolutely uprooted, never to grow up again
and the latter because at this state purusa remains for ever alone without any associa
tion with buddhi, see Samkhya karika, 68 and Yoga sfttras, IV. 34.
3 Vyasabhasya and Tattvavaisaradi, IV. 7.
vn] Modes of Ignorance 267
proceed from the five-fold afflictions (klesas\ namely avidyd,
asmitd, rdga, dvesa and abhinivesa.
We have already noticed what was meant by avidya. It con
sists generally in ascribing intelligence to buddhi, in thinking it
as permanent and leading to happiness. This false knowledge
while remaining in this form further manifests itself in the other
four forms of asmita, etc. Asmita means the thinking of worldly
objects and our experiences as really belonging to us the
sense of " mine " or " I " to things that really are the qualities or
transformations of the gunas. Raga means the consequent attach
ment to pleasures and things. Dvesa means aversion or antipathy
to unpleasant things. Abhinivesa is the desire for life or love of
life the will to be. We proceed to work because we think our
experiences to be our own, our body to be our own, our family
to be our own, our possessions to be our own ; because we are
attached to these ; because we feel great antipathy against any
mischief that might befall them, and also because we love our
life and always try to preserve it against any mischief. These all
proceed, as is easy to see, from their root avidya, which consists
in the false identification of buddhi with purusa. These five,
avidya, asmita, raga, dvesa and abhinivesa, permeate our buddhi,
and lead us to perform karma and to suffer. These together
with the performed karmas which lie inherent in the buddhi as
a particular mode of it transmigrate with the buddhi from birth
to birth, and it is hard to get rid of them 1 . The karma in the
aspect in which it lies in the buddhi as a mode or modification of
it is called karmdsaya (the bed of karma for the purusa to lie in).
We perform a karma actuated by the vicious tendencies (klesd) of
the buddhi. The karma when thus performed leaves its stain or
modification on the buddhi, and it is so ordained according to the
teleology of the prakrti and the removal of obstacles in the course
of its evolution in accordance with it by the permanent will of
Isvara that each vicious action brings sufferance and a virtuous
one pleasure,
The karmas performed in the present life will generally ac
cumulate, and when the time for giving their fruits comes, such
a life is ordained for the person, such a body is made ready for
him according to the evolution of prakrti as shall make it possible
for him to suffer or enjoy the fruits thereof. The karma of the
1 Vyasabkasya and Tattvawaifaradi, n. 3-9.
268 The Kapila and the Patanjala Samkhya [CH.
present life thus determines the particular kind of future birth
(as this or that animal or man), the period of life (ayus) and the
painful or pleasurable experiences (bhogd) destined for that life.
Exceedingly good actions and extremely bad actions often pro
duce their effects in this life. It may also happen that a man has
done certain bad actions, for the realization of the fruits of which
he requires a dog-life and good actions for the fruits of which
he requires a man-life. In such cases the good action may remain
in abeyance and the man may suffer the pains of a dog-life first
and then be born again as a man to enjoy the fruits of his good
actions. But if we can remove ignorance and the other afflictions,
all his previous unfulfilled karmas are for ever lost and cannot
again be revived. He has of course to suffer the fruits of those
karmas which have already ripened. This is tic& jivanmukti stage,
when the sage has attained true knowledge and is yet suffering
mundane life in order to experience the karmas that have already
ripened (tisthati samskdravasdt cakrabhramivaddhrtasariraJt).
Citta.
The word Yoga which wa. c formerly used in Vedic literature
in the sense of the restraint of the senses is used by Patanjali in
his Yoga sutra in the sense of the partial or full restraint or
steadying of the states of citta. Some sort of concentration may
be brought about by violent passions, as when fighting against
a mortal enemy, or even by an ignorant attachment or instinct.
The citta which has the concentration of the former type is called
ksipta (wild) and of the latter type pramudha (ignorant). There
is another kind of citta, as with all ordinary people, in which
concentration is only possible for a time, the mind remaining
steady on one thing for a short time leaves that off and clings to
another thing and so on. This is called the viksipta (unsteady)
stage of mind (cittabhumi}. As distinguished from these there is
an advanced stage of citta in which it can concentrate steadily on
an object for a long time. This is the ekdgra (one- pointed) stage.
There is a still further advanced stage in which the citta processes
are absolutely stopped. This happens immediately before mukti,
and is called the nirodha (cessation) state of citta. The purpose of
Yoga is to achieve the conditions of the last two stages of citta.
The cittas have five processes (vrtti\ (i) pramdna 1 (valid
1 Samkhya holds that both validity and invalidity of any cognition depend upon
the cognitive state itself and not on correspondence with external facts or objects
(svatah prdmanyam svatah apramanya>>i). The contribution of Samkhya to the doc-
vn] Tendencies of Good and Evil 269
cognitive states such as are generated by perception, inference
and scriptural testimony), (2) viparyaya (false knowledge, illusion,
etc.), (3) vikalpa (abstraction, construction and different kinds of
imagination), (4) nidrd (sleep, is a vacant state of mind, in which
tamas tends to predominate), (5) smrti (memory).
These states of mind (vrtti) comprise our inner experience.
When they lead us towards samsara into the course of passions
and their satisfactions, they are said to be klista (afflicted or
leading to affliction) ; when they lead us towards liberation, they
are called aklista (unafflicted). To whichever side we go, towards
samsara or towards mukti, we have to make use of our states of
mind ; the states which are bad often alternate with good states,
and whichever state should tend towards our final good (libera
tion) must be regarded as good.
This draws attention to that important characteristic of citta,
that it sometimes tends towards good (i.e. liberation) and some
times towards bad (samsara). It is like a river, as the Vydsa-
bhdsya says, which flows both ways, towards sin and towards the
good. The teleology of prakrti requires that it should produce
in man the samsara as well as the liberation tendency.
Thus in accordance with it in the midst of many bad thoughts
and bad habits there come good moral will and good thoughts,
and in the midst of good thoughts and habits come also bad
thoughts and vicious tendencies. The will to be good is therefore
never lost in man, as it is an innate tendency in him which is
as strong as his desire to enjoy pleasures. This point is rather
remarkable, for it gives us the key of Yoga ethics and shows that
our desire of liberation is not actuated by any hedonistic attraction
for happiness or even removal of pain, but by an innate tendency
of the mind to follow the path of liberation 1 . Removal of pains
trine of inference is not definitely known. What little Vacaspati says on the subject has
been borrowed from Vatsyayana such as the putvavat, Sesavat and samanyatodrsta types
of inference, and these may better be consulted in our chapter on Nyaya or in the Tatpar-
yatika of Vacaspati. Samkhya inference was probably from particular to particular on
the ground of seven kinds of relations according to which they had seven kinds of in
ference "matranimittasamyogivirodhisahacaribhik. Svasvamibadhyaghatadyaih sam-
khya nam saptadhanuma " (Tdtparyattkd, p. 09). Samkhya definition of inference as
given by Udyotakara (I. I. v) is " sambandhadekasmat pratyaksacchesas iddhiranuma-
nam."
1 Samkhya however makes the absolute and complete destruction of three kinds
of sorrows, ddhyatmika (generated internally by the illness of the body or the unsatis
fied passions of the mind), adhibhautika (generated externally by the injuries inflicted
by other men, beasts, etc.) and adhidaivika (generated by the injuries inflicted by demons
and ghosts) the object of all our endeavours (purusartha).
270 The Kapila and the Patanjala Samkhya [CH.
is of course the concomitant effect of following such a course, but
still the motive to follow this path is a natural and irresistible
tendency of the mind. Man has power (saktt) stored up in his
citta, and he has to use it in such a way that this tendency may
gradually grow stronger and stronger and ultimately uproot the
other. He must succeed in this, since prakrti wants liberation for
her final realization 1 .
Yoga Purificatory Practices (Parikarma).
The purpose of Yoga meditation is to steady the mind on
the gradually advancing stages of thoughts towards liberation,
so that vicious tendencies may gradually be more and more
weakened and at last disappear altogether. But before the mind
can be fit for this lofty meditation, it is necessary that it should
be purged of ordinary impurities. Thus the intending yogin
should practise absolute non-injury to all living beings (ahimsa),
absolute and strict truthfulness (satyd), non-stealing (asteya\
absolute sexual restraint (brahmacarya) and the acceptance of
nothing but that which is absolutely necessary (aparigraha).
These are collectively called yama. Again side by side with these
abstinences one must also practise external cleanliness by ablu
tions and inner cleanliness of the mind, contentment of mind, the
habit of bearing all privations of heat and cold, or keeping the
body unmoved and remaining silent in speech (tapas), the study
of philosophy (svddhydya) and meditation on I3vara (Isvara-
pranidhdna). These are collectively called niyamas. To these are
also to be added certain other moral disciplines such &s> pratipaksa-
bhdvand, maitrl, karund, muditd and upeksd. Pratipaksa-bhavana
means that whenever a bad thought (e.g. selfish motive) may
come one should practise the opposite good thought (self-
sacrifice); so that the bad thoughts may not find any scope.
Most of our vices are originated by our unfriendly relations
with our fellow-beings. To remove these the practice of mere
abstinence may not be sufficient, and therefore one should
habituate the mind to keep itself in positive good relations with
our fellow-beings. The practice of maitrl means to think of
all beings as friends. If we continually habituate ourselves to
think this, we can never be displeased with them. So too one
should practise karuna or kindly feeling for sufferers, mudita
1 See my "Yoga Psychology," Quest, October, 1921.
vi i] Yogd Meditation 271
or a feeling of happiness for the good of all beings, and upeksa
or a feeling of equanimity and indifference for the vices of others.
The last one indicates that the yogin should not take any note
of the vices of vicious men.
When the mind becomes disinclined to all worldly pleasures
(yairdgyd) and to all such as are promised in heaven by the per
formances of Vedic sacrifices, and the mind purged of its dross
and made fit for the practice of Yoga meditation, the yogin may
attain liberation by a constant practice (abhydsd) attended with
faith, confidence (sraddha), strength of purpose and execution
(virya) and wisdom (prajnd) attained at each advance.
The Yoga Meditation.
When the mind has become pure the chances of its being
ruffled by external disturbances are greatly reduced. At such
a stage the yogin takes a firm posture (asand) and fixes his mind
on any object he chooses. It is, however, preferable that he should
fix it on Isvara, for in that case Isvara being pleased removes
many of the obstacles in his path, and it becomes easier for
him to attain success. But of course he makes his own choice,
and can choose anything he likes for the unifying concentration
(samadhi) of his mind. There are four states of this unifying
concentration namely vitarka, vicdra, dnanda and asmitd. Of
these vitarka and vicara have each two varieties, savitarka, ntrvi-
tarka,savicdra,nirvicdra^. When the mind concentrates on objects,
remembering their names and qualities, it is called the savitarka
stage ; when on the five tanmatras with a remembrance of their
qualities it is called savicara, and when it is one with the tan
matras without any notion of their qualities it is called nirvicara.
Higher than these are the ananda and the asmita states. In the
ananda state the mind concentrates on the buddhi with its func
tions of the senses causing pleasure. In the asmita stage buddhi
concentrates on pure substance as divested of all modifica
tions. In all these stages there are objects on which the mind
consciously concentrates, these are therefore called the samprajhdta
(with knowledge of objects) types of samadhi. Next to this comes
the last stage of samadhi called the asamprajndta or nirodha
samadhi, in which the mind is without any object. By remaining
1 Vacaspati, however, thinks that ananda and asmita have also two other varieties,
which is denied by Bhiksu.
272 The Kapila and the Patanjala Samkhya [CH.
long in this stage the old potencies (samskaras) or impressions
due to the continued experience of worldly events tending towards
the objective world or towards any process of experiencing inner
thinking are destroyed by the production of a strong habit of the
nirodha state. At this stage dawns the true knowledge, when the
buddhi becomes as pure as the purusa, and after that the citta not
being able to bind the purusa any longer returns back to prakrti.
In order to practise this concentration one has to see that
there may be no disturbance, and the yogin should select a
quiet place on a hill or in a forest. One of the main obstacles
is, however, to be found in our constant respiratory action. This
has to be stopped by the practice of prdndydma. Pranayama
consists in taking in breath, keeping it for a while and then
giving it up. With practice one may retain breath steadily for
hours, days, months and even years. When there is no need
of taking in breath or giving it out, and it can be retained
steady for a long time, one of the main obstacles is removed.
The process of practising concentration is begun by sitting
in a steady posture, holding the breath by pranayama, excluding
all other thoughts, and fixing the mind on any object (dhdrand}.
At first it is difficult to fix steadily on any object, and the same
thought has to be repeated constantly in the mind, this is called
dhydna. After sufficient practice in dhyana the mind attains the
power of making itself steady; at this stage it becomes one
with its object and there is no change or repetition. There is
no consciousness of subject, object or thinking, but the mind
becomes steady and one with the object of thought. This is called
samadhi 1 . We have already described the six stages of samadhi.
As the yogin acquires strength in one stage of samadhi, he passes
on to a still higher stage and so on. As he progresses onwards
he attains miraculous powers (yibhuti} and his faith and hope
in the practice increase. Miraculous powers bring with them
many temptations, but the yogin is firm of purpose and even
though the position of Indra is offered to him he does not relax.
His wisdom (prajfid) also increases at each step. Prajfla know
ledge is as clear as perception, but while perception is limited to
1 It should be noted that the word samadhi cannot properly be translated either
by " concentration" or by " meditation." It meajis that peculiar kind of concentra
tion in the Yoga sense by which the mind becomes one with its object and there is no
movement of the mind into its passing states.
vn] Wisdom and Emancipation 273
certain gross things and certain gross qualities 1 prajfia has no
such limitations, penetrating into the subtlest things, the tan-
matras, the gunas, and perceiving clearly and vividly all their
subtle conditions and qualities 1 . As the potencies (samskdrd) of the
prajfia wisdom grow in strength the potencies of ordinary know
ledge are rooted out, and the yogin continues to remain always
in his prajfla wisdom. It is a peculiarity of this prajfia that it
leads a man towards liberation and cannot bind him to samsara.
The final prajfias which lead to liberation are of seven kinds,
namely, ( i ) I have known the world, the object of suffering and
misery, I have nothing more to know of it. (2) The grounds and
roots of samsara have been thoroughly uprooted, nothing more
of it remains to be uprooted. (3) Removal has become a fact of
direct cognition by inhibitive trance. (4) The means of knowledge
in the shape of a discrimination of purusa from prakrti has been
understood. The other three are not psychological but are rather
metaphysical processes associated with the situation. They are
as follows : (5) The double purpose of buddhi experience and
emancipation (bhoga and apavarga) has been realized. (6) The
strong gravitating tendency of the disintegrated gunas drives
them into prakrti like heavy stones dropped from high hill tops.
(7) The buddhi disintegrated into its constituents the gunas
become merged in the prakrti and remain there for ever. The
purusa having passed beyond the bondage of the gunas shines
forth in its pure intelligence. There is no bliss or happiness in
this Samkhya-Yoga mukti, for all feeling belongs to prakrti. It
is thus a state of pure intelligence. What the Samkhya tries to
achieve through knowledge, Yoga achieves through the perfected
discipline of the will and psychological control of the mental
states.
1 The limitations which baffle perception are counted in the Karika as follows :
Extreme remoteness (e.g. a lark high up in the sky), extreme proximity (e.g. collyrium
inside the eye), loss of sense-organ (e.g. a blind man), want of attention, extreme
smallness of the object (e.g. atoms), obstruction by other intervening objects (e.g. by
walls), presence of superior lights (the star cannot be seen in daylight), being mixed
up with other things of its own kind (e.g. water thrown into a lake).
8 Though all things are but the modifications of gunas yet the real nature of the
gunas is never revealed by the sense-knowledge. What appears to the senses are but
illusory characteristics like those of magic (maya) :
" Gundndm pa.ra.mam rupam na drftipathamrechati
Yattu drstipatham praptam tanmdyeva sutucchakam."
VySsabhdsya, IV. r3.
The real nature of the gunas is thus revealed only by prajfia.
D. 18
CHAPTER VIII
THE NYAYA-VAISESIKA PHILOSOPHY
Criticism of Buddhism and Samkhya from the
Nyaya standpoint.
THE Buddhists had upset all common sense convictions of
substance and attribute, cause and effect, and permanence of
things, on the ground that all collocations are momentary;
each group of collocations exhausts itself in giving rise to
another group and that to another and so on. But if a col
location representing milk generates the collocation of curd
it is said to be due to a joint action of the elements forming
the cause-collocation and the modus operandi is unintelligible;
the elements composing the cause-collocation cannot separately
generate the elements composing the effect-collocation, for on
such a supposition it becomes hard to maintain the doctrine
of momentariness as the individual and separate exercise of in
fluence on the part of the cause-elements and their coordination
and manifestation as effect cannot but take more than one moment.
The supposition that the whole of the effect-collocation is the
result of the joint action of the elements of cause-collocation is
against our universal uncontradicted experience that specific
elements constituting the cause (e.g. the whiteness of milk) are
the cause of other corresponding elements of the effect (e.g. the
whiteness of the curd); and we could not say that the hardness,
blackness, and other properties of the atoms of iron in a lump
state should not be regarded as the cause of similar qualities in
the iron ball, for this is against the testimony of experience.
Moreover there would be no difference between material (updddna,
e.g. clay of the jug), instrumental and concomitant causes (nimitta
and sahakdri, such as the potter, and the wheel, the stick etc. in
forming the jug), for the causes jointly produce the effect, and
there was no room for distinguishing the material and the instru
mental causes, as such.
Again at the very moment in which a cause-collocation is
brought into being, it cannot exert its influence to produce its
CH. vm] Criticism of Samkhya 275
effect-collocation. Thus after coming into being it would take the
cause-collocation at least another moment to exercise its influence
to produce the effect. How can the thing which is destroyed the
moment after it is born produce any effect ? The truth is that
causal elements remain and when they are properly collocated
the effect is produced. Ordinary experience also shows that we
perceive things as existing from a past time. The past time is
perceived by us as past, the present as present and the future as
future and things are perceived as existing from a past time on
wards.
The Samkhya assumption that effects are but the actualized
states of the potential cause, and that the causal entity holds
within it all the future series of effects, and that thus the effect is
already existent even before the causal movement for the pro
duction of the effect, is also baseless. Samkhya says that the
oil was already existent in the sesamum and not in the stone, and
that it is thus that oil can be got from sesamum and not from the
stone. The action of the instrumental cause with them consists
only in actualizing or manifesting what was already existent in
a potential form in the cause. This is all nonsense. A lump of
clay is called the cause and the jug the effect ; of what good is it
to say that the jug exists in the clay since with clay we can never
carry water ? A jug is made out of clay, but clay is not a jug.
What is meant by saying that the jug was unmanifested or was
in a potential state before, and that it has now become manifest
or actual ? What does potential state mean ? The potential state
of the jug is not the same as its actual state; thus the actual state
of the jug must be admitted as non-existent before. If it is
meant that the jug is made up of the same parts (the atoms) of
which the clay is made up, of course we admit it, but this does
not mean that the jug was existent in the atoms of the lump
of clay. The potency inherent in the clay by virtue of which it
can expose itself to the influence of other agents, such as the
potter, for being transformed into a jug is not the same as the
effect, the jug. Had it been so, then we should rather have said
that the jug came out of the jug. The assumption of Samkhya
that the substance and attribute have the same reality is also
against all experience, for we all perceive that movement and
attribute belong to substance and not to attribute. Again
Samkhya holds a preposterous doctrine that buddhi is different
18 2
276 The Nyaya-Vaitesika Philosophy [CH.
from intelligence. It is absolutely unmeaning to call buddhi non-
intelligent. Again what is the good of all this fictitious fuss that
the qualities of buddhi are reflected on purusa and then again on
buddhi. Evidently in all our experience we find that the soul
(dtman) knows, feels and wills, and it is difficult to understand why
Samkhya does not accept this patent fact and declare that know
ledge, feeling, and willing, all belonged to buddhi. Then again in
order to explain experience it brought forth a theory of double
reflection. Again Samkhya prakrti is non-intelligent, and where
is the guarantee that she (prakrti) will not bind the wise again
and will emancipate him once for all ? Why did the purusa be
come bound down ? Prakrti is being utilized for enjoyment by
the infinite number of purusas, and she is no delicate girl (as
Samkhya supposes) who will leave the presence of the purusa
ashamed as soon as her real nature is discovered. Again pleasure
(snkha), sorrow (duhkhd) and a blinding feeling through ignorance
(moha) are but the feeling-experiences of the soul, and with what
impudence could Samkhya think of these as material substances?
Again their cosmology of a mahat, ahamkara, the tanmatras,
is all a series of assumptions never testified by experience nor
by reason. They are all a series of hopeless and foolish blunders.
The phenomena of experience thus call for a new careful recon
struction in the light of reason and experience such as cannot
be found in other systems. (See Nydyamatijari, pp. 452-466
and 490-496.)
Nyaya and Vaisesika sutras.
It is very probable that the earliest beginnings of Nyaya are
to be found in the disputations and debates amongst scholars
trying to find out the right meanings of the Vedic texts for use
in sacrifices and also in those disputations which took place be
tween the adherents of different schools of thought trying to
defeat one another. I suppose that such disputations occurred in
the days of the Upanisads, and the art of disputation was regarded
even then as a subject of study, and it probably passed then by
the name vi vdkovdkya. Mr Bodas has pointed out that Apastamba
who according to Buhler lived before the third century B.C. used the
word Nyaya in the sense of Mimamsa 1 . The word Nyaya derived
1 Apastamba^ trans, by Buhler, Introduction, p. xxvil., and Bodas s article on the
Historical Survey of Indian Logic in the Bombay Branch of J.R. A.S., vol. xix.
vi 1 1] The Science of Nyaya 277
from the root nl is sometimes explained as that by which sentences
and words could be interpreted as having one particular meaning
and not another, and on the strength of this even Vedic accents of
words (which indicate the meaning of compound words by pointing
out the particular kind of compound in which the words entered
into combination) were called Nyaya 1 . Prof. Jacobi on the strength
of Kautilya s enumeration of the vidyd (sciences) as Anvlksikl
(the science of testing the perceptual and scriptural knowledge
by further scrutiny), trayi (the three Vedas), vdrttd (the sciences
of agriculture, cattle keeping etc.), and dandantti (polity), and the
enumeration of the philosophies as Samkhya, Yoga, Lokayata
and Anvlksikl, supposes that the Nyaya sutra was not in existence
in Kautilya s time 300 B.C.) 2 . Kautilya s reference to Nyaya as
Anvlksikl only suggests that the word Nyaya was not a familiar
name for Anvlksikl in Kautilya s time. He seems to misunderstand
Vatsyayana in thinking that Vatsyayana distinguishes Nyaya
from the Anvlksikl in holding that while the latter only means
the science of logic the former means logic as well as metaphysics.
What appears from Vatsyayana s statement in Nyaya sutra I. i. I
is this that he points out that the science which was known in his
time as Nyaya was the same as was referred to as Anvlksikl by
Kautilya. He distinctly identifies Nyayavidya with Anvlksikl,
but justifies the separate enumeration of certain logical categories
such as samsaya (doubt) etc., though these were already contained
within the first two terms pratndna (means of cognition) and
prameya (objects of cognition), by holding that unless these its
special and separate branches (prthakprastkdna) were treated,
Nyayavidya would simply become metaphysics (adhydtmavidya)
like the Upanisads. The old meaning of Nyaya as the means of de
termining the right meaning or the right thing is also agreed upon
by Vatsyayana and is sanctioned by Vacaspati in his Nydyavdrt-
tikatdtparyatlkd I. i. i). He compares the meaning of the word
Nyaya (pramdnairarthapariksanam to scrutinize an object by
means of logical proof) with the etymological meaning of the word
an vlksikl (to scrutinize anything after it has been known by percep
tion and scriptures). Vatsyayana of course points out that so far as
this logical side of Nyaya is concerned it has the widest scope for
1 Kalidasa s FCumdrasambhava Udghdto pranavo ydsdm nydyaistriohirudfranam,"
also Mallinatha s gloss on it.
3 Prof. Jacobi s "The early history of Indian Philosophy " Indian Antiquary, 1918.
2 78 The Nyaya - Vai&sika Philosophy [CH.
itself as it includes all beings, all their actions, and all the sciences 1 .
He quotes Kautilya to show that in this capacity Nyaya is like
light illumining all sciences and is the means of all works. In its
capacity as dealing with the truths of metaphysics it may show the
way to salvation. I do not dispute Prof. Jacobi s main point that
the metaphysical portion of the work was a later addition, for this
seems to me to be a very probable view. In fact Vatsyayana him
self designates the logical portion as a prthakprasthana (separate
branch). But I do not find that any statement of Vatsyayana or
Kautilya can justify us in concluding that this addition was made
after Kautilya. Vatsyayana has no doubt put more stress on the
importance of the logical side of the work, but the reason of that
seems to be quite obvious, for the importance of metaphysics or
adhydtmavidyd was acknowledged by all. But the importance of
the mere logical side would not appeal to most people. None of
the dharmaSastras (religious scriptures) or the Vedas would lend
any support to It, and Vatsyayana had to seek the support of
Kautilya in the matter as the last resource. The fact that Kau
tilya was not satisfied by counting Anvlksikl as one of the four
vidyas but also named it as one of the philosophies side by side
with Samkhya seems to lead to the presumption that probably
even in Kautilya s time Nyaya was composed of two branches,
one as adhyatmavidya and another as a science of logic or rather
of debate. This combination is on the face of it loose and external,
and it is not improbable that the metaphysical portion was added
to increase the popularity of the logical part, which by itself might
not attract sufficient attention. Mahamahopadhyaya Haraprasada
astri in an article in the Journal of the Bengal Asiatic Society
1905 says that as Vacaspati made two attempts to collect the
Nyaya sutras, one as Nydyasuci and the other as Nydyasutroddhdra,
it seems that even in Vacaspati s time he was not certain as to
the authenticity of many of the Nyaya sutras. He further points
out that there are unmistakable signs that many of the sutras
were interpolated, and relates the Buddhist tradition from China
and Japan that Mirok mingled Nyaya and Yoga. He also
1 Yena prayuktah pravarttate tat prayojanam (that by which one is led to act is
called prayojanam) ; yamartham abhipsan jihasan va karma drabhate tenanena sarve
praninah sarvdni karmani sarvd/ca vidydh vyaptah tadafrayafca nyayah pravarttatt
(all those which one tries to have or to fly from are called prayojana, therefore all
beings, all their actions, and all sciences, are included within prayojana, and all these
depend on Nyaya). Vatsyayana bhdsya, I. i. i.
vm] Date of the Nyaya sutras 279
thinks that the sutras underwent two additions, one at the hands
of some Buddhists and another at the hands of some Hindu who
put in Hindu arguments against the Buddhist ones. These
suggestions of this learned scholar seem to be very probable, but
we have no clue by which we can ascertain the time when such
additions were made. The fact that there are unmistakable proofs
of the interpolation of many of the sutras makes the fixing of
the date of the original part of the Nyaya sutras still more diffi
cult, for the Buddhist references can hardly be of any help, and
Prof. Jacobi s attempt to fix the date of the Nydya sutras. on the
basis of references to Sunyavada naturally loses its value, except
on the supposition that all references to Sunyavada must be later
than Nagarjuna, which is not correct, since the Mahdydna sutras
written before Nagarjuna also held the Sunyavada doctrine.
The late Dr S. C. Vidyabhusana in J.R.A.S. 1918 thinks
that the earlier part of Nyaya was written by Gautama about
550 B.C. whereas the Nydya sutras of Aksapada were written
about 1 50 A.D. and says that the use of the word Nyaya in the
sense of logic in Mahdbhdrata I. I. 67, I. 70. 42-51, must be
regarded as interpolations. He, however, does not give any
reasons in support of his assumption. It appears from his treatment
of the subject that the fixing of the date of Aksapada was made
to fit in somehow with his idea that Aksapada wrote his Nydya
sutras under the influence of Aristotle a supposition which does
not require serious refutation, at least so far as Dr Vidyabhusana
has proved it. Thus after all this discussion we have not advanced
a step towards the ascertainment of the date of the original part
of the Nyaya. Goldstiicker says that both Patafljali (140 B.C.)
and Katyayana (fourth century B.C.) knew the Nydya sutras*. We
know that Kautilya knew the Nyaya in some form as Anvlksikl
in 300 B.C., and on the strength of this we may venture to say
that the Nyaya existed in some form as early as the fourth
century B.C. But there are other reasons which lead me to think
that at least some of the present sutras were written some time
in the second century A.D. Bodas points out that Badarayana s
sutras make allusions to the VaiSesika doctrines and not to Nyaya.
On this ground he thinks that Vaisesika sutras were written be
fore Badarayana s Brahma-sutras, whereas the Nydya sutras were
written later. Candrakanta Tarkalamkara also contends in his
1 Goldstticker s Pdnini, p. 157.
280 The Nyaya, -Vaitesika Philosophy [CH.
edition of Vateesika that the Vaisesika sutras were earlier than the
Nyaya. It seems to me to be perfectly certain that the Vaisesika
sutras were written before Caraka (80 A.D.) ; for he not only quotes
one of the Vaisesika sutras, but the whole foundation of his medical
physics is based on the Vaisesika physics 1 . The Lankdvatara
sutra (which as it was quoted by Asvaghosa is earlier than
80 A.D.) also makes allusions to the atomic doctrine. There are
other weightier grounds, as we shall see later on, for supposing
that the Vaisesika sutras are probably pre-Buddhistic 2 .
It is certain that even the logical part of the present Nyaya
sutras was preceded by previous speculations on the subject by
thinkers of other schools. Thus in commenting on I. i. 32 in which
the sutra states that a syllogism consists of five premisses (avayava)
Vatsyayana says that this sutra was written to refute the views
of those who held that there should be ten premisses 8 . The
Vaisesika sutras also give us some of the earliest types of inference,
which do not show any acquaintance with the technic of the Nyaya
doctrine of inference 4 .
Does Vaisesika represent an Old School of Mimamsa ?
The Vaisesika is so much associated with Nyaya by tradition
that it seems at first sight quite unlikely that it could be supposed
to represent an old school of Mimamsa, older than that represented
in the Mimamsa sutras. But a closer inspection of the Vaisesika
sutras seems to confirm such a supposition in a very remarkable
way. We have seen in the previous section that Caraka quotes
a Vaisesika sutra. An examination of Caraka s Sutrasthdna (I.
35-38) leaves us convinced that the writer of the verses had some
compendium of Vaisesika such as that of the Bhdsdpariccheda
before him. Caraka sutra or kdrikd (i. i. 36) says that the gunas
are those which have been enumerated such as heaviness, etc.,
cognition, and those which begin with the guna "para" (univer
sality) and end with "prayatna" (effort) together with the sense-
qualities (sdrthd). It seems that this is a reference to some well-
known enumeration. But this enumeration is not to be found
in the Vaisesika sutra (I. i. 6) which leaves out the six gunas,
1 Caraka, Sdrira, 39.
* See the next section.
8 Vatsyayana s Bhasya on the Nyaya sutras, i. i. 32. This is undoubtedly a reference
to the Jaina view as found in Dafavaikalikaniryukti as noted before.
4 Nyaya sutra I. i. 5, and Vaisesika sutras IX. ii. 1-2, 4-5, and in. i. 8-17.
vm] Antiquity of Vaifesika 281
heaviness (gurutva), liquid ity(dravafva),oi\ mess(sneha), elasticity
(samskdra), merit (dharmd) and demerit (adharmd) ; in one part
of the sutra the enumeration begins with "para" (universality)
and ends in "prayatna," but buddhi (cognition) comes within
the enumeration beginning from para and ending in prayatna,
whereas in Caraka buddhi does not form part of the list and is
separately enumerated. This leads me to suppose that Caraka s
sutra was written at a time when the six gunas left out in the
Vaisesika enumeration had come to be counted as gunas, and
compendiums had been made in which these were enumerated.
Bhdsdpariccheda (a later Vaisesika compendium), is a compilation
from some very old karikas which are referred to by ViSvanatha
as being collected from " atisamksiptacirantanoktibhih" (from
very ancient aphorisms 1 ); Caraka s definition of samanya and
viesa shows that they had not then been counted as separate
categories as in later Nyaya- Vaisesika doctrines; but though
slightly different it is quite in keeping with the sort of definition
one finds in the Vaisesika sutra that samanya (generality) and
vis"esa are relative to each other 2 . Caraka s sutras were therefore
probably written at a time when the Vaisesika doctrines were
undergoing changes, and well-known compendiums were begin
ning to be written on them.
The Vaisesika sutras seem to be ignorant of the Buddhist
doctrines. In their discussions on the existence of soul, there is
no reference to any view as to non-existence of soul, but the
argument turned on the point as to whether the self is to be an
object of inference or revealed to us by our notion of "I." There
is also no other reference to any other systems except to some
Mlmamsa doctrines and occasionally to Samkhya. There is no
reason to suppose that the Mlmamsa doctrines referred to allude
to the Mimdmsd sutras of Jaimini. The manner in which the
nature of inference has been treated shows that the Nyaya
phraseology of "purvavat" and "sesavat" was not known. Vaise
sika sutras in more than one place refer to time as the ultimate
cause 3 . We know that the SvetasVatara Upanisad refers to those
who regard time as the cause of all things, but in none of the
1 Professor Vanamali Vedantatlrtha s article in_/. A,S.B., 1908.
3 Caraka (i. i. 33) says that samanya is that which produces unity and vis"esa is
that which separates. V. S. n. ii. 7. Samanya and viesa depend upon our mode of
thinking (as united or as separate).
3 VaiSesika sutra (n. ii. 9 and V. ii. iff).
282 The Nyaya-Vaifesika Philosophy [CH.
systems that we have can we trace any upholding of this ancient
view 1 . These considerations as well as the general style of the
work and the methods of discussion lead me to think that these
sutras are probably the oldest that we have and in all probability
are pre- Buddhistic.
The Vaisesika sutra begins with the statement that its object
is to explain virtue, "dharma." This is we know the manifest duty
of Mlmamsa and we know that unlike any other system Jaimini
begins his Mlmdmsd sutras by defining "dharma." This at first
seems irrelevant to the main purpose of Vaisesika, viz., the de
scription of the nature of padartha 2 . He then defines dharma as
that which gives prosperity and ultimate good (nihsreyasd) and
says that the Veda must be regarded as valid, since it can dictate
this. He ends his book with the remarks that those injunctions
(of Vedic deeds) which are performed for ordinary human motives
bestow prosperity even though their efficacy is not known to us
through our ordinary experience, and in this matter the Veda must
be regarded as the authority which dictates those acts*. The fact
that the Vaisesika begins with a promise to describe dharma and
after describing the nature of substances, qualities and actions
and also the adrsta (unknown virtue) due to dharma (merit
accruing from the performance of Vedic deeds) by which many
of our unexplained experiences may be explained, ends his book
by saying that those Vedic works which are not seen to produce
any direct effect, will produce prosperity through adrsta, shows
that Kanada s method of explaining dharma has been by showing
that physical phenomena involving substances, qualities, and
actions can only be explained up to a certain extent while a
good number cannot be explained at all except on the as
sumption of adrsta (unseen virtue) produced by dharma. The
1 SvetasVatara I. i. i.
2 I remember a verse quoted in an old commentary of the Kalapa Vyakarana, in
which it is said that the description of the six categories by Kanada in his Vaisesika
sutras, after having proposed to describe the nature of dharma, is as irrelevant as to
proceed towards the sea while intending to go to the mountain Himavat (Himalaya).
" Dharmam vyakhyatukamasya satpaddrthopavarnanatii Himavadgantukamasya saga-
ragamanopam am . "
3 The sutra " Tadvacanad dmndyasya prdmdnyam (l. i. 3 and x. ii. 9) has been
explained by Upaskara as meaning " The Veda being the word of I^vara (God) must
be regarded as valid," but since there is no mention of " Kvara " anywhere in the text
this is simply reading the later Nyaya ideas into the Vaisesika. Sutra x. ii. 8 is only
a repetition of vi. ii. i.
vmj Antiquity of Vaifesika 283
description of the categories of substance is not irrelevant, but
is the means of proving that our ordinary experience of these
cannot explain many facts which are only to be explained on
the supposition of adrsta proceeding out of the performance
of Vedic deeds. In v. i. 15 the movement of needles towards
magnets, in V. ii. 7 the Circulation of water in plant bodies,
v. ii. 13 and IV. ii. 7 the upward motion of fire, the side motion
of air, the combining movement of atoms (by which all com
binations have taken place), and the original movement of the
mind are said to be due to adrsta. In v. ii. 17 the movement
of the soul after death, its taking hold of other bodies, the
assimilation of food and drink and other kinds of contact (the
movement and development of the foetus as enumerated in
Upaskdra} are said to be due to adrsta. Salvation (moksa) is
said to be produced by the annihilation of adrsta leading to the
annihilation of all contacts and non-production of rebirths.
Vaisesika marks the distinction between the drsta (experienced)
and the adrsta. All the categories that he describes are founded
on drsta (experience) and those unexplained by known experi
ence are due to adrsta. These are the acts on which depend all
life-process of animals and plants, the continuation of atoms or
the construction of the worlds, natural motion of fire and air,
death and rebirth (VI. ii. 15) and even the physical phenomena
by which our fortunes are affected in some way or other (V. ii. 2),
in fact all with which we are vitally interested in philosophy.
Kanada s philosophy gives onlysome facts of experience regarding
substances, qualities and actions, leaving all the graver issues of
metaphysics to adrsta. But what leads to adrsta? In answer to
this, Kanada does not speak of good or bad or virtuous or
sinful deeds, but of Vedic works, such as holy ablutions (sndna),
fasting, holy student life (brahmacarya), remaining at the house
of the teacher (gurukulavdsa\ retired forest life (vdnaprastha},
sacrifice (yajha\ gifts (ddna), certain kinds of sacrificial sprink
ling and rules of performing sacrificial works according to the
prescribed time of the stars, the prescribed hymns (mantras)
(VI. ii. 2).
He described what is pure and what is impure food, pure
food being that which is sacrificially purified (VI. ii. 5) the con
trary being impure; and he says that the taking of pure food
leads to prosperity through adrsta. He also described how
284 The Nyaya - Vaisesika Philosophy [CH.
feelings of attachment to things are also generated by adrsta.
Throughout almost the whole of VI. i Kanada is busy in showing
the special conditions of making gifts and receiving them. A refer
ence to our chapter on Mlmamsa will show that the later Mlmamsa
writers agreed with the Nyaya- Vaisesika doctrines in most of their
views regarding substance, qualities, etc. Some of the main points
in which Mlmamsa differs from Nyaya-VaiSesika are (i) self-
validity of the Vedas, (2) the eternality of the Vedas, (3) disbelief
in any creator or god, (4) eternality of sound (sabda), (5) (accord
ing to Kumarila) direct perception of self in the notion of the ego.
Of these the first and the second points do not form any subject
of discussion in the Vaisesika. But as no Isvara is mentioned,
and as all adrsta depends upon the authority of the Vedas, we
may assume that Vaisesika had no dispute with Mlmamsa. The
fact that there is no reference to any dissension is probably due
to the fact that really none had taken place at the time of the
Vaisesika sutras. It is probable that Kanada believed that the
Vedas were written by some persons superior to us (II. i. 18, VI. i.
1-2). But the fact that there is no reference to any conflict with
Mlmamsa suggests that the doctrine that the Vedas were never
written by anyone was formulated at a later period, whereas in
the days of the Vaisesika sutras, the view was probably what is
represented in the Vaisesika sutras. As there is no reference to
Isvara and as adrsta proceeding out of the performance of actions
in accordance with Vedic injunctions is made the cause of all
atomic movements, we can very well assume that Vaisesika was
as atheistic or non-theistic as the later Mlmarnsa philosophers.
As regards the eternality of sound, which in later days was one
of the main points of quarrel between the Nyaya- Vaisesika and
the Mlmamsa, we find that in II. ii. 25-32, Kanada gives reasons
in favour of the non-eternality of sound, but after that from II. ii. 33
till the end of the chapter he closes the argument in favour of the
eternality of sound, which is the distinctive Mlmamsa view as we
know from the later Mlmamsa writers 1 . Next comes the question
of the proof of the existence of self. The traditional Nyaya view is
1 The last two concluding sutras n. ii. 36 and 37 are in my opinion wrongly inter
preted by 6ankara MisVa in his Upaskara (n. ii. 36 by adding an "aft" to the sutra
and thereby changing the issue, and II. ii. 37 by misreading the phonetic combination
" samkhyabhava " as samkhya and bhava instead of samkhya and abhava, which in
my opinion is the right combination here) in favour of the non-eternality of sound as
we find in the later Nyaya-Vais"esika view.
vm] Philosophy in the Vaisesika sutras 285
that the self is supposed to exist because it must be inferred as the
seat of the qualities of pleasure, pain, cognition, etc. Traditionally
this is regarded as the Vaisesika view as well. But in Vaisesika
III. ii. 4 the existence of soul is first inferred by reason of its
activity and the existence of pleasure, pain, etc., in III. ii. 6-7 this
inference is challenged by saying that we do not perceive that the
activity, etc. belongs to the soul and not to the body and so no
certainty can be arrived at by inference, and in in. ii. 8 it is
suggested that therefore the existence of soul is to be accepted
on the authority of the scriptures (agamd). To this the final
Vaisesika conclusion is given that we can directly perceive the self
in our feeling as "I" (aham), and we have therefore not to depend
on the scriptures for the proof of the existence of the self, and thus
the inference of the existence of the self is only an additional
proof of what we already find in perception as "I" (aham) (in. ii.
10-18, also IX. i. n).
These considerations lead me to think that the Vaisesika
represented a school of Mlmamsa thought which supplemented
a metaphysics to strengthen the grounds of the Vedas.
Philosophy in the Vaisesika sutras.
The Vaisesika sutras begin with the ostensible purpose of ex
plaining virtue (dharma) (I. i. i) and dharma according to it is
that by which prosperity (abhyudayd) and salvation (nihsreyasd)
are attained. Then it goes on to say that the validity of the
Vedas depends on the fact that it leads us to prosperity and
salvation. Then it turns back to the second sutra and says that
salvation comes as the result of real knowledge, produced by
special excellence of dharma, of the characteristic features of
the categories of substance (dravyd), quality (guna), class con
cept (sdmdnyd}, particularity (visesd), and inherence (samavdydy.
The dravyas are earth, water, fire, air, ether, time, space, soul,
and mind. The gunas are colour, taste, odour, touch, number,
measure, separations, contact, disjoining, quality of belonging to
high genus or to species 2 . Action (karma) means upward move-
1 Upaskara notes that vis"esa here refers to the ultimate differences of things and
not to species. A special doctrine of this system is this, that each of the indivisible
atoms of even the same element has specific features of difference.
2 Here the well known qualities of heaviness (gurutva), liquidity (dravatva), oili-
ness (sneha), elasticity (samskdra), merit (dharma), and demerit (adharma) have been
altogether omitted. These are all counted in later Vais esika commentaries and com-
286 The Nyaya-Vai&sika Philosophy [CH.
ment, down ward movement, contraction, expansion and horizontal
movement. The three common qualities of dravya, guna and karma
are that they are existent, non-eternal, substantive, effect, cause,
and possess generality and particularity. Dravya produces other
dravyas and the gunas other gunas. But karma is not necessarily
produced by karma. Dravya does not destroy either its cause or
its effect, but the gunas are destroyed both by the cause and by
the effect. Karma is destroyed by karma. Dravya possesses
karma and guna and is regarded as the material (samavdyi) cause.
Gunas inhere in dravya, cannot possess further gunas, and are
not by themselves the cause of contact or disjoining. Karma is
devoid of guna, cannot remain at one time in more than one
object, inheres in dravya alone, and is an independent cause of
contact or disjoining. Dravya is the material cause (samavayi)
of (derivative) dravyas, guna, and karma; guna is also the non-
material cause (flsamdvdyi) of dravya, guna and karma. Karma
is the general cause of contact, disjoining, and inertia in motion
(vega). Karma is not the cause of dravya. For dravya may be
produced even without karma 1 . Dravya is the general effect of
dravya. Karma is dissimilar to guna in this that it does not pro
duce karma. The numbers two, three, etc., separateness, contact
and disjoining are effected by more than one dravya. Each karma
not being connected with more than one thing is not produced
by more than one thing 8 . A dravya is the result of many con
tacts (of the atoms). One colour may be the result of many
colours. Upward movement is the result of heaviness, effort and
contact. Contact and disjoining are also the result of karma. In
denying the causality of karma it is meant that karma is not the
cause of dravya and karma*.
In the second chapter of the first book Kanada first says that
if there is no cause, there is no effect, but there may be the cause
even though there may not be the effect. He next says that
genus (sdmanyd) and species (visesa) are relative to the under-
pendiums. It must be noted tha* "guna" in Vai^esika means qualities and not subtle
reals or substances as in Samkhya-Yoga. Guna in Vai^esika would be akin to what
Yoga would call dharma.
1 It is only when the karya ceases that dravya is produced. See Upaskara I. i. 12.
2 If karma is related to more than one thing, then with the movement of one we
should have felt that two or more things were moving.
3 It must be noted that "karma" in this sense is quite different from the more
extensive use of karma as meritorious or vicious action which is the cause of rebirth.
vin] Philosophy in the Vaifesika sutras 287
standing; being (bhdvd) indicates continuity only and is hence
only a genus. The universals of substance, quality and action
may be both genus and species, but visesa as constituting the ulti
mate differences (of atoms) exists (independent of any percipient).
In connection with this he says that the ultimate genus is being
(satta) in virtue of which things appear as existent; all other
genera may only relatively be regarded as relative genera or
species. Being must be regarded as a separate category, since it
is different from dravya, guna and karma, and yet exists in them,
and has no genus or species. It gives us the notion that some
thing is and must be regarded as a category existing as one
identical entity in all dravya, guna, and karma, for in its uni
versal nature as being it has no special characteristics in the
different objects in which it inheres. The specific universals of
thingness (dravyatva\ qualitiness (guftatva) or actionness (kar-
matvd) are also categories which are separate from universal being
(bhdva or satta) for they also have no separate genus or species
and yet may be distinguished from one another, but bhava or
being was the same in all.
In the first chapter of the second book Kanada deals with
substances. Earth possesses colour, taste, smell, and touch ; water,
colour, taste, touch, liquidity, and smoothness (snigdha)\ fire,
colour and touch; air, touch; but none of these qualities can be
found in ether (dkdsd). Liquidity is a special quality of water
because butter, lac, wax, lead, iron, silver, gold, become liquids
only when they are heated, while water is naturally liquid itself 1 .
Though air cannot be seen, yet its existence can be inferred by
touch, just as the existence of the genus of cows may be inferred
from the characteristics of horns, tails, etc. Since this thing in
ferred from touch possesses motion and quality, and does not
itself inhere in any other substance, it is a substance (dravya)
and is eternal 2 . The inference of air is of the type of inference
of imperceptible things from certain known characteristics
called sdmdnyato drsta. The name of air "vayu" is derived
from the scriptures. The existence of others different from us
has (asmadvisistdndm) to be admitted for accounting for the
1 It should be noted that mercury is not mentioned. This is important for mercury
was known at a time later than Caraka.
2 Substance is that which possesses quality and action. It should be noted that
the word " adravyatvena" in II. i. 13 has been interpreted by me as " adravyavattvtna"
288 The Nyaya-Vatiesika Philosophy [CH.
giving of names to things (samjndkarma). Because we find
that the giving of names is already in usage (and not invented
by us) 1 . On account of the fact that movements rest only in
one thing, the phenomenon that a thing can enter into any un
occupied space, would not lead us to infer the existence of akasa
(ether). Akasa has to be admitted as the hypothetical substance
in which the quality of sound inheres, because, since sound (a
quality) is not the characteristic of things which can be touched,
there must be some substance of which it is a quality. And this
substance is akasa. It is a substance and eternal like air. As
being is one so akasa is one 2 .
In the second chapter of the second book Kanada tries to
prove that smell is a special characteristic of earth, heat of fire,
and coldness of water. Time is defined as that which gives the
notion of youth in the young, simultaneity, and quickness. It is
one like being. Time is the cause of all non-eternal things, be
cause the notion of time is absent in eternal things. Space
supplies the notion that this is so far away from this or so much
nearer to this. Like being it is one. One space appears to have
diverse inter-space relations in connection with the motion of the
sun. As a preliminary to discussing the problem whether sound
is eternal or not, he discusses the notion of doubt, which arises
when a thing is seen in a general way, but the particular features
coming under it are not seen, either when these are only remem
bered, or when some such attribute is seen which resembles some
other attribute seen before, or when a thing is seen in one way
but appears in another, or when what is seen is not definitely
grasped, whether rightly seen or not He then discusses the ques
tion whether sound is eternal or non-eternal and gives his reasons
to show that it is non-eternal, but concludes the discussion with
a number of other reasons proving that it is eternal.
The first chapter of the third book is entirely devoted to the
inference of the existence of soul from the fact that there must
be some substance in which knowledge produced by the contact
of the senses and their object inheres.
The knowledge of sense-objects (indriydrtha) is the reason by
1 I have differed from Upaskara in interpreting " samjftakarma " in II. i. 18, 19 as
a genitive compound while Upaskara makes it a dvandva compound. Upaskara s
interpretation seems to be far-fetched. He wants to twist it into an argument for the
existence of God.
2 This interpretation is according to Sankara Misra s Upaskara.
vm] Philosophy in the Vaifesika sutras 289
which we can infer the existence of something different from the
senses and the objects which appear in connection with them. The
types of inferences referred to are ( I ) inference of non-existence of
some things from the existence of some things, (2) of the existence
of some things from the non-existence of some things, (3) of the
existence of some things from the existence of others. In all
these cases inference is possible only when the two are known to
be connected with each other (prasiddkipurvakatv&t apadesasyd) 1 .
When such a connection does not exist or is doubtful, we have
anapadesa (fallacious middle) and sandigdha (doubtful middle);
thus, it is a horse because it has a horn, or it is a cow because it
has a horn are examples of fallacious reason. The inference of
soul from the cognition produced by the contact of soul, senses
and objects is not fallacious in the above way. The inference of
the existence of the soul in others may be made in a similar way
in which the existence of one s own soul is inferred 2 , i.e. by virtue
of the existence of movement and cessation of movement. In the
second chapter it is said that the fact that there is cognition only
when there is contact between the self, the senses and the objects
proves that there is manas (mind), and this manas is a substance
and eternal, and this can be proved because there is no simul
taneity of production of efforts and various kinds of cognition; it
may also be inferred that this manas is one (with each person).
The soul may be inferred from inhalation, exhalation, twinkling
of the eye, life, the movement of the mind, the sense-affections
pleasure, pain, will, antipathy, and effort. That it is a substance
and eternal can be proved after the manner of vayu. An objector
is supposed to say that since when I see a man I do not see his
soul, the inference of the soul is of the type of sdmdnyatodrsta
inference, i.e., from the perceived signs of pleasure, pain, cog
nition to infer an unknown entity to which they belong, but
that this was the self could not be affirmed. So the existence of
soul has to be admitted on the strength of the scriptures. But
the Vaisesika reply is that since there is nothing else but self to
which the expression "I" may be applied, there is no need of
falling back on the scriptures for the existence of the soul. But
1 In connection with this there is a short reference to the methods of fallacy in
which Gautama s terminology does not appear. There is no generalised statement, but
specific types of inference are only pointed out as the basis.
3 The forms of inference used show that Kanada was probably not aware of
Gautama s terminology.
D. 19
290 The Nyaya-Vaifesika Philosophy [CH.
then it is said that if the self is directly perceived in such ex
periences as "I am Yajfiadatta" or "I am Devadatta," what is the
good of turning to inference? The reply to this is that inference
lending its aid to the same existence only strengthens the con
viction. When we say that Devadatta goes or Yajfiadatta goes,
there comes the doubt whether by Devadatta or Yajfiadatta the
body alone is meant; but the doubt is removed when we think
that the notion of "I" refers to the self and not to anything else.
As there is no difference regarding the production of pleasure,
pain, and cognition, the soul is one in all. But yet it is many
by special limitations as individuals and this is also proved on
the strength of the scriptures 1 .
In the first chapter of the fourth book it is said that that
which is existent, but yet has no cause, should be considered
eternal (nityd). It can be inferred by its effect, for the effect can
only take place because of the cause. When we speak of any
thing as non-eternal, it is only a negation of the eternal, so that
also proves that there is something eternal. The non-eternal
is ignorance (avid/yd)*. Colour is visible in a thing which is great
(mahat) and compounded. Air (jvdyu) is not perceived to have
colour, though it is great and made up of parts, because it has not
the actuality of colour (rufiasamskara i.e. in air there is only
colour in its unmanifested form) in it Colour is thus visible only
when there is colour with special qualifications and conditions 8 . In
this way the cognition of taste, smell, and touch is also explained.
Number,measure,separateness, contact, and disjoining, the quality
of belonging to a higher or lower class, action, all these as they
abide in things possessing colour are visible to the eye. The
number etc. of those which have no colour are not perceived by the
eye. But the notion of being and also of genus of quality (gunatva)
1 I have differed here from the meaning given in Upaskara. I think the three
sutras " Sukhaduhkhajnanani spotty avifesadekatmy am" "vyavasthdto ndnd," and "JYW-
tras&marthyat ca " originally meant that the self was one, though for the sake of many
limitations, and also because of the need of the performance of acts enjoined by the
scriptures, they are regarded as many.
* I have differed here also in my meaning from the Upaskara, which regards this
sutra " avidyd" to mean that we do not know of any reasons which lead to the non-
eternality of the atoms.
3 This is what is meant in the later distinctions of udbhUtarupavattva and anud-
bhutartipavattva. The word samskaru in Vais"esika has many senses. It means inertia,
elasticity, collection (samavdya), production (udbhava) and not being overcome (anab-
hibhava). For the last three senses see Upaskara IV. i. 7.
vi n] Philosophy in the Vaifesika sutras 291
are perceived by all the senses (just as colour, taste, smell, touch,
and sound are perceived by one sense, cognition, pleasure, pain,
etc. by the manas and number etc. by the visual and the tactile
sense) 1 .
In the second chapter of the fourth book it is said that the
earth, etc. exist in three forms, body, sense, and objects. There
cannot be any compounding of the five elements or even of the
three, but the atoms of different elements may combine when one
of them acts as the central radicle (upastambhakd). Bodies are of
two kinds, those produced from ovaries and those which are other
wise produced by the combination of the atoms in accordance
with special kinds of dharma. All combinations of atoms are due
to special kinds of dharmas. Such super-mundane bodies are to
be admitted for explaining the fact that things must have been
given names by beings having such super-mundane bodies, and
also on account of the authority of the Vedas.
In the first chapter of the fifth book action (karma) is dis
cussed. Taking the example of threshing the corn, it is said
that the movement of the hand is due to its contact with the
soul in a state of effort, and the movement of the flail is due
to its contact with the hand. But in the case of the uprising of
the flail in the threshing pot due to impact the movement is
not due to contact with the hands, and so the uplifting of the
hand in touch with the flail is not due to its contact with the
soul; for it is due to the impact of the flail. On account of
heaviness (gurutva) the flail will fall when not held by the hand.
Things may have an upward or side motion by specially directed
motions (nodanavisesa) which are generated by special kinds of
efforts. Even without effort the body may move during sleep.
The movement of needles towards magnets is due to an unknown
cause (adrstakaranaka\ The arrow first acquires motion by
specially directed movement, and then on account of its inertia
(vegasamskara) keeps on moving and when that ceases it falls
down through heaviness.
The second chapter abounds with extremely crude explana-
1 This portion has been taken from the Upnskdra of Sankara Misra on the Vaiie-
sika sutras of Kanada. It must be noted here that the notion of number according to
Vaisesika is due to mental relativity or oscillation (apeksdbuddJiijanya). But this mental
relativity can only start when the thing having number is either seen or touched ; and it
is in this sense that notion of number is said to depend on the visual or the tactual
sense.
192
292 The Nyaya-Vaitesika Philosophy [CH.
tions of certain physical phenomena which have no philosophical
importance. All the special phenomena of nature are explained
as being due to unknown cause (adr$takdritam) and no ex
planation is given as to the nature of this unknown (adrsta).
It is however said that with the absence of adrsta there is no con
tact of body with soul, and thus there is no rebirth, and therefore
moksa (salvation); pleasure and pain are due to contact of the
self, manas, senses and objects. Yoga is that in which the mind
is in contact with the self alone, by which the former becomes
steady and there is no pain in the body. Time, space, akaa are
regarded as inactive.
The whole of the sixth book is devoted to showing that gifts
are made to proper persons not through sympathy but on account
of the injunction of the scriptures, the enumeration of certain
Vedic performances, which brings in adrsta, purification and im
purities of things, how passions are often generated by adrsta,
how dharma and adharma lead to birth and death and how moksa
takes place as a result of the work of the soul.
In the seventh book it is said that the qualities in eternal
things are eternal and in non-eternal things non-eternal. The
change of qualities produced by heat in earth has its beginning
in the cause (the atoms). Atomic size is invisible while great size
is visible. Visibility is due to a thing s being made up of many
causes 1 , but the atom is therefore different from those that have
great size. The same thing may be called great and small rela
tively at the same time. In accordance with anutva (atomic) and
mahattva (great) there are also the notions of small and big. The
eternal size of parimandala (round) belongs to the atoms. Akasa
and atman are called mahan or paramamahan (the supremely
great or all-pervasive); since manas is not of the great measure
it is of atomic size. Space and time are also considered as being
of the measure "supremely great" (paramamahat). Atomic size
(parimandala) belonging to the atoms and the mind (manas) and
the supremely great size belonging to space, time, soul and ether
(akasa) are regarded as eternal.
In the second chapter of the seventh book it is said that unity
and separateness are to be admitted as entities distinct from
other qualities. There is no number in movement and quality;
the appearance of number in them is false. Cause and effect are
1 I have differed from the Upaskara in the interpretation of this sutra.
vi 1 1] Philosophy in the Vaisesika sutras 293
neither one, nor have they distinctive separateness (ekaprthaktvd).
The notion of unity is the cause of the notion of duality, etc.
Contact may be due to the action of one or two things, or the
effect of another contact and so is disjoining. There is neither
contact nor disjoining in cause and effect since they do not exist
independently (yutasiddhyabhdvdt). In the eighth book it is said
that soul and manas are not perceptible, and that in the ap
prehension of qualities, action, generality, and particularity
perception is due to their contact with the thing. Earth is the
cause of perception of smell, and water, fire, and air are the
cause of taste, colour and touch 1 . In the ninth book negation is
described ; non-existence (asat) is defined as that to which
neither action nor quality can be attributed. Even existent things
may become non-existent and that which is existent in one
way may be non-existent in another; but there is another kind
of non-existence which is different from the above kinds of
existence and non-existence 2 . All negation can be directly per
ceived through the help of the memory which keeps before the
mind the thing to which the negation applies. Allusion is also
made in this connection to the special perceptual powers of the
yogins (sages attaining mystical powers through Yoga practices).
In the second chapter the nature of hetu (reason) or the
middle term is described. It is said that anything connected
with any other thing, as effect, cause, as in contact, or as con
trary or as inseparably connected, will serve as liriga (reason).
The main point is the notion "this is associated with this," or
"these two are related as cause and effect," and since this may
also be produced through premisses, there may be a formal syllo
gism from propositions fulfilling the above condition. Verbal
cognition comes without inference. False knowledge (avidyd) is
due to the defect of the senses or non-observation and mal-
observation due to wrong expectant impressions. The opposite
of this is true knowledge (vidya). In the tenth it is said that
pleasure and pain are not cognitions, since they are not related to
doubt and certainty.
1 Upaskara here explains that it is intended that the senses are produced by those
specific elements, but this cannot be found in the sutras.
2 In the previous three kinds of non-existence, pragabhava (negation before pro
duction), dhvamsabhava (negation after destruction), and anyonyabhava (mutual
negation of each other in each other), have been described. The fourth one is sdnidn-
yabhava (general negation).
294 The Nyaya- Vaitesika Philosophy [CH.
A dravya may be caused by the inhering of the effect in it, for
because of its contact with another thing the effect is produced.
Karma (motion) is also a cause since it inheres in the cause. Con
tact is also a cause since it inheres in the cause. A contact which
inheres in the cause of the cause and thereby helps the production
of the effect is also a cause. The special quality of the heat of
fire is also a cause.
Works according to the injunctions of the scriptures since they
have no visible effect are the cause of prosperity, and because the
Vedas direct them, they have validity.
Philosophy in the Nyaya sutras 1 .
The Nydya sutras begin with an enumeration of the sixteen
subjects, viz. means of right knowledge (pramdna), object of right
knowledge (prameya), doubt (samsayd), purpose (prayojana), il
lustrative instances (drstdnta), accepted conclusions (siddhdnta),
premisses (avayava), argumentation (tarkd), ascertainment (nir-
naya), debates \vddd), disputations (jalpa), destructive criticisms
{vitanda), fallacy (hetvdbhdsd), quibble (chala), refutations (j dft),
points of opponent s defeat (nigrahasthdna), and hold that by a
thorough knowledge of these the highest good (m /zsreyasa), is
attained. In the second sutra it is said that salvation (apavargd)
is attained by the successive disappearance of false knowledge
(mithydjndnd), defects (dosd), endeavours (pravrtti), birth (jan-
ma\ and ultimately of sorrow. Then the means of proof are said
to be of four kinds, perception (pratyaksd), inference (anumdna),
analogy (upamdnd), and testimony (sabda). Perception is defined
asuncontradicted determinate knowledge unassociated with names
proceeding out of sense contact with objects. Inference is of three
kinds, from cause to effect (purvavai), effect to cause (sesavat),
and inference from common characteristics (sdmdnyato drsta}.
Upamana is the knowing of anything by similarity with any well-
known thing.
Sabda is defined as the testimony of reliable authority (apta) 2 .
1 This is a brief summary of the doctrines found in Nyaya sutras, supplemented
here and there with the views of Vatsyayana, the commentator. This follows the
order of the sutras, and tries to present their ideas with as little additions from those
of later day Nyaya as possible. The general treatment of Nyaya- Vais esika expounds
the two systems in the light of later writers and commentators.
2 It is curious to notice that Vatsyayana says that an arya, a rsi or a mleccha
(foreigner), may be an apta (reliable authority).
viu] Philosophy in the Nyaya sutras 295
Such a testimony may tell us about things which may be ex
perienced and which are beyond experience. Objects of know
ledge are said to be self (atman\ body, senses, sense-objects,
understanding (buddht), mind (manas), endeavour (pravrtti), re
births, enjoyment of pleasure and suffering of pain, sorrow and
salvation. Desire, antipathy, effort (prayatna), pleasure, pain, and
knowledge indicate the existence of the self. Body is that which
upholds movement, the senses and the rise of pleasure and pain
as arising out of the contact of sense with sense-objects 1 ; the five
senses are derived from the five elements, such as prthivl, ap,
tejas, vayu and akasa ; smell, taste, colour, touch, and sound are
the qualities of the above five elements, and these are also the
objects of the senses. The fact that many cognitions cannot
occur at any one moment indicates the existence of mind (manas}.
Endeavour means what is done by speech, understanding, and
body. Dosas (attachment, antipathy, etc.) are those which lead
men to virtue and vice. Pain is that which causes suffering 2 .
Ultimate cessation from pain is called apavarga*. Doubt arises
when through confusion of similar qualities or conflicting opinions
etc., one wants to settle one of the two alternatives. That for
attaining which, or for giving up which one sets himself to work
is called prayojana.
Illustrative example (drstdntd) is that on which both the
common man and the expert (parzksaka) hold the same opinion.
Established texts or conclusions (siddhdnta) are of four kinds,
viz. ( I ) those which are accepted by all schools of thought called
the sarvatantrasiddhanta\ (2) those which are held by one school
or similar schools but opposed by others called the pratitantra-
siddhdnta; (3) those which being accepted other conclusions will
also naturally follow called adhikaranasiddhdnta\ (4) those of the
opponent s views which are uncritically granted by a debater, who
proceeds then to refute the consequences that follow and thereby
show his own special skill and bring the opponent s intellect to
disrepute (abhyupagamasiddhantay. The premisses are five:
1 Here I have followed Vatsyayana s meaning.
2 Vatsyayana comments here that when one finds all things full of misery, he
wishes to avoid misery, and finding birth to be associated with pain becomes unattached
and thus is emancipated.
3 Vatsyayana wants to emphasize that there is no bliss in salvation, but only
cessation from pain.
* I have followed Vatsyayana s interpretation here.
296 The Ny ay a- Vaifesika Philosophy [CH.
(1) pratijha (the first enunciation of the thing to be proved);
(2) hetu (the reason which establishes the conclusion on the
strength of the similarity of the case in hand with known exam
ples or negative instances); (3) uddharaqa (positive or negative
illustrative instances) ; (4) upanaya (corroboration by the instance) ;
(5) nigamana (to reach the conclusion which has been proved).
Then come the definitions of tarka, nirnaya, vada, jalpa, vitanda,
the fallacies (hetvabhasa), chala, jati, and nigrahasthana, which
have been enumerated in the first sutra.
The second book deals with the refutations of objections
against the means of right knowledge (pramana). In refutation
of certain objections against the possibility of the happening
of doubt, which held that doubt could not happen, since there
was always a difference between the two things regarding which
doubt arose, it is held that doubt arises when the special dif
ferentiating characteristics between the two things are not noted.
Certain objectors, probably the Buddhists, are supposed to object
to the validity of the pramana in general and particularly of
perceptions on the ground that if they were generated before
the sense-object contact, they could not be due to the latter,
and if they are produced after the sense-object contact, they
could not establish the nature of the objects, and if the two
happened together then there would be no notion of succession
in our cognitions. To this the Nyaya reply is that if there were
no means of right knowledge, then there would be no means of
knowledge by means of which the objector would refute all
means of right knowledge; if the objector presumes to have any
means of valid knowledge then he cannot say that there are no
means of valid knowledge at all. Just as from the diverse kinds
of sounds of different musical instruments, one can infer the pre
vious existence of those different kinds of musical instruments,
so from our knowledge of objects we can infer the previous exist
ence of those objects of knowledge 1 .
The same things (e.g. the senses, etc.) which are regarded as
instruments of right knowledge with reference to the right cog
nition of other things may themselves be the objects of right
1 Yathapafcatsiddhena labdena purvasiddham atodyamanunnyate sddhyam ca ato-
dyam sadhanam ca Sabdah antarhite hy&todye svanatah anumanam bhcrvattti, vino,
vadyate venuk puryyate iti svanavifescna atodyaviiesam pratipadyate tatha purvasiJ-
dham upalabdhivisayam pafc&tsiddhena upalabdhihetuna pratipadyate. Vatsyayana
bhatya, II. i. 15.
vmj Philosophy in the Nyaya sutras 297
knowledge. There are no hard and fast limits that those which
are instruments of knowledge should always be treated as mere
instruments, for they themselves may be objects of right know
ledge. The means of right knowledge (pramana) do not require
other sets of means for revealing them, for they like the light of
a lamp in revealing the objects of right knowledge reveal them
selves as well.
Coming to the question of the correctness of the definition
of perception, it is held that the definition includes the contact
of the soul with the mind 1 . Then it is said that though we per
ceive only parts of things, yet since there is a whole, the per
ception of the part will naturally refer to the whole. Since we
can pull and draw things wholes exist, and the whole is not
merely the parts collected together, for were it so one could
say that we perceived the ultimate parts or the atoms 2 . Some
objectors hold that since there may be a plurality of causes it is
wrong to infer particular causes from particular effects. To this
the Nyaya answer is that there is always such a difference in the
specific nature of each effect that if properly observed each par
ticular effect will lead us to a correct inference of its own par
ticular cause 8 . In refuting those who object to the existence of
time on the ground of relativity, it is said that if the present time
did not exist, then no perception of it would have been possible.
The past and future also exist, for otherwise we should not have
perceived things as being done in the past or as going to be
done in the future. The validity of analogy (upamdnct) as a
means of knowledge and the validity of the Vedas is then proved.
The four pramanas of perception, inference, analogy, and scripture
1 Here the sutras, II. i. 20-28, are probably later interpolations to answer criticisms,
not against the Nyaya doctrine of perception, but against the wording of the definition
of perception as given in the Ny&ya sutra, n. i. 4.
3 This is a refutation of the doctrines of the Buddhists, who rejected the existence
of wholes (avayavl). On this subject a later Buddhist monograph by Pandita As"oka
(9th century A.D.), Avayavinirakarana in Six Buddhist Nyaya Tracts t may be re
ferred to.
8 Purvodakavis istam khalu varsodakan Sighrataram srotasa bahutaraphenaphala-
parnakasthadivahanaflcopalabhamdnah piirnatvena, nadya upari vrsto deva ityanu-
minoti nodakabrddhimatretia. Vatsyayana bkdsya, II. i. 38. The inference that there
has been rain up the river is not made merely from seeing the rise of water, but from
the rainwater augmenting the previous water of the river and carrying with its current
large quantities of foam, fruits, leaves, wood, etc. These characteristics, associated
with the rise of water, mark it as a special kind of rise of water, which can only be
due to the happening of rain up the river.
298 The Nyaya-Vaifesika Philosophy [CH.
are quite sufficient and it is needless to accept arthapatti (impli
cation), aitihya (tradition), sambhava (when a thing is understood
in terms of higher measure the lower measure contained in it is
also understood if we know that there is a bushel of corn any
where we understand that the same contains eight gallons of
corn as well) and abhava (non-existence) as separate pramanas
for the tradition is included in verbal testimony and arthapatti,
sambhava and abhava are included within inference.
The validity of these as pramanas is recognized, but they are
said to be included in the four pramanas mentioned before. The
theory of the eternity of sound is then refuted and the non-
eternity proved in great detail. The meaning of words is said to
refer to class-notions (jdti), individuals (vyaktt), and the specific
position of the limbs (dkrti), by which the class notion is mani
fested. Class (Jdtt) is defined as that which produces the notion
of sameness (samdnaprasavdtmikd jdtik).
The third book begins with the proofs for the existence of
the self or atman. It is said that each of the senses is associated
with its own specific object, but there must exist some other entity
in us which gathered together the different sense-cognitions and
produced the perception of the total object as distinguished from
the separate sense-perceptions. If there were no self then there
would be no sin in injuring the bodies of men; again if there
were no permanent self, no one would be able to recognize
things as having seen them before; the two images produced by
the eyes in visual perception could not also have been united
together as one visual perception of the things 1 ; moreover if
there were no permanent cognizer then by the sight of a sour
fruit one could not be reminded of its sour taste. If conscious
ness belonged to the senses only, then there would be no recogni
tion, for the experience of one could not be recognized by another.
If it is said that the unity of sensations could as well be effected
by manas (mind), then the manas would serve the same purpose
as self and it would only be a quarrel over a name, for this
entity the knower would require some instrument by which it
would co-ordinate the sensations and cognize; unless manas is
admitted as a separate instrument of the soul, then though the
sense perceptions could be explained as being the work of the
1 According to Vatsyayana, in the two eyes we have two different senses. Udyo-
takara, however, thinks that there is one visual sense which works in both eyes.
vm] Philosophy in the Nyaya sutras 299
senses, yet imagining, thinking, etc., could not be explained.
Another argument for the admission of soul is this, that infants
show signs of pleasure and pain in quite early stages of infancy
and this could not be due to anything but similar experiences in
previous lives. Moreover every creature is born with some desires,
and no one is seen to be born without desires. All attachments
and desires are due to previous experiences, and therefore it is
argued that desires in infants are due to their experience in
previous existences.
The body is made up of the ksiti element. The visual sense
is material and so also are all other senses 1 . Incidentally the
view held by some that the skin is the only organ of sensation
is also refuted. The earth possesses four qualities, water three,
fire two, air one, and ether one, but the sense of smell, taste, eye,
and touch which are made respectively by the four elements of
earth, etc., can only grasp the distinctive features of the elements
of which they are made. Thus though the organ of smell is made
by earth which contains four qualities, it can only grasp the dis
tinctive quality of earth, viz. smell.
Against the Samkhya distinction of buddhi (cognition) and
cit (pure intelligence) it is said that there is no difference between
the buddhi and cit. We do not find in our consciousness two
elements of a phenomenal and a non-phenomenal consciousness,
but only one, by whichever name it may be called. The Samkhya
epistemology that the antahkarana assumes diverse forms in
cognitive acts is also denied, and these are explained on the sup
position of contacts of manas with the senses, atman and external
objects. The Buddhist objection against the Samkhya explana
tion that the antahkaranas catch reflection from the external
world just as a crystal does from the coloured objects that may
lie near it, that there were really momentary productions of
crystals and no permanent crystal catching different reflections at
different times is refuted by Nyaya; for it says that it cannot be
said that all creations are momentary, but it can only be agreed to
in those cases where momentariness was actually experienced.
In the case of the transformation of milk into curd there is no
coming in of new qualities and disappearance of old ones, but
1 It is well to remember that Samkhya did not believe that the senses were con
stituted of the gross elements. But the Samkhya- Yoga view represented in Atreya-
samhita (Carakd) regarded the senses as bhautika or constituted of the gross elements.
3oo The Nyaya- Vaitesika Philosophy [CH.
the old milk is destroyed and the curd originates anew. The
contact of manas with soul (atman) takes place within the body
and not in that part of atman which is outside the body ; know
ledge belongs to the self and not to the senses or the object for
even when they are destroyed knowledge remains. New cogni
tions destroy the old ones. No two recollections can be simul
taneous. Desire and antipathy also belong to the soul. None of
these can belong either to the body or to the mind (manas).
Manas cannot be conscious for it is dependent upon self. Again
if it was conscious then the actions done by it would have to be
borne by the self and one cannot reap the fruits of the actions of
another. The causes of recollection on the part of self are given
as follows: (i) attention, (2) context, (3) repetition, (4) sign,
(5) association, (6) likeness, (7) association of the possessor
and the possessed or master and servant, or things which
are generally seen to follow each other, (8) separation (as of
husband and wife), (9) simpler employment, (10) opposition,
(11) excess, (12) that from which anything can be got, (13) cover
and covered, (14) pleasure and pain causing memory of that
which caused them, (15) fear, (16) entreaty, (17) action such
as that of the chariot reminding the charioteer, (18) affection,
(19) merit and demerit 1 . It is said that knowledge does not belong
to body, and then the question of the production of the body as
due to adrsta is described. Salvation (apavarga) is effected by
the manas being permanenly separated from the soul (atman)
through the destruction of karma.
In the fourth book in course of the examination of dosa
(defects), it is said that moha (ignorance), is at the root of all
other defects such as raga (attachment) and dvesa (antipathy).
As against the Buddhist view that a thing could be produced by
destruction, it is said that destruction is only a stage in the
process of origination. Isvara is regarded as the cause of the
production of effects of deeds performed by men s efforts, for
man is not always found to attain success according to his efforts.
A reference is made to the doctrine of those who say that all
things have come into being by no-cause (animitta), for then
no-cause would be the cause, which is impossible.
The doctrine of some that all things are eternal is next refuted
on the ground that we always see things produced and destroyed.
1 Nydya sutra ill. ii. 44.
vm] Caraka, Nyaya and Vaitesika 301
The doctrine of the nihilistic Buddhists (sunyavadin Bauddhas)
that all things are what they are by virtue of their relations to
other things, and that of other Buddhists who hold that there are
merely the qualities and parts but no substances or wholes, are
then refuted. The fruits of karmas are regarded as being like
the fruits of trees which take some time before they can ripen.
Even though there may be pleasures here and there, birth means
sorrow for men, for even the man who enjoys pleasure is tor
mented by many sorrows, and sometimes one mistakes pains for
pleasures. As there is no sorrow in the man who is in deep dream
less sleep, so there is no affliction (klesa) in the man who attains
apavarga (salvation) 1 . When once this state is attained all efforts
(pravrttt) cease for ever, for though efforts were beginningless
with us they were all due to attachment, antipathy, etc. Then
there are short discussions regarding the way in which egoism
(ahamkdra) ceases with the knowledge of the true causes of de
fects (dosd) ; about the nature of whole and parts and about the
nature of atoms (anus) which cannot further be divided. A dis
cussion is then introduced against the doctrine of the Vijflana-
vadins that nothing can be regarded as having any reality when
separated from thoughts. Incidentally Yoga is mentioned as
leading to right knowledge.
The whole of the fifth book which seems to be a later addition
is devoted to the enumeration of different kinds of refutations
(nigrahasthdnd) and futilities (jatt).
Caraka, Nyaya sutras and Vai^esika sutras.
When we compare the Nyaya sutras with the Vaisesika
sutras we find that in the former two or three different streams
of purposes have met, whereas the latter is much more homo
geneous. The large amount of materials relating to debates
treated as a practical art for defeating an opponent would lead
one to suppose that it was probably originally compiled from
some other existing treatises which were used by Hindus and
Buddhists alike for rendering themselves fit to hold their own in
debates with their opponents 2 . This assumption is justified when
1 Vatsyayana notes that this is the salvation of him who has known Brahman, iv. i. 63.
* A reference to the Suvarnaprabhasa sutra shows that the Buddhist missionaries
used to get certain preparations for improving their voice in order to be able to argue
with force, and they took to the worship of Sarasvati (goddess of learning), who they
supposed would help them in bringing readily before their mind all the information
and ideas of which they stood so much in need at the time of debates.
3O2 The Nyaya- Vaitesika Philosophy [CH.
we compare the futilities (jati) quibbles (chala), etc., relating to
disputations as found in the Nyaya sutra with those that are
found in the medical work of Caraka (78 A.D.), III. viii. There
are no other works in early Sanskrit literature, excepting the
Nyaya sutra and" Caraka-samhita which have treated of these
matters. Caraka s description of some of the categories (e.g.
drstanta, prayojana, pratijfia and vitanda) follows very closely
the definitions given of those in the Nyaya sutras*. There are
others such as the definitions of jalpa, chala, nigrahasthana, etc.,
where the definitions of two authorities differ more. There are
some other logical categories mentioned in Caraka (e.g. pra-
tisthdpand, jijndsd, vyavasdya, vdkyadosa, vdkyaprasanisd, upa-
lambha, parihdra, abhyanujnd, etc.) which are not found in the
Nyaya sutra 1 . Again,the various types of futilities (jati) and points
of opponent s refutation (nigrahasthana) mentioned in the Nyaya
sutra are not found in Caraka. There are some terms which are
found in slightly variant forms in the two works, e.g. aupamya in
Caraka, upamdna in Nyaya sutra, arthdpatti in Nyaya sutra and
arthaprdpti in Caraka. Caraka does not seem to know anything
about the Nyaya work on this subject, and it is plain that the
treatment of these terms of disputations in the Caraka is much
simpler and less technical than what we find in the Nyaya sutras.
If we leave out the varieties of jati and nigrahasthana of the
fifth book, there is on the whole a great agreement between the
treatment of Caraka and that of the Nyaya sutras. It seems there
fore in a high degree probable that both Caraka and the Nyaya
sutras were indebted for their treatment of these terms of dispu
tation to some other earlier work. Of these, Caraka s compilation
was earlier, whereas the compilation of the Nyaya sutras repre
sents a later work when a hotter atmosphere of disputations had
necessitated the use of more technical terms which are embodied
in this work, but which were not contained in the earlier work.
It does not seem therefore that this part of the work could have
been earlier than the second century A.D. Another stream flowing
through the Nyaya sutras is that of a polemic against the doctrines
which could be attributed to the Sauti.mtika Buddhists, the
Vijftanavada Buddhists, the nihilists, the Samkhya, the Carvaka,
and some other unknown schools of thought to which we find no
1 Like Vais esika, Caraka does not know the threefold division of inference (anu-
mdna) as purvavat, iesavat and samanyatodrsta.
vin] Nyaya sutras and Vaisesika sutras 303
further allusion elsewhere. The Vaisesika sutras as we have already
seen had argued only against the Mlmamsa, and ultimately agreed
with them on most points. The dispute with Mlmamsa in the
Nyaya sutras is the same as in the Vai&esika over the question
of the doctrine of the eternality of sound. The question of the
self- validity of knowledge (svatahprdmd nydvdda) and the akhyati
doctrine of illusion of the Mlmamsists, which form the two chief
points of discussion between later Mlmamsa and later Nyaya,
are never alluded to in the Nyaya sutras. The advocacy of Yoga
methods (Nyaya sutras, iv. ii. 38-42 and 46) seems also to be
an alien element; these are not found in Vaisesika and are not in
keeping with the general tendency of the Nyaya sutras, and the
Japanese tradition that Mirok added them later on as Mahamaho-
padhyaya Haraprasada ^astrl has pointed out 1 is not improbable.
The Vaisesika sutras, III. i. 18 and III. ii. i, describe per
ceptional knowledge as produced by the close proximity of the^
self (atman), the senses and the objects of sense, and they
also adhere to the doctrine, that colour can only be perceived
under special conditions of samskdra (conglomeration etc.).
The reason for inferring the existence of manas from the non-
simultaneity (ayaugapadyd) of knowledge and efforts is almost
the same with Vaisesika as with Nyaya. The Nyaya sutras
give a more technical definition of perception, but do not bring
in the questions of samskara or udbhutarupavattva which Vai-
Sesika does. On the question of inference Nyaya gives three
classifications as purvavat, Sesavat and samanyatodrsta, but no
definition. The Vaisesika sutras do not know of these classifica
tions, and give only particular types or instances of inference
(V. S. III. i. 7-17, IX. ii. 1-2, 4-5). Inference is said to be made
when a thing is in contact with another, or when it is in a relation
of inherence in it, or when it inheres in a third thing ; one kind
of effect may lead to the inference of another kind of effect, and
so on. These are but mere collections of specific instances of infer
ence without reaching a general theory. The doctrine of vyapti
(concomitance oihetu (reason) and sddhya(probsindum)) which be
came so important in later Nyaya has never been properly formu
lated either in the Nyaya sutras or in the Vaisesika. Vaisesika
sutra, III. i. 24, no doubt assumes the knowledge of concomitance
between hetu and sadhya (prasiddhipurvakatvdt apadesasya),
i J.A.S.B. 1905.
304 The Nyaya-Vaifesika Philosophy [CH.
but the technical vyapti is not known, and the connotation of
the term prasiddhipuruakatva of Vaisesika seems to be more
loose than the term vydpti as we know it in the later Nyaya. The
Vaisesika sutras do not count scriptures (sabda) as a separate
pramana, but they tacitly admit the great validity of the Vedas.
With Nyaya sutras sabda as a pramana applies not only to the
Vedas, but to the testimony of any trustworthy person, and
Vatsyayana says that trustworthy persons may be of three
kinds rsi, drya and mleccha (foreigners). Upamana which is
regarded as a means of right cognition in Nyaya is not even
referred to in the Vaisesika sutras. The Nyaya sutras know of
other pramanas, such as arthdpatti, sambhava and aitihya, but
include them within the pramanas admitted by them, but the
Vaisesika sutras do not seem to know them at all 1 . The Vaise
sika sutras believe in the perception of negation (abhava) through
the perception of the locus to which such negation refers (IX. i.
i-io,. The Nyaya sutras (II. ii. I, 2, 7-12) consider that abhava as
non-existence or negation can be perceived ; when one asks another
to "bring the clothes which are not marked," he finds that marks
are absent in some clothes and brings them ; so it is argued that
absence or non-existence can be directly perceived 2 . Though
there is thus an agreement between the Nyaya and the Vaisesika
sutras about the acceptance of abhav? as being due to perception,
yet their method of handling the matter is different. The Nyaya
sutras say nothing about the categories of dravya, guna, karma,
visesa and samavdya which form the main subjects of Vateeska
discussions . The Nyaya sutras take much pains to prove the
materiality of the senses. But this question does not seem to have
been important with Vaisesika. The slight reference to this
question in vin. ii. 5-6 can hardly be regarded as sufficient.
The Vaisesika sutras do not mention the name of" Isvara," whereas
the Nyaya sutras try to prove his existence on eschatological
grounds. The reasons given in support of the existence of self
in the Nyaya sutras are mainly on the ground of the unity of
sense-cognitions and the phenomenon of recognition, whereas the
1 The only old authority which knows these pramanas is Caraka. But he also gives
an interpretation of sambhava which is different from Nyaya and calls arthapatti
arthaprapti {Caraka in. viii.).
2 The details of this example are taken from Vatsyayana s commentary.
3 The Nyaya stitra no doubt incidentally gives a definition of jati as "samdnapra-
saijatmika jatih " (I I. ii. 71).
vin] Nyaya sutras and Vaisesika sutras 305
Vaisesika lays its main emphasis on self-consciousness as a fact
of knowledge. Both the Nyaya and the Vaisesika sutras admit
the existence of atoms, but all the details of the doctrine of
atomic structure in later Nyaya- Vaisesika are absent there. The
VaiSesika calls salvation nihsreyasa or moksa and the Nyaya
apavarga. Moksa with Vaisesika is the permanent cessation of
connection with body ; the apavarga with Nyaya is cessation of
pain 1 . In later times the main points of difference between the
Vaisesika and Nyaya are said to lie with regard to theory of the
notion of number, changes of colour in the molecules by heat, etc.
Thus the former admitted a special procedure of the mind by which
cognitions of number arose in the mind (e.g. at the first moment
there is the sense contact with an object, then the notion of one
ness, then from a sense of relativeness apeksabuddhi notion
of two, then a notion of two-ness, and then the notion of two
things) ; again, the doctrine of pilupaka (changes of qualities by
heat are produced in atoms and not in molecules as Nyaya held)
was held by Vaisesika, which the Naiyayikas did not admit 2 . But
as the Nyaya sutras are silent on these points, it is not possible to
say that such were really the differences between early Nyaya and
early Vaisesika. These differences may be said to hold between
the later interpreters of Vaisesika and the later interpreters of
Nyaya. The Vaisesika as we find it in the commentary of
PraSastapada (probably sixth century A.D.), and the Nyaya from
the time of Udyotakara have come to be treated as almost
the same system with slight variations only. I have therefore
preferred to treat them together. The main presentation of tbye
Nyaya- VaiSesika philosophy in this chapter is that which is found
from the sixth century onwards.
The Vai&esika and Nyaya Literature.
It is difficult to ascertain definitely the date of the Vaisesika
sulras by Kanada, also called Aulukya the son of Uluka, though
there is every reason to suppose it to be pre- Buddhistic. It
1 Professor Vanamali Vedantatirtha quotes a passage from Samk$epa$ankarajaya t
XVI. 68-69 m f A.S.B., 1905, and another passage from a Nyaya writer Bhasarvajfla,
pp. 39-41, in J.A.S.B., 1914, to show that the old Naiyayikas considered that there
was an element of happiness (sukha) in the state of mukti (salvation) which the Vais"e-
sikas denied. No evidence in support of this opinion is found in the Nyaya or the
Vaisesika sutras ; unless the cessation of pain with Nyaya is interpreted as meaning the
presence of some sort of bliss or happiness.
2 See Madhava s Sarvadarianasamgraha-Aulukyadarfana.
D. 20
306 The Nyaya-VaiSesika Philosophy [CH.
appears from the Vdyu purdna that he was born in Prabhasa near
Dvaraka, and was the disciple of SomaSarma. The time of
PraSastapada who wrote a bhasya (commentary) of the Vaise
sika sutras cannot also unfortunately be ascertained. The pecu
liarity of PraSastapada s bhasya is this that unlike other bhasyas
(which first give brief explanations of the text of the sutras and
then continue to elaborate independent explanations by explain
ing the first brief comments), it does not follow the sutras but
is an independent dissertation based on their main contents 1 .
There were two other bhasyas on the Vaisesika sutras, namely
Rdvana-bhdsya and Bharddvdja-vrtti, but these are now probably
lost. References to the former are found in Kirandvallbhdskara
of Padmanabha MiSra and also in Ratnaprabhd 2. 2. n. Four
commentaries were written on this bhasya, namely Vyomavati by
Vyomaekharacarya, Nydyakandali by rldhara, Kirandvali by
Udayana (984 A.D.) and Lildvati by rivatsacarya. In addition to
these JagadlSaBhattacarya of Navadvlpa andSarikara MiSra wrote
two other commentaries on the Prasastapdda-bhasya, namely
Bhdsyasukti and Kandda-rahasya. Sankara MiSra (1425 A.D.)
also wrote a commentary on the Vaisesika sutras called the
Upaskdra. Of these Nydya-kandall of ridhara on account of its
simplicity of style and elaborate nature of exposition is probably
the best for a modern student of Vaisesika. Its author was a
native of the village of Bhurisrsti in Bengal (Radha). His father s
name was Baladeva and mother s name was Acchoka and he
wrote his work in 913 Saka era (990 A.D.) as he himself writes
at the end of his work.
The Nydya sutra was written by Aksapada or Gautama, and
the earliest commentary on it written by Vatsyayana is known
as the Vdtsydyana-blidsya. The date of Vatsyayana has not
1 The bhasya of Prasastapada can hardly be called a bhasya (elaborate commen
tary). He himself makes no such claim and calls his work a compendium of the
properties of the categories (Paddrthadharmasamgraha). He takes the categories of
dravya, guna, karma, sdmdnya, vifesa and samavdya in order and without raising any
discussions plainly narrates what he has got to say on them. Some of the doctrines
which are important in later Nyaya-Vais"esika discussions, such as the doctrine of
creation and dissolution, doctrine of number, the theory that the number of atoms
contributes to the atomic measure of the molecules, the doctrine of pilupaka in con
nection with the transformation of colours by heat occur in his narration for the first
time as the Vaihsika sutras are silent on these points. It is difficult to ascertain his
date definitely ; he is the earliest writer on Vaisesika available to us after Kanada
and it is not improbable that he lived in the 5th or 6th century A.D.
viu] Nyaya Literature 307
been definitely settled, but there is reason to believe that he lived
some time in the beginning of the fourth century A.D. Jacobi
places him in 300 A.D. Udyotakara (about 635 A.D.) wrote a
Vdrttika on Vatsyayana s bhasya to establish the Nyaya views
and to refute the criticisms of the Buddhist logician Dirinaga
(about 500 A.D.) in his Pramdnasamuccaya, VacaspatimiSra
(840 A.D.) wrote a sub-commentary on the Nydyavdrttika of
Udyotakara called Nydyavdrttikatdtparyatlkd in order to make
clear the right meanings of Udyotakara s Vdrttika which was sink
ing in the mud as it were through numerous other bad writings
(dustarakunibandhapankamagndndm), Udayana (984 A.D.) wrote
a sub-commentary on the Tdtparyatlkd called Tdtparyatlkd-
parisuddhi. Varddhamana (1225 A.D.) wrote a sub-commentary
on that called the Nydyanibandhaprakdsa. Padmanabha wrote
a sub-commentary on that called Varddhamdnendu and arikara
MiSra (1425 A.D.) wrote a sub-commentary on that called the
Nydyatdtparyamandana. In the seventeenth century ViSvanatha
wrote an independent short commentary known as Visvandtha-
vrtti, on the Nyaya sutra, and Radhamohana wrote a separate
commentary on the Nyaya sutras known as Nydyasutravivarana.
In addition to these works on the Nyaya sutras many other
independent works of great phflosophical value have been written
on the Nyaya system. The most important of these in medieval
times is the Nydyamanjari of Jayanta (880 A.D.), who flourished
shortly after VacaspatimiSra. Jayanta chooses some of the Nyaya
sutras for interpretation, but he discusses the Nyaya views quite
independently, and criticizes the views of other systems of Indian
thought of his time. It is far more comprehensive than Vacaspati s
Tdtparyatlkd, and its style is most delightfully lucid. Another
important work is Uday ana s Kusumdnjali in which he tries to
prove the existence of IsVara (God). This work ought to be read
with its commentary Prakdsa by Varddhamana (1225 A.D.) and its
sub-commentary Makaranda by Rucidatta ( 1 275 A.D.). Udayana s
Atmatattvaviveka is a polemical work against the Buddhists, in
which he tries to establish the Nyaya doctrine of soul. In addition
to these we have a number of useful works on Nyaya in later
times. Of these the following deserve special mention in connec
tion with the present work. Bhdsdpariccheda by VisVanatha with
its commentaries Muktdvali, Dinakarl and Rdmarudri, Tarka-
samgraha with Nydyanirnaya, Tarkabhdsd of Kesava Misra with
20 2
308 The Nyaya-VaiSesika Philosophy [CH.
the commentary Nyayapradipa, Saptapaddrthl of ivaditya,
Tarkikaraksd, of Varadaraja with the commentary Niskantaka of
Mallinatha, Nydyasdra of Madhava Deva of the city of Dhara
and Nydyasiddhdntamanjari of Janaklnatha Bhattacarya with
the Nyayamanjarisara by Yadavacarya, and Nyayasiddhantadipa
of Sasadhara with Prabha by Sesanantacarya.
The new school of Nyaya philosophy known as Navya-Nyaya
began with Garigesa Upadhyaya of Mithila, about 1200 A.D.
Garigesa wrote only on the four pramanas admitted by the Nyaya,
viz. pratyaksa, anumana, upamana, and sabda.and not on any of the
topics of Nyaya metaphysics. But it so happened that his dis-
cussionsonanumana(inference)attracted unusually great attention
in Navadvlpa (Bengal), and large numbers of commentaries and
commentaries of commentaries were written on the anumana
portion of his work Tattvacintamani, and many independent
treatises on sabda and anumana were also written by the scholars
of Bengal, which became thenceforth for some centuries the home
of Nyaya studies. The commentaries of Raghunatha iromani
(1500 A.D.), Mathura Bhattacarya (1580 A.D.), Gadadhara Bhatta
carya (1650 A.D.) and Jagadlsa Bhattacarya (1590 A.D.), commen
taries on Siromani s commentary on Tattvacintamani, had been
very widely read in Bengal. The new school of Nyaya became the
most important study in Navadvlpa and there appeared a series
of thinkers who produced an extensive literature on the subject 1 .
The contribution was not in the direction of metaphysics, theology,
ethics, or religion, but consisted mainly in developing a system
of linguistic notations to specify accurately and precisely any
concept or its relation with other concepts 2 .
Thus for example when they wished to define precisely the
nature of the concomitance of one concept with another (e.g. smoke
and fire), they would so specify the relation that the exact nature
of the concomitance should be clearly expressed, and that .here
should be no confusion or ambiguity. Close subtle analytic
thinking and the development of a system of highly technical
1 From the latter half of the twelfth century to the third quarter of the sixteenth
century the new school of Nyaya was started in Mithila (Behar) ; but from the fifteenth
to the seventeenth century Bengal became pre-eminently the home of Nyaya studies.
See Mr Cakravartti s paper,/. A. S. B. 1915. I am indebted to it for some of the
dates mentioned in this section.
1 Sfvaranumdna of Raghunatha as well as his Padarthatattvanirupana are, how
ever, notable exceptions.
vm] Nyaya Literature 309
expressions mark the development of this literature. The technical
expressions invented by this school were thus generally accepted
even by other systems of thought, wherever the need of accurate
and subtle thinking was felt. But from the time that Sanskrit
ceased to be the vehicle of philosophical thinking in India the
importance of this literature has gradually lost ground, and it
can hardly be hoped that it will ever regain its old position by
attracting enthusiastic students in large numbers.
I cannot close this chapter without mentioning the fact that
so far as the logical portion of the Nyaya system is concerned,
though Aksapada was the first to write a comprehensive account
of it, the Jains and Buddhists in medieval times had indepen
dently worked at this subject and had criticized the Nyaya ac
count of logic and made valuable contributions. In Jaina logic
Dasavaikdlikaniryukti of Bhadrabahu (357 B.C.), Umasvati s
Tattvdrthddhigama sutra, Nydydvatdra of Siddhasena Divakara
(533 A.D.) Manikya Nandl s (800 A.D.) Parlksdmukha sutra, and
Pramdnanayatattvdlokdlamkdra of Deva Suri (1159 A.D.) and
Prameyakamalamdrtanda of Prabhacandra deserve special notice.
Pramdnasamuccaya and Nydyapravesa of Dirinaga (5OOA.D.),
Pramanavarttika karikn and Nyayabindu of Dharmaklrtti
(650 A.D.) with the commentary of Dharmottara are the most
interesting of the Buddhist works on systematic logic 1 . The
diverse points of difference between the Hindu, Jain and
Buddhist logic require to be dealt with in a separate work on
Indian logic and can hardly be treated within the compass of the
present volume.
It is interesting to notice that between the Vdtsydyana
bhasya and the Udyotakara s V&rttika no Hindu work on logic
of importance seems to have been written : it appears that the
science of logic in this period was in the hands of the Jains and
the Buddhists ; and it was Dirinaga s criticism of Hindu Nyaya
that roused Udyotakara to write the Varttika. The Buddhist and
the Jain method of treating logic separately from metaphysics
as an independent study was not accepted by the Hindus till we
come to GangeSa, and there is probably only one Hindu work of
importance on Nyaya in the Buddhist style namely Nyayasara
of Bhasarvajfla. Other older Hindu works generally treated of
1 See Indian Logic Medieval School, by Dr S. C. Vidyabhusana, for a biblio
graphy of Jain and Buddhist Logic.
3io The Nyaya -Vaisesika Philosophy [CH.
inference only along with metaphysical and other points of Nyaya
interest 1 .
The main doctrine of the Nyaya- Vaisesika Philosophy*.
The Nyaya- Vaisesika having dismissed the doctrine of mo-
mentariness took a common-sense view of things, and held that
things remain permanent until suitable collocations so arrange
themselves that the thing can be destroyed. Thus the jug con
tinues to remain a jug unless or until it is broken to pieces by
the stroke of a stick. Things exist not because they can produce
an impression on us, or serve my purposes either directly or
through knowledge, as the Buddhists suppose, but because exist
ence is one of their characteristics. If I or you or any other perceiver
did not exist, the things would continue to exist all the same.
Whether they produce any effect on us or on their surrounding
environments is immaterial. Existence is the most general
characteristic of things, and it is on account of this that things
are testified by experience to be existing.
As the Nyaya- Vaisesikas depended solely on experience and
on valid reasons, they dismissed the Samkhya cosmology, but
accepted the atomic doctrine of the four elements (bhutas\ earth
(ksiti\ water (ap\ fire (tejas\ and air (marut). These atoms are
eternal ; the fifth substance (akdsd) is all pervasive and eternal.
It is regarded as the cause of propagating sound; though all-
pervading and thus in touch with the ears of all persons, it mani
fests sound only in the ear-drum, as it is only there that it shows
itself as a sense-organ and manifests such sounds as the man de
serves to hear by reason of his merit and demerit. Thus a deaf
man though he has the akasa as his sense of hearing, cannot hear
on account of his demerit which impedes the faculty of that sense
organ*. In addition to these they admitted the existence of time
(kdla) as extending from the past through the present to the
1 Almost all the books on Nyaya and Vaisesika referred to have been consulted in
the writing of this chapter. Those who want to be acquainted with a fuller bibliography
of the new school of logic should refer to the paper called " The History of Navya
Nyaya in Bengal," by Mr Cakravartti \nJ.A.S.B. 1915.
8 I have treated Nyaya and Vais esika as the same system. Whatever may have been
their original differences, they are regarded since about 600 A.D. as being in complete
agreement except in some minor points. The views of one system are often supple
mented by those of the other. The original character of the two systems has already
been treated.
3 See Nydyakandati, pp. 59-64.
viu] Metaphysical Categories 311
endless futurity before us. Had there been no time we could
have no knowledge of it and there would be nothing to account
for our time-notions associated with all changes. The Samkhya
did not admit the existence of any real time ; to them the unit
of kala is regarded as the time taken by an atom to traverse its
own unit of space. It has no existence separate from the atoms
and their movements. The appearance of kala as a separate entity
is a creation of our buddhi (buddhinirmdna) as it represents the
order or mode in which the buddhi records its perceptions. But
kala in Nyaya-Vaisesika is regarded as a substance existing by
itself. In accordance with the changes of things it reveals itself
as past, present, and future. Samkhya regarded it as past, present,
and future, as being the modes of the constitution of the things
in its different manifesting stages of evolution (adhvan). The
astronomers regarded it as being due to the motion of the planets.
These must all be contrasted with the Nyaya-Vaisesika con
ception of kala which is regarded as an all -pervading, partless
substance which appears as many in association with the changes
related to it 1 .
The seventh substance is relative space (dik). It is that sub
stance by virtue of which things are perceived as being on the
right, left, east, west, upwards and downwards ; kala like dik is
also one. But yet tradition has given us varieties of it in the eight
directions and in the upper and lower 2 . The eighth substance is
the soul (atman) which is all-pervading. There are separate atmans
for each person ; the qualities of knowledge, feelings of pleasure
and pain, desire, etc. belong to dtman. Manas (mind) is the ninth
substance. It is atomic in size and the vehicle of memory ; all affec
tions of the soul such as knowing, feeling, and willing, are generated
tvy the connection of manas with soul, the senses and the objects.
It is the intermediate link which connects the soul with the senses,
and thereby produces the affections of knowledge, feeling, or
willing. With each single connection of soul with manas we have
a separate affection of the soul, and thus our intellectual experience
is conducted in a series, one coming after another and not simul
taneously. Over and above all these we have Isvara. The definition
1 See NydyakanJali, pp. 64-66, and Nyayamaftjari, pp. 136-139. The VaUesika
sutras regarded time as the cause of things which suffer change but denied it of things
which are eternal.
8 See Nyayakandali, pp. 66-69, and Nydyamattjari, p. 140.
312 The Ny ay a-Vai^esika Philosophy [CH.
of substance consists in this, that it is independent by itself, whereas
the other things such as quality (guna}, action (karma), sameness
or generality (sdmdnyd), speciality or specific individuality (visesa)
and the relation of inherence (samavdya) cannot show themselves
without the help of substance (dravya). Dravya is thus the place
of rest (asrayd) on which all the others depend (dsrtd). Dravya,
guna, karma, samanya, visesa, and samavaya are the six original
entities of which all things in the world are made up 1 . When a
man through some special merit, by the cultivation of reason and
a thorough knowledge of the fallacies and pitfalls in the way
of right thinking, comes to know the respective characteristics
and differences of the above entities, he ceases to have any
passions and to work in accordance with their promptings and
attains a conviction of the nature of self, and is liberated 2 . The
Nyaya-Vaisesika is a pluralistic system which neither tries to
reduce the diversity of experience to any universal principle, nor
dismisses patent facts of experience on the strength of the de
mands of the logical coherence of mere abstract thought. The
entities it admits are taken directly from experience. The under
lying principle is that at the root of each kind of perception there
must be something to which the perception is due. It classified the
percepts and concepts of experience into several ultimate types
or categories (paddrtha), and held that the notion of each type
was due to the presence of that entity. These types are six in
number dravya, guna, etc. If we take a percept "I see a red
book," the book appears to be an independent entity on which
rests the concept of "redness " and "oneness," and we thus call the
book a substance (dravya); dravya is thus defined as that which
has the characteristic of a dravya (dravyatvd). So also guna and
karma. In the subdivision of different kinds of dravya also the
same principle of classification is followed. In contrasting it with
Samkhya or Buddhism we see that for each unit of sensation (say
1 Abhava (negation) as dependent on bhava (position) is mentioned in the Vaiiesika
sutras. Later Nyaya writers such as Udayana include abhava as a separate category,
but Sridhara a contemporary of Udayana rightly remarks that abhava was not counted
by Pras astapada as it was dependent on bhava ^abhdvasya prthaganupadefah
bhdvapdratantrydt na tvabhdvdt." Nydyakandali, p. 6, and Laksan&vali, p. i.
" Tattvato jndtesu bdhyddhydtmikesu visayesu dosadarSandt viraktasya samiAd-
nivrttau dtmajnasya tadarthani karmdnyakurvatah tatparilydgasddhandni frutismr-
tyuditdni asankalpitaphaldni upddaddnasya dtmajndnamabhyasyatah prakrstanivart-
takadharmopacayt sati paripakvdtmajnanasydtyantikaSariraviyogasya bhdvdt." Ibid.
p. 7.
vm] Category of Quality 313
whiteness) the latter would admit a corresponding real, but
Nyaya-VaiSesika would collect "all whiteness" under the name
of "the quality of white colour" which the atom possessed 1 . They
only regarded as a separate entity what represented an ultimate
mode of thought. They did not enquire whether such notions
could be regarded as the modification of some other notion or
not ; but whenever they found that there were some experiences
which were similar and universal, they classed them as separate
entities or categories.
The six Padarthas : Dravya, Guna, Karma, Samanya,
Visesa, Samavaya.
Of the six classes of entities or categories (paddrthd) we have
already given some account of dravya*. Let us now turn to
the others. Of the qualities (guna} the first one called rupa
{colour) is that which can be apprehended by the eye alone
and not by any other sense. The colours are white, blue,
yellow, red, green, brown and variegated (citrd). Colours are
found only in ksiti, ap and tejas. The colours of ap and tejas are
permanent (nitya\ but the colour of ksiti changes when heat
is applied, and this, Sridhara holds, is due to the fact that
heat changes the atomic structure of ksiti (earth) and thus the
old constitution of the substance being destroyed, its old colour
is also destroyed, and a new one is generated. Rupa is the general
name for the specific individual colours. There is the genus ru-
patva (colourness), and the rupa guna (quality) is that on which
rests this genus; rupa is not itself a genus and can be appre
hended by the eye.
The second is rasa (taste), that quality of things which can be
apprehended only by the tongue ; these are sweet, sour, pungent
(katu), astringent (kasdya) and bitter (tikta\ Only ksiti and ap
have taste. The natural taste of ap is sweetness. Rasa like
rupa also denotes the genus rasatva, and rasa as quality must
be distinguished from rasa as genus, though both of them are
apprehended by the tongue.
The third is gandha (odour), that quality which can be ap
prehended by the nose alone. It belongs to ksiti alone. Water
1 The reference is to Sautrantika Buddhism, " yo yo viruddhadhy&savan nasave-
kah." See Panditas oka s Avayavinirakarana, Six Buddhist Nyaya tracts.
2 The word "paddrtha" literally means denotations of words.
314 The Nyaya-Vaifesika Philosophy [CH.
or air is apprehended as having odour on account of the presence
of earth materials.
The fourth is sparsa (touch), that quality which can be ap
prehended only by the skin. There are three kinds of touch, cold,
hot, neither hot nor cold. Sparsa belongs to ksiti; ap, tejas, and
vayu. The fifth sabda (sound) is an attribute of akasa. Had there
been no akasa there would have been no sound.
The sixth is samkhya (number), that entity of quality belonging
to things by virtue of which we can count them as one, two, three,
etc. The conception of numbers two, three, etc. is due to a relative
oscillatory state of the mind (apeksdbuddhi) ; thus when there are
two jugs before my eyes, I have the notion This is one jug and
that is another jug. This is called apeksabuddhi ; then in the
two jugs there arises the quality of twoness (dvitvd) and then an
indeterminate perception (nirvikalpa-dvitva-gund) of dvitva in us
and then the determinate perceptions that there are the two jugs.
The conceptions of other numbers as well as of many arise in a
similar manner 1 .
The seventh is parimiti (measure), that entity of quality in
things by virtue of which we perceive them as great or small and
speak of them as such. The measure of the partless atoms is
called parimandala parimana ; it is eternal, and it cannot gene
rate the measure of any other thing. Its measure is its own abso
lutely; when two atoms generate a dyad (dvyanuka) it is not
the measure of the atom that generates the arm (atomic) and
the hrasva (small) measure of the dyad molecule (dvyanuka),
for then the size (parimana) of it would have been still smaller
than the measure of the atom (parimandala), whereas the
measure of the dyanuka is of a different kind, namely the
small (hrasva)*. Of course two atoms generate a dyad, but
then the number (samkhya) of the atom should be regarded as
bringing forth a new kind of measure, namely the small (hrasva)
measure in the dyads. So again when three dyads (dyanuka)
compose a tryanuka the number and not the measure " small "
1 This is distinctively a Vaiesika view introduced by Praiastapada. Nyaya seems
to be silent on this matter. See Sahkara Mis"ra s Upaskdra, vn. ii. 8.
2 It should be noted that the atomic measure appears in two forms as eterqal as in
"paramanus" and non-eternal as in the dvyanuka. The parimandala parimana is thus
a variety of anuparimana. The anuparimana and the hrasvaparimana represent the
two dimensions of the measure of dvyanukas as mahat and dirgha are with reference
to tryanukas. See Nyayakandali, p. 133.
vm] The Quality of Measure 3 1 5
(hrasva) of the dyad is the cause of the measure " great " (mahat)
of the tryanuka. But when we come to the region of these gross
tryanukas we find that the " great " measure of the tryanukas is
the cause of the measure of other grosser bodies composed by
them. For as many tryanukas constitute a gross body, so much
bigger does the thing become. Thus the cumulation of the trya
nukas of mahat parimana makes things of still more mahat pari
mana. The measure of tryanukas is not only regarded as mahat
but also as dlrgha (long) and this dirgha parimana has to be ad
mitted as coexisting with mahat parimana but not identical, for
things not only appear as great but also as long (dtrgha). Here
we find that the accumulation of tryanukas means the accumula
tion of "great" (mahat) and "long" (dtrgha) parimana, and hence
the thing generated happens to possess a measure which is greater
and longer than the individual atoms which composed them.
Now the hrasva parimana of the dyads is not regarded as having
a lower degree of greatness or length but as a separate and distinct
type of measure which is called small (hrasva). As accumulation
of grossness, greatness or length, generates still more greatness,
grossness and length in its effect, so an accumulation of the
hrasva (small) parimana ought to generate still more hrasva
parimana, and we should expect that if the hrasva measure of
the dyads was the cause of the measure of the tryanukas, the
tryanukas should be even smaller than the dyanukas. So also if
the atomic and circular (parimandala) size of the atoms is re
garded as generating by their measure the measure of the dya
nukas, then the measure of the dyanukas ought to be more atomic
than the atoms. The atomic, small, and great measures should
not be regarded as representing successively bigger measures pro
duced by the mere cumulation of measures, but each should be
regarded as a measure absolutely distinct, different from or foreign
to the other measure. It is therefore held that if grossness in the
cause generates still more greatness in the effect, the smallness
and the parimandala measure of the dyads and atoms ought to
generate still more smallness and subtleness in their effect.
But since the dyads and the tryanuka molecules are seen to
be constituted of atoms and dyads respectively, and yet are
not found to share the measure of their causes, it is to be argued
that the measures of the atoms and dyads do not generate the
measure of their effects, but it is their number which is the cause
316 The Nyaya-Vaitesika Philosophy [CH.
of the measure of the latter. This explains anuparimana, hrasva
parimana, mahat parimana, and dlrgha parimana. The parimana
of akasa, kala, dik and atman which are regarded as all-pervasive,
is said to be paramamahat (absolutely large). The parimanas
of the atoms, akasa, kala, dik, manas, and atman are regarded
as eternal (nitya). All other kinds of parimanas as belonging to
non-eternal things are regarded as non-eternal.
The eighth is prthaktva (mutual difference or separateness of
things), that entity or quality in things by virtue of which things
appear as different (e.g. this is different from that). Difference is
perceived by us as a positive notion and not as a mere negation
such as this jug is not this pot.
The ninth is samyoga (connection), that entity of guna by
virtue of which things appear to us as connected.
The tenth is vibhdga (separation), that entity of guna which
destroys the connection or contact of things.
The eleventh and twelfth gunas, paratva and aparatva, give
rise in us to the perceptions of long time and short time, remote
and near.
The other gunas such as buddhi (knowledge), sukha (happiness),
duhkha (sorrow), icchd (will), dvesa (antipathy or hatred) and
yatna (effort) can occur only with reference to soul.
The characteristic of gurutva (heaviness) is that by virtue of
which things fall to the ground. The guna of sneha (oiliness)
belongs to water. The guna of samskdra is of three kinds, (i) vega
(velocity) which keeps a thing moving in different directions,
(2) sthiti-sthdpaka (elasticity) on account of which a gross thing
tries to get back its old state even though disturbed, (3) bhd-
vand is that quality of atman by which things are constantly
practised or by which things experienced are remembered and
recognized 1 . Dharma is the quality the presence of which enables
the soul to enjoy happiness or to attain salvation*. Adharma is
1 Pra^astapada says that bhavana is a special characteristic of the soul, contrary to
intoxication, sorrow and knowledge, by which things seen, heard and felt are remem
bered and recognized. Through unexpectedness (as the sight of a camel for a man of
South India), repetition (as in studies, art etc.) and intensity of interest, the sarnskara
becomes particularly strong. See Nyayakandali, p. 267. Kanada however is silent
on these points. He only says that by a special kind of contact of the mind with soul
and also by the sarnskara, memory (smrti) is produced (ix. i, 6).
2 Prasastapada speaks of dharma (merit) as being a quality of the soul. Thereupon
&ridhara points out that this view does not admit that dharma is a power of karma (na
karmasamarthyam). Sacrifice etc. cannot be dharma for these actions being momentary
viu] Category of Universality 3 1 7
the opposite quality, the presence of which in the soul leads a
man to suffer. Adrsta or destiny is that unknown quality of
things and of the soul which brings about the cosmic order, and
arranges it for the experience of the souls in accordance with
their merits or demerits.
Karma means movement ; it is the third thing which must
be held to be as irreducible a reality as dravya or guna. There
are five kinds of movement, (i) upward, (2) downward, (3) con
traction, (4) expansion, (5) movement in general. All kinds of
karmas rest on substances just as the gunas do, and cause the
things to which they belong to move.
Sdmdnya is the fourth category. It means the genus, or aspect
of generality or sameness that we notice in things. Thus in spite
of the difference of colour between one cow and another, both of
them are found to have such a sameness that we call them cows.
In spite of all diversity in all objects around us, they are all
perceived as sat or existing. This sat or existence is thus a same
ness, which is found to exist in all the three things, dravya, guna,
and karma. This sameness is called samdnya or jdti, and it is
regarded as a separate thing which rests on dravya, guna, or
karma. This highest genus sattd (being) is called parajdti (highest
universal), the other intermediate jatis are called aparajdti (lower
universals), such as the genus of dravya, of karma, or of guna, or
still more intermediate jatis such as gotvajdti (the genus cow),
nllatvajdti (the genus blue). The intermediate jatis or genera
sometimes appear to have a special aspect as a species, such as
pasutva (animal jati) and gotva (the cow jati); here however
gotva appears as a species, yet it is in reality nothing but a jati.
The aspect as species has no separate existence. It is jati which
from one aspect appears as genus and from another as species.
they cannot generate the effects which are only to be reaped at a future time. If the
action is destroyed its power (samarthya) cannot last. So dharma is to be admitted
as a quality generated in the self by certain courses of conduct which produce happi
ness for him when helped by certain other conditions of time, place, etc. Faith
(traddha), non-injury, doing good to all beings, truthfulness, non-stealing, sex -control,
sincerity, control of anger, ablutions, taking of pure food, devotion to particular gods,
fasting, strict adherence to scriptural duties, and the performance of duties assigned
to each caste and stage of life, are enumerated by Pras"astapada as producing dharma.
The person who strictly adheres to these duties and the yamas and niyamas (cf.
Pataftjali s Yoga) and attains Yoga by a meditation on the six padarthas attains a
dharma which brings liberation (moksa). Srldhara refers to the Samkhya-Yoga
account of the method of attaining salvation (Nyayakandalt, pp. 272-280). See also
Vallabha s Nyayaltlavatt, pp. 74-75. (Bombay, 1915.)
318 The Nyaya- Vaifesika Philosophy [CH.
This jati or sdmdnya thus must be regarded as having a separate
independent reality though it is existent in dravya, guna and
karma. The Buddhists denied the existence of any indepen
dent reality of samanya, but said that the sameness as cow
was really but the negation of all non-cows (apoha). The per
ception of cow realizes the negation of all non-cows and this
is represented in consciousness as the sameness as cow. He who
should regard this sameness to be a separate and independent
reality perceived in experience might also discover two horns
on his own head 1 . The Nyaya- Vaisesika said that negation
of non-cows is a negative perception, whereas the sameness per
ceived as cow is a positive perception, which cannot be explained
by the aforesaid negation theory of the Buddhists. Samanya has
thus to be admitted to have a separate reality. All perception as
sameness of a thing is due to the presence of this thing in that
object 1 . This jati is eternal or non-destructible; for even with
the destruction of individuals comprehended within the jati, the
latter is not destroyed*.
Through visesa things are perceived as diverse. No single
sensation that we receive from the external world probably agrees
with any other sensation, and this difference must be due to the
existence of some specific differences amongst the atoms them
selves. The specific difference existing in the atoms, emancipated
souls and minds must be regarded as eternally existing, and it
1 The Buddhist Panditas oka says that there is no single thing running through
different individuals (e.g. cooks) by virtue of which the samanya could be established.
For if it did exist then we could have known it simply by seeing any cook without
any reference to his action of cooking by virtue of which the notion of generality is
formed. If there is a similarity between the action of cooks that cannot establish
jati in the cooks, for the similarity applies to other things, viz. the action of the
cooks. If the specific individualities of a cow should require one common factor to
hold them together, then these should require another and that another, and we have
a regressus ad infinitum Whatever being perceptible is not perceived is non-existent
(yadyadupalabdhilaksanapraptam sannopalabhyatc taltadasat}. Samanya is such,
therefore samanya is non-existent. No samanya can be admitted to exist as an
entity. But it is only as a result of the impressions of past experiences of existence
and non-existence that this notion is formed and transferred erroneously to external
objects. Apart from this no samanya can be pointed out as being externally per
ceptible Samdnyadusanadikprasarita in Six Buddhist Nyaya Tracts. The Vedanta
also does not think that either by perception or by inference we can know jati as a
separate substance. So it discards jati. See Vedantaparibhasa, Sikhdmani and Mani-
prabhd, pp. 69-71. See also Sriharsa s Khandanakhandakhadya, pp. 1079-1086.
2 Similarity (fddrsya) is not regarded as a separate category, for it is denned as
identity in difference (tadbhinnatve sali tadgalabhuyodharmavattvam).
vin] Category of Inherence 319
is on account of its presence that atoms appear as different to the
yogins who can perceive them.
Samavdya, the inseparable relation of inherence, is a relation
by virtue of which two different things such as substance and
attribute, substance and karma, substance and samanya, karana
(cause) and karya (effect), atoms and vis"esa, appear so unified
that they represent one whole, or one identical inseparable reality.
This peculiar relation of inseparable inherence is the cause why
substance, action, and attribute, cause and effect, and jati in sub
stance and attribute appear as indissolubly connected as if they
are one and the same thing. Samyoga or contact may take place
between two things of the same nature which exist as disconnected
and may later on be connected (yutasiddha), such as when I put
my pen on the table. The pen and the table are both substances
and were disconnected; the samyoga relation is the guna by
virtue of which they appear to be connected for a while. Samavaya
however makes absolutely different things such as dravya and
guna and karma or karana and karya (clay and jug) appear as
one inseparable whole (ayutasiddhd). This relation is thus a
separate and independent category. This is not regarded as
many like samyogas (contact) but as one and eternal because
it has no cause. This or that object (e.g. jug) may be destroyed
but the samavaya relation which was never brought into being
by anybody always remains 1 .
These six things are called the six padarthas or independent
realities experienced in perception and expressed in language.
The Theory of Causation.
The Nyaya-Vais esika in most of its speculations took that
view of things which finds expression in our language, and which
we tacitly assume as true in all our ordinary experience. Thus
1 The Vedanta does not admit the existence of the relation of samavaya as sub
sisting between two different entities (e.g. substance and qualities). Thus &ankara
says (Brahma- sutrabhdsy a n. ii. 13) that if a samavaya relation is to be admitted to
connect two different things, then another samavaya would be necessary to connect
it with either of the two entities that it intended to connect, and that another,
and so there will be a vicious infinite (anavasthd). Nyaya, however, would not re
gard it as vicious at all. It is well to remember that the Indian systems acknow
ledge two kinds of anavastha prdmdniki (valid infinite, as in case of the question of
the seed and the tree, or of the avidya and the passions), and another apr&tnaniki
anavasthd (vicious infinite) as when the admission of anything involves an infinite chain
before it can be completed.
320 The Ny ay a- Vaitesika Philosophy [CH.
they admitted dravya, guna, karma and samanya. Vi^esa they
had to admit as the ultimate peculiarities of atoms, for they did
not admit that things were continually changing their qualities,
and that everything could be produced out of everything by a
change of the collocation or arrangement of the constituting atoms.
In the production of the effect too they did not admit that the
effect was potentially pre-existent in the cause. They held that
the material cause (e.g. clay) had some power within it, and the
accessory and other instrumental causes (such as the stick, the
wheel etc.) had other powers; the collocation of these two de
stroyed the cause, and produced the effect which was not existent
before but was newly produced. This is what is called the
doctrine of asatkdryavdda. This is just the opposite of the
Samkhya axiom, that what is existent cannot be destroyed (nd-
bhdvo vidyate satah) and that the non-existent could never be
produced (ndsato vidyate bhdvafi}. The objection to this view is
that if what is non-existent is produced, then even such im
possible things as the hare s horn could also be produced. The
Nyaya-Vaiesika answer is that the view is not that anything
that is non-existent can be produced, but that which is produced
was non-existent 1 .
It is held by Mlmamsa that an unseen power resides in the
cause which produces the effect. To this Nyaya objects that this
is neither a matter of observation nor of legitimate hypothesis, for
there is no reason to suppose that there is any transcendental
operation in causal movement as this can be satisfactorily ex
plained by molecular movement (parispanda). There is nothing
except the invariable time relation (antecedence and sequence)
between the cause and the effect, but the mere invariableness of
an antecedent does not suffice to make it the cause of what
succeeds; it must be an unconditional antecedent as well (anya-
tfatsiddhisunyasya niyatdpurvavarttita). Unconditionality and in
variability are indispensable for kdryakdrana-bhdva or cause and
effect relation. For example, the non-essential or adventitious
accompaniments of an invariable antecedent may also be invari
able antecedents; but they are not unconditional, only collateral
or indirect. In other words their antecedence is conditional
upon something else (na svdtantryend). The potter s stick is an
unconditional invariable antecedent of the jar; but the colour
1 Nyayamanjari, p. 494.
vin] Doctrine of Causation 32 1
of a stick or its texture or size, or any other accompaniment
or accident which does not contribute to the work done, is
not an unconditional antecedent, and must not therefore be
regarded as a cause. Similarly the co-effects of the invari
able antecedents or what enters into the production of their
co-effects may themselves be invariable antecedents; but they
are not unconditional, being themselves conditioned by those
of the antecedents of which they are effects. For example, the
sound produced by the stick or by the potter s wheel invariably
precedes the jar but it is a co-effect; and akasa (ether) as the
substrate and vayu (air) as the vehicle of the sound enter into
the production of this co-effect, but these are no unconditional
antecedents, and must therefore be rejected in an enumera
tion of conditions or causes of the jar. The conditions of the
conditions should also be rejected; the invariable antecedent
of the potter (who is an invariable antecedent of the jar),
the potter s father, does not stand in a causal relation to the
potter s handiwork. In fact the antecedence must not only be
unconditionally invariable, but must also be immediate. Finally
all seemingly invariable antecedents which may be dispensed with
or left out are not unconditional and cannot therefore be regarded
as causal conditions. Thus Dr Seal in describing it rightly
remarks, "In the end, the discrimination of what is necessary to
complete the sum -of causes from what is dependent, collateral,
secondary, superfluous, or inert (i.e. of the relevant from the
irrelevant factors), must depend on the test of expenditure of
energy. This test the Nyaya would accept only in the sense of
an operation analysable into molar or molecular motion (paris-
panda eva bhautiko vydpdrah karotyarthah atindriyastu vyd-
paro ndsti* Jayanta s Maftjarl Ahnika I), but would emphatically
reject, if it is advanced in support of the notion of a mysterious
causal power or efficiency (sakti) 1 ." With Nyaya all energy is
necessarily kinetic. This is a peculiarity of Nyaya its insisting
that the effect is only the sum or resultant of the operations
of the different causal conditions that these operations are of
the nature of motion of kinetic, in other words it firmly holds
to the view that causation is a case of expenditure of energy,
i.e. a redistribution of motion, but at the same time absolutely
repudiates the Samkhya conception of power or productive
1 Dr P. C. Ray s Hindu Chemistry, .1909, pp. 749-150.
D. 21
322 The Ny ay a- Vaitesika Philosophy [CH.
efficiency as metaphysical or transcendental (atlndriya) and finds
nothing in the cause other than unconditional invariable com
plements of operative conditions (kdrana-sdmagrt\ and nothing
in the effect other than the consequent phenomenon which results
from the joint operations of the antecedent conditions 1 . Certain
general conditions such as relative space (dik}, time (kdla), the will
of Isvara, destiny (adrsta) are regarded as the common cause of all
effects (kdryatva-prayojaka). Those are called sddhdrana-kdrana
(common cause) as distinguished from the specific causes which
determine the specific effects which are called asddhdrana kdrana.
It may not be out of place here to notice that Nyaya while
repudiating transcendental power (sakti) in the mechanism of
nature and natural causation, does not deny the existence of
metaphysical conditions like merit (dharma), which constitutes
a system of moral ends that fulfil themselves through the
mechanical systems and order of nature.
The causal relation then like the relation of genus to species,
is a natural relation of concomitance, which can be ascertained
only by the uniform and uninterrupted experience of agreement in
presence and agreement in absence, and not by a deduction from
a certain a priori principle like that of causality or identity of
essence 3 .
The material cause such as the clay is technically called the
samavdyi-kdrana of the jug. Samav&ya means as we have seen
an intimate, inseparable relation of inherence. A karana is called
samavZyi when its materials are found inseparably connected
with the materials of the effect. Asamavayi-karana is that which
produces its characteristics in the effect through the medium of
the samavayi or material cause, e.g. the clay is not the cause of
the colour of the jug but the colour of the clay is the cause of the
colour of the jug. The colour of the clay which exists in the clay
in inseparable relation is the cause of the colour of the jug. This
colour of the clay is thus called the asamavayi cause of the jug.
Any quality (gund) or movement which existing in thesamavaya
cause in the samavaya relation determines the characteristics of
the effect is called the asamavayi-karana. The instrumental
1 Dr P. C. Ray s Hindu Chemistry, 1909, pp. 249-250.
* See for this portion Dr B. N. Seal s Positive Sciences of the Ancient Hindus,
pp. 263-266. SarvadarJanasamgraha on Buddhism. Nyayamanjari, Bhasd-pariccheda,
with Muktdvali and Dinakari, and Tarkasamgraha. The doctrine of Anyathasiddhi
was systematically developed from the time of Ganges a.
vni J Dissolution and Creation 323
nimitta and accessory (sahakdri) causes are those which help the
material cause to produce the effect. Thus the potter, the wheel
and the stick may be regarded as the nimitta and the sahakari
causes of the effect.
We know that the Nyaya-Vaiesika regards the effect as non
existent, before the operation of the cause in producing it, but it
holds that the gunas in the cause are the causes of the gunas in
the effect, e.g. the black colour of the clay is the cause of the
black colour of the effect, except in cases where heat comes as an
extraneous cause to generate other qualities ; thus when a clay
jug is burnt, on account of the heat we get red colour, though the
colour of the original clay and the jug was black. Another im
portant exception is to be found in the case of the production of
the parimanas of dvyanukas and trasarenus which are not pro
duced by the parimanas of an arm or a dyanuka, but by their
number as we have already seen.
Dissolution (Pralaya) and Creation (Srs{i).
The docrine of pralaya is accepted by all the Hindu systems
except the Mlmamsa 1 . According to the Nyaya-Vais"esika view
ISvara wishing to give some respite or rest to all living beings
desires to bring about dissolution (samhdreccho bhavati). Simul
taneously with it the adrsta force residing in all the souls and
forming bodies, senses, and the gross elements, ceases to act
(sakti-pratibandha\ As a result of this no further bodies, senses,
or other products come into being. Then for the bringing about
of the dissolution of all produced things (by the desire of IsVara)
the separation of the atoms commences and thus all combinations
as bodies or senses are disintegrated; so all earth is reduced to
the disintegrated atomic state, then all ap, then all tejas and then
all vayu. These disintegrated atoms and the souls associated
with dharma, adharma and past impressions (samskdra) remain
suspended in their own inanimate condition. For we know that
souls in their natural condition are lifeless and knowledgeless,
non-intelligent entities. It is only when these are connected
with bodies that they possess knowledge through the activity of
manas. In the state of pralaya owing to the adrsta of souls the
1 The doctrine of pralaya and srsti is found only in later Nyaya-Vais esika works,
but the sutras of both the systems seem to be silent on the matter.
21 2
324 The Ny ay a- Vaitesika Philosophy [CH.
atoms do not conglomerate. It is not an act of cruelty on the
part of Isvara that he brings about dissolution, for he does it to
give some rest to the sufferings of the living beings.
At the time of creation, Isvara wishes to create and this desire
of Isvara works in all the souls as adrsta. This one eternal
desire of Isvara under certain conditions of time (e.g. of pralaya)
as accessory causes (sahakdri) helps the disintegration of atoms
and at other times (e.g. that of creation) the constructive process
of integration and unification of atoms for the world-creation.
When it acts in a specific capacity in the diverse souls it is called
adrsta. At the time of dissolution the creative function of this
adrsta is suspended and at the time of creation it finds full play.
At the time of creation action first begins in the vayu atoms by
the kinetic function of this adrsta, by the contact of the souls
with the atoms. By such action the air atoms come in contact
with one another and the dvyanukas are formed and then in a
similar way the tryanukas are formed, and thus vayu originates.
After vayu, the ap is formed by the conglomeration of water
atoms, and then the tejas atoms conglomerate and then the earth
atoms. When the four elements are thus conglomerated in the
gross form, the god Brahma and all the worlds are created by
Isvara and Brahma is directed by Isvara to do the rest of the
work. Brahma thus arranges for the enjoyment and suffering of
the fruits of diverse kinds of karma, good or bad. IsVara brings
about this creation not for any selfish purpose but for the good
of all beings. Even here sorrows have their place that they
may lead men to turn from worldly attachment and try for
the attainment of the highest good, mukti. Moreover Isvara
arranges for the enjoyment of pleasures and the suffering of
pains according to the merits and demerits of men, just as in
our ordinary experience we find that a master awards prizes
or punishments according to good or bad deeds 1 . Many Nyaya
books do not speak of the appointment of a Brahma as de
puty for supervision of the due disposal of the fruits of karma
according to merit or demerit. It is also held that pralaya and
creation were brought about in accordance with the karma of
men, or that it may be due to a mere play (Ilia) of Isvara.
IsVara is one, for if there were many Isvaras they might quarrel.
The will of Isvara not only brings about dissolution and creation,
1 See Ny&yakandali, pp. 48-54.
vm] Proof of the Existence of God 325
but also acts always among us in a general way, for without it
our karmas could not ripen, and the consequent disposal of
pleasures and sorrows to us and a corresponding change in the
exterior world in the form of order or harmony could not happen.
The exterior world is in perfect harmony with men s actions.
Their merits and demerits and all its changes and modifications
take place in accordance with merits and demerits. This desire
(iccha) of Isvara may thus be compared with the icchd of Isvara
as we find it in the Yoga system.
Proof of the Existence of Isvara.
Samkhya asserts that the teleology of the prakrti is suffi
cient to explain all order and arrangement of the cosmos. The
Mimamsakas, the Carvakas, the Buddhists and the Jains all
deny the existence of Isvara (God). Nyaya believes that IsVara
has fashioned this universe by his will out of the ever-existing
atoms. For every effect (e.g. a jug) must have its cause. If
this be so, then this world with all its order and arrangement
must also be due to the agency of some cause, and this cause is
Isvara. This world is not momentary as the Buddhists suppose,
but is permanent as atoms, is also an effect so far as it is a
collocation of atoms and is made up of parts like all other in
dividual objects (e.g. jug, etc.), which we call effects. The world
being an effect like any other effect must have a cause like any
other effect. The objection made against this view is that such
effects as we ordinarily perceive may be said to have agents
as their causes but this manifest world with mountains, rivers,
oceans etc. is so utterly different in form from ordinary effects
that we notice every day, that the law that every effect must have
a cause cannot be said to hold good in the present case. The
answer that Nyaya gives is that the concomitance between two
things must be taken in its general aspect neglecting the specific
peculiarities of each case of observed concomitance. Thus I had
seen many cases of the concomitance of smoke with fire, and had
thence formed the notion that "wherever there is smoke there is
fire"; but if I had only observed small puffs of smoke and small
fires, could I say that only small quantities <?f smoke could lead
us to the inference of fire, and could I hold that therefore large
volumes of smoke from the burning of a forest should not be
sufficient reason for us to infer the existence of fire in the forest?
326 The Nyaya- Vaifesika Philosophy [CH.
Thus our conclusion should not be that only smaller effects
are preceded by their causes, but that all effects are invariably
and unconditionally preceded by causes. This world therefore
being an effect must be preceded by a cause, and this cause is
Isvara. This cause we cannot see, because Isvara has no visible
body, not because he does not exist. It is sometimes said that
we see every day that shoots come out of seeds and they are
not produced by any agent. To such an objection the Nyaya
answer is that even they are created by God, for they are also
effects. That we do not see any one to fashion them is not
because there is no maker of them, but because the creator can
not be seen. If the objector could distinctly prove that there was
no invisible maker shaping these shoots, then only could he point
to it as a case of contradiction. But so long as this is not done
it is still only a doubtful case of enquiry and it is therefore legiti
mate for us to infer that since all effects have a cause, the shoots
as well as the manifest world being effects must have a cause.
This cause is ISvara. He has infinite knowledge and is all merciful.
At the beginning of creation He created the Vedas. He is like our
father who is always engaged in doing us good 1 .
The Nyaya- Vaisesika Physics.
The four kinds of atoms are earth, water, fire, and air atoms.
These have mass, number, weight, fluidity (or hardness), vis
cosity (or its opposite), velocity, characteristic potential colour,
taste, smell, or touch, not produced by the chemical operation of
heat. Akaa (space) is absolutely inert and structure-less being
only as the substratum of sound, which is supposed to travel
wave-like in the manifesting medium of air. Atomic combina
tion is only possible with the four elements. Atoms cannot
exist in an uncombined condition in the creation stage; atmo
spheric air however consists of atoms in an uncombined state.
Two atoms combine to form a binary molecule (dvyanuka). Two,
three, four, or five dvyanukas form themselves into grosser mole
cules of tryanuka, caturanuka, etc. 8 Though this was the generally
current view, there was also another view as has been pointed out
by Dr B. N. Seal in his Positive Sciences of the Ancient Hindu j.that
the "atoms have also an inherent tendency to unite," and that
1 See Jayanta s Ny&yamanjnri, pp. 190-704, and Udayana s Kusumanjali with
Prakaia and Ihiaranumdna of Raghunatha.
2 ffaddfit tnbhirarabhyatt id tryanukamityucyatt, kaddcit cnturbhirarabhyate
kaddcit pancabhiriti yathestam kalpan&. AyayaAandali, p. 31.
vin] Molecular Changes 327
they do so in twos, threes, or fours, "either by the atoms falling into
groups of threes, fours, etc. directly, or by the successive addition
of one atom to each preceding aggregate 1 ." Of course the atoms
are regarded as possessed of an incessant vibratory motion. It
must however be noted in this connection that behind this
physical explanation of the union of atoms there is the adrsta, the
will of Ivara, which gives the direction of all such unions in har
mony with the principle of a "moral government of the universe,"
so that only such things are produced as can be arranged for the
due disposal of the effects of karma. "An elementary substance
thus produced by primary atomic combination may however suffer
qualitative changes under the influence of heat (pdkajotpattt)"
The impact of heat corpuscles decomposes a dvyanuka into the
atoms and transforms the characters of the atoms determining
them all in the same way. The heat particles continuing to im
pinge reunite the atoms so transformed to form binary or other
molecules in different orders or arrangements, which account for
the specific characters or qualities finally produced. The Vaisesika
holds that there is first a disintegration into simple atoms, then
change of atomic qualities, and then the final re-combination,
under the influence of heat. This doctrine is called the doctrine
of pilupdka (heating of atoms). Nyaya on the other hand thinks
that no disintegration into atoms is necessary for change of quali
ties, but it is the molecules which assume new characters under the
influence of heat. Heat thus according to Nyaya directly affects
the characters of the molecules and changes their qualities with
out effecting a change in the atoms. Nyaya holds that the
heat-corpuscles penetrate into the porous body of the object and
thereby produce the change of colour. The object as a whole is
not disintegrated into atoms and then reconstituted again, for
such a procedure is never experienced by observation. This is
called the doctrine of pitharapdka (heating of molecules). This
is one of the few points of difference between the later Nyaya
and Vaisesika systems 2 .
Chemical compounds of atoms may take place between the
1 Utpala s commentary on Brhatsamhita \. 7.
2 See Dr B. N. Seal in P. C. Ray s Hindu Chemistry, pp. igo-igi,JVyayamafl/ari,
p. 438, and Udyotakara s Varttika. There is very little indication in the Nyaya and
Vaisesika sutras that they had any of those differences indicated here. Though there
are slight indications of these matters in the Vaisesika sutras (vn. i), the Nyaya
sutras are almost silent upon the matter. A systematic development of the theory
of creation and atomic combinations appear to have taken place after Vatsyayana.
328 The Ny ay a-Vaifesika Philosophy [CH.
atoms of the same bhuta or of many bhutas. According to the
Nyaya view there are no differences in the atoms of the same
bhuta, and all differences of quality and characteristics of the
compound of the same bhuta are due only to diverse collocations
of those atoms. Thus Udyotakara says (ill. i. 4) that there is no
difference between the atom of a barley seed and paddy seed,
since these are all but atoms of earth. Under the continued impact
of heat particles the atoms take new characters. It is heat and
heat alone that can cause the transformations of colours, tastes
etc. in the original bhuta atoms. The change of these physical
characters depends on the colours etc. of the constituent substances
in contact, on the intensity or degree of heat and also on the
species of tejas corpuscles that impinge on the atoms. Heat breaks
bodies in contact into atoms, transforms their qualities, and forms
separate bodies with them.
PraSastapada (the commentator of Vaisesika) holds that in
the higher compounds of the same bhuta the transformation takes
place (under internal heat) in the constituent atoms of the com
pound molecules, atoms specially determined as the compound
and not in the original atoms of the bhuta entering into the com
position of the compound. Thus when milk is turned into curd,
the transformation as curd takes place in the atoms determined
as milk in the milk molecule, and it is not necessary that the
milk molecule should be disintegrated into the atoms of the
original bhuta of which the milk is a modification. The change
as curd thus takes place in the milk atom, and the milk molecule
has not to be disintegrated into ksiti or ap atoms. So again in
the fertilized ovum, the germ and the ovum substances, which in
the Vaisesika view are both isomeric modes of earth (with accom
paniments of other bhutas) are broken up into homogeneous earth
atoms, and it is these that chemically combine under the animal
heat and biomotor force vayu to form the germ (kalala). But
when the germ plasm develops, deriving its nutrition from the
blood of the mother, the animal heat breaks up the molecules of
the germ plasm into its constituent atoms, i.e. atoms specifically
determined which by their grouping formed the germ plasm.
These germ-plasm atoms chemically combine with the atoms of
the food constituents and thus produce cells and tissues 1 . This
atomic contact is called arambhaka-samyoga.
1 See Dr B. N. Seal s Positive Sciences, pp. 104-108, and Nydyakandalt, pp. 33-34,
Sarir&rambhe paramdnava eva karanam na iukra-ionitasannipatah kriyavibhaga-
vii i] Molecular Changes and Heat 329
In the case of poly-bhautik or bi-bhautik compounds there is
another kind of contact called upasfambka. Thus in the case of
such compounds as oils, fats, and fruit juices, the earth atoms
cannot combine with one another unless they are surrounded by
the water atoms which congregate round the former, and by the
infra-atomic forces thus set up the earth atoms take peculiar
qualities under the impact of heat corpuscles. Other compounds
are also possible where the ap, tejas, or the vayu atoms form the
inner radicle and earth atoms dynamically surround them (e.g.
gold, which is the tejas atom with the earth atoms as the sur
rounding upastambhaka). Solutions (of earth substances in ap)
are regarded as physical mixtures.
Udayana points out that the solar heat is the source of all the
stores of heat required for chemical change. But there are
differences in the modes of the action of heat ; and the kind of
contact with heat-corpuscles, or the kind of heat with chemical
action which transforms colours, is supposed to differ from what
transforms flavour or taste.
Heat and light rays are supposed to consist of indefinitely
small particles which dart forth or radiate in all directions recti-
lineally with inconceivable velocity. Heat may penetrate through
the interatomic space as in the case of the conduction of heat, as
when water boils in a pot put on the fire; in cases of transparency
light rays penetrate through the inter-atomic spaces with pari-
spanda of the nature of deflection or refraction (tiryag-gamand).
In other cases heat rays may impinge on the atoms and rebound
back which explains reflection. Lastly heat may strike the
atoms in a peculiar way, so as to break up their grouping, transform
the physico-chemical characters of the atoms, and again recom-
bine them, all by means of continual impact with inconceivable
velocity, an operation which explains all cases of chemical
combination 1 . Govardhana a later Nyaya writer says that paka
means the combination of different kinds of heat. The heat that
diny&ytna tayorvindSe satiutpannapakajaihparam&nubhirarambhat, na ca (ukroJonita-
paramanundm kafddvifesah pdrthivatvavifesat....Pituh fakram mdtuh fonitam tayos
sannipdtanantaram jathardnalasambandh&t fukra-fonitarambhakefu paramdnusu
purvarup&divindSc samanagunantarotpattau dvyanukddikramena kalalafarirotpattih
tatrdntahkaranaprave{o...tatra mdturdhdraraso matrayd samkrdmate, adrstavafdttatra
punarjathardnalasambandhdt kalaldrambhakaparamdnuru kriydvibhdgddinydyena
kalalafarire naste samutpannapdkajaih kalaldrambhakaparamdnubhiradrstavafdd
upajdtakriyairdh&raparamdnubhih saha sambhuya farirdntaramdrabhyate."
1 See Dr Seal s Positive Sciences of the Hindus.
330 The Nyaya - Vaitesika Philosophy [CH.
changes the colour of a fruit is different from that which generates
or changes the taste. Even when the colour and taste remain the
same a particular kind of heat may change the smell. When
grass eaten by cows is broken up into atoms special kinds of
heat-light rays change its old taste, colour, touch and smell into
such forms as those that belong to milk 1 .
In the Nyaya- Vaisesika system all action of matter on matter
is thus resolved into motion. Conscious activity (prayatna) is
distinguished from all forms of motion as against the Samkhya
doctrine which considered everything other than purusa (in
telligence) to arise in the course of cosmic evolution and therefore
to be subject to vibratory motion.
The Origin of Knowledge (Pramana).
The manner in which knowledge originates is one of the
most favourite topics of discussion in Indian philosophy. We
have already seen that Samkhya- Yoga explained it by supposing
that the buddhi (place of consciousness) assumed the form of the
object of perception, and that the buddhi so transformed was
then intelligized by the reflection of the pure intelligence or purusa.
The Jains regarded the origin of any knowledge as being due to
a withdrawal of a veil of karma which was covering the all-
intelligence of the self.
Nyaya-Vaisesika regarded all effects as being due to the as
semblage of certain collocations which unconditionally, invariably,
and immediately preceded these effects. That collocation (s&magri)
which produced knowlege involved certain non-intelligent as well
as intelligent elements and through their conjoint action un-
contradicted and determinate knowledge was produced, and this
collocation is thus called pramana or the determining cause of the
origin of knowledge 2 . None of the separate elements composing
1 Govardhana s Nyayabodhini on Tarkasamgraha, pp. 9, 10.
2 " Avyabhicarinimasandigdharthopalabdhim vidadhati bodhabodhasvabhava sama-
gri pram&nam." Nyayamanjari, p. 12. Udyotakara however defined "pramana"
as upalabdhihetu (cause of knowledge). This view does not go against Jayanta s view
which I have followed, but it emphasizes the side of vyapara or movement of the
senses, etc. by virtue of which the objects come in contact with them and knowledge
is produced. Thus Vacaspati says: " siddhamindriyadi, asiddhafica tatsannikarsadi
vyaparayannutpddayan karana eva caritarthah karnam tvindriyddi tatsannikarsadi va.
nanyatra caritarthamiti saksddupalabdhaveva phale vyapriyate." Tatparyatlka, p. 15.
Thus it is the action of the senses as pramana which is the direct cause of the pro
duction of knowledge, but as this production could not have taken place without the
vm] Nature of Pramana 331
the causal collocation can be called the primary cause; it is only
their joint collocation that can be said to determine the effect, for
sometimes the absence of a single element composing the causal
collocation is sufficient to stop the production of the effect. Of
course the collocation or combination is not an entity separated
from the collocated or combined things. But in any case it is the
preceding collocations that combine to produce the effect jointly.
These involve not only intellectual elements (e.g. indeterminate
cognition as qualification (visesana) in determinate perceptions,
the knowledge of liriga in inference, the seeing of similar things in
upamana, the hearing of sound in sabda) but also the assemblage
of such physical things (e.g. proximity of the object of perception,
capacity of the sense, light, etc.), which are all indispensable for
the origin of knowledge. The cognitive and physical elements
all co-operate in the same plane, combine together and produce
further determinate knowledge. It is this capacity of the colloca
tions that is called pramana.
Nyaya argues that in the Samkhya view knowledge origi
nates by the transcendent influence of purusa on a particular
state of buddhi ; this is quite unintelligible, for knowledge does
not belong to buddhi as it is non-intelligent, though it contains
within it the content and the form of the concept or the percept
(knowledge). The purusa to whom the knowledge belongs, how
ever, neither knows, nor feels, neither conceives nor perceives, as
it always remains in its own transcendental purity. If the trans
cendental contact of the purusa with buddhi is but a mere sem
blance or appearance or illusion, then the Samkhya has to admit
that there is no real knowledge according to them. All knowledge
is false. And since all knowledge is false, the Samkhyists have
precious little wherewith to explain the origin of right knowledge.
There are again some Buddhists who advocate the doctrine
that simultaneously with the generation of an object there is the
knowledge corresponding to it, and that corresponding to the
rise of any knowledge there is the rise of the object of it. Neither
is the knowledge generated by the object nor the object by the
knowledge; but there is a sort of simultaneous parallelism. It is
evident that this view does not explain why knowledge should
subject and the object, they also are to be regarded as causes in some sense. " Pramatr-
prameyayoh pramane caritarthatvamacaritarthatvam pramanasya tasmiit tadeva pha-
lahetuh. Pramatrprameyc tu phalodde&na pravrtte iti taddhetu kathancit. " Ibid. p. 16.
332 The Ny ay a- Vaitesika Philosophy [CH.
express or manifest its object. If knowledge and the object are
both but corresponding points in a parallel series, whence comes
this correspondence? Why should knowledge illuminate the
object. The doetrine of the Vijflana vadins, that it is knowledge
alone that shows itself both as knowledge and as its object, is also
irrational, for how can knowledge divide itself as subject and ob
ject in such a manner that knowledge as object should require
the knowledge as subject to illuminate it ? If this be the case we
might again expect that knowledge as knowledge should also
require another knowledge to manifest it and this another, and so
on adinfinitum. Again if pramana be defined %.$prdpana (capacity
of being realized) then also it would not hold, for all things being
momentary according to the Buddhists, the thing known cannot
be realized, so there would be nothing which could be called
pramana. These views moreover do not explain the origin of
knowledge. Knowledge is thus to be regarded as an effect like
any other effect, and its origin or production occurs in the same
way as any other effect, namely by the joint collocation of causes
intellectual and physical 1 . There is no transcendent element
involved in the production of knowledge, but it is a production
on the same plane as that in which many physical phenomena
are produced 2 .
The four Pramanas of Nyaya.
We know that the Carvakas admitted perception (pratyaksd)
alone as the valid source of knowledge. The Buddhists and the
Vaisesika admitted two sources, pratyaksa and inference (anu-
mdna) 3 . Samkhya added sabda (testimony) as the third source;
1 See Nyayamanjari, pp. 12-26.
2 Discussing the question of the validity of knowledge Ganges^, a later naiyayika
of great fame, says that it is derived as a result of our inference from the correspondence
of the perception of a thing with the activity which prompted us to realize it. That
which leads us to successful activity is valid and the opposite invalid. When I am sure
that if I work in accordance with th perception of an object I shall be successful, 1
call it valid knowledge. Tattvacintdmani, K. TarkavagisVs edition, Pramanyavada.
3 The Vattesika sutras tacitly admit the Vedas as a pramana. The view that
Vaisesika only admitted two pramanas, perception and inference, is traditionally ac
cepted, " pratyaksamckamcarvakah kanadasugatau punah anumananca taccapi, etc."
Pra^astapada divides all cognition (buddhi) as vidya (right knowledge) and avidya
(ignorance). Under avidya he counts samJaya (doubt or uncertainty), viparyaya
(illusion or error), anadhyavas&ya (want of definite knowledge, thus when a man who
had never seen a mango, sees it for the first time, he wonders what it may be) and svapna
(dream). Right knowledge (vidya) is of four kinds, perception, inference, memory and
the supernatural knowledge of the sages (arsa). Interpreting the Vaifesika sutras I. i. 3,
v 1 1 1 ] Perception 333
Nyaya adds a fourth, upamana (analogy). The principle on which
the four-fold division of pramanas depends is that the causal
collocation which generates the knowledge as well as the nature
or characteristic kind of knowledge in each of the four cases is
different. The same thing which appears to us as the object of
our perception, may become the object of inference or sabda
(testimony), but the manner or mode of manifestation of know
ledge being different in each case, and the manner or conditions
producing knowledge being different in each case, it is to be
admitted that inference and sabda are different pramanas, though
they point to the same object indicated by the perception. Nyaya
thus objects to the incorporation of sabda (testimony) or upamana
within inference, on the ground that since the mode of produc
tion of knowledge is different, these are to be held as different
pramanas 1 .
Perception (Pratyaksa).
The naiyayikas admitted only the five cognitive senses which
they believed to be composed of one or other of the five elements.
These senses could each come in contact with the special charac
teristic of that element of which they were composed. Thus the
ear could perceive sound, because sound was the attribute of
akasa, of which the auditory sense, the ear, was made up. The
eye could send forth rays to receive the colour, etc., of things.
Thus the cognitive senses can only manifest their specific objects
by going over to them and thereby coming in contact with them.
The conative senses (vdk,pdm,pdda,p&yu, and w/tfj^z) recognized
in Samkhya as separate senses are not recognized here as such
for the functions of these so-called senses are discharged by the
general motor functions of the body.
Perception is defined as that right knowledge generated by the
contact of the senses with the object, devoid of doubt and error
not associated with any other simultaneous sound cognition (such
VI. i. i, and vi. i. 3, to mean that the validity of the Vedas depends upon the trust
worthy character of their author, he does not consider scriptures as valid in themselves.
Their validity is only derived by inference from the trustworthy character of their author.
Arthdpatti (implication) and anupalabdhi (non-perception) are also classed as inference
and upamana (analogy) and aitihya (tradition) are regarded as being the same as faith
in trustworthy persons and hence cases of inference.
1 Sdmagribheddt phalabheddcca pramdnabhedah
Anye eva hi sdmagrtphale pratyaksalingayok
Anye eva ca sdmagriphale fabdopamdnayoh. Nyayamanjari, p. 33.
334 The Ny ay a- Vai^esika Philosophy [CH.
as the name of the object as heard from a person uttering it, just
at the time when the object is seen) or name association, and de
terminate 1 . If when we see a cow, a man says here is a cow, the
knowledge of the sound as associated with the percept cannot be
counted as perception but as sound-knowledge (Sabda-pramdna).
That right knowledge which is generated directly by the contact
of the senses with the object is said to be the product of the
perceptual process. Perception may be divided as indeterminate
(nirvikalpa) and (savikalpd) determinate. Indeterminate percep
tion is that in which the thing is taken at the very first moment of
perception in which it appears without any association with name.
Determinate perception takes place after the indeterminate stage
is just passed; it reveals things as being endowed with all charac
teristics and qualities and names just as we find in all our concrete
experience. Indeterminate perception reveals the things with their
characteristics and universals, but at this stage there being no
association of name it is more or less indistinct. When once the
names are connected with the percept it forms the determinate
perception of a thing called savikalpa-pratyaksa. If at the time
of having the perception of a thing of which the name is not known
to me anybody utters its name then the hearing of that should
be regarded as a separate auditory name perception. Only that
product is said to constitute nirvikalpa perception which results
from the perceiving process of the contact of the senses with
the object. Of this nirvikalpa (indeterminate) perception it is
held by the later naiyayikas that we are not conscious of it
directly, but yet it has to be admitted as a necessary first
stage without which the determinate consciousness could not
arise. The indeterminate perception is regarded as the first stage
in the process of perception. At the second stage it joins the
other conditions of perception in producing the determinate per
ception. The contact of the sense with the object is regarded
as being of six kinds: (i) contact with the dravya (thing) called
samyoga, (2) contact with the gunas (qualities) through the thing
(samyukta-samavdya) in which they inhere in samavaya (insepar
able) relation, (3) contact with the gunas (such as colour etc.) in
the generic character as universals of those qualities.e.g. colourness
(rupatva), which inhere in the gunas in the samavaya relation.
1 Ganges^, a later naiyayika of great reputation, describes perception as immediate
awareness (pratyaksasya saksatkaritvani laksanam ).
vm] Sense-contact and Perception 335
This species of contact is called samyukta-samaveta-samavaya,
for the eye is in contact with the thing, in the thing the colour
is in samavaya relation, and in the specific colour there is the
colour universal or the generic character of colour in samavaya
relation. (4) There is another kind of contact called samavaya
by which sounds are said to be perceived by the ear. The auditory
sense is akasa and the sound exists in akasa in the samavaya
relation, and thus the auditory sense can perceive sound in a pe
culiar kind of contact called samaveta-samavaya. (5) Thegeneric
character of sound as the universal of sound (sabdatva) is perceived
by the kind of contact known as samaveta-samavaya. (6) There is
another kind of contact by which negation (abhava) is perceived,
namely samyukta visesana (as qualifying contact). This is so
called because the eye perceives only the empty space which is
qualified by the absence of an object and through it the negation.
Thus I see that there is no jug here on the ground. My eye in
this case is in touch with the ground and the absence of the jug
is only a kind of quality 6f the ground which is perceived along
with the perception of the empty ground. It will thus be seen
that Nyaya admits not only the substances and qualities but all
kinds of relations as real and existing and as being directly
apprehended by perception (so far as they are directly presented).
The most important thing about the Nyaya- Vaisesika theory
of perception is this that the whole process beginning from the
contact of the sense with the object to the distinct and clear per
ception of the thing, sometimes involving the appreciation of its
usefulness or harmfulness, is regarded as the process of percep
tion and its result perception. The self, the mind, the senses and
the objects are the main factors by the particular kinds of contact
between which perceptual knowledge is produced. All know
ledge is indeed arthaprakdsa, revelation of objects, and it is called
perception when the sense factors are the instruments of its
production and the knowledge produced is of the objects with
which the senses are in contact. The contact of the senses with
the objects is not in any sense metaphorical but actual. Not
only in the case of touch and taste are the senses in contact with
the objects, but in the cases of sight, hearing and smell as well.
The senses according to Nyaya- Vaisesika are material and we have
seen that the system does not admit of any other kind of trans
cendental (atindriya) power (sakti) than that of actual vibratory
336 The Ny ay a- Vaitesika Philosophy [CH.
movement which is within the purview of sense-cognition 1 .
The production of knowledge is thus no transcendental occur
rence, but is one which is similar to the effects produced by
the conglomeration and movements of physical causes. When
I perceive an orange, my visual or the tactual sense is in touch
not only with its specific colour, or hardness, but also with the
universals associated with them in a relation of inherence and also
with the object itself of which the colour etc. are predicated. The
result of this sense-contact at the first stage is called dlocana-
jndna (sense-cognition) and as a result of that there is roused the
memory of its previous taste and a sense of pleasurable character
(sukhasddhanatvasmrti} and as a result of that I perceive the
orange before me to have a certain pleasure-giving character 2 .
It is urged that this appreciation of the orange as a pleasurable
object should also be regarded as a direct result of perception
through the action of the memory operating as a concomitant
cause (sahakari). I perceive the orange with the eye and under
stand the pleasure it will give, by the mind, and thereupon
understand by the mind that it is a pleasurable object. So though
this perception results immediately by the operation of the mind,
yet since it could only happen in association with sense-contact,
it must be considered as a subsidiary effect of sense-contact and
hence regarded as visual perception. Whatever may be the succes
sive intermediary processes, if the knowledge is a result of sense-
contact and if it appertains to the object with which the sense is
in contact, we should regard it as a result of the perceptual pro
cess. Sense-contact with the object is thus the primary and indis
pensable condition of all perceptions and not only can the senses
be in contact with the objects, their qualities, and the universals
associated with them but also with negation. A perception is
erroneous when it presents an object in a character which it does
not possess (atasmimstaditi) and right knowledge (pramd} is that
which presents an object with a character which it really has
Na khalvatindriya Saktirasmabhirupagamyate
yayd saha no. kdryyasya sambandhajftanasambhavah,
Nyayamanjari, p. 69.
Sukhadi manasa buddhvd kapitthadi ca caksusd
tasya karanatd tatra manasaivdvagamyate . . .
. . . Sambandhagrahanakale yattatkapitthadivisayamaksajam
jfianam tadupadeyadijnanaphalamiti bhdsyakrtatcetasi sthitam
sukhasadhanatvajndnamupadeyajndnani.
Ny&yamanjart, pp. 69-70; see also pp. 66-71.
vm] Nature of Illusion 337
(tadvati tatprakdrakdnubhava)*. In all cases of perceptual illu
sion the sense is in real contact with the right object, but it is
only on account of the presence of certain other conditions that
it is associated with wrong characteristics or misapprehended as
a different object. Thus when the sun s rays are perceived in a
desert and misapprehended as a stream, at the first indeterminate
stage the visual sense is in real contact with the rays and thus
far there is no illusion so far as the contact with a real object is
concerned, but at the second determinate stage it is owing to the
similarity of certain of its characteristics with those of a stream
that it is misapprehended as a stream 2 . Jayanta observes that on
account of the presence of the defect of the organs or the rousing
of the memory of similar objects, the object with which the sense
is in contact hides its own characteristics and appears with the
characteristics of other objects and this is what is meant by
illusion 8 . In the case of mental delusions however there is no
sense-contact with any object and the rousing of irrelevant
memories is sufficient to produce illusory notions 4 . This doctrine
of illusion is known as viparitakhydti or anyathdkhydti. What
existed in the mind appeared as the object before us (hrdaye
parisphuratd rthasya bahiravabhdsanam)*. Later Vaisesika as
interpreted by Prasastapada and Sridhara is in full agreement
with Nyaya in this doctrine of illusion (bhrama or as Vaisesika
calls it viparyaya) that the object of illusion is always the right
thing with which the sense is in contact and that the illusion
consists in the imposition of wrong characteristics 6 .
I have pointed out above that Nyaya divided perception into
two classes as nirvikalpa (indeterminate) and savikalpa (deter
minate) according as it is an earlier or a later stage. Vacaspati
says, that at the first stage perception reveals an object as a
particular; the perception of an orange at this avikalpika or nir-
vikalpika stage gives us indeed all its colour, form, and also the
universal of orangeness associated with it, but it does not reveal
1 See Udyotakara s Nydyavdrttika, p. 37, and Ganger s Tattvacintdmani, p. 401,
Bibliotheca Indica.
2 " Indriyenalocya maricin iuca.vacamuccal.ato nirvikaipena grhitva pafcattatro
paghatadosat viparyycti, savikalpakd sya pratyayo bhranto jayate tasmddvijttanasya
vvabhicaro narthasya, Vacaspati s Tatparyatfkd," p. 87.
3 Nydyamanjari, p. 88. * Jbid. pp. 89 and, 184. & Ibid. p. 184.
6 Nyayakandalt, pp. 177-181, " Suktisamyuktenettdriyena dosasahakdrina rajata-
samskdrasacivena sddrSyatnanurundhatd fuktikavisayo rajatadhyavasayah krtak"
D. 22
338 The Nyaya-Vaifesika Philosophy [CH.
it in a subject-predicate relation as when I say "this is an orange."
The avikalpika stage thus reveals the universal associated with
the particular, but as there is no association of name at this stage,
the universal and the particular are taken in one sweep and not
as terms of relation as subject and predicate or substance and
attribute (jdtyddisvarupdvagdhi na tu jdtyddlndm mitho visesana-
visesyabhdvdvagdhiti y&vaty. He thinks that such a stage, when
the object is only seen but not associated with name or a subject-
predicate relation, can be distinguished in perception not only in
the case of infants or dumb persons that do not know the names
of things, but also in the case of all ordinary persons, for the
association of the names and relations could be distinguished
as occurring at a succeeding stage*. Sridhara, in explaining the
VaiSesika view, seems to be largely in agreement with the above
view of Vacaspati. Thus Sridhara says that in the nirvikalpa stage
not only the universals were perceived but the differences as well.
But as at this stage there is no memory of other things, there is no
manifest differentiation and unification such as can only result
by comparison. But the differences and the universals as they
are in the thing are perceived, only they are not consciously
ordered as "different from this" or "similar to this," which can
only take place at the savikalpa stage 8 . Vacaspati did not
bring in the question of comparison with others, but had only
spoken of the determinate notion of the thing in definite subject-
predicate relation in association with names. The later Nyaya
writers however, following Gahgesa, hold an altogether dif
ferent opinion on the subject. With them nirvikalpa knowledge
means the knowledge of mere predication without any associa
tion with the subject or the thing to which the predicate refers.
But such a knowledge is never testified by experience. The nir
vikalpa stage is thus a logical stage in the development of per
ceptual cognition and not a psychological stage. They would
1 Tdtparyattkd, p. 82, also ibid. p. 91, " prathamamalocitd rthah samanyavifesa-
vdn."
2 Ibid. p. 84, " tasmddvyutpannasydpi ndmadheyasmarandya purvamesitavyo vi-
naiva ndmadheyamarthapratyayah"
3 Nyayakandah , p. 189 ff., " atah savikalpakamicchatd nirvfkalpakamapyesitavyam,
tacca na sdmdnyamdtram grhndti bhedasydpi pratibhdsandt ndpi svalaksanamdtram
sdmdnydkdrasydpi samvedandt vyaktyantaradarfane pratisandhdndcca, kintu sdmdn-
yam vifesancobhayamapi grhndti yadi paramidam sdmdnyamayam vi/esaA ityevam
vivicya na pratyeti vastvantardnusandhdnavirahdt, pinddntardnuvrttigrahandddhi
sdmdnyam vivicyate, vydvrttigrahanddvifesoyamiti vivekah."
vm] Indeterminate Perception 339
not like to dispense with it for they think that it is impossible
to have the knowledge of a thing as qualified by a predicate or a
quality, without previously knowing the quality or the predicate
(visistavaisistyajndnam prati hi visesanatdvacchedakaprakdram
jndnam kdranam) 1 . So, before any determinate knowledge such
as "I see a cow," "this is a cow" or "a cow" can arise it must
be preceded by an indeterminate stage presenting only the
indeterminate, unrelated, predicative quality as nirvikalpa, un
connected with universality or any other relations (jdtyddiyo-
jandrahitam vaisistydnavagdhi nisprakdrakam nirvikalpakam)*-
But this stage is never psychologically experienced (atlndriya)
and it is only a logical necessity arising out of their synthetic
conception of a proposition as being the relationing of a pre
dicate with a subject. Thus VisVanatha says in his Siddhanta-
muktavall, "the cognition which does not involve relationing
cannot be perceptual for the perception is of the form I know
the jug ; here the knowledge is related to the self, the knower,
the jug again is related to knowledge and the definite content of
jugness is related to the jug. It is this content which forms the
predicative quality (visesanatdvacchedakd) of the predicate jug
which is related to knowledge. We cannot therefore have the
knowledge of the jug without having the knowledge of the pre
dicative quality, the content 3 ." But in order that the knowledge
of the jug could be rendered possible, there must be a stage at
which the universal or the pure predication should be known
and this is the nirvikalpa stage, the admission of which though
not testified by experience is after all logically indispensably
necessary. In the proposition "It is a cow," the cow is an
universal, and this must be intuited directly before it could be
related to the particular with which it is associated.
But both the old and the new schools of Nyaya and Vai-
Sesika admitted the validity of the savikalpa perception which
the Buddhists denied. Things are not of the nature of momentary
particulars, but they are endowed with class-characters or uni-
versals and thus our knowledge of universals as revealed by the
perception of objects is not erroneous and is directly produced
by objects. The Buddhists hold that the error of savikalpa per
ception consists in the attribution ofjati(universal),guna (quality),
1 Tattvacintamani, p. 8n. 2 Ibid. p. 809.
3 Siddhantamuktavali on Bhasapariccheda kdrika, 58.
22 2
340 The Nyaya - Vaitesika Philosophy [CH.
kriya (action), nama (name), and dravya (substance) to things 1 .
The universal and that of which the universal is predicated are
not different but are the same identical entity. Thus the predi
cation of an universal in the savikalpa perception involves the
false creation of a difference where there was none. So also the
quality is not different from the substance and to speak of a
thing as qualified is thus an error similar to the former. The
same remark applies to action, for motion is not something dif
ferent from that which moves. But name is completely different
from the thing and yet the name and the thing are identified,
and again the percept "man with a stick" is regarded as if it
was a single thing or substance, though "man" and "stick" are
altogether different and there is no unity between them. Now
as regards the first three objections it is a question of the dif
ference of the Nyaya ontological position with that of the Bud
dhists, for we know that Nyaya and Vaiesika believe jati, guna
and kriya to be different from substance and therefore the pre
dicating of them of substance as different categories related to it
at the determinate stage of perception cannot be regarded as
erroneous. As to the fourth objection Vacaspati replies that the
memory of the name of the thing roused by its sight cannot make
the perception erroneous. The fact that memory operates cannot
in any way vitiate perception. The fact that name is not asso
ciated until the second stage through the joint action of memory
is easily explained, for the operation of memory was necessary in
order to bring about the association. But so long as it is borne in
mind that the name is not identical with the thing but is only asso
ciated with it as being the same as was previously acquired, there
cannot be any objection to the association of the name. But the
Buddhists further object that there is no reascn why one should
identify a thing seen at the present moment as being that which
was seen before, for this identity is never the object of visual
perception. To this Vacaspati says that through the help of
memory or past impressions (samskdrd) this can be considered
as being directly the object of perception, for whatever may be
the concomitant causes when the main cause of sense-contact is
1 Nyayamanjarz, pp. 93-100, "Panca caite kalpana bhavanti jatikalpana, gunakal-
pana, kriydkalpand, n&makalpana dravyakalpana ceti, taSca kvacidabhede pi bhedakal-
panat kvacicca bhede pyabhedakalpanat kalpana ucy ante." See Dharmakirtti s theory of
Perception, pp. 151-4. See also pp. 409-410 of this book.
vin] Transcendental Contact 341
present, this perception of identity should be regarded as an
effect of it. But the Buddhists still emphasize the point that an
object of past experience refers to a past time and place and
is not experienced now and cannot therefore be identified with
an object which is experienced at the present moment. It
has to be admitted that Vacaspati s answer is not very satis
factory for it leads ultimately to the testimony of direct percep
tion which was challenged by the Buddhists 1 . It is easy to see
that early Nyaya- Vaisesika could not dismiss the savikalpa per
ception as invalid for it was the same as the nirvikalpa and
differed from it only in this, that a name was associated with
the thing of perception at this stage. As it admits a gradual
development of perception as the progressive effects of causal
operations continued through the contacts of the mind with the
self and the object under the influence of various intellectual
(e.g. memory) and physical (e.g. light rays) concomitant causes,
it does not, like Vedanta, require that right perception should only
give knowledge which was not previously acquired. The varia
tion as well as production of knowledge in the soul depends upon
the variety of causal collocations.
Mind according to Nyaya is regarded as a separate sense
and can come in contact with pleasure, pain, desire, antipathy
and will. The later Nyaya writers speak of three other kinds
of contact of a transcendental nature called sdmdnyalaksana,
jndnalaksana and yogaja (miraculous). The contact samanyalak-
sana is that by virtue of which by coming in contact with a
particular we are transcendentally (alaukika) in contact with all
the particulars (in a general way) of which the correspond
ing universal may be predicated. Thus when I see smoke and
through it my sense is in contact with the universal associated
with smoke my visual sense is in transcendental contact with all
smoke in general. Jftanalaksana contact is that by virtue of which
we can associate the perceptions of other senses when perceiving
by any one sense. Thus when we are looking at a piece of
sandal wood our visual sense is in touch with its colour only,
but still we perceive it to be fragrant without any direct contact
of the object with the organ of smell. The sort of transcendental
contact (alaukika sannikarsa) by virtue of which this is rendered
1 Tatparyatika, pp. 88-95.
34 2 The Nyaya -Vaisesika Philosophy [CH.
possible is called jfianalaksana. But the knowledge acquired by
these two contacts is not counted as perception 1 .
Pleasures and pains (sukha and duhkha) are held by Nyaya
to be different from knowledge (jflana). For knowledge interprets,
conceives or illumines things, but sukha etc. are never found to
appear as behaving in that character. On the other hand we feel
that we grasp them after having some knowledge. They cannot
be self-revealing, for even knowledge is not so; if it were so, then
that experience which generates sukha in one should have gene
rated the same kind of feeling in others, or in other words it should
have manifested its nature as sukha to all; and this does not
happen, for the same thing which generates sukha in one might
not do so in others. Moreover even admitting for argument s
sake that it is knowledge itself that appears as pleasure and pain,
it is evident that there must be some differences between the
pleasurable and painful experiences that make them so different,
and this difference is due to the fact that knowledge in one case
was associated with sukha and in another case with duhkha.
This shows that sukha and duhkha are not themselves knowledge.
Such is the course of things that sukha and duhkha are generated
by the collocation of certain conditions,and are manifested through
or in association with other objects either in direct perception or
in memory. They are thus the qualities which are generated in
the self as a result of causal operation. It should however be
remembered that merit and demerit act as concomitant causes
in their production.
The yogins are believed to have the pratyaksa of the most
distant things beyond our senses ; they can acquire this power
by gradually increasing their powers of concentration and per
ceive the subtlest and most distant objects directly by their
mind. Even we ourselves may at some time have the notions
of future events which come to be true, e.g. sometimes I may
have the intuition that "To-morrow my brother will come,"
1 Siddhdntamuktavali on Kdrika 63 and 64. We must remember that Ganges"a
discarded the definition of perception as given in the Nyaya sutra which we have dis
cussed above, and held that perception should be denned as that cognition which has
the special class-character of direct apprehension. He thinks that the old definition
of perception as the cognition generated by sense-contact involves a vicious circle
(Tattvacint&mani, pp. 538-546). Sense-contact is still regarded by him as the cause of
perception, but it should not be included in the definition. He agrees to the six kinds
of contact described first by Udyotakara as mentioned above.
vm] Inference 343
and this may happen to be true. This is called pratibhana-
jftana, which is also to be regarded as a pratyaksa directly
by the mind. This is of course different from the other form
of perception called manasa-pratyaksa, by which memories of
past perceptions by other senses are associated with a percept
visualized at the present moment ; thus we see a rose and per
ceive that it is fragrant ; the fragrance is not perceived by the
eye, but the manas perceives it directly and associates the visual
percept with it. According to Vedanta this acquired perception
is only a case of inference. The pratibha-pratyaksa however is
that which is with reference to the happening of a future event.
When a cognition is produced, it is produced only as an objective
cognition, e.g. This is a pot, but after this it is again related to
the self by the mind as " I know this pot." This is effected by
the mind again coming in contact for reperception of the cogni
tion which had already been generated in the soul. This second
reperception is called anuvyavasaya, and all practical work can
proceed as a result of this anuvyavasaya 1 .
Inference.
Inference (anumdnd) is the second means of proof (pramana)
and the most valuable contribution that Nyaya has made has
been on this subject. It consists in making an assertion about a
thing on the strength of the mark or liriga which is associated
with it, as when finding smoke rising from a hill we remember
that since smoke cannot be without fire, there must also be fire
in yonder hill. In an example like this smoke is technically
called liriga, or hetu. That about which the assertion has been
made (the hill in this example) is called paksa, and the term
"fire" is called sadhya. To make a correct inference it is
necessary that the hetu or liriga must be present in the paksa,
1 This later Nyaya doctrine that the cognition of self in association with cognition is
produced at a later moment must be contrasted with the triputipratyaksa doctrine of
Prabhakara, which holds that the object, knower and knowledge are all given simul
taneously in knowledge. Vyavasaya (determinate cognition), according to Ganges^,
gives us only the cognition of the object, but the cognition that I am aware of this
object or cognition is a different functioning succeeding the former one and is called
anu (after) vyavasaya (cognition), "idamaham janamiti vyavasaye na bhasate tad-
bodhakendriyasannikarsabhavat kintvidamvisayakajnanatvaviiistasya jnanasya vai-
hstyamatmani bhasate; na ca svaprakase vyavasaye t&Jrsam svasya vaihstyam bha-
silumarhati,purvam visesanasya tasyajnanat, tasmadidamahamjananiiiinavyavasayah
kintu anuvyavasayah." Tattvacintamant , p. 795.
344 The Nyaya- Vaitesika Philosophy [CH.
and in all other known objects similar to the paksa in having the
sadhya in it (sapaksa-satta), i.e., which are known to possess the
sadhya (possessing fire in the present example). The liriga must
not be present in any such object as does not possess the
sadhya (vipaksa-vydvrtti absent from vipaksa or that which does
not possess the sadhya). The inferred assertion should not be
such that it is invalidated by direct perception (pratyaksa) or
the testimony of the sastra (abddhita-visayatvd). The lihga
should not be such that by it an inference in the opposite way
could also be possible (asat-pratipaksa). The violation of any
one of these conditions would spoil the certitude of the hetu
as determining the inference, and thus would only make the
hetu fallacious, or what is technically called hetvabhasa or
seeming hetu by which no correct inference could be made.
Thus the inference that sound is eternal because it is visible
is fallacious, for visibility is a quality which sound (here the
paksa) does not possess 1 . This hetvabhasa is technically
called asiddha-hetu. Again, hetvabhasa of the second type,
technically called viruddha-hetu, may be exemplified in the case
that sound is eternal, since it is created ; the hetu " being
created " is present in the opposite of sadhya (vipaksa), namely
non-eternality, for we know that non-eternality is a quality
which belongs to all created things. A fallacy of the third type,
technically called anaikdntika-hetu> is found in the case that
sound is eternal, since it is an object of knowledge. Now " being
an object of knowledge " (prameyatva) is here the hetu, but it is
present in things eternal (i.e. things possessing sadhya), as well
as in things that are not eternal (i.e. which do not possess the
sadhya), and therefore the concomitance of the hetu with the
sadhya is not absolute (anaikdntika). A fallacy of the fourth
type, technically called kdldtyaydpadi$ta, may be found in the
example fire is not hot, since it is created like a jug, etc.
Here pratyaksa shows that fire is hot, and hence the hetu is
fallacious. The fifth fallacy, called prakaranasama, is to be
found in cases where opposite hetus are available at the same
time for opposite conclusions, e.g. sound like a jug is non-
1 It should be borne in mind that Nyaya did not believe in the doctrine of the
eternality of sound, which the Mimamsa did. Eternality of sound meant with Mimamsa
the theory that sounds existed as eternal indestructible entities, and they were only
manifested in our ears under certain conditions, e.g. the stroke of a drum or a
particular kind of movement of the vocal muscles.
vin] Nyaya and Buddhism on Causation 345
eternal, since no eternal qualities are found in it, and sound like
akas"a is eternal, since no non-eternal qualities are found in it.
The Buddhists held in answer to the objections raised against
inference by the Carvakas, that inferential arguments are
valid, because they are arguments on the principle of the uni
formity of nature in two relations, viz. tdddtmya (essential
identity) and tadutpatti (succession in a relation of cause and
effect). Tadatmya is a relation of genus and species and not
of causation ; thus we know that all pines are trees, and infer
that this is a tree since it is a pine; tree and pine are related
to each other as genus and species, and the co-inherence of
the generic qualities of a tree with the specific characters of a
pine tree may be viewed as a relation of essential identity
(tdddtmya). The relation of tadutpatti is that of uniformity of
succession of cause and effect, e.g. of smoke to fire.
Nyaya holds that inference is made because of the invariable
association (niyamd) of the liriga or hetu (the concomitance of
which with the sadhya has been safeguarded by the five conditions
noted above) with the sadhya, and not because of such specific
relations as tadatmya or tadutpatti. If it is held that the
inference that it is a tree because it is a pine is due to the
essential identity of tree and pine, then the opposite argument
that it is a pine because it is a tree ought to be valid as well;
for if it were a case of identity it ought to be the same both
ways. If in answer to this it is said that the characteristics of a
pine are associated with those of a tree and not those of a tree with
those of a pine, then certainly the argument is not due to essen
tial identity, but to the invariable association of the liriga (mark)
with the lihgin (the possessor of liriga), otherwise called niyama.
The argument from tadutpatti (association as cause and effect)
is also really due to invariable association, for it explains the
case of the inference of the type of cause and effect as well as of
other types of inference, where the association as cause and
effect is not available (e.g. from sunset the rise of stars is
inferred). Thus it is that the invariable concomitance of the
liriga with the lirigin, as safeguarded by the conditions noted
above, is" what leads us to make a valid inference 1 .
We perceived in many cases that a liriga (e.g. smoke) was
associated with a lirigin (fire), and had thence formed the notion
1 See Nyayamanjarl on anumana.
346 The Ny ay a- Vaitesika Philosophy [CH.
that wherever there was smoke there was fire. Now when we
perceived that there was smoke in yonder hill, we remembered
the concomitance (yyapti} of smoke and fire which we had
observed before, and then since there was smoke in the hill,
which was known to us to be inseparably connected with fire, we
concluded that there was fire in the hill. The discovery of the
liriga (smoke) in the hill as associated with the memory of its
concomitance with fire (trtlya-lihga-pardmarsd) is thus the cause
(anumitikarana or anumdnd) of the inference (anumiti). The con
comitance of smoke with fire is technically called vyaptt. When
this refers to the concomitance of cases containing smoke with
those having fire, it is called bahirvydpti\ and when it refers to the
conviction of the concomitance of smoke with fire, without any
relation to the circumstances under which the concomitance was
observed, it is called antarvydpti. The Buddhists since they did
not admit the notions of generality, etc. preferred antarvyapti
view of concomitance to bahirvyapti as a means of inference 1 .
Now the question arises that since the validity of an inference
will depend mainly on the validity of the concomitance of sign
(hetu} with the signate (sddkya), how are we to assure ourselves in
each case that the process of ascertaining the concomitance (vydp-
tigraha) had been correct, and the observation of concomitance
had been valid. The Mlmamsa school held, as we shall see in
the next chapter, that if we had no knowledge of any such case
in which there was smoke but no fire, and if in all the cases
I knew I had perceived that wherever there was smoke there
was fire, I could enunciate the concomitance of smoke with fire.
But Nyaya holds that it is not enough that in all cases where
there is smoke there should be fire, but it is necessary that in
all those cases where there is no fire there should not be any
smoke, i.e. not only every case of the existence of smoke should
be a case of the existence of fire, but every case of absence of fire
should be a case of absence of smoke. The former is technically
called anvayavydpti and the latter vyatirekavydptt. But even this
is not enough. Thus there may have been an ass sitting, in a
hundred cases where I had seen smoke, and there might have
been a hundred cases where there was neither ass nor smoke, but
it cannot be asserted from it that there is any relation of concomi-
1 See Antarvyaptisamarthana, by Ratnakaraanti in the Six Buddhist Nyaya Tracts,
Bibliothtca Indica, 1910.
vin] Invariable Unconditional Concomitance 347
tance, or of cause and effect between the ass and the smoke. It
may be that one might never have observed smoke without an
antecedent ass, or an ass without the smoke following it, but even
that is not enough. If it were such that we had so experienced in
a very large number of cases that the introduction of the ass
produced the smoke, and that even when all the antecedents re
mained the same, the disappearance of the ass was immediately
followed by the disappearance of smoke (yasmin sati bttavanam
yato vind na bhavanam iti bhuyodarsanam> Nydyamanjari,
p. 122), then only could we say that there was any relation of
concomitance (yydptt) between the ass and the smoke 1 . But of
course it might be that what we concluded to be the hetu by the
above observations of anvaya-vyatireka might not be a real hetu,
and there might be some other condition (upddhi) associated
with the hetu which was the real hetu. Thus we know that fire
in green wood (ardrendhand) produced smoke, but one might
doubt that it was not the fire in the green wood that pro
duced smoke, but there was some hidden demon who did it.
But there would be no end of such doubts, and if we indulged
in them, all our work endeavour and practical activities would
have to be dispensed with (vydghdtd). Thus such doubts as
lead us to the suspension of all work should not disturb or
unsettle the notion of vyapti or concomitance at which we
had arrived by careful observation and consideration 2 . The
Buddhists and the naiyayikas generally agreed as to the method
of forming the notion of concomitance or vyapti (vydptigrahd),
but the former tried to assert that the validity of such a con
comitance always depended on a relation of cause and effect
or of identity of essence, whereas Nyaya held that neither the
relations of cause and effect, nor that of essential identity of
genus and species, exhausted the field of inference, and there was
quite a number of other types of inference which could not be
brought under either of them (e.g. the rise of the moon and the
tide of the ocean). A natural fixed order that certain things hap
pening other things would happen could certainly exist, even
without the supposition of an identity of essence.
But sometimes it happens that different kinds of causes often
have the same kind of effect, and in such cases it is difficult to
1 See Tatparyatika on anumana and vyaptigraha.
z Tatparyatika on vyaptigraha, and Tattvacintamani of Gaiigea on vyaptigraha.
348 The Ny ay a- Vaitesika Philosophy [CH.
infer the particular cause from the effect. Nyaya holds how
ever that though different causes are often found to produce
the same effect, yet there must be some difference between one
effect and another. If each effect is taken by itself with its
other attendant circumstances and peculiarities, it will be found
that it may then be possible to distinguish it from similar other
effects. Thus a flood in the street may be due either to a heavy
downpour of rain immediately before, or to the rise in the water
of the river close by, but if observed carefully the flooding of
the street due to rain will be found to have such special traits
that it could be distinguished from a similar flooding due to the
rise of water in the river. Thus from the flooding of the street
of a special type, as demonstrated by its other attendant circum
stances, the special manner in which the water flows by small
rivulets or in sheets, will enable us to infer that the flood was
due to rains and not to the rise of water in the river. Thus we
see that Nyaya relied on empirical induction based on uniform
and uninterrupted agreement in nature, whereas the Buddhists
assumed a priori principles of causality or identity of essence.
It may not be out of place here to mention that in later Nyaya
works great emphasis is laid on the necessity of getting ourselves
assured that there was no such upadhi (condition) associated with
the hetu on account of which the concomitance happened, but
that the hetu was unconditionally associated with the sadhya in
a relation of inseparable concomitance. Thus all fire does not pro
duce smoke ; fire must be associated with green wood in order to
produce smoke. Green wood is thus the necessary condition
(upddht) without which no smoke could be produced. It is on
account of this condition that fire is associated with smoke; and
so we cannot say that there is smoke because there is fire. But in
the concomitance of smoke with fire there is no condition, and so
in every case of smoke there is fire. In order to be assured of the
validity of vyapti, it is necessary that we must be assured that
there should be nothing associated with the hetu which con
ditioned the concomitance, and this must be settled by wide
experience (bhuyodarsand).
Prasastapada in defining inference as the " knowledge of that
(e.g. fire) associated with the reason (e.g. smoke) by the sight of
the reason" described a valid reason (lingo) as that which is con
nected with the object of inference (anumeya) and which exists
wherever the object of inference exists and is absent in all cases
vm] Pra^astapada s Interpretation of Inference 349
where it does not exist. This is indeed the same as the Nyaya
qualifications of paksasattva, sapaksasattva and vipaksdsattva of
a valid reason (hetu). Praastapada further quotes a verse to say
that this is the same as what Kasyapa (believed to be the family
name of Kanada) said. Kanada says that we can infer a cause
from the effect, the effect from the cause, or we can infer one
thing by another when they are mutually connected, or in op
position or in a relation of inherence (ix. ii. i and III. i. 9). We
can infer by a reason because it is duly associated (prasiddhipur-
vakatvd) with the object of inference. What this association was
according to Kanada can also be understood for he tells us (ill.
i. 15) that where there is no proper association, the reason (hetu)
is either non-existent in the object to be inferred or it has no
concomitance with it (aprasiddhd) or it has a doubtful existence
(sandigdha). Thus if I say this ass is a horse because it has
horns it is fallacious, for neither the horse nor the ass has horns.
Again if I say it is a cow because it has horns, it is fallacious, for
there is no concomitance between horns and a cow, and though
a cow may have a horn, all that have horns are not cows. The
first fallacy is a combination of paksasattva and sapaksasattva,
for not only the present paksa (the ass) had no horns, but no
horses had any horns, and the second is a case of vipaksasattva,
for those which are not cows (e.g. buffaloes) have also horns. Thus,
it seems that when PraSastapada says that he is giving us the view
of Kanada he is faithful to it. Praastapada says that wherever
there is smoke there is fire, if there is no fire there is no smoke.
When one knows this concomitance and unerringly perceives the
smoke, he remembers the concomitance and feels certain that
there is fire. But with regard to Kanada s enumeration of types of
inference such as " a cause is inferred from its effect, or an effect
from the cause," etc., PraSastapada holds that these are not the
only types of inference, but are only some examples for showing
the general nature of inference. Inference merely shows a connec
tion such that from this that can be inferred. He then divides
inference into two classes, drsta (from the experienced charac
teristics of one member of a class to z nother member of the same
class), and samanyato drsta. Drsta (perceived resemblance) is
that where the previously known case and the inferred case is
exactly of the same class. Thus as an example of it we can point
out that by perceiving that only a cow has a hanging mass of
flesh on its neck (sasna), I can whenever I see the same hanging
350 The Nyaya - Vaifesika Philosophy [CH.
mass of flesh at the neck of an animal infer that it is a cow. But
when on the strength of a common quality the inference is ex
tended to a different class of objects, it is called samanyato drsta.
Thus on perceiving that the work of the peasants is rewarded
with a good harvest I may infer that the work of the priests,
namely the performance of sacrifices, will also be rewarded with
the objects for which they are performed (i.e. the attainment of
heaven). When the conclusion to which one has arrived (svani-
scitdrthd) is expressed in five premisses for convincing others
who are either in doubt, or in error or are simply ignorant, then
the inference is called pararthanumana. We know that the distinc
tion of svarthanumana (inference for oneself) and pararthanumana
(inference for others) was made by the Jains and Buddhists.
Prasastapada does not make a sharp distinction of two classes
of inference, but he seems to mean that what one infers, it can be
conveyed to others by means of five premisses in which case it is
called pararthanumana. But this need not be considered as an
entirely new innovation of Prasastapada, for in IX. 2, Kanada
himself definitely alludes to this distinction (asyedam kdryyakdra-
nasambandhascdvayavddbhavati). The five premisses which are
called in Nyaya pratijnd, hetu drstdnta, upanaya, and nigamana
are called in Vaisesika/ratfz/wtf, apadesa, nidarsana, anusandhdna,
and pratydmndya. Kanada however does not mention the name
of any of these premisses excepting the second " apadesa."
Pratijfia is of course the same as we have in Nyaya, and the term
nidarsana is very similar to Nyaya drstanta, but the last two are
entirely different. Nidarsana may be of two kinds, (i) agreement
in presence (e.g. that which has motion is a substance as is seen
in the case of an arrow), (2) agreement in absence (e.g. what is not
a substance has no motion as is seen in the case of the universal
being 1 ). He also points out cases of the fallacy of the example
1 Dr Vidyabhusana says that "An example before the time of Dignaga served as
a mere familiar case which was cited to help the understanding of the listener, e.g. The
hill is fiery ; because it has smoke ; like a kitchen (example). Asahga made the ex
ample more serviceable to reasoning, but Dignaga converted it into a universal
proposition, that is a proposition expressive of the universal or inseparable connection
between the middle term and the major term, e.g. The hill is fiery ; because it has
smoke ; all that has smoke is fiery as a kitchen " {Indian Logic, pp. 95, 96). It is of
course true that Vatsyayana had an imperfect example as " like a kitchen " (fabdah
utpattidharmakatvadanityah sthdlyddivat, I. i. 36), but Pras"astapada has it in the
proper form. Whether Prasastapada borrowed it from Dirinaga or Dinnaga from
Prasastapada cannot be easily settled.
vm] Doctrine of Concomitance 351
(nidarsandbhdsd). Prasastapada s contribution thus seems to con
sist of the enumeration of the five premisses and the fallacy of
the nidarsana, but the names of the last two premisses are so
different from what are current in other systems that it is reason
able to suppose that he collected them from some other traditional
Vaisesika work which is now lost to us. It however definitely
indicates that the study of the problem of inference was being
pursued in Vaisesika circles independently of Nyaya. There is
no reason however to suppose that Prasastapada borrowed any
thing from Dirinaga as Professor Stcherbatsky or Keith supposes,
for, as I have shown above, most of Prasastapada s apparent in
novations are all definitely alluded to by Kanada himself, and
Professor Keith has not discussed this alternative. On the
question of the fallacies of nidarsana, unless it is definitely proved
that Dirinaga preceded Prasastapada, there is no reason whatever
to suppose that the latter borrowed it from the former 1 .
The nature and ascertainment of concomitance is the most
important part of inference. Vatsyayana says that an inference
can be made by the sight of the liriga (reason or middle) through
the memory of the connection between the middle and the major
previously perceived. Udyotakara raises the question whether it
is the present perception of the middle or the memory of the
connection of the middle with the major that should be regarded
as leading to inference. His answer is that both these lead to
inference, but that which immediately leads to inference is linga-
pardmarsa, i.e. the present perception of the middle in the minor
associated with the memory of its connection with the major, for
inference does not immediately follow the memory of the con
nection, but the present perception of the middle associated with
the memory of the connection (smrtyanugrhito lingapardmarso).
But he is silent with regard to the nature of concomitance.
Udyotakara s criticisms of Dirinaga as shown by Vacaspati have
no reference to this point. The doctrine of tdddtmya and tadut-
patti was therefore in all probability a new contribution to
Buddhist logic by Dharmaklrtti. Dharmaklrtti s contention was
that the root principle of the connection between the middle and
the major was that the former was either identical in essence
with the latter or its effect and that unless this was grasped a
mere collection of positive or negative instances will not give us
1 Prasastapada s bhasya with Nyayakandali, pp. 200-255.
352 The Ny ay a- Vaifesika Philosophy [CH.
the desired connection 1 . Vacaspati in his refutation of this view
says that the cause-effect relation cannot be determined as a
separate relation. If causality means invariable immediate ante
cedence such that there being fire there is smoke and there being
no fire there is no smoke, then it cannot be ascertained with
perfect satisfaction, for there is no proof that in each case the
smoke was caused by fire and not by an invisible demon. Unless
it can be ascertained that there was no invisible element as
sociated, it cannot be said that the smoke was immediately
preceded by fire and fire alone. Again accepting for the sake of
argument that causality can be determined, then also cause is
known to precede the effect and therefore the perception of smoke
can only lead us to infer the presence of fire at a preceding time
and not contemporaneously with it. Moreover there are many
cases where inference is possible, but there is no relation of cause
and effect or of identity of essence (e.g. the sunrise of this
morning by the sunrise of yesterday morning). In the case of
identity of essence (tdddtmya as in the case of the pine and the
tree) also there cannot be any inference, for one thing has to be
inferred by another, but if they are identical there cannot be any
inference. The nature of concomitance therefore cannot be de
scribed in either of these ways. Some things (e.g. smoke) are
naturally connected with some other things (e.g. fire) and when
such is the case, though we may not know any further about the
nature of this connection, we may infer the latter from the former
and not vice versa, for fire is connected with smoke only under
certain conditions (e.g. green wood). It may be argued that there
may always be certain unknown conditions which may vitiate
the validity of inference. To this Vacaspati s answer is that if
even after observing a large number of cases and careful search
such conditions (upddhi) cannot be discovered, we have to take
it for granted that they do not exist and that there is a natural
connection between the middle and the major. The later
Buddhists introduced the method of Pancakdranl in order to
determine effectively the causal relation. These five conditions
determining the causal relation are (i) neither the cause nor the
effect is perceived, (2) the cause is perceived, (3) in immediate
succession the effect is perceived, (4) the cause disappears, (5) in
1 Karyyakaranabhavadva svabhavadva niyamakat avinabhavaniyamo darsandnna
na darfanat. Tatparyatlka^. 105.
vm] Classification of Inference 353
immediate succession the effect disappears. But this method
cannot guarantee the infallibility of the determination of cause
and effect relation ; and if by the assumption of a cause-effect
relation no higher degree of certainty is available, it is better
to accept a natural relation without limiting it to a cause-effect
relation 1 .
In early Nyaya books three kinds of inference are described,
namely purvavat, sesavat, and samanyato-drsta. Purvavat is the
inference of effects from causes, e.g. that of impending rain from
heavy dark clouds ; Sesavat is the inference of causes from effects,
e.g. that of rain from the rise of water in the river ; samanyato-
drsta refers to the inference in all cases other than those of
cause and effect, e.g. the inference of the sour taste of the
tamarind from its form and colour. Nydyamanjari mentions
another form of anumana, namely pariesamana (reductio ad
absurdum), which consists in asserting anything (e.g. conscious
ness) of any other thing (e.g. atman), because it was already
definitely found out that consciousness was not produced in any
other part of man. Since consciousness could not belong to
anything else, it must belong to soul of necessity. In spite of
these variant forms they are all however of one kind, namely
that of the inference of the probandum (sddhya) by virtue of the
unconditional and invariable concomitance of the hetu, called
the vyapti-niyama. In the new school of Nyaya (Navya-Nyaya)
a formal distinction of three kinds of inference occupies an
important place, namely anvayavyatireki, kevalanvayi, and
kevalavyatireki. Anvayavyatireki is that inference where the
vyapti has been observed by a combination of a large number of
instances of agreement in presence and agreement in absence,
as in the case of the concomitance of smoke and fire (wherever
there is smoke there is fire (anvayd)^ and where there is no fire,
there is no smoke (vyatirekd)}. An inference could be for one s
own self (svdrthdnumdnd) or for the sake of convincing others
(pardrthdnumdna). In the latter case, when it was necessary that
an inference should be put explicitly in an unambiguous manner,
five propositions (avayavas) were regarded as necessary, namely
pratijfta (e.g. the hill is fiery), hetu (since it has smoke), uda-
harana (where there is smoke there is fire, as in the kitchen),
upanaya (this hill has smoke), nigamana (therefore it has got
1 Vatsyaya^ia s bhasya, Udyotakara s Varttika and Tatparyyatikd, I. i. 5.
D. 23
354 The Ny ay a- Vaifesika Philosophy [CH.
fire). Kevalanvayi is that type of inference, the vyapti of which
could not be based on any negative instance, as in the case
" this object has a name, since it is an object of knowledge
{idattt, vdcyani prameyatvdt)" Now no such case is known which
is not an object of knowledge ; we cannot therefore know of any
case where there was no object of knowledge (prameyatva) and
no name (yficyatva) ; the vyapti here has therefore to be based
necessarily on cases of agreement wherever there is prame-
yatva or an object of knowledge, there is vacyatva or name.
The third form of kevalavyatireki is that where positive in
stances in agreement cannot be found, such as in the case of the
inference that earth differs from other elements in possessing
the specific quality of smell, since all that does not differ from
other elements is not earth, such as water; here it is evident
that there cannot be any positive instance of agreement and the
concomitance has to be taken from negative instances. There
is only one instance, which is exactly the proposition of our
inference earth differs from other elements, since it has the
special qualities of earth. This inference could be of use only in
those cases where we had to infer anything by reason of such
special traits of it as was possessed by it and it alone.
Upamana and Sabda.
The third pramana, which is admitted by Nyaya and not by
VaiSesika, is upamana, and consists in associating a thing un
known before with its name by virtue of its similarity with some
other known thing. Thus a man of the city who has never
seen a wild ox (gavaya) goes to the forest, asks a forester
"what is gavaya?" and the forester replies "oh, you do not
know it, it is just like a cow"; after hearing this from the
forester he travels on, and on seeing a gavaya and finding it to
be similar to a cow he forms the opinion that this is a gavaya.
This knowing an hitherto unknown thing by virtue of its
similarity to a known thing is called upamana. If some forester
had pointed out a gavaya to a man of the city and had told him
that it was called a gavaya, then also the man would have
known the animal by the name gavaya, but then this would
have been due to testimony (sabda-pramdna). The knowledge is
said to be generated by the upamana process when the associa
tion of the unknown animal with its name is made by the observer
vm] Upamana and Sabda 355
on the strength of the experience of the similarity of the un
known animal to a known one. The naiyayikas are thorough
realists, and as such they do not regard the observation of
similarity as being due to any subjective process of the mind.
Similarity is indeed perceived by the visual sense but yet the
association of the name in accordance with the perception of
similarity and the instruction received is a separate act and is
called upamdncf.
abda-pramana or testimony is the right knowledge which
we derive from the utterances of infallible and absolutely truthful
persons. All knowledge derived from the Vedas is valid, for the
Vedas were uttered by ISvara himself. The Vedas give us
right knowledge not of itself, but because they came out as the
utterances of the infallible IsVara. The VaiSesikas did not admit
abda as a separate pramana, but they sought to establish the
validity of testimony (sabdd) on the strength of inference (anu-
miti) on the ground of its being the utterance of an infallible
person. But as I have said before, this explanation is hardly
corroborated by the Vaisesika sutras, which tacitly admit the
validity of the scriptures on its own authority. But anyhow this
was how Vaisesika was interpreted in later times.
Negation in Nyaya- Vaisesika.
The problem of negation or non-existence (abhdva) is of great
interest in Indian philosophy. In this section we can describe its
nature only from the point of view of perceptibility. Kumarila 1
1 See Nyayamanjari on upamana. The oldest Nyaya view was that the instruction
given by the forester by virtue of which the association of the name " wild ox" to the
strange animal was possible was itself "upamana." When PraSastapada held that upa
mana should be treated as a case of testimony (dptavacana), he had probably this inter
pretation in view. But Udyotakara and Vacaspati hold that it was not by the instruction
alone of the forester that the association of the name " wild ox " was made, but there
was the perception of similarity, and the memory of the instruction of the forester too.
So it is the perception of similarity with the other two factors as accessories that lead
us to this association called upamana. What Vatsyayana meant is not very clear, but
Dinnaga supposes that according to him the result of upamana was the knowledge of
similarity or the knowledge of a thing having similarity. Vacaspati of course holds that
he has correctly interpreted Vatsyayana s intention. It is however definite that upamana
means the associating of a name to a new object (sam&khyasambandhapratipattirupama-
ndrthah, Vatsyayana). Jayanta points out that it is the preception of similarity which
directly leads to the association of the name and hence the instruction of the forester
cannot be regarded as the direct cause and consequently it cannot be classed under
testimony (Sabda). See Pra^astapada and NydyakandaK, pp. 110-21, Vatsyayana,
Udyotakara, Vacaspati and Jayanta on Upamana.
2 See Rumania s treatment of abhava in the Slokavdrttika, pp. 473-493.
23 2
356 The Nyaya-Vaifesika Philosophy [CH.
and his followers, whose philosophy we shall deal with in the
next chapter, hold that negation (abhdvd) appears as an intuition
(mdnam) with reference to the object negated where there are no
means of ordinary cognition (pramdna) leading to prove the exist
ence (satparicchedakam) of that thing. They held that the notion
"it is not existent" cannot be due to perception, for there is no
contact here with sense and object. It is true indeed that when
we turn our eyes (e.g. in the case of the perception of the non-
existence of a jug) to the ground, we see both the ground and
the non-existence of a jug, and when we shut them we can see
neither the jug nor the ground, and therefore it could be urged
that if we called the ground visually perceptible, we could say
the same with regard to the non-existence of the jug. But even
then since in the case of the perception of the jug there is sense-
contact, which is absent in the other case, we could never say
that both are grasped by perception. We see the ground and
remember the jug (which is absent) and thus in the mind rises
the notion of non-existence which has no reference at all to visual
perception. A man may be sitting in a place where there were
no tigers, but he might not then be aware of their non-existence
at the time, since he did not think of them, but when later on he
is asked in the evening if there were any tigers at the place where
he was sitting in the morning, he then thinks and becomes aware
of the non-existence of tigers there in the morning, even
without perceiving the place and without any operation of the
memory of the non-existence of tigers. There is no question of
there being any inference in the rise of our notion of non-existence,
for it is not preceded by any notion of concomitance of any kind,
and neither the ground nor the non-perception of the jug could
be regarded as a reason (lingo), for the non- perception of the jug
is related to the jug and not to the negation of the jug, and no
concomitance is known between the non-perception of the jug and
its non-existence, and when the question of the concomitance of
non-perception with non-existence is brought in, the same diffi
culty about the notion of non-existence (abhdvd) which was sought
to be explained will recur again. Negation is therefore to be
admitted as cognized by a separate and independent process
of knowledge. Nyaya however says that the perception of
non-existence (e.g. there is no jug here) is a unitary perception
of one whole, just as any perception of positive existence (e.g.
vm] Mimamsa view of Negation 357
there is a jug on the ground) is. Both the knowledge of the
ground as well as the knowledge of the non-existence of the jug
arise there by the same kind of action of the visual organ, and
there is therefore no reason why the knowledge of the ground
should be said to be due to perception, whereas the knowledge of
the negation of the jug on the ground should be said to be due
to a separate process of knowledge. The non-existence of the jug
is taken in the same act as the ground is perceived. The principle
that in order to perceive a thing one should have sense-contact
with it, applies only to positive existents and not to negation or
non-existence. Negation or non-existence can be cognized even
without any sense-contact. Non-existence is not a positive sub
stance, and hence there cannot be any question here of sense-
contact. It may be urged that if no sense-contact is required
in apprehending negation, one could as well apprehend negation
or non-existence of other places which are far away from him.
To this the reply is that to apprehend negation it is necessary
that the place where it exists must be perceived. We know a
thing and its quality to be different, and yet the quality can only
be taken in association with the thing and it is so in this case as
well. We can apprehend non-existence only through the appre
hension of its locus. In the case when non-existence is said to
be apprehended later on it is really no later apprehension of non-
existence but a memory of non-existence (e.g. of jug) perceived
before along with the perception of the locus of non-existence
(e.g. ground). Negation or non-existence (abkava) can thus, ac
cording to Nyaya, generate its cognition just as any positive
existence can do. Negation is not mere negativity or mere
vacuous absence, but is what generates the cognition "is not,"
as position (bhdva) is what generates the cognition "it is."
The Buddhists deny the existence of negation. They hold
that when a negation is apprehended, it is apprehended with
specific time and space conditions (e.g. this is not here now);
but in spite of such an apprehension, we could never think
that negation could thus be associated with them in any
relation. There is also no relation between the negation and its
pratiyogi (thing negated e.g. jug in the negation of jug), for
when there is the pratiyogi there is no negation, and when there
is the negation there is no pratiyogi. There is not even the
relation of opposition (yirodhd), for we could have admitted it, if
358 The Nyaya - Vaitesika Philosophy [CH.
the negation of the jug existed before and opposed the jug,
for how can the negation of the jug oppose the jug, without
effecting anything at all? Again, it may be asked whether nega
tion is to be regarded as a positive being or becoming or of the
nature of not becoming or non-being. In the first alternative it
will be like any other positive existents, and in the second case it
will be permanent and eternal, and it cannot be related to this or
that particular negation. There are however many kinds of non-
perception, e.g. (i) svabhavanupalabdhi (natural non-perception
there is no jug because none is perceived); (2) karananupalabdhi
(non-perception of cause there is no smoke here, since there is
no fire); (3) vyapakanupalabdhi (non-perception of the species
there is no pine here, since there is no tree); (4) karyanupalabdhi
(non-perception of effects there are not the causes of smoke here,
since there is no smoke); (5) svabhavaviruddhopalabdhi (percep-
ti6n of contradictory natures there is no cold touch here because
of fire) ; (6) viruddhakaryopalabdhi (perception of contradictory
effects there is no cold touch here because of smoke); (7) virud-
dhavyaptopalabdhi (opposite concomitance past is not of neces
sity destructible, since it depends on other causes); (8) karyyavi-
ruddhopalabdhi (opposition of effects there is not here the causes
which can give cold since there is fire); (9) vyapakaviruddhopa-
labdhi (opposite concomitants there is no touch of snow here,
because of fire); (10) karanaviruddhopalabdhi (opposite causes
there is no shivering through cold here, since he is near the fire) ;
(11) karanaviruddhakaryyopalabdhi (effects of opposite causes
this place is not occupied by men of shivering sensations for it
is full of smoke 1 ).
There is no doubt that in the above ways we speak of nega
tion, but that does not prove that there is any reason for the
cognition of negation (heturnabhdvasamvidak). All that we can
say is this that there are certain situations which justify the use
(yogyata) of negative appellations. But this situation or yogyata
is positive in character. What we all speak of in ordinary usage
as non-perception is of the nature of perception of some sort.
Perception of negation thus does not prove the existence of
negation, but only shows that there are certain positive percep
tions which are only interpreted in that way. It is the positive
perception of the ground where the visible jug is absent that
1 See Nydyabindu, p. u, and Nyayamanjari, pp. 53-7.
vui] Nyaya view of Negation 359
leads us to speak of having perceived the negation of the jug
(anupalambhah abhdvam vyavahdrayati)*.
The Nyaya reply against this is that the perception of positive
existents is as much a fact as the perception of negation, and we
have no right to say that the former alone is valid. It is said
that the non-perception of jug on the ground is but the percep
tion of the ground without the jug. But is this being without
the jug identical with the ground or different? If identical then
it is the same as the ground, and we shall expect to have it even
when the jug is there. If different then the quarrel is only over
the name, for whatever you may call it, it is admitted to be a
distinct category. If some difference is noted between the ground
with the jug, and the ground without it, then call it "ground,
without the jugness" or "the negation of jug," it does not matter
mu.ch, for a distinct category has anyhow been admitted. Nega
tion is apprehended by perception as much as any positive
existent is; the nature of the objects of perception only are dif
ferent; just as even in the perception of positive sense-objects
there are such diversities as colour, taste, etc. The relation of
negation with space and time with which it appears associated is
the relation that subsists between the qualified and the quality
(visesya visesand). The relation between the negation and its
pratiyogi is one of opposition, in the sense that where the one is
the other is not. The Vaisesika sutra (IX. i. 6) seems to take abhava
in a similar way as Kumarila the Mlmamsist does, though the
commentators have tried to explain it away 2 . In Vaisesika the
four kinds of negation are enumerated as (i) prdgabhdva (the
negation preceding the production of an object e.g. of the jug
before it is made by the potter); (2) dhvamsdbhdva (the negation
following the destruction of an object as of the jug after it is
destroyed by the stroke of a stick); (3) anyonydbhava (mutual
negation e.g. in the cow there is the negation of the horse and
1 See Nydyabindu(fkd, pp. 34 ff., and also Nydyamanjari, pp. 48-63.
2 Pras"astapada says that as the production of an effect is the sign of the existence
of the cause, so the non -production of it is the sign of its non-existence. Sridhara in
commenting upon it says that the non-preception of a sensible object is the sign (lingo)
of its non-existence. But evidently he is not satisfied with the view for he says that
non-existence is also directly perceived by the senses (bhavavad abhavcfpindriyagra-
hanayogyah) and that there is an actual sense-contact with non-existence which is the
collocating cause of the preception of non-existence (abhavendriyasannikarso 1 pi abhd-
vagrahanasdmagri), ffydyakandalt, pp. 225-30.
360 The Nyaya - Vaites ika Philosophy [CH.
in the horse that of th& cow) ; (4) atyantabhava (a negation which
always exists e.g. even when there is a jug here, its negation in
other places is not destroyed) 1 .
The necessity of the Acquirement of debating devices
for the seeker of Salvation.
It is probable that the Nyaya philosophy arose in an atmo
sphere of continued disputes and debates; as a consequence
of this we find here many terms related to debates which we do
not notice in any other system of Indian philosophy. These are
tarka^ nirnaya, vdda, jalpa, vitandd, hetvdbhdsa, chala, jdti and
n igrahasthdna.
Tarka means deliberation on an unknown thing to discern
its real nature; it thus consists of seeking reasons in favour of
some supposition to the exclusion of other suppositions ; it is not
inference, but merely an oscillation of the mind to come to a right
conclusion. When there is doubt (samsayd) about the specific
nature of anything we have to take to tarka. Nirnaya means the
conclusion to which we arrive as a result of tarka. When two
opposite parties dispute over their respective theses, such as the
doctrines that there is or is not an atman, in which each of them
tries to prove his own thesis with reasons, each of the theses is
called a vdda. Jalpa means a dispute in which the disputants
give wrangling rejoinders in order to defeat their respective op
ponents. A jalpa is called a vitandd when it is only a destructive
criticism which seeks to refute the opponent s doctrine without
seeking to establish or formulate any new doctrine. Hetvabhasas
are those which appear as hetus but are really not so. Nyaya
sutras enumerate five fallacies (hetvdbhdsas) of the middle (hetu):
savyabhicdra (erratic), virudd/ia (contradictory), prakaranasama
(tautology), sddhyasama (unproved reason) and kdldtita (inop
portune). Savyabhicara is that where the same reason may prove
opposite conclusions (e.g. sound is eternal because it j s intangible
like the atoms which are eternal, and sound is non-eternal because
it is intangible like cognitions which are non-eternal) ; viruddha
is that where the reason opposes the premiss to be proved (e.g. a
jug is eternal, because it is produced) ; prakaranasama is that
1 The doctrine of negation, its function and value with reference to diverse logical
problems, have many diverse aspects, and it is impossible to do them justice in a small
section like this.
vi n] Fallacies 361
where the reason repeats the thesis to be proved in another form
(e.g. sound is non-eternal because it has not the quality of
eternality) ; sadhyasama is that where the reason itself requires
to be proved (e.g. shadow is a substance because it has motion,
but it remains to be proved whether shadows have motion or not) ;
kalatlta is a false analogy where the reason fails because it does not
tally with the example in point of time. Thus one may argue that
sound is eternal because it is the result of contact (stick and the
drum) like colour which is also a result of contact of light and
the object and is eternal. Here the fallacy lies in this, that colour
is simultaneous with the contact of light which shows what was
already there and only manifested by the light, whereas in the
case of sound it is produced immediately after the contact of the
stick and drum and is hence a product and hence non-eternal.
The later Nyaya works divide savyabhicara into three classes,
(i) sadharana or common (e.g. the mountain is fiery because it is
an object of knowledge, but even a lake which is opposed to fire
is also an object of knowledge), (2) asadharana or too restricted
(e.g. sound is eternal because it has the nature of sound ; this
cannot be a reason for the nature of sound exists only in the
sound and nowhere else), and (3) anupasamharin or unsubsuming
(e.g. everything is non-eternal, because they are all objects of
knowledge ; here the fallacy lies in this, that no instance can be
found which is not an object of knowledge and an opposite con
clusion may also be drawn). The fallacy satpratipaksa is that in
which there is a contrary reason which may prove the opposite
conclusion (e.g. sound is eternal because it is audible, sound is
non-eternal because it is an effect). The fallacy asiddha (unreal)
is of three kinds (i) dsraydsiddha (the lotus of the sky is fragrant
because it is like other lotuses; now there cannot be any lotus in
the sky), (2) svarupdsiddha (sound is a quality because it is
visible ; but sound has no visibility), (3) vydpyatvdsiddha is that
where the concomitance between the middle and the consequence
is not invariable and inevitable ; there is smoke in the hill because
there is fire ; but there may be fire without the smoke as in a red
hot iron ball, it is only green-wood fire that is invariably associated
with smoke. The fallacy bddhita is that which pretends to prove
a thesis which is against direct experience, e.g. fire is not hot
because it is a substance. We have already enumerated the
fallacies counted by Vaisesika. Contrary to Nyaya practice
362 The Nyaya - Vaitesika Philosophy [CH.
Prasastapada counts the fallacies of the example. Dirinaga also
counted fallacies of example (e.g. sound is eternal, because it is
incorporeal, that which is incorporeal is eternal as the atoms ;
but atoms are not incorporeal) and Dharmaklrtti counted also the
fallacies of the paksa (minor) ; but Nyaya rightly considers that
the fallacies of the middle if avoided will completely safeguard
inference and that these are mere repetitions. Chala means the
intentional misinterpretation of the opponent s arguments for the
purpose of defeating him. Jati consists in the drawing of contra
dictory conclusions, the raising of false issues or the like with
the deliberate intention of defeating an opponent. Nigrahasthana
means the exposure of the opponent s argument as involving
self-contradiction, inconsistency or the like, by which his defeat is
conclusively proved before the people to the glory of the victorious
opponent. As to the utility of the description of so many debating
tricks by which an opponent might be defeated in a metaphysical
work, the aim of which ought to be to direct the ways that lead to
emancipation, it is said by Jayanta in his Nyayamanjari that these
had to be resorted to as a protective measure against arrogant
disputants who often tried to humiliate a teacher before his pupils.
If the teacher could not silence the opponent, the faith of the
pupils in him would be shaken and great disorder would follow,
and it was therefore deemed necessary that he who was plodding
onward for the attainment of moksa should acquire these devices
for the protection of his own faith and that of his pupils. A know
ledge of these has therefore been enjoined in the Nyaya sutra as
being necessary for the attainment of salvation 1 .
The doctrine of Soul.
Dhurtta Carvakas denied the existence of soul and regarded
consciousness and life as products of bodily changes; there were
other Carvakas called Suiksita Carvakas who admitted the
existence of soul but thought that it was destroyed at death.
The Buddhists also denied the existence of any permanent self.
The naiyayikas ascertained all the categories of metaphysics
mainly by such inference as was corroborated by experience.
They argued that since consciousness, pleasures, pains, willing,
etc. could not belong to our body or the senses, there must be
1 See Nyayamanjari, pp. 586-659, and Tarkikaraksa of Varadaraja and Nis-
kantaka of Mallinatha, pp. 185 ff.
vm] Doctrine of Soul 363
some entity to which they belonged; the existence of the self
is not proved according to Nyaya merely by the notion of our
self-consciousness, as in the case of Mlmamsa, for Nyaya holds
that we cannot depend upon such a perception, for it may
be erroneous. It often happens that I say that I am white or
I am black, but it is evident that such a perception cannot
be relied upon, for the self cannot have any colour. So we
cannot safely depend on our self-consciousness as upon the
inference that the self has to be admitted as that entity to
which consciousness, emotion, etc. adhere when they are pro
duced as a result of collocations. Never has the production of
atman been experienced, nor has it been found to suffer any
destruction like the body, so the soul must be eternal. It is not
located in any part of the body, but is all-pervading, i.e. exists at
the same time in all places (vibhu), and does not travel with
the body but exists everywhere at the same time. But though
atman is thus disconnected from the body, yet its actions are
seen in the body because it is with the help of the collocation
of bodily limbs, etc. that action in the self can be manifested
or produced. It is unconscious in itself and acquires conscious
ness as a result of suitable collocations 1 .
Even at birth children show signs of pleasure by their different
facial features, and this could not be due to anything else than
the memory of the past experiences in past lives of pleasures and
pains. Moreover the inequalities in the distribution of pleasures
and pains and of successes and failures prove that these must be
due to the different kinds of good and bad action that men per
formed in their past lives. Since the inequality of the world
must have some reasons behind it, it is better to admit karma as
the determining factor than to leave it to irresponsible chance.
Isvara and Salvation.
Nyaya seeks to establish the existence of Isvara on the
basis of inference. We know that the Jains, the Samkhya and
the Buddhists did not believe in the existence of Isvara and
offered many antitheistic arguments. Nyaya wanted to refute
these and prove the existence of Isvara by an inference of the
samanyato-drsta type.
1 JMnasamavayanibandhanamevatmanaScetayitrtvam, &c. See Nydyamaftjart,
pp. 432 ff.
364 The Nyaya - Vaitesika Philosophy [CH.
The Jains and other atheists held that though things in the
world have production and decay, the world as a whole was never
produced, and it was never therefore an effect. In contrast to
this view the Nyaya holds that the world as a whole is also an
effect like any other effect. Many geological changes and land
slips occur, and from these destructive operations proceeding in
nature it may be assumed that this world is not eternal but a
result of production. But even if this is not admitted by the
atheists they can in no way deny the arrangement and order of
the universe. But they would argue that there was certainly a
difference between the order and arrangement of human produc
tions (e.g. a jug) and the order and arrangement of the universe;
and therefore from the order and a.rra.ng&ment(sannivesa-viststatd)
of the universe it could not be argued that the universe was
produced by a creator ; for, it is from the sort of order and
arrangement that is found in human productions that a creator
or producer could be inferred. To this, Nyaya answers that the
concomitance is to be taken between the "order and arrangement"
in a general sense and "the existence of a creator" and not with
specific cases of " order and arrangement," for each specific case
may have some such peculiarity in which it differs from similar
other specific cases ; thus the fire in the kitchen is not the same
kind of fire as we find in a forest fire, but yet we are to disregard
the specific individual peculiarities of fire in each case and con
sider the concomitance of fire in general with smoke in general.
So here, we have to consider the concomitance of "order and
arrangement " in general with " the existence of a creator," and
thus though the order and arrangement of the world may be
different from the order and arrangement of things produced by
man, yet an inference from it for the existence of a creator would
not be inadmissible. The objection that even now we see many
effects (e.g. trees) which are daily shooting forth from the ground
without any creator being found to produce them, does not hold,
for it can never be proved that the plants are not actually created
by a creator. The inference therefore stands that the world has
a creator, since it is an effect and has order and arrangement in
its construction. Everything that is an effect and has an order
and arrangement has a creator, like the jug. The world is an
effect and has order and arrangement and has therefore a creator.
Just as the potter knows all the purposes of the jug that he makes,
vin] God and Salvation 365
so IsVara knows all the purposes of this wide universe and is thus
omniscient. He knows all things always and therefore does not
require memory; all things are perceived by him directly without
any intervention of any internal sense such as manas, etc. He is
always happy. His will is eternal, and in accordance with the
karma of men the same will produces dissolution, creates, or
protects the world, in the order by which each man reaps the
results of his own deeds. As our self which is in itself bodiless
can by its will produce changes in our body and through it in
the external world, so IsVara also can by his will create the
universe though he has no body. Some, however, say that if any
association of body with lvara is indispensable for our con
ception of him, the atoms may as well be regarded as his body,
so that just as by the will of our self changes and movement of
our body take place, so also by his will changes and movements
are produced in the atoms 1 .
The naiyayikas in common with most other systems of Indian
philosophy believed that the world was full of sorrow and that
the small bits of pleasure only served to intensify the force of
sorrow. To a wise person therefore everything is sorrow (sarvam
duhkham vivekinaK) ; the wise therefore is never attached to the
so-called pleasures of life which only lead us to further sorrows.
The bondage of the world is due to false knowledge (mithyd-
jndna) which consists in thinking as my own self that which
is not my self, namely body, senses, manas, feelings and know
ledge; when once the true knowledge of the six padarthas and
as Nyaya says, of the proofs (pramdna), the objects of knowledge
(prameya), and of the other logical categories of inference is
attained, false knowledge is destroyed. False knowledge can
be removed by constant thinking of its opposite (pratipaksa-
bhdvana), namely the true estimates of things. Thus when any
pleasure attracts us, we are to think that this is in reality but
pain, and thus the right knowledge about it will dawn and it
will never attract us again. Thus it is that with the destruction
of false knowledge our attachment or antipathy to things and
ignorance about them (collectively called dosa, cf. the klesa of
Pataftjali) are also destroyed.
With the destruction of attachment actions (pravrtti) for the
1 See Nydyamanjart, pp. 190-204, hvaranumdna of Raghunatha 6iromani and
Udayana s Kusumanjalt.
366 The Nyaya - Vaifesika Philosophy [CH. vm
fulfilment of desires cease and with it rebirth ceases and with
it sorrow ceases. Without false knowledge and attachment,
actions cannot produce the bondage of karma that leads to the
production of body and its experiences. With the cessation of
sorrow there is emancipation in which the self is divested of all
its qualities (consciousness, feeling, willing, etc.) and remains
in its own inert state. The state of mukti according to Nyaya-
Vaisesika is neither a state of pure knowledge nor of bliss but a
state of perfect qualitilessness, in which the self remains in itself in
its own purity. It is the negative state of absolute painlessness
in mukti that is sometimes spoken of as being a state of absolute
happiness (ananda\ though really speaking the state of mukti
can never be a state of happiness. It is a passive state of self in
its original and natural purity unassociated with pleasure, pain,
knowledge, willing, etc. 1 .
1 Nyayamanjari, pp. 499-533.
CHAPTER IX
MlMAMSA PHILOSOPHY 1
A Comparative Review.
THE Nyaya-Vaisesika philosophy looked at experience from
a purely common sense point of view and did not work with any
such monistic tendency that the ultimate conceptions of our
common sense experience should be considered as coming out of
an original universal (e.g. prakrti of the Samkhya). Space, time,
the four elements, soul, etc. convey the impression that they are sub
stantive entities or substances. What is perceived of the material
things as qualities such as colour, taste, etc. is regarded as so many
entities which have distinct and separate existence but which
manifest themselves in connection with the substances. So also
karma or action is supposed to be a separate entity, and even
the class notions are perceived as separate entities inhering in
substances. Knowledge (jnand) which illuminates all things is
regarded only as a quality belonging to soul, just as there are
other qualities of material objects. Causation is viewed merely
as the collocation of conditions. The genesis of knowledge is
also viewed as similar in nature to the production of any other
physical event. Thus just as by the collocation of certain physical
circumstances a jug and its qualities are produced, so by the
combination and respective contacts of the soul, mind, sense, and
the objects of sense, knowledge (Jndna) is produced. Soul with
Nyaya is an inert unconscious entity in which knowledge, etc.
inhere. The relation between a substance and its quality, action,
class notion, etc. has also to be admitted as a separate entity, as
without it the different entities being without any principle of
relation would naturally fail to give us a philosophic construction.
Samkhya had conceived of a principle which consisted of an
infinite number of reals of three different types, which by their
combination were conceived to be able to produce all substances,
qualities, actions, etc. No difference was acknowledged to exist
between substances, qualities and actions, and it was conceived
1 On the meaning of the word Mimamsa see Chapter :v.
368 Mimamsa Philosophy [CH.
that these were but so many aspects of a combination of the three
types of reals in different proportions. The reals contained within
them the rudiments of all developments of matter, knowledge,
willing, feelings, etc. As combinations of reals changed incessantly
and new phenomena of matter and mind were manifested, collo
cations did not bring about any new thing but brought about a
phenomenon which was already there in its causes in another
form. What we call knowledge or thought ordinarily, is with them
merely a form of subtle illuminating matter-stuff. Samkhya holds
however that there is a transcendent entity as pure conscious
ness and that by some kind of transcendent reflection or contact
this pure consciousness transforms the bare translucent thought-
matter into conscious thought or experience of a person.
But this hypothesis of a pure self, as essentially distinct and
separate from knowledge as ordinarily understood, can hardly
be demonstrated in our common sense experience ; and this has
been pointed out by the Nyaya school in a very strong and
emphatic manner. Even Samkhya did not try to prove that the
existence of its transcendent purusa could be demonstrated in
experience, and it had to attempt to support its hypothesis of the
existence of a transcendent self on the ground of the need of
a permanent entity as a fixed object, to which the passing states
of knowledge could cling, and on grounds of moral struggle
towards virtue and emancipation. Samkhya had first supposed
knowledge to be merely a combination of changing reals, and
then had as a matter of necessity to admit a fixed principle as
purusa (pure transcendent consciousness). The self is thus here
in some sense an object of inference to fill up the gap left by
the inadequate analysis of consciousness (buddht) as being non-
intelligent and incessantly changing.
Nyaya fared no better, for it also had to demonstrate self
on the ground that since knowledge existed it was a quality,
and therefore must inhere in some substance. This hypothesis
is again based upon another uncritical assumption that substances
and attributes were entirely separate, and that it was the nature
of the latter to inhere in the former, and also that knowledge was
a quality requiring (similarly with other attributes) a substance
in which to inhere. None of them could take their stand upon
the self-conscious nature of our ordinary thought and draw their
conclusions on the strength of the direct evidence of this self-
ix] Nyaya and Mtmamsa 369
conscious thought. Of course it is true that Samkhya had ap
proached nearer to this view than Nyaya, but it had separated
the content of knowledge and its essence so irrevocably that it
threatened to break the integrity of thought in a manner quite
unwarranted by common sense experience, which does not seem
to reveal this dual element in thought. Anyhow the unification
of the content of thought and its essence had to be made, and this
could not be done except by what may be regarded as a make
shift a transcendent illusion running on from beginningless
time. These difficulties occurred because Samkhya soared to a
region which was not directly illuminated by the light of common
sense experience. The Nyaya position is of course much worse
as a metaphysical solution, for it did not indeed try to solve any
thing, but only gave us a schedule of inferential results which could
not be tested by experience, and which were based ultimately on
a one-sided and uncritical assumption. It is an uncritical common
sense experience that substances are different from qualities and
actions, and that the latter inhere in the former. To base the
whole of metaphysics on such a tender and fragile experience is,
to say the least, building on a weak foundation. It was necessary
that the importance of the self- revealing thought must be brought
to the forefront, its evidence should be collected and trusted, and
an account of experience should be given according to its verdict.
No construction of metaphysics can ever satisfy us which ignores
the direct immediate convictions of self-conscious thought. It is
a relief to find that a movement of philosophy in this direction
is ushered in by the Mlmamsa system. The Mimamsd sutras
were written by Jaimini and the commentary (bhdsya) on it was
written by abara. But the systematic elaboration of it was made
by Kumarila, who preceded the great Sarikaracarya, and a disciple
of Kumarila, Prabhakara.
The Mlmamsa Literature.
It is difficult to say how the sacrificial system of worship grew
in India in the Brahmanas. This system once set up gradually
began to develop into a net-work of elaborate rituals, the details
of which were probably taken note of by the priests. As some
generations passed and the sacrifices spread over larger tracts of
India and grew up into more and more elaborate details, the old
rules and regulations began to be collected probably as tradition
D. 24
37o Mlmamsa Philosophy [CH.
had it, and this it seems gave rise to the smrti literature. Dis
cussions and doubts became more common about the many
intricacies of the sacrificial rituals, and regular rational enquiries
into them were begun in different circles by different scholars and
priests. These represent the beginnings of Mlmamsa (lit. at
tempts at rational enquiry), and it is probable that there were
different schools of this thought. That Jaimini s Mtmdmsd sutras
(which are with us the foundations of Mlmamsa) are only a compre
hensive and systematic compilation of one school is evident from
the references he gives to the views in different matters of other
preceding writers who dealt with the subject. These works are not
available now, and we cannot say how much of what Jaimini has
written is his original work and how much of it borrowed. But it
may be said with some degree of confidence that it was deemed so
masterly a work at least of one school that it has survived all other
attempts that were made before him. Jaimini s Mtmdmsd siifras
were probably written about 200 B.C. and are now the ground work
of the Mlmamsa system. Commentaries were written on it by
various persons such as Bhartrmitra (alluded to in Nydyaratndkara
verse 10 of Slokavdrttikd), Bhavadasa (Pratijhasutra 63), Hari and
Upavarsa (mentioned in Sdstradlpikd). It is probable that at least
some of these preceded abara, the writer of the famous com
mentary known as the Sabara-bhasya. It is difficult to say any
thing about the time in which he flourished. Dr Gariganatha
Jha would have him about 57 B.C. on the evidence of a current
verse which speaks of King Vikramaditya as being the son
of ^abarasvamin by a Ksattriya wife. This bhasya of Sabara
is the basis of the later Mlmamsa works. It was commented
upon by an unknown person alluded to as Varttikakara by
Prabhakara and merely referred to as " yathahuh " (as they say)
by Kumarila. Dr Gahganatha Jha says that Prabhakara s com
mentary Brhati on the Sabara- bhasya was based upon the work
of this Varttikakara. This Brhati of Prabhakara had another
commentary on it Rjuvimdld by alikanatha Misra, who also
wrote a compendium on the Prabhakara interpretation of Ml
mamsa called Prakaranapancikd. Tradition says that Prab
hakara (often referred to as Nibandhakara), whose views are
often alluded to as "gurumata," was a pupil of Kumarila. Ku
marila Bhatta, who is traditionally believed to be the senior con
temporary of Sarikara (788 A.D.), wrote his celebrated independent
ix] Mlmamsa Literature 371
exposition of Sahara s bhasya in three parts known as Sloka-
vdrttika (dealing only with the philosophical portion of Sahara s
work as contained in the first chapter of the first book known as
Tarkapada), Tantravdrttika (dealing with the remaining three
chapters of the first book, the second and the third book) and
Tuptlkd (containing brief notes on the remaining nine books) 1 .
Kumarila is referred to by his later followers as Bhatta, Bhatta-
pada, and Varttikakara. The next great Mlmamsa scholar and
follower of Kumarila was Mandana Misra, the author of Vidhi-
viveka, Mlmdmsdnukramant and the commentator of Tantra-
vdrttika,vi\\Q became later on converted by Sankara to Vedantism.
Parthasarathi MisYa (about ninth century A.D.) wrote his Sdstradi-
pikd, Tantraratna, and Nydyaratnamdld following the footprints
of Kumarila. Amongst the numerous other followers of Kumarila,
fhe names of Sucarita Mira the author of Kdsikd and SomesVara
the author of Nydyasudhd deserve special notice. Ramakrsna
Bhatta wrote an excellent commentary on the Tarkapdda of Sds-
tradlpikd called the Yuktisnehapurani-siddhdnta-candrikd and
Somanatha wrote his Mayukhamdlikd on the remaining chapters
of Sdstradtpikd. Other important current MimamsS works which
deserve notice are such as Nydyamdldvi stara of Madhava, Subo-
dhim, Mimdmsdbdlaprakdsa of Sarikara Bhatta, Nydyakanikd of
Vacaspati MiSra, Mimdmsdparibhdsa by Krsnayajvan, Mimdmsd-
nydyaprakdsa by Anantadeva, Gaga Bhatta s Bhattacintdmani,
etc. Most of the books mentioned here have been consulted in the
writing of this chapter. The importance of the Mlmmsa litera
ture for a Hindu is indeed great. For not only are all Vedic duties
to be performed according to its maxims, but even the smrti
literatures which regulate the daily duties, ceremonials and rituals
of Hindus even at the present day are all guided and explained
by them. The legal side of the smrtis consisting of inheritance,
proprietory rights, adoption, etc. which guide Hindu civil life even
under the British administration is explained according to the
Mlmamsa maxims. Its relations to the Vedanta philosophy will
be briefly indicated in the next chapter. Its relations with Nyaya-
VaiSesika have also been pointed out in various places of this
chapter. The views of the two schools of Mlmamsa as propounded
by Prabhakara and Kumarila on all the important topics have
1 Mahamahopadhyaya Haraprasada &astri says, in his introduction to Six Buddhist
Nyaya Tracts, that " Kumarila preceded Sankara by two generations."
242
372 Mtmamsa Philosophy [CH.
also been pointed out. Prabhakara s views however could not
win many followers in later times, but while living it is said that
he was regarded by Kumarila as a very strong rival 1 . Hardly
any new contribution has been made to the Mimamsa philosophy
after Kumarila and Prabhakara. The Mimdmsd sutras deal mostly
with the principles of the interpretation of the Vedic texts in
connection with sacrifices, and very little of philosophy can be
gleaned out of them. Sahara s contributions are also slight and
vague. Varttikakara s views also can only be gathered from the
references to them by Kumarila and Prabhakara. What we know
of Mimamsa philosophy consists of their views and theirs alone.
It did not develop any further after them. Works written on the
subject in later times were but of a purely expository nature. I do
not know of any work on Mimamsa written in English except
the excellent one by Dr Gariganatha Jha on the Prabhakara
Mimamsa to which I have frequently referred.
The Paratah-pramanya doctrine of Nyaya and the
Svatah-pramanya doctrine of Mimamsa.
The doctrine of the self-validity of knowledge (svatah-
prdntdnyd) forms the cornerstone on which the whole structure
of the Mimamsa philosophy is based. Validity means the certi
tude of truth. The Mimamsa philosophy asserts that all know
ledge excepting the action of remembering (smrtt) or memory is
valid in itself, for it itself certifies its own truth, and neither
depends on any other extraneous condition nor on any other
knowledge for its validity. But Nyaya holds that this self-
validity of knowledge is a question which requires an explanation.
It is true that under certain conditions a piece of knowledge
is produced in us, but what is meant by saying that this
knowledge is a proof of its own truth? When we perceive
anything as blue, it is the direct result of visual contact, and this
visual contact cannot certify that the knowledge generated is
true, as the visual contact is not in any touch with the knowledge
1 There is a story that Kumarila, not being able to convert Prabhakara, his own
pupil, to his views, attempted a trick and pretended that he was dead. His disciples
then asked Prabhakara whether his burial rites should be performed according to
Rumania s views or Prabhakara s. Prabhakara said that his own views were erroneous,
but these were held by him only to rouse up Rumania s pointed attacks, whereas
Rumania s views were the right ones. Rumarila then rose up and said that Prabhakara
was defeated, but the latter said he was not defeated so long as he was alive. But
this has of course no historic value.
ix] Objections against the Self-validity of Knowledge 373
it has conditioned. Moreover, knowledge is a mental affair and
how can it certify the objective truth of its representation ? In
other words, how can my perception " a blue thing " guarantee
that what is subjectively perceived as blue is really so objectively
as well ? After my perception of anything as blue we do not
have any such perception that what I have perceived as blue
is really so. So this so-called self-validity of knowledge cannot
be testified or justified by any perception. We can only be cer
tain that knowledge has been produced by the perceptual act, but
there is nothing in this knowledge or its revelation of its object
from which we can infer that the perception is also objectively
valid or true. If the production of any knowledge should certify
its validity then there would be no invalidity, no illusory know
ledge, and following our perception of even a mirage we should
never come to grief. But we are disappointed often in our per
ceptions, and this proves that when we practically follow the
directions of our perception we are undecided as to its validity,
which can only be ascertained by the correspondence of the per
ception with what we find later on in practical experience. Again,
every piece of knowledge is the result of certain causal colloca
tions, and as such depends upon them for its production, and
hence cannot be said to rise without depending on anything else.
It is meaningless to speak of the validity of knowledge, for
validity always refers to objective realization of our desires and
attempts proceeding in accordance with our knowledge. People
only declare their knowledge invalid when proceeding practically
in accordance with it they are disappointed. The perception of
a mirage is called invalid when proceeding in accordance with
our perception we do not find anything that can serve the pur
poses of water (e.g. drinking, bathing). The validity or truth of
knowledge is thus the attainment by practical experience of the
object and the fulfilment of all our purposes from it (arthakriyd-
jiidna or phalajndna) just as perception or knowledge repre
sented them to the perceiver. There is thus no self-validity of
knowledge (svatah-prdmdnya), but validity is ascertained by
samvdda or agreement with the objective facts of experience 1 .
It is easy to see that this Nyaya objection is based on the
supposition that knowledge is generated by certain objective
collocations of conditions, and that knowledge so produced can
1 See Nydyamanjari, pp. 160-173.
374 M imams a Philosophy [CH.
only be tested by its agreement with objective facts. But this
theory of knowledge is merely an hypothesis ; for it can never be
experienced that knowledge is the product of any collocations ;
we have a perception and immediately we become aware of cer
tain objective things; knowledge reveals to us the facts of the
objective world and this is experienced by us always. But that
the objective world generates knowledge in us is only an hypothesis
which can hardly be demonstrated by experience. It is the supreme
prerogative of knowledge that it reveals all other things. It is not a
phenomenon like any other phenomenon of the world. When we
say that knowledge has been produced in us by the external
collocations, we just take a perverse point of view which is un
warranted by experience; knowledge only photographs the
objective phenomena for us; but there is nothing to show that
knowledge has been generated by these phenomena. This is
only a theory which applies the ordinary conceptions of causation
to knowledge and this is evidently unwarrantable. Knowledge is
not like any other phenomena for it stands above them and
interprets or illumines them all. There can be no validity in
things, for truth applies to knowledge and knowledge alone. What
we call agreement with facts by practical experience is but the
agreement of previous knowledge with later knowledge; for ob
jective facts never come to us directly, they are always taken
on the evidence of knowledge, and they have no other certainty
than what is bestowed on them by knowledge. There arise in
deed different kinds of knowledge revealing different things, but
these latter do not on that account generate the former, for this
is never experienced ; we are never aware of any objective fact
before it is revealed by knowledge. Why knowledge makes
different kinds of revelations is indeed more than we can say, for
experience only shows that knowledge reveals objective facts and
not why it does so. The rise of knowledge is never perceived by
us to be dependent on any objective fact, for all objective facts
are dependent on it for its revelation or illumination. This is
what is said to be the self-validity (svatah-prdmdnyci) of know
ledge in its production (utpatti). As soon as knowledge is pro
duced, objects are revealed to us; there is no intermediate link
between the rise of knowledge and the revelation of objects on
which knowledge depends for producing its action of revealing
or illuminating them. Thus knowledge is not only independent
ix] Self -validity of Knowledge 375
of anything else in its own rise but in its own action as well
{svakdryakarane svatah pramdnyam jndnasya). Whenever there
is any knowledge it carries with it the impression that it is
certain and valid, and we are naturally thus prompted to work
(pravrttt) according to its direction. There is no indecision in
our mind at the time of the rise of knowledge as to the correct
ness of knowledge ; but just as knowledge rises, it carries with
it the certainty of its revelation, presence, or action. But in cases
of illusory perception other perceptions or cognitions dawn which
carry with them the notion that our original knowledge was not
valid. Thus though the invalidity of any knowledge may appear
to us by later experience, and in accordance with which we
reject our former knowledge, yet when the knowledge first revealed
itself to us it carried with it the conviction of certainty which
goaded us on to work according to its indication. Whenever a man
works according to his knowledge, he does so with the conviction
that his knowledge is valid, and not in a passive or uncertain temper
of mind. This is what Mlmamsa means when it says that the
validity of knowledge appears immediately with its rise, though
its invalidity may be derived from later experience or some other
data (jndnasya pramdnyam svatah aprdmdnyam paratati). Know
ledge attained is proved invalid when later on a contradictory
experience (bddhakajndna) comes in or when our organs etc. are
known to be faulty and defective (karanadosajndnd). It is from
these that knowledge appearing as valid is invalidated; when
we take all necessary care to look for these and yet find them
not, we must think that they do not exist. Thus the validity of
knowledge certified at the moment of its production need not
be doubted unnecessarily when even after enquiry we do not find
any defect in sense or any contradiction in later experience. All
knowledge except memory is thus regarded as valid independently
by itself as a general rule, unless it is invalidated later on. Memory
is excluded because the phenomenon of memory depends upon
a previous experience, and its existing latent impressions, and
cannot thus be regarded as arising independently by itself.
The place of sense organs in perception.
We have just said that knowledge arises by itself and that it
could not have been generated by sense-contact. If this be so,
the diversity of perceptions is however left unexplained. But in
376 Mimamsa Philosophy [CH.
face of the Nyaya philosophy explaining all perceptions on the
ground of diverse sense-contact the Mimamsa probably could not
afford to remain silent on such an important point. It therefore
accepted the Nyaya view of sense-contact as a condition of know
ledge with slight modifications, and yet held their doctrine of
svatah-pramanya. It does not appear to have been conscious of
a conflict between these two different principles of the production
of knowledge. Evidently the point of view from which it looked
at it was that the fact that there were the senses and contacts
of them with the objects, or such special capacities in them by
virtue of which the things could be perceived, was with us a
matter of inference. Their actions in producing the knowledge
are never experienced at the time of the rise of knowledge, but
when the knowledge arises we argue that such and such senses
must have acted. The only case where knowledge is found to
be dependent on anything else seems to be the case where one
knowledge is found to depend on a previous experience or know
ledge as in the case of memory. In other cases the dependence
of the rise of knowledge on anything else cannot be felt, for the
physical collocations conditioning knowledge are not felt to be
operating before the rise of knowledge, and these are only in
ferred later on in accordance with the nature and characteristic
of knowledge. We always have our first start in knowledge
which is directly experienced from which we may proceed later
on to the operation and nature of objective facts in relation to it.
Thus it is that though contact of the senses with the objects
may later on be imagined to be the conditioning factor, yet the
rise of knowledge as well as our notion of its validity strikes us
as original, underived, immediate, and first-hand.
Prabhakara gives us a sketch as to how the existence of
the senses may be inferred. Thus our cognitions of objects are
phenomena which are not all the same, and do not happen always
in the same manner.for these vary differently at different moments ;
the cognitions of course take place in the soul which may thus
be regarded as the material cause (samavdyikdrand) ; but there
must be some such movements or other specific associations
(asamavayikdrana) which render the production of this or
that specific cognition possible. The immaterial causes subsist
either in the cause of the material cause (e.g. in the case of the
colouring of a white piece of cloth, the colour of the yarns which
ix] Sense-contact and Perception 377
is the cause of the colour in the cloth subsists in the yarns which
form the material cause of the cloth) or in the material cause it
self (e.g. in the case of a new form of smell being produced in a
substance by fire-contact, this contact, which is the immaterial
cause of the smell, subsists in that substance itself which is put
in the fire and in which the smell is produced). The soul is
eternal and has no other cause, and it has to be assumed that
the immaterial cause required for the rise of a cognition must
inhere in the soul, and hence must be a quality. Then again
accepting the Nyaya conclusions we know that the rise of qualities
in an eternal thing can only take place by contact with some
other substances. Now cognition being a quality which the soul
acquires would naturally require the contact of such substances.
Since there is nothing to show that such substances inhere in
other substances they are also to be taken as eternal. There are
three eternal substances, time, space, and atoms. But time and
space being all-pervasive the soul is always in contact with them.
Contact with these therefore cannot explain the occasional rise
of different cognitions. This contact must then be of some kind
of atom which resides in the body ensouled by the cognizing soul.
This atom may be called manas (mind). This manas alone by
itself brings about cognitions, pleasure, pain, desire, aversion,
effort, etc. The manas however by itself is found to be devoid
of any such qualities as colour, smell, etc., and as such cannot
lead the soul to experience or cognize these qualities ; hence
it stands in need of such other organs as may be characterized
by these qualities ; for the cognition of colour, the mind will
need the aid of an organ of which colour is the characteristic
quality; for the cognition of smell, an organ having the odorous
characteristic and so on with touch, taste, vision. Now we know
that the organ which has colour for its distinctive feature must
be one composed of tejas or light, as colour is a feature of light,
and this proves the existence of the organ, the eye for the cogni
tion of colour ; in a similar manner the existence of the earthly
organ (organ of smell), the aqueous organ (organ of taste), the
akasic organ (organ of sound) and the airy organ (organ of
touch) may be demonstrated. But without manas none of these
organs is found to be effective. Four necessary contacts have
to be admitted, (i) of the sense organs with the object, (2) of the
sense organs with the qualities of the object, (3) of the manas
378 Mlmamsa Philosophy [CH.
with the sense organs, and (4) of the manas with the soul. The
objects of perception are of three kinds,(i) substances, (2) qualities,
(3) jati or class. The material substances are tangible objects of
earth, fire, water, air in large dimensions (for in their fine atomic
states they cannot be perceived). The qualities are colour, taste,
smell, touch, number, dimension, separateness, conjunction, dis
junction, priority, posteriority, pleasure, pain, desire, aversion, and
effort 1 .
It may not be out of place here to mention in conclusion that
Kumarila Bhatta was rather undecided as to the nature of the
senses or of their contact with the objects. Thus he says that
the senses may be conceived either as certain functions or
activities, or as entities having the capacity of revealing things
without coming into actual contact with them, or that they might
be entities which actually come in contact with their objects 8 , and
he prefers this last view as being more satisfactory.
Indeterminate and determinate perception.
There are two kinds of perception in two stages, the first
stage is called nirvikalpa (indeterminate) and the second savikalpa
(determinate). The nirvikalpa perception of a thing is its per
ception at the first moment of the association of the senses and
their objects. Thus Kumarila says that the cognition that appears
first is a mere dlocana or simple perception, called non-determinate
pertaining to the object itself pure and simple, and resembling
the cognitions that the new-born infant has of things around
himself. In this cognition neither the genus nor the differentia is
presented to consciousness ; all that is present there is the
individual wherein these two subsist. This view of indeterminate
perception may seem in some sense to resemble the Buddhist
view which defines it as being merely the specific individuality
(svalaksana) and regards it as being the only valid element in
perception, whereas all the rest are conceived as being imaginary
1 See Prakaranapaftcikd, pp. 53 etc., and Dr Ganganatha Jha s Prabhakarami-
mdmsd, pp. 35 etc.
y Slokavarttika, see Pratyaksasutra, 40 etc., and Nyayaratnakara on it. It may be
noted in this connection that Samkhya-Yoga did not think like Nyaya that the senses
actually went out to meet the objects (prdpyakdritva) but held that there was a special
kind of functioning (vt ttt) by virtue of which the senses could grasp even such distant
objects as the sun and the stars. It is the functioning of the sense that reached the
objects. The nature of this vrtti is not further clearly explained and Parthasarathi objects
to it as being almost a different category (tattvantara).
ix J Indeterminate and Determinate Perception 379
impositions. But both Kumarila and Prabhakara think that both
the genus and the differentia are perceived in the indeterminate
stage, but these do not manifest themselves to us only because
we do not remember the other things in relation to which, or in
contrast to which, the percept has to show its character as genus or
differentia; a thing can be cognized as an "individual" only in
comparison with other things from which it differs in certain well-
defined characters ; and it can be apprehended as belonging to a
class only when it is found to possess certain characteristic features
in common with some other things ; so we see that as other things
are not presented to consciousness through memory, the percept
at the indeterminate stage cannot be fully apprehended as an
individual belonging to a class, though the data constituting the
characteristic of the thing as a genus and its differentia are per
ceived at the indeterminate stage 1 . So long as other things are not
remembered these data cannot manifest themselves properly, and
hence the perception of the thing remains indeterminate at the first
stage of perception. At the second stage the self by its past im
pressions brings the present perception in relation to past ones
and realizes its character as involving universal and particular. It
is thus apparent that the difference between the indeterminate
and the determinate perception is this, that in the latter case
memory of other things creeps in, but this association of memory
in the determinate perception refers to those other objects of
memory and not to the percept. It is also held that though the
determinate perception is based upon the indeterminate one, yet
since the former also apprehends certain such factors as did not
enter into the indeterminate perception, it is to be regarded as
a valid cognition. Kumarila also agrees with Prabhakara in
holding both the indeterminate and the determinate perception
valid 8 .
Some Ontological Problems connected with the
Doctrine of Perception.
The perception of the class (jdli) of a percept in relation to
other things may thus be regarded in the main as a difference
between determinate and indeterminate perceptions. The pro
blems of jati and avayavavayavl (part and whole notion) were
1 Compare this with the Vai^esika view as interpreted by Sridhara.
2 See PrakaranapaftcikA and Sditradipikfi.
380 Mimamsa Philosophy [CH.
the subjects of hot dispute in Indian philosophy. Before enter
ing into discussion about jati, Prabhakara first introduced the
problem of avayava (part) and avayavi (whole). He argues as
an exponent of svatah-pramanyavada that the proof of the true
existence of anything must ultimately rest on our own con
sciousness, and what is distinctly recognized in consciousness
must be admitted to have its existence established. Following
this canon Prabhakara says that gross objects as a whole exist,
since they are so perceived. The subtle atoms are the material
cause and their connection (samyoga) is the immaterial cause
(asamavayik&rana), and it is the latter which renders the whole
altogether different from the parts of which it is composed ; and
it is not necessary that all the parts should be perceived before the
whole is perceived. Kumarila holds that it is due to the point of
view from which we look at a thing that we call it a separate
whole or only a conglomeration of parts. In reality they are iden
tical, but when we lay stress on the notion of parts, the thing
appears to be a conglomeration of them, and when we look at it
from the point of view of the unity appearing as a whole, the thing
appears to be a whole of which there are parts (see Slokavdrttika^
Vanavddd) 1 .
Jati, though incorporating the idea of having many units within
one, is different from the conception of whole in this, that it resides
in its entirety in each individual constituting that jati (vydsajya-
1 According to Samkhya-Yoga a thing is regarded as the unity of the universal and
the particular (samanyavifesasamuddyo dravyam, Vyasabhasya^ 111.44); for there is no
other separate entity which is different from them both in which they would inhere
as Nyaya holds. Conglomerations can be of two kinds, namely those in which the parts
exist at a distance from one another (e. g. a forest), and those in which they exist close to
gether (nirantara hi tadavayavah}^ and it is this latter combination (ayutasiddhavayava)
which is called a dravya, but here also there is no separate whole distinct from the parts ;
it is the parts connected in a particular way and having no perceptible space between
them that is called a thing or a whole. The Buddhists as Panditas"oka has shown did
not believe in any whole (avayavi) ; it is the atoms which in connection with one
another appeared as a whole occupying space {paramanava eva hi pararupadefapari-
harenotpannah parasparasahita avabhasamana desavitdnavanto bhavanti). The whole
is thus a mere appearance and notareality (stz Avayavinirakarana, Six Buddhist Nyaya
Tracts}. Nyaya however held that the atoms were partless (niravayava) and hence it
would be wrong to say that when we see an object we see the atoms. The existence
of a whole as different from the parts which belong to it is directly experienced and
there is no valid reason against it :
adustakaranodbh Uta manavirbh utabddhakam
asandigdanca vijiianam katham mithyeti kathyate."
Nyayamanjari, pp. 550 ff.
ix] Jati and Samavaya 381
vrtli\ but the establishment of the existence of wholes refutes the
argument that jati should be denied, because it involves the concep
tion of a whole (class) consisting of many parts (individuals). The
class character or jati exists because it is distinctly perceived by
us in the individuals included in any particular class. It is eternal
in the sense that it continues to exist in other individuals, even
when one of the individuals ceases to exist. When a new in
dividual of that class (e.g. cow class) comes into being, a new
relation of inherence is generated by which the individual is
brought into relation with the class-character existing in other
individuals; for inherence (samavdyd) according to Prabhakara
is not an eternal entity but an entity which is both produced
and not produced according as the thing in which it exists is
non-eternal or eternal, and it is not regarded as one as Nyaya
holds, but as many, according as there is the infinite number of
things in which it exists. When any individual is destroyed, the
class-character does not go elsewhere, nor subsist in that in
dividual, nor is itself destroyed, but it is only the inherence of
class-character with that individual that ceases to exist. With
the destruction of an individual or its production it is a new
relation of inherence that is destroyed or produced. But the class-
character or jati has no separate existence apart from the indivi
duals as Nyaya supposes. Apprehension of jati is essentially
the apprehension of the class-character of a thing in relation to
other similar things of that class by the perception of the common
characteristics. But Prabhakara would not admit the existence of
a highest genus satta (being) as acknowledged by Nyaya. He
argues that the existence of class-character is apprehended be
cause we find that the individuals of a class possess some common
characteristic possessed by all the heterogeneous and disparate
things of the world as can give rise to the conception of a separate
jati as satta, as demanded by the naiyayikas. That all things are
said to be sat (existing) is more or less a word or a name without
the corresponding apprehension of a common quality. Our ex
perience always gives us concrete existing individuals, but we
can never experience such a highest genus as pure existence or
being, as it has no concrete form which may be perceived. When
we speak of a thing as sat, we do not mean that it is possessed
of any such class-characters as satta (being) ; what we mean
is simply that the individual has its specific existence or svarii-
382 Mtmamsa Philosophy [CH.
pasattd. Thus the Nyaya view of perception as taking only the
thing in its pure being apart from qualities, etc. (sanmdtra-visayam
pratyaksam) is made untenable by Prabhakara, as according to
him the thing is perceived direct with all its qualities. According
to Rumania however jati is not something different from the
individuals comprehended by it and it is directly perceived.
Kumarila S view of jati is thus similar to that held by Samkhya,
namely that when we look at an individual from one point of
view (jati as identical with the individual), it is the individual that
lays its stress upon our consciousness and the notion of jati be
comes latent, but when we look at it from another point of view
(the individual as identical with jati) it is the jati which presents
itself to consciousness, and the aspect as individual becomes latent.
The apprehension as jati or as individual is thus only a matter
of different points of view or angles of vision from which we look
at a thing. Quite in harmony with the conception of jati, Kumarila
holds that the relation of inherence is not anything which is dis
tinct from the things themselves in which it is supposed to exist,
but only a particular aspect or phase of the things themselves
(Slokavdrttika, Pratyaksasutra^ 149, 150, abheddt samavdydstu
svarupam dharmadharminoti), Kumarila agrees with Prabhakara
that jati is perceived by the senses (tatraikabuddhinirgrdhyd
jdtirindriyagoca.ro).
It is not out of place to mention that on the evidence of
Prabhakara we find that the category of visesa admitted by the
Kanada school is not accepted as a separate category by the
Mimamsa on the ground that the differentiation of eternal
things from one another, for which the category of viSesa is
admitted, may very well be effected on the basis of the ordinary
qualities of these things. The quality of prthaktva or specific
differences in atoms, as inferred by the difference of things they
constitute, can very well serve the purposes of visesa.
The nature of knowledge.
All knowledge involves the knower, the known object, and the
knowledge at the same identical moment. All knowledge whether
perceptual, inferential or of any other kind must necessarily reveal
the self or the knower directly. Thus as in all knowledge the self
is directly and immediately perceived, all knowledge may be re
garded as perception from the point of view of self. The division
ix] Self-revealing Character of Knowledge 383
of the pramanas as pratyaksa (perception), anumana (inference),
etc. is from the point of view of the objects of knowledge with
reference to the varying modes in which they are brought within
the purview of knowledge. The self itself however has no illumining
or revealing powers, for then even in deep sleep we could have
knowledge, for the self is present even then, as is proved by the
remembrance of dreams. It is knowledge (samvid) that reveals
by its very appearance both the self, the knower, and the objects.
It is generally argued against the self-illuminative character of
knowledge that all cognitions are of the forms of the objects they
are said to reveal ; and if they have the same form we may rather
say that they have the same identical reality too. The Mlmamsa
answer to these objections is this, that if the cognition and the
cognized were not different from one another, they could not
have been felt as such, and we could not have felt that it is
by cognition that we apprehend the cognized objects. The
cognition (samvedana) of a person simply means that such a
special kind of quality (dharma) has been manifested in the
self by virtue of which his active operation with reference to
a certain object is favoured or determined, and the object of cog
nition is that with reference to which the active operation of the
self has been induced. Cognitions are not indeed absolutely form
less, for they have the cognitional character by which things are
illumined and manifested. Cognition has no other character than
this, that it illumines and reveals objects. The things only are
believed to have forms and only such forms as knowledge reveal
to us about them. Even the dream cognition is with reference to
objects that were perceived previously, and of which the im
pressions were left in the mind and were aroused by the
unseen agency (adrsta). Dream cognition is thus only a kind of
remembrance of that which was previously experienced. Only
such of the impressions of cognized objects are roused in dreams
as can beget just that amount of pleasurable or painful experience,
in accordance with the operation of adrsta, as the person deserves
to have in accordance with his previous merit or demerit.
The Prabhakara Mlmamsa, in refuting the arguments of those
who hold that our cognitions of objects are themselves cognized
by some other cognition, says that this is not possible, since we
do not experience any such double cognition and also because it
would lead us to a regressus ad infinitum, for if a second cognition
384 Mtmamsa Philosophy [CH.
is necessary to interpret the first, then that would require a third
and so on. If a cognition could be the object of another cognition,
then it could not be self-valid. The cognition is not of course un
known to us, but that is of course because it is self-cognized, and
reveals itself to us the moment it reveals its objects. From the
illumination of objects also we can infer the presence of this self-
cognizing knowledge. But it is only its presence that is inferred
and not the cognition itself, for inference can only indicate the
presence of an object and not in the form in which it can be
apprehended by perception (pratyaksa). Prabhakara draws a
subtle distinction between perceptuality (samvedyatva) and being
object of knowledge (prameyatva). A thing can only be appre
hended (samvedyate) by perception, whereas inference can only
indicate the presence of an object without apprehending the
object itself. Our cognition cannot be apprehended by any other
cognition. Inference can only indicate the presence or existence
of knowledge but cannot apprehend the cognition itself 1 .
Kumarila also agrees with Prabhakara in holding that per
ception is never the object of another perception and that it ends
in the direct apprehensibility of the object of perception. But he
says that every perception involves a relationship between the
perceiver and the perceived, wherein the perceiver behaves as
the agent whose activity in grasping the object is known as cog
nition. This is indeed different from the Prabhakara view, that
in one manifestation of knowledge the knower, the known, and
the knowledge, are simultaneously illuminated (the doctrine oi
triputlpratyaksd) 2 .
The Psychology of Illusion,
The question however arises that if all apprehensions are
valid, how are we to account for illusory perceptions which cannot
be regarded as valid ? The problem of illusory perception and
its psychology is a very favourite topic of discussion in Indian
philosophy. Omitting the theory of illusion of the Jains called
satkhydti which we have described before, and of the Vedantists,
which we shall describe in the next chapter, there are three
different theories of illusion, viz. (i) atmakhydti, (2) viparitakhydti
or anyathdkhyati, and (3) akhydti of the Mlmamsa school. The
1 See Prabhdkaramimamsa, by Dr Gariganatha Jha.
2 loc. cit. pp. 26-28.
ix] Buddhist and Nyaya Doctrine of Illusion 385
viparltakhyati or anyathakhyati theory of illusion is accepted by
the Nyaya, Vaiesika and the Yoga, the akhyati theory by
Mlmamsa and Samkhya and the atmakhyati by the Buddhists.
The commonest example of illusion in Indian philosophy is
the illusory appearance of a piece of broken conch-shell as a piece
of silver. That such an illusion occurs is a fact which is experienced
by all and agreed to by all. The differences of view are with regard
to its cause or its psychology. The idealistic Buddhists who deny
the existence of the external world and think that there are only
the forms of knowledge, generated by the accumulated karma of
past lives, hold that just as in the case of a correct perception, so
also in the case of illusory perception it is the flow of knowledge
which must be held responsible. The flow of knowledge on account
of the peculiarities of its own collocating conditions generates
sometimes what we call right perception and sometimes wrong
perception or illusion. On this view nothing depends upon the so-
called external data. For they do not exist, and even if they did
exist, why should the same data sometimes bring about the right
perception and sometimes the illusion? The flow of knowledge
creates both the percept and the perceiver and unites them. This
is true both in the case of correct perception and illusory per
ception. Nyaya objects to the above view, and says that if
knowledge irrespective of any external condition imposes upon
itself the knower and the illusory percept, then the perception
ought to be of the form "I am silver" and not "this is silver."
Moreover this theory stands refuted, as it is based upon a false
hypothesis that it is the inner knowledge which appears as coming
from outside and that the external as such does not exist.
The viparltakhyati or the anyathakhyati theory supposes that
the illusion takes place because on account of malobservation we
do not note the peculiar traits of the conch-shell as distinguished
from the silver, and at the same time by the glow etc. of the
conch-shell unconsciously the silver which I had seen elsewhere
is remembered and the object before me is taken as silver. In
illusion the object before us with which our eye is associated is
not conch-shell, for the traits peculiar to it not being grasped, it
is merely an object. The silver is not utterly non-existent, for it
exists elsewhere and it is the memory of it as experienced before
that creates confusion and leads us to think of the conch-shell as
silver. This school agrees with the akhyati school that the fact
D. 25
386 Mimamsa Philosophy [CH.
that I remember silver is not taken note of at the time of
illusion. But it holds that the mere non-distinction is not enough
to account for the phenomenon of illusion, for there is a definite
positive aspect associated with it, viz. the false identification of
silver (seen elsewhere) with the conch-shell before us.
The akhyati theory of Mimamsa holds that since the special
peculiarities of the conch-shell are not noticed, it is erroneous
to say that we identify or cognize positively the conch-shell as
the silver (perceived elsewhere), for the conch-shell is not cog
nized at all. What happens here is simply this, that only the
features common to conch-shell and silver being noticed, the per-
ceiver fails to apprehend the difference between these two things,
and this gives rise to the cognition of silver. Owing to a certain
weakness of the mind the remembrance of silver roused by the
common features of the conch-shell and silver is not apprehended,
and the fact that it is only a memory of silver seen in some past
time that has appeared before him is not perceived ; and it is as
a result of this non-apprehension of the difference between the
silver remembered and the present conch-shell that the illusion
takes place. Thus, though the illusory perception partakes of a
dual character of remembrance and apprehension, and as such is
different from the ordinary valid perception (which is wholly a
matter of direct apprehension) of real silver before us, yet as the
difference between the remembrance of silver and the sight of
the present object is not apprehended, the illusory perception
appears at the moment of its production to be as valid as a real
valid perception. Both give rise to the same kind of activity on
the part of the agent, for in illusory perception the perceiver
would be as eager to stoop and pick up the thing as in the case
of a real perception. Kumarila agrees with this view as expounded
by Prabhakara, and further says that the illusory judgment is as
valid to the cognizor at the time that he has the cognition as any
real judgment could be. If subsequent experience rejects it, that
does not matter, for it is admitted in Mimamsa that when later
experience finds out the defects of any perception it can invalidate
the original perception which was self-valid at the time of its
production 1 . It is easy to see that the Mimamsa had to adopt
this view of illusion to maintain the doctrine that all cognition
at the moment of its production is valid. The akhyati theory
1 See Prakaranapancikd, Sastradipika, and Slokavdrttika, sutra i.
ix] Inference 387
tries to establish the view that the illusion is not due to any
positive wrong knowledge, but to a mere negative factor of non-
apprehension due to certain weakness of mind. So it is that
though illusion is the result, yet the cognition so far as it is cog
nition, is made up of two elements, the present perception and
memory, both of which are true so far as they are individually
present to us, and the cognition itself has all the characteristics of
any other valid knowledge, for the mark of the validity of a cogni
tion is its power to prompt us to action. In doubtful cognitions also,
as in the case " Is this a post or a man?" what is actually perceived
is some tall object and thus far it is valid too. But when this
perception gives rise to two different kinds of remembrance (of
the pillar and the man), doubt comes in. So the element of ap
prehension involved in doubtful cognitions should be regarded
as self-valid as any other cognition.
Inference.
Sabara says that when a certain fixed or permanent relation
has been known to exist between two things, we can have the
idea of one thing when the other one is perceived, and this kind
of knowledge is called inference. Kumarila on the basis of this
tries to show that inference is only possible when we notice
that in a large number of cases two things (e.g. smoke and fire)
subsist together in a third thing (e.g. kitchen, etc.) in some inde
pendent relation, i.e. when their coexistence does not depend
upon any other eliminable condition or factor. It is also neces
sary that the two things (smoke and fire) coexisting in a third
thing should be so experienced that all cases of the existence of
one thing should also be cases involving the existence of the
other, but the cases of the existence of one thing (e.g. fire),
though including all the cases of the existence of the other
(smoke), may have yet a more extensive sphere where the latter
(smoke) may not exist. When once a permanent relation, whether
it be a case of coexistence (as in the case of the contiguity of
the constellation of Krttika with RohinI, where, by the rise of the
former the early rise of the latter may be inferred), or a case of
identity (as in the relation between a genus and its species), or
a case of cause and effect or otherwise between two things and
a third thing which had been apprehended in a large number of
cases, is perceived, they fuse together in the mind as forming
252
388 Mimamsa Philosophy [CH.
one whole, and as a result of that when the existence of the
one (e.g. smoke) in a thing (hill) is noticed, we can infer the
existence of the thing (hill) with its counterpart (fire). In all
such cases the thing (e.g. fire) which has a sphere extending
beyond that in which the other (e.g. smoke) can exist is called
gamya or vydpaka and the other (e.g. smoke) vydpya or gamaka
and it is only by the presence of gamaka in a thing (e.g. hill,
the paksa) that the other counterpart the gamya (fire) may be
inferred. The general proposition, universal coexistence of the
gamaka with the gamya (e.g. wherever there is smoke there is
fire) cannot be the cause of inference, for it is itself a case
of inference. Inference involves the memory of a permanent
relation subsisting between two things (e.g. smoke and fire) in a
third thing (e.g. kitchen); but the third thing is remembered only
in a general way that the coexisting things must have a place
where they are found associated. It is by virtue of such a memory
that the direct perception of a basis (e.g. hill) with the gamaka
thing (e.g. smoke) in it would naturally bring to my mind that
the same basis (hill) must contain the gamya (i.e. fire) also.
Every case of inference thus proceeds directly from a perception
and not from any universal general proposition. Kumarila holds
that the inference gives us the minor as associated with the major
and not of the major alone, i.e. of the fiery mountain and not of
fire. Thus inference gives us a new knowledge, for though it was
known in a general way that the possessor of smoke is the pos
sessor of fire, yet the case of the mountain was not anticipated
and the inference of the fiery mountain is thus a distinctly new
knowledge (desakdlddhikyddyuktamagrhitagrdhitvam anumdna-
sya, Nyayaratnakara, p. 363 )\ It should also be noted that in
forming the notion of the permanent relation between two things,
a third thing in which these two subsist is always remembered
and for the conception of this permanent relation it is enough
that in the large number of cases where the concomitance was
noted there was no knowledge of any case where the concomit
ance failed, and it is not indispensable that the negative instances
in which the absence of the gamya or vyapaka was marked by an
1 It is important to note that it is not unlikely that Kumarila was indebted to
Dinnaga for this ; for Dinnaga s main contention is that " it is not fire, nor the con
nection between it and the hill, but it is the fiery hill that is inferred " for otherwise
inference would give us no new knowledge (see Vidyabhiisana s Indian Logic, p. 87
and Tatparyatika, p. 120.
ix] Inference 389
absence of the gamaka or vyapya, should also be noted, for a
knowledge of such a negative relation is not indispensable for
the forming of the notion of the permanent relation 1 . The ex
perience of a large number of particular cases in which any two
things were found to coexist together in another thing in some
relation associated with the non-perception of any case of failure
creates an expectancy in us of inferring the presence of the
gamya in that thing in which the gamaka is perceived to exist
in exactly the same relation 2 . In those cases where the circle of
the existence of the gamya coincides with the circle of the exist
ence of the gamaka, each of them becomes a gamaka for the other.
It is clear that this form of inference not only includes all cases
of cause and effect, of genus and species but also all cases of
coexistence as well.
The question arises that if no inference is possible without
a memory of the permanent relation, is not the self-validity
of inference destroyed on that account, for memory is not re
garded as self-valid. To this Rumania s answer is that memory
is not invalid, but it has not the status of pramana, as it does
not bring to us a new knowledge. But inference involves the
acquirement of a new knowledge in this, that though the coex
istence of two things in another was known in a number of cases,
yet in the present case a new case of the existence of the gamya
in a thing is known from the perception of the existence of the
gamaka and this knowledge is gained by a means which is not
perception, for it is only the gamaka that is seen and not the
gamya. If the gamya is also seen it is no inference at all.
As regards the number of propositions necessary for the ex
plicit statement of the process of inference for convincing others
(pdrdrthdnumdna) both Kumarila and Prabhakara hold that three
premisses are quite sufficient for inference. Thus the first three
premisses pratijfta, hetu and drstanta may quite serve the purpose
of an anumana.
There are two kinds of anumana according to Kumarila
viz. pratyaksatodrstasambandha and samanyatodrstasambandha.
The former is that kind of inference where the permanent
1 Kumarila strongly opposes a Buddhist view that concomitance (vyaptt) is ascer
tained only by the negative instances and not by the positive ones.
2 " tasmadanavagatipisarvatranvaye saruataSca vyatireke bahuSah sahityavagama-
matradeva vyabhicaradarfanasanathadanumanotpattirangikartavyah. " NyayaratnA-
kara, p. 288.
390 Mimamsa Philosophy [CH.
relation between two concrete things, as in the case of smoke and
fire, has been noticed. The latter is that kind of inference where
the permanent relation is observed not between two concrete
things but between two general notions, as in the case of move
ment and change of place, e.g. the perceived cases where there is
change of place there is also motion involved with it; so from the
change of place of the sun its motion is inferred and it is held
that this general notion is directly perceived like all universals 1 .
Prabhakara recognizes the need of forming the notion of the
permanent relation, but he does not lay any stress on the fact
that this permanent relation between two things (fire and smoke)
is taken in connection with a third thing in which they both
subsist. He says that the notion of the permanent relation be
tween two things is the main point, whereas in all other associa
tions of time and place the things in which these two subsist
together are taken only as adjuncts to qualify the two things
(e.g. fire and smoke). It is also necessary to recognize the fact that
though the concomitance of smoke in fire is only conditional, the
concomitance of the fire in smoke is unconditional and abso
lute 2 . When such a conviction is firmly rooted in the mind that
the concept of the presence of smoke involves the concept of the
presence of fire, the inference of fire is made as soon as any
smoke is seen. Prabhakara counts separately the fallacies of the
minor (paksdbhdsa), of the enunciation (pratijnabhasa) and of
the example (drstdntdbhdsa) along with the fallacies of the middle
and this seems to indicate that the Mimamsa logic was not alto
gether free from Buddhist influence. The cognition of smoke
includes within itself the cognition of fire also, and thus there
would be nothing left unknown to be cognized by the inferential
cognition. But this objection has little force with Prabhakara,
for he does not admit that a pramana should necessarily bring
us any new knowledge, for pramana is simply defined as "appre
hension." So though the inferential cognition always pertains to
things already known it is yet regarded by him as a pramana,
since it is in any case no doubt an apprehension.
1 See Slokavdrttika, Nyayaratnakara, Saslradipika, Yiiktisnehapurani, Sid.dha.n-
tacandrikii on anumana.
2 On the subject of the means of assuring oneself that there is no condition (upadhi)
which may vitiate the inference, Prabhakara has nothing new to tell us. He says that
where even after careful enquiry in a large number of cases the condition cannot be
discovered we must say that it does not exist (prayatnenanvisyamane aupadhikatva-
navagamat, see Prakaranapancika, p. 71).
ix] Upamana and Arthapatti 391
Upamana, Arthapatti.
Analogy (upamana} is accepted by Mlmamsa in a sense which
is different from that in which Nyaya took it. The man who
has seen a cow (go) goes to the forest and sees a wild ox
(gavaya), and apprehends the similarity of the gavaya with
the go, and then cognizes the similarity of the go (which is riot
within the limits of his perception then) with the gavaya. The
cognition of this similarity of the gavaya in the go, as it follows
directly from the perception of the similarity of the go in the
gavaya, is called upamana (analogy). It is regarded as a sepa
rate pramana, because by it we can apprehend the similarity
existing in a thing which is not perceived at the moment. It is
not mere remembrance, for at the time the go was seen the
gavaya was not seen, and hence the similarity also was not seen,
and what was not seen could not be remembered. The difference
of Prabhakara and Kumarila on this point is that while the
latter regards similarity as only a quality consisting, in the fact
of more than one object having the same set of qualities, the
former regards it as a distinct category.
Arthapatti (implication) is a new pramana which is admitted
by the Mlmamsa. Thus when we know that a person Devadatta
is alive and perceive that he is not in the house, we cannot re
concile these two facts, viz. his remaining alive and his not being
in the house without presuming his existence somewhere outside
the house, and this method of cognizing the existence of Deva
datta outside the house is called arthdpatti (presumption or
implication).
The exact psychological analysis of the mind in this artha-
patti cognition is a matter on which Prabhakara and Kumarila
disagree. Prabhakara holds that when a man knows that Deva
datta habitually resides in his house but yet does not find him
there, his knowledge that Devadatta is living (though acquired
previously by some other means of proof) is made doubtful, and
the cause of this doubt is that he does not find Devadatta at his
house. The absence of Devadatta from the house is not the cause
of implication, but it throws into doubt the very existence of Deva
datta, and thus forces us to imagine that Devadatta must remain
somewhere outside. That can only be found by implication,
without the hypothesis of which the doubt cannot be removed.
The mere absence of Devadatta from the house is not enough for
392 Mlmamsa Philosophy [CH.
making the presumption that he is outside the house, for he
might also be dead. But I know that Devadatta was living and
also that he was not at home ; this perception of his absence from
home creates a doubt as regards my first knowledge that he is
living, and it is for the removal of this doubt that there cre