Skip to main content

Full text of "Jahresbericht der Naturhistorischen Gesellschaft zu Nürnberg"

See other formats


This is a digital copy of a book that was preserved for generations on library shelves before it was carefully scanned by Google as part of a project 
to make the world's books discoverable online. 

It has survived long enough for the Copyright to expire and the book to enter the public domain. A public domain book is one that was never subject 
to Copyright or whose legal Copyright term has expired. Whether a book is in the public domain may vary country to country. Public domain books 
are our gateways to the past, representing a wealth of history, culture and knowledge that 's often difficult to discover. 

Marks, notations and other marginalia present in the original volume will appear in this file - a reminder of this book's long journey from the 
publisher to a library and finally to you. 

Usage guidelines 

Google is proud to partner with libraries to digitize public domain materials and make them widely accessible. Public domain books belong to the 
public and we are merely their custodians. Nevertheless, this work is expensive, so in order to keep providing this resource, we have taken Steps to 
prevent abuse by commercial parties, including placing technical restrictions on automated querying. 

We also ask that you: 

+ Make non-commercial use of the file s We designed Google Book Search for use by individuals, and we request that you use these files for 
personal, non-commercial purposes. 

+ Refrain from automated querying Do not send automated queries of any sort to Google's System: If you are conducting research on machine 
translation, optical character recognition or other areas where access to a large amount of text is helpful, please contact us. We encourage the 
use of public domain materials for these purposes and may be able to help. 

+ Maintain attribution The Google "watermark" you see on each file is essential for informing people about this project and helping them find 
additional materials through Google Book Search. Please do not remove it. 

+ Keep it legal Whatever your use, remember that you are responsible for ensuring that what you are doing is legal. Do not assume that just 
because we believe a book is in the public domain for users in the United States, that the work is also in the public domain for users in other 
countries. Whether a book is still in Copyright varies from country to country, and we can't off er guidance on whether any specific use of 
any specific book is allowed. Please do not assume that a book's appearance in Google Book Search means it can be used in any manner 
any where in the world. Copyright infringement liability can be quite severe. 

About Google Book Search 

Google's mission is to organize the world's Information and to make it universally accessible and useful. Google Book Search helps readers 
discover the world's books white helping authors and publishers reach new audiences. You can search through the füll text of this book on the web 



at |http : //books . google . com/ 



"■iN" 



-_a jä. 



\ t. v^ -f r 



:m./^*.--^-. 



\-fis 
^t-'*- 



^* a;' 



♦4-,T -TS:. 



t'^>V-->^'^ .• " • ^. >^ 









WISCONSIN ACADEMY 

OF 
SCIENCES, ARTS, AND LETTERS i 




Digitized by VjOOQ IC 



Digitized by VjOOQ IC 



Digitized by VjOOQ IC 



r 



Jahresbericht 



der 



Naturhistorischen Gesellschaft 



zu 



Nürnberg 



für 



1896. 



Nürnberg 
1897. 



Digitized by VjOOQIC 



U. R. Sebald, Nürnberg 



Digitized by VjOOQ IC 



AS 947270 

Jahresbericht 

der 

Naturhistorischen Gesellschaft 

zu Nürnberg 

für 1896. 



L)er ordentlichen Generalversammlung am 20. Januar 1897 
legt die Vorstandschaft nachfolgenden Bericht über die wissen- 
schaftliche Thätigkeit und die Geschäfte während des Kalender- 
jahres 1896 vor, in welchem die Naturhistorische Gesellschaft ihr 
95. Jahr vollendete. Dieser Bericht enthält 

I. die Chronik der Gesellschaft. 

Von den 460 ordentlichen Mitgliedern, welche der Jahres- 
bericht pro 1895 als Bestand am 31. Dezember jenes Jahres auf- 
fuhrt, sind 22 Herren faktisch nicht mehr Mitglieder gewesen : zum 
Teil war die Streichung ihrer Namen aus der Mitgliederliste nach 
erfolgter Abmeldung unterblieben, zum Teil müssen einige Namen 
statutengemäfs wegen Uneinbringlichkeit der Beiträge gestrichen 
werden. Nach solcher Richtigstellung der Mitgliederliste trat die 
Gesellschaft das Jahr 1896 mit einem Bestände von 438 ordentlichen 
Mitgliedern an. Hie von schieden 4 durch Tod, 2 durch Wegzug, 
17 anderweitig aus. Hiezu traten 15 durch Neuaufnahme, so dafs 
am 31. Dezember 430 ordentliche Mitglieder die Gesellschaft bilden. 
Die Namen der Verstorbenen werden hier zu ehrendem 
Gedächtnis aufgeführt: 

Albrecht Hohenner, 

Julius Stief, 

Rudolf Engelhard, 

August Pickel. 
Die Überlebenden werden ihnen treue Erinnerung bewahren. 
Als korrespondierende Mitgheder wurden neu erwählt: 
Dr. Paul Ascherson, Professor und Dr. Paul Magnus, Professor, 

DigitizedbyQbogle 



beide an der Universität Berlin, so dafs die Zahl der korrespon- 
dierendeit Mitglieder Ende 1896 38 beträgt. 

Aus der Reihe der Ehrenmitglieder schied durch den 
Tod Lothar Freiherr von Faber, Reichsrat der Krone Bayern 
und Fabrikbesitzer in Stein a. R.; er hat letztwillig unserer Ge- 
sellschaft sein Interesse an ihren Bestrebungen durch ein Legat 
von tausend Mark bewiesen, was an dieser Stelle in dankbarer Er- 
innerung hervorgehoben werden soll. Auch Herr Dr. Stölzl, Professor 
an der k. technischen Hochschule München, früher an der Gewerbe- 
schule Nürnberg, mufs in die Liste der toten Ehrenmitglieder über- 
geschrieben werden. Die Naturhistorische Gesellschaft Nürnberg 
wird auch die Namen von Faber und Stölzl in ehrendem Gedächtnis 
erhalten. Die Zahl der Ehrenmitglieder beträgt am Schlüsse des 
Jahres 1896 24. 

Der geringe Zuwachs an ordentlichen Mitgliedern mag für 
das verflossene Jahr aus dem Umstände erklärt werden, dafs die 
Interessen der gesamten Bevölkerung unserer Stadt durch die 
IL Bayerische Landes-Industrie und Gewerbe- Ausstellung absorbiert 
wurden, so dafs kaum Zeit für die gewohnten Kneip- und Spiel- 
abende, geschweige für die Abendsitzungen einer Gesellschaft übrig 
blieb, welche sogar den Anspruch erhebt, belehrend wirken zu 
wollen. Kommen doch von den Mitgliedern selten mehr als 8Wo 
zu den regelmäfsigen Abend Versammlungen ! Um so erfreulicher 
war es, dafs der Besuch dieser letztern durch die Getreuen selbst 
zur Zeit der verflossenen Ferien trotz Ausstellung u. A. nicht zu 
der Tiefe des Jahres 1895 sank. Gerade diese Getreuen aber be- 
weisen, dafs auch der ermüdete Schulmann, der abgespannte Ge- 
schäftsmann, der angestrengte Beamte, der beschäftigte Arzt, ja 
selbst der ermattete Handwerksmeister, einem regen Interesse zu 
folgen Zeit, Lust und Fähigkeit haben kann. Die alte germanische 
Kampfeslust braucht nicht nur in politischem Gezanke oder beim 
blöden Kartenspiel bethätigt zu werden, sie kann auch in wissen- 
schaftlicher Diskussion sich zeigen. 

In der Chronik der Gesellschaft ist für das Jahr 1896 kein 
besonders erhebendes oder freudiges Ereignis zu verzeichnen; aber 
aufser den Todesfällen der genannten Mitglieder ist der Gesellschaft 
auch kein gröfseres Unheil widerfahren. 

Das Jahr ist für uns als eines ruhigen Fortschreitens und 
einer Art behaglicher Umschau im Gebiet der Naturwissenschaften 
zu bezeichnen. 

Digitizedöy VjOOQIC 



Dafür legen die zahlreichen Referate und Demonstrationen 
Zeugnis ab, welche der nachfolgende Bericht enthält Es brachte 

in der Sitzung am 8. Januar : 
Herr Schwarz ein Sortiment exotischer Schmetterlinge, Geschenk 
des Herrn Dr. Lessing; 
> Kaulfufs eine Reihe von Schmetterlingen, exotische und 

einheimische ; 
» Schwarz zwei Darmsteine vom Pferde und Referat über 
diese Bildungen; 

in der 2. Sitzung am 15. Januar: 
Herr Dr. Heerwagen, Vortrag über die Verbreitung der Kameele ; 
Schenkung der Verbreitungskarte; 
» Dr. B a u m ü 1 1 e r , Demonstration einer Holzbüchsemit Schnitzerei- 
Verzierung von der Insel Java und eines Paars Kastagnetten 
einer italienischen Tänzerin, Geschenke des Herrn Lambrecht; 
eines Petrefacts aus dem Diluvialsand bei Mögeldorf, Ge- 
schenk des Herrn Lehrers Speckhardt; 
« Hub er, Obergabe einiger männlichen Skelettteile vom hän- 
genden Fels bei Streitberg, Geschenk des Herrn Bing; 
Dr. Low i, Demonstration eines Stücks Bernstein mit Insekten- 
einschlufs ; 
» Förderreuther, Vorlage von »Heike, Geschichte der Reichs- 
stadt Nürnberg« ; 

in der 3. Sitzung am 29. Januar: 
Herr Dr. Frankenburger, Vortrag über die Bakteriengifte und 
Gegengifte ; 
- Kaulfufs, Demonstration einer Reihe farbenprächtiger exo- 
tischer Lepidopteren ; 

• Dr. Heerwagen, Bericht über den literarischen Einlauf; 

• Schwarz, Vorlage von Eryon arctiformis aus dem Platten- 

kalk von Solnhofen, Geschenk des Herrn Funk; 

• Dr. Heerwagen, Demonstration einiger ausgestopfter Vögel : 

Captaube, Tölpelschwalbe und Stummelmöve, Geschenke 
des korresp. Mitgliedes Herrn Kapitän Maeco ; 
» Schwarz, Demonstration eines Feldsperlings; 
in der 4. Sitzung am 5. Februar: 
Herr Dr. Bau mü Her, Demonstration multipler subcutaner Fibrome 
und Referat über die Bildung und den Bau derselben; 
in der 5. Sitzung am 12. Februar: 
Herr Dr. Heer wagen, Bericht über den literarischen Einlauf; 

Digitized by VjOOQ IC 



Herr Dr. B a u m ü 11 e r , Übergabe von Gesehenken des Herrn Lanibrecht : 
Granit vom Nordkap, ein Löffel aus Renntiergeweih; 
derselbe, Vortrag über Wirkung der kleinkalibrigen Hand- 
feuerwaffengesehosse mit Demonstration von Knochen und 
Vorlage von Kochers und Beckhs Werken; 
in der 6. Sitzung am 19. Februar; 
Herr Dr. Hefs, Experimental vertrag über Röntgenstrahlen; 

> Füchtbauer, Demonstration U-förmiger GeiTsler'schen Röhren, 

sogen, elektrischer Ventile; 

in der 7. Sitzung vom 26. Februar : 
Herr Huber, Vortrag über den Petersberg bei Maastricht und 
dorther mitgebrachte Gesteine; 
» Dr. Baumüller, kurze Schilderung der Schichten des Kreide- 
systems ; 
» Dr. Heerwagen, Bericht über den literarischen Einlauf; 
in der 8. Sitzung am 4. März: 
Herr Dr. v. Forster, Vortrag über altperuanische Urnen: 

» Dr. Baumüller, Demonstration eines Schädels mit sogen. 

Inka-Bein ; 
» Dr. Heerwagen, Bericht über den literarischen Einlauf; 
in der 9. Sitzung am 11. März: 
Herr Dr. Hartwig, Vortrag über die astronomischen Grundlagen 
des Kalenders unter Demonstration eines Planetariums; 
» Voit, Demonstration von Raupen des Kiefernspanners und 

Eiern des Mikroastes an denselben ; 
» Schwarz, Referat über parasitäres Vorkommen von Rhinanthus 

hirsutus auf Roggenwurzeln; 
» V. Huber-Liebenau, Demonstration von Viscum album auf 
einem Fohrenzweig; 

in der 10. Sitzung am 18. März: 
Herr Dr. Heerwagen. Bericht über den Inhalt zweier habanesischer 
Abhandlungen über die Verbreitung der Tuberkulose durch 
Besuch der Kaffeehäuser; 
derselbe, Vorlage von Photogrammen nach Röntgen, von 
Walter König in Frankfurt; 

> Dr. Baumüller, Bemerkungen über die Bedeutung der Röntgen- 

sehen Strahlen für die Chirurgie; 
» Kaulfufs, Demonstration exotischer Schmetterlinge; 
» Schwarz, Vorlage eines inkrustierten Zweiges aus der 

Kissinger Saline ; 

Digitized by VjOOQ IC 



^ _7 

Herr Schwarz, Obergabe von Geschenken des Herrn Grofs und 
des Herrn Kränzte für das Herbar; 
in der 11. Sitzung am 25. März: 
Herr Dr. Heerwagen, Bericht über den literarischen Einlauf; 
» Huber, eine Schenkung von Schriften von der Weltausstellung 

zu Chicago; 
» Schwarz, Demonstration zweier Eier vom Somali-StrauÜB ; 
» V. Schultheifs, Demonstration einer Cacteen-Neubildung ; 

> Schwarz, Referat über die Keimblätter bei den Papilionaceen, 

mit Demonstration von Exemplaren von Lupinus angusti- 
folius von Herrn Aug. Müller aus Samen gezogen; 

> S'chwarz, Demonstration einer in Diluvialsand bei Pillenreuth 

von Herrn Förderreuther gefundenen Koralle; 
in der 12. Sitzung am 1. April: 
Herr Dr. Heerwagen, Bericht über den literarischen Einlauf; 

> Dr. Baumüller, Demonstration einer als Tauschangebot ein- 

gesendeten Sammlung ethnographischer Gegenstände; 
» Erhard, Demonstration und Schenkung ausgezeichneter 

Petrefakten aus dem Miocen bei Ortenburg; 
» V. Schultheifs, Demonstration einer Alo3 nigricans; 
in der 13. Sitzung vom 8. April : 
Herr Schwarz, Vortrag über die Gentianeen; 

derselbe, über sogen. Hexenbesen, nach einer Schrift von 

Prof. Magnus; 
derselbe, Demonstration einer Probe von Gagatkohle im 
rhätischen Keuper bei Guntersbühl von Herrn Huber 
gefunden ; 
derselbe; Demonstration eines von Herrn Rodler geschenkten 
Stückes verkieselten Koniferenholzes aus dem Diluvium 
bei Forchheim; 

in der 14. Sitzung am 15. April: 
Herr Dr. Stockmeier, Vortrag über Nitrocellulose, rauchloses 
Pulver, Celluloid und künstliche Seide mit Experimenten; 
» Huber, Demonstration eines Mastod onzahnes von Landshut; 
in der 15. Sitzung am 22. April: 
Herr Dr. Baumüller, Demonstration der Mumie der Julia Pastrana 
und Vortrag über normale und abnorme Behaarung beim 
Menschen ; 
» Dr. Heerwagen, Bericht über den literarischen Einlauf; 
» Schwarz, Demonstration von Paradiesvogelbälgen, von der 
Lannaea in Berlin eingesendet; 



Digitized by VjOOQ IC 



8 

Herr V. Schultheils, Demonstration blühender Exemplare von 
Aloe glauca und Gasteria lingua und einer mit Früchten 
besetzten Mammillaria polythele eolumnaris ; 

in der 16i Sitzung am 29. April: 
Herr Dr. Heerwagen, Bericht über den literarischen Einlauf; 
» Kinkel in, erster Bericht über seine Reise nach dem Orient 

(Triest, Griechenland) ; 
» Förderreuther, Besprechung einer Touristenkarte durch 

das Pegnitzthal ; 
» Schwarz, Bemerkungen über Helleborus foetidus und Euphorbia 
amygdaloides (von Herrn Lucas aus Metz eingeschickt) ; 
derselbe, Demonstration eines Latschenzweigs aus der Nähe 

des Dutzendteichs; 
derselbe, Demonstration des Moschusblümchens; 

in der 17. Sitzung am 6. Mai: 
Herr Schwarz, Vortrag über die Flechten; 

derselbe, Demonstration von Pflanzenabdrücken aus mährischen 
Kohlenflözen (aus der LöfTelholz'schen Schenkung); 

in der 18. Sitzung am 20. Mai: 
Herr Kinkelin, zweiter Bericht über seine Orientreise (Palästina, 
Nazareth) ; 

> V. Schultheifs, Demonstration von Sedum fruticosum mi 

Verbänderung ; 

» Schwarz, Demonstration eines Fichtenastes mit Verbänderung ; 

» Erhard, Schenkung eines schönerhaltenen Pecten von Orten- 
burg; 

» Dr. Baumüller, Übergabe eines Messers aus Cattaro, Geschenk 
des Herrn Lambrecht, und einer Scheidenmuschel, Solen 
Vagina, Geschenk des Herrn Elliesen, sowie einiger Frag- 
mente von menschlichen Unterkiefern von einer städtischen 
Baustelle ; 

» Förderreuther, Demonstration von Equisetum maximum; 

» Dr. Heerwagen, Bericht über den literarischen Einlauf; 

> Schwarz, Demonstration von Bartramia pomiformis; 

» KaulfuDs, Schenkung mikroskopischer Präparate von Algen 

und Laubmoosen ; 
» Dr. Baum ül 1er, Vorlage der von Herrn Esper in Kirchheim- 

bolanden eingesendeten reichhaltigen Schenkung von Petre- 

fakten aus der oberen Kohle; 



Digitized by VjOOQ IC 



9_ _ 

in der 19. Sitzung am 27. Mai : 
Herr Schwarz, Vorzeigung dreier lebender junger Eulen und 

Referat über die bei uns vorkommenden Eulen ; 
» Voigt, Vorlage eines grolsen Stalaktiten von einem Acker 

bei Pegnitz; 
» Aug. Schmidt, Vorzeigung einer Raupe vom Weidenbohrer; 
» Dr. Heerwagen, Referat über das Wachstum und den 

Muskelapparat derselben Raupe; 
» Schwarz, Vorlage einer Reihe von Herrn Barbeck an der 

Riviera gesammelten Pflanzen (z. B. Eucalyptus globulus); 
in der 20. Sitzung am 3. Juni : 
Herr Erhard, Vortrag über die Ernährung der Pflanzen; 
» Dr. He er wagen, Bericht über den literarischen Einlauf; 
» Dr. Baum Ol 1er, Referat über v. Chlingensperg : »Die 

römischen Brandgräber bei Reichenhall« ; 
» Enslin, Demonstration von Kaulquappen in verschiedenen 

Stadien der Entwicklung; 
» Kaulfufs, Vorlage einer Reihe von Schwärmern def europ. 

Fauna ; 
» V. Schultheifs, Demonstration von Euphorbia metoformis 

und Caput medusae; 

in der 21. Sitzung am 10. Juni: 
Herr Schwarz, Vorlage von Lychnis viscaria, an deren Klebstoff 

sich ein Citronenfalter fing; 
» Aug. Schmidt, Demonstration von Eichenlaub mit enormer 

Gallapfelbildung ; 
• Schwarz, Vorlage von Petrefacten der Monotisplatte (Monotis 

substriata) ; 
» Kinkelin, III. Bericht Ober seine Orientreise (See Genezareth 

bis Jerusalem); 

in der 22. Sitzung am 17. Juni : 
Herr Huber, Übergabe von Petrefakten aus Solnhofen (von Herrn 

Oskar Bock geschenkt); 
> Kinkelin^ IV. Reisebericht über seine Orientreise (Jerusalem- 
Jericho) ; 
» Dr. Baumüller, Obergabe der von der kgl. Akademie der 

Wissenschaften geschenkten Karte vom Bodensee; 
» Schwarz, Bericht über den Gesellschaftsausflug nach Hil- 

poltstein ; 
» V. Schultheifs, Demonstration von Sempervivum arachnoi- 

deum in blühendem Zustand ; 



Digitized by VjOOQ IC 



10 

Herr Dr. Heerwagen, Bericht über den literarischen Einlauf; 
in der 23. Sitzung am 24. Juni: 
» Kinkel in, IV. Bericht über seine Orientreise (Totes Meer); 
derselbe, Übergabe einer von Herrn Seyschab geschenkten 
riesigen Eidechse aus Westindien: des Teju; 

> Kinkel in, Demonstration lebeoder Spanischer Fliegen (Lytta 

vesicatoria) ; 

in -der 24. Sitzung am 1. Juli : 
Herr Lukas, Demonstration von Bluten des Tulpenbaums; 

> Dr. Heerwagen, Bericht über den literarischen Einlauf; 

» Schwarz, Demonstration eines Blattabdrucks von Quercus 
pedunculata, in erhärtetem Lehm als »recente Versteine- 
rung« aufzufassen; 

> Kinkelin, Demonstration eines schönen Exemplars der 

Kragenechse (Chlamydosaurus kingi); 
» Schwarz, Demonstration von Lupinus angustifolius; 

> V. Schultheifs, Demonstration von blühendem Echinocactus ; 

in der 25. Sitzung am 8. Juli: 
Herr Sachs: Übergabe einer Kollektion von Reptilien und In- 
sekten aus Matagalpa (Nicaragua), Geschenk des dortigen 
Plantagenbesitzers Herrn Überselzig; 

> Kinkel in, V. Bericht über seine Orientreise (Bethlehem); 

> Kaulfufs, Demonstration eines von ihm in Bayern zum 

ersten Mal gefundenen Mooses (Thuidium ßlandowii); 
» V. Schultheifs, Demonstration von Aloe saponaria und einer 
Ceropegia ; 

in der 26. Sitzung am 15. Juli: 
Herr Dr. Baumüller, Demonstration von Proben belgischen Mar- 
mors, Geschenk des^ Herrn Schüchner ; 

> Enslin, Demonstration eines Sperbers; 

> Förderreuther, Demonstration von Lupinus Cruicksankii 

und Lupinus mutabilis; 
derselbe, Demonstration vdn Gordius aquaticus und eines Exem- 
plars von Parnassius Apollo; 
» V. Schultheifs, Demonstration von Echinocereus dubius und 
Opuntia Rafinesquiana ; beide in blühendem Zustand; 
in der 27. Sitzung am 29. Juli: 
Herr K i n k e 1 i n , VI. Bericht über seine Orientreise (Kairo, Pyramiden) ; 
» V. Schultheifs, Demonstration von Gereus Seidelii in 
blühendem Zustand; 

Digitized by VjOOQ IC 



11 

Herr Dr. Baum ii Her, Demonstration von grobkörnigem Keupersand- 
stein von den Kanaiisierungsarbeiten in der Friedrichstrafse ; 
in der 28. Sitzung am 29. Juli: 
Herr Dr. Heerwagen, Bericht über den literarischen Emiauf: 
» Kinkel in, Demonstration von Straufseneiern und einer Ab- 
bildung einer Straufsenzucht in Ägypten (Matariye); 
> V. Schultheifs, Demonstration von Gasteria acinacifolia mit 
reichem Blütenschmuck ; 

in der 29. Sitzung am 5. August: 
Herr Kinkel in, Schenkung einer Rautenschlange, Morelia argus und 
eines Harduns, Agama stellio; 
» Dr. H eer wagen, Vorlage einer Raupe von Acherontia Atropos, 

bei St. Johannis gefunden von Herrn Dr. Heinlein; 
» Schwarz, Demonstration von sog. Meteorpapier; 

• Dr. Baumüller, Vortrag über die Schilddrüse, ihre Funktion, 

ihre Entartung und die Folgen ihrer operativen Entfernung; 
» Schwarz, Vorlage einer MiTsbiidung an einer Rose, wahr- 
scheinlich durch Insektenstich entstanden, und eines Früchte 
tragenden Zweigs des Götterbaums ; 

in der 30. Sitzung am 12. August: 
Herr Dr. Baumüller, Vorlage von Skelettresten, bei einer Strafsen- 

regulierung hier gefunden (Geschenk des Stadtmagistrats); 
» Dr. Heerwagen, Bericht über den literarischen Einlauf; 
» Schwarz, Vorlage von Eiern des Gorvus corone (Geschenk 

des Herrn v. Huber-Liebenau) ; 
» Rudel, Demonstration eines fruchttragenden Zweiges von 

Aristolochia Clematitis, Zweige von Juniperus sabina und 

von Pinus cembra; 
» Paalzow, Schenkung einer WurzelgaUe von einer Erle aus 

der Hüttenbachschlucht ; 

* Kinkelin, Schenkung eines jungen Exemplars vom fliegenden 

Hund, Pteropus edulis; 

» Dr. Heerwagen, Obergabe von: Charadrius pluvialis, Gold- 
regenpfeifer, Geschenk des Herrn Wiedder, Gallinula 
chloropus, grünfüfsiges Rohrhuhn, Geschenk des Herrn 
Uhner; 

» Dr. B a u m ü 1 1 e r , Übergabe eines Exemplars einer Zwergfleder- 
maus (Vespertilio pipistreUus), Geschenk des Herrn Gallinger ; 

» Schwarz, Vorlage einer von Herrn Simon zum bayer. Landes- 
herbar geschenkten Reihe von Pflanzen; 



Digitized by VjOOQ IC 



12 

in der 31. Sitzung am 19. August: 
Herr Schwarz, Vorlage einer Probesendung der Linnaea in Berlin: 
eines deutschen Bibers und biologischer Metamorphosen- 
präparate ; 

> Rudel, Deoaonstration blühender Exemplare von Anastatica 

hierochuntica ; 
» Paalzow, Vorlage eines Pilzes, Guepinia helvelloides ; 
» Kinkelin, Vorlage eines Tausend fufses vom Queensland, 

Scolopendra gigantea; 
» V. Schultheifs, Demonstration von Echinocactus setispinus 
und Echinocactus longehamatus mit eigentümlichem Rippen- 
wachstum ; 
» Schwarz, Bericht über d. Gesellschaftsausflug nach Schwarzach; 
in der 32. Sitzung am 26. August : 
Herr Enslin, Demonstration eines lebenden Exemplars der öster- 
reichischen Natter; 
» Dr. Heerwagen, Referat über die von der Linnaea eingesen- 
deten Präparate (s. 31. Sitzung); 
» Erhard, Schenkung von schönen Exemplaren von Kamm- 
muscheln aus dem obern Miocen von Ortenburg ; 
in der 33. Sitzung am 2. September : 
Herr Paalzow, Vorlage kolorierter eigenhändiger Pilzzeichnungen ; 
» Dr. Heerwagen, Vorlage einer bei Sperberslohe erlegtenOhreule ; 
derselbe, Bericht über den literarischen Einlauf; 

> Dr. Bernett, Bemerkungen über den Unterschied zwischen 

Höhlenlöwen- und Höhlenbärenschädel und den recenten 
Löwen- und Bärenschädeln ; 
» V.SchuUheifs,DemonstrationvonSempervivum, tajaulaeforme; 
in der 34. Sitzung am 9. September: 
Herr Dr. Heerwagen, Bericht über den literarischen Einlauf; 

derselbe, Übergabe eines sogen. Kropf- oder Paterlessteins 
vomOchsenkopf (Geschenkdes Herrn Dr. Schmidt- Wunsiedel); 
» V. Schultheifs, Demonstration von Echinocactus ingens; 
in der 35. Sitzung am 16. September : 
Herr Kinkel in, Demonstration einer Schwarzotter (Pseudechis 
porphyriacus) ; 
» Dr. Baumüller, Bemerkungen über den Fango; 
» Erhard, Schenkung einer Gastropacha quercifolia; 
in der 36. Sitzung am 23. September: 
Herr Enslin, Vorzeigung lebender Exemplare der Ringelnatter 
und der Knoblauchkröte und Schenkung einer glatten Natter ; 



Digitized by VjOOQ IC 



13 

Herr Dr. Heerwagen, Bericht über den literarischen Einlauf; 
» Kinkelin, Schenkung einer Dornschwanzeidechse (Uromas tix 

spinipes) ; 
» Dr. Löwi, Demonstration eines Kalksteins mit eigentümlichen 

Verwitterungen vom Herzogenstand; 
» Schultheifs, Demonstration von Stapelia variegata; 
in der 37. Sitzung am 30. September: 
Herr Kinkel in, Schenkung ausländischer Eidechsen (2 Gymnodac- 
tylus punctatus und Diporophora australis); 

> V. Schultheifs, Demonstration von Euphorbia cereiformis und 

Euph. globosa, beide blöhend ; 

> Oskar Gebhard, korresp. Mitglied, Vortrag über Fundstellen, 

Eigenschaften und Verwendung von Maltazit, Orthoklas, 
Chlorit, Voigtit und anderer von ihm zur Sammlung ge- 
schenkter Mineralien vom Fichtelgebirge; 

* Schwarz, Vortrag über Verbreitung von Tieren und Pflanzen 

durch den Verkehr; 
» Spandel, Bericht über Einiges von der Frankfurter Natur- 
forscherversammlung ; 
» Schwarz, Vorlage von Lycopodium clavatum, dem Schlangen- 
moos (von Herrn Hecht aus Danzig übersendet), und von 
diluvialem Gerolle von der Steinplatte bei St. Jobst mit 
Abdrücken einer Muschel (Greschenk des Herrn Ammon); 
in der 38. Sitzung am 7. Oktober: 
Herr Dr. Heerwagen, Bericht über den literarischen Einlauf; 

> Paalzow, Vorlage von Blattabdrücken aus dem Miocen von 

Öningen ; 

» Knapp, Schenkung eines sogen. Wendemauls aus dem 
Mainzer Becken (Trochostoma) ; 

» Schwarz, Bericht über den Gesellschaftsausflug nach Erlen- 
stegen ; 

» Wunder, Bericht über eine Ausgrabung bei Langenzenn ; 

* Schwarz, Demonstration von Darmsteinen vom Pferd, Ge- 

schenk der Herren Metzger und Böhm; 

* V. Schultheifs, Demonstration von Eucomis punctata in 

blühendem Zustande; 
» K in k e 1 i n, Schenkungeiner Baumnatter(Dendrophis punctulatus); 

* Schwarz, Referat über* eine Schenkung des Herrn Weidner 

in Gerasmühle : Magnolien etc. ; 

in der 39. Sitzung am 14. Oktober: 
Herr Tölke, Demonstration einer Nepenthes; 

Digitized by VjOOQ IC 



14 

Herr Lucas, Geognostische Mitteilungen aus der Umgebung von 
Metz; 

> V. Schultheifs, Demonstration einer Stapelia deflexa und einer 

Opuntia Schottii; 

> Voigt, Schenkung von Schriften, Zeichnungen und Karten 

aus dem Nachlafs seines Herrn Schwiegervaters Friedrich 
Sturm; 

in der 40. Sitzung am 21. Oktober: 
Herr Dr. Bau mü 11 er, Eine Erinnerung an das '95. Bestehen der 
Gesellschaft ; 

> Dr. Hanau, Vortrag über die Geschichte der Äthernarkose; 
» Dr. Bernett, Übergabe des Berichtes über die Versammlung 

nordbayerischer Anthropologen (siehe Jahresbericht der 
antropol. Sektion); 

> Paalzow, Schenkung von Petrefakten aus der Gegend von 

Genf; 

> Lucas, Schenkung einer Karte von Schwaben aus dem 

Jahre 1625; 

> Huber, Demonstration getrockneter KafTeekirschen ; 

» Dr. von Oefele-Neuenahr, Mitteilungen über den Droguen- 
handel im alten Ägypten; 

in der 41. Sitzung am 28. Oktober: 
Herr Dr. Heerwagen, Bericht über den literarischen Einlauf; 

> Dr. Baumüller, Mitteilungen aus der Geschichte der Chirurgie 

(Peter Frank und Lorenz Heister); 

> Kinkel in, Demonstration von Varanus punctatus und anderer 

Reptilien ; 
» Hör mann, Proben von Kork, Geschenk des Herrn Bromig; 
» V. Schultheifs, Demonstration einer von ihm gezogenen 

Mexikanischen Schlingpflanze, Mina lobata; 
» Ertheiler, Demonstration einer Rarität: eine durch einen 

abgebrochenen Bierflaschenhals gewachsene Gelbrübe; 

in der 42. Sitzung am 4. November: 
Herr Kinkel in, Schenkung einer austr. Otter (Diemenia tertilis); 
» Schwarz, Vortrag über die geologischen Verhältnisse der 

Umgebung von Amberg; 
» V. Schultheifs, Demonstration von Crassula gracilis mit 
Blüten ; 

> Schwarz, Obergabe einer Harnblase vom Schwein mit Diver- 

tikelbildung ; 

Digitized by VjOOQ IC 



15 

Herr Paalzow, Schenkung eines Abdruckes von Limulus in Soln- 
hofener Kalkschiefer; 

in der 43. Sitzung am 11. November : 
Herr Dr. Heer wagen, Bericht über den literarischen Einlauf; 
derselbe, Obergabe eines Seeigels aus der Kreide, Geschenk 
des Herrn EUiesen; 
» Dr. Frankenburger, Mitteilungen über Schlangengifte; 
in der 44. Sitzung am 18. November: 
Herr Aug. Schmidt, Vortrag von Reiseschilderungen seines Sohnes 
aus Java; 
» Huber, Referat über einen Acetylengasometer ; 

> Kinkel in, Schenkung von Schlangen aus Australien; 

» Dr. Baumüller, Vorlage eines auffallend kleinen Einhufer- 
schädels, gefunden bei der Grundaushebung am Fünferplatze; 
in der 45. Sitzung am 25. November: 
Herr Dr. Neubur ger, Vortrag über tierische Schmarotzer im mensch- 
lichen Auge; 
» K i n k e 1 i n , Schenkung einer Agama agilis (Eidechse) aus Persien ; 

> Dr. Baumüller, Vorlage von Forellenschmarotzern aus der 

Pegnitz bei Vorra, übersendet von dem früheren Gouverneur 
von Ostafrika, Freiherm von Soden; 
» Schwarz, Vortrag über Schmarotzer im. Auge der Haustiere; 

derselbe, Demonstration von Schwerspat aus Wendelstein; 
» Dr. Heerwagen, Bericht über den literarischen Einlaüf; 
in der 46. Sitzung am 2. Dezember: 
Herr Dr. Frankenburger, Vortrag über die Wirkung des Alkohols 
auf die menschliche Zelle ; 
» Dr . B a u m ü 1 1 e r^DemonstrationeinesPar iserSalon-Phonographen ; 
derselbe, Obergabe eines von Ameisen zerfressenen Holz- 
* Stammes, Geschenk des Herrn Forchheimer; 

> Schwarz, Demonstration eines Eisente; 

> Kinkel in, Schenkung eines Phrynocephalus mystaceus 

(»Krötenkopf«); 

> Kaulfufs, Schenkung mehrerer teilweise neuaufgefundener 

Moosarten ; 

> V.Schultheifs, Demonstration eines blühenden Exemplars von 

Hesembryanthemum Salmianum; 

> Schwarz, Obergabe von Glimmerschiefer mit Granaten- 

einschluls vom Böhmerwalde, Geschenk des Herrn Optikers 
Schmidt ; 

Digitized by VjOOQ IC 



16 

in der 47. Sitzung am 9. Dezember : 
Herr Dr. Heerwagen, Bericht über den literarischen Einlauf; 
» Kaulfufs, Demonstration von mikroskopischen Präparaten 
zur Histologie der Moose; 

> Paalzow, Referat über Freiherrn v. Stromer's Dissertation: 

Geologie von Afrika (deutsche Schutzgebiete); 

* Kinkel in, Schenkung einer Agama pallida, (ägypt. Wechsel - 
agame) ; 

» V. Schultheifs, Referat über Schmarotzer auf Cacteen; 

» Kaulfufs, Schenkung von Moosen zum Herbar; 

» Dr. Baumüller, Übergabe zweier Solnhofener Platten mit 
Abdrücken von Pterodactylus, Geschenk des Herrn Hutzel- 
meyer; 

in der 48. Sitzung am 16. Dezember: 
Herr Dr. Baumül 1er, Vortrag über die StatikdesmenschlichenFufses; 

in der 49. Sitzung am 23. Dezember : 

Herr Wunder, Vortrag über die Ergebnisse einer Ausgrabung bei 

Rückersdorf ; 
» Paalzow, Referat über: Praktische Geologie von Keilhack; 
» Kinkelin: Schenkung zweier Eidechsen : Anolis carolinensis 

und Gehyra variegata; 

in der 50. Sitzung am 30. Dezember: 

Herr Kaulfufs, Vortrag über Bryogeographisches aus dem Pegnitz- 
gebiet ; 

> Kinkel in, Schenkung eines Exemplars von Acanthodactylus 

vulgaris (Fransenfinger) aus Süd-Spanien; 

» Schwarz, Demonstration von Fossilien aus dem Franken- 
dolomit am Wichsenstein; 
derselbe, Vorlage einer Reihe getrockneter Pflanzen, Geschenk 
des Herrn Simon; 

» Preifs, Demonstration eines echten rumänischen Frauen- 
kostüms und rumänischen Puppenkleidchens. 

In diesen 50 Sitzungen wurden also 234 Vorträge, Referate, 
Mitteilungen, Berichte und Demonstrationen gebracht, ein Beweis 
eines regen und anregenden Gedankenaustausches. Über den Ver- 
lauf der Sitzungen wurde von den Herren Dr. Hartwig und Förder- 
reuther im Turnus Protokoll geführt. 

Digitized by VjOOQ IC 



17 

Die ordentliche Generalversammlung fand am 22. Januar 
statt; in ihr wurden sämtliche Herren der Vorstandschaft wieder- 
gewählt. 

Über den abschlägigen Bescheid auf eine Eingabe um einen 
Staatszuscbufs mufs sich die Naturhistorische Gesellschaft mit vielen 
andern Gleichen trösten und mit Geduld und Ausdauer kommender 
geneigterer Gesinnung harren. — Gutta eavat lapideml — 

Um so dankenswerter mufs der auch für dieses Jahr be- 
willigten Zuschüsse des hiesigen Stadtmagistrats und des mittel- 
fränkischen Landrats gedacht werden. Der erstere unterstützt 
aufserdem die Gesellschaft durch Zuweisung von Skelettfunden, 
Büchern u. a. 

Des Legates des verstorbenen Ehrenmitglieds Frhrn. v. Faber 
in Stein wurde oben schon gedacht 

Über die Mehrungen, welche die Bücherei und die Sammlungen 
naturgeschichtlicher Objecte erfuhren, bringen die folgenden Berichte 
Näheres. An dieser Stelle soll im Namen der Gesellschaft der 
beste Dank und der Wunsch nach Forterhaltung des bewiesenen 
Wohlwollens ausgesprochen werden. 

Die Berichte der wissenschaftlichen Sektionen ergeben die er- 
freuliche Thatsache^ dafs auch für Einzelfragen und deren ein- 
gehende Behandlung sich Viele aus des Alltagsberufes Mühen in 
den Schols der wissenschaftlichen Erholung zu retten wissen. 

Nach aufsen hat namentUch die anthropologische Sektion 
Zeugnis für ihr Schaffen durch Einberufen eines Kongresses nord- 
bayerischer Anthropologen und Prähistoriker gegeben. 

Die geographische und chemische Sektion wetteifert ebenso 
wie die vorhererwähnten in Überweisung wertvoller Zuwendungen 
zur Bibliothek, die letztere schaffte aus ihren Mitteln einen mikro- 
photographischen Apparat. Auch für solche Hülfe hat die Gesell- 
schaft dankbarst zu empfinden. 

Auch von Personen, welche der Gesellschaft fernerstehen, 
werden in erfreulicher Weise die Bestrebungen derselben unterstützt, 
so durch Zuweisung von Naturalien, von Büchern, sowie durch 
Schenkung von Schuldscheinen, deren Verlosung laut Bericht über 
die Verwaltung gemäfs den Bestimmungen über die Aufnahme der 
Schuld, immer noch nicht möglich ist. 

Selbstverständlich aber sind Schenkungen von Naturalien aus 
der Reihe von Mitgliedern als fortdauernder Beweis reger Anteil- 

2 



Digitized by VjOOQ IC 



18 

nähme zu begrüfsen, so namentlich jene zur Reptilien-Sammlung, 
womit Herr Kinkelin, und zum Herbar, womit Herr Kaulfufs 
und Herr Simon uns erfreuten. Angekauft wurde aus den Beständen 
der Sammelbüchse eine wertvolle Reihe exotischer Schmetterlinge, 
und durch freiwillige Beiträge eine Serie sehr wertvoller Paradies- 
vögel aus Neu-Guinea. 

So wolle auch für das kommende Jahr dem weiteren Lebens- 
weg der alten, nicht veralteten Naturhistorischen Gesellschaft zu 
Nürnberg ein freundlicher Stern voranleuchten ! 



Digitized by VjOOQ IC 



19 _ 

IL Bericht über die Bibliothek. 

Einlauf im Jahre 1896 100 Nummern. Am 31. Dezember 1896 
sind 3300 Katalog-Nummern vorhanden. 

Ausgeliehen wurden 50. Bände an 16 Mitglieder (im Vorjahr 
88 Bände an 19 Mitglieder.) 

Von Ankäufen ist besonders zu erwähnen: 
Gümbel, Geologie von Bayern. 
Rees^ Lehrbuch der Botanik. 
Neumader^ Geologie, 2 Bände. 

Gümbely Geognostische Besehreibung der schwäbischen Alp. 
Zeitschriften wurden gehalten: 

Archiv fii/r Anthropologie ; Biologisches Ceniralblatt; Glo- 
bus; NaiurwissensthafIMche Rtmdsehau; Zeitschrift für Ethno- 
logie; Botanisches Ceniralblatt ; Deutsche boia/nische Monats- 
schrift; Geographisches Jahrbuch; Kolonialzeitimg; Petermanns 
Mitteihmgen. 

Als Geschenke erhielten wir: 

Von Herrn Ballhorn die Zeitschrift .^Prometheus", 

Von Herrn Dr. EUiesen die Zeit^chriß für Naturunssen- 
schaftenj 69. Band 1896. 

Verschiedene Werke und Karten von der botanischen, geo- 
graphischen, anthropologischen und chemischen Sektion. 

Eine Anzahl Bücher von den Herren : 

Dr. Dr. Dieudonn4,Wettstein, Blasius, Fleisch mann, 
Pfarrer Rudel, Kaufmann Voigt, Freiherrn v. Stromer, 
Spandel, Irlbacher, v. Lucas, Stabsveterinär Schwarz, 
Dr. Wagner und der Schräg' sehen Hofbuchhandlung. 

Tauschverkehr besteht mit 235 wissenschaftlichen Körper- 
schaften. 



Digitizec?* Google 



20 



An den Bericht über die Bibliothek ist anzureihen jener über die 
Einsendungen, welche wir von den im Schriftenaustausch mit uns 
stehenden gelehrten Körperschaften erhielten. Derselbe enthält die 
Namen dieser Körperschaften und die von ihnen im Jahre 1896 einge- 
sendeten Werke: 

A. Europa. 
I. Dentsolies Beicli. 

1. Altenburg: Naturforschende Gesellschaft des Osterlandes. 

2. Annaberg: Annaberg-Buchholzer Verein für Naturkunde. 

3. Ansbach: Historischer Verein für Mittelfranken. 

4. Augsburg: Naturwissenschaftlicher Verein. XXXII. Bericht. 

5. Bamberg: Gewerbeverein. 

6. „ Naturforschende Gesellschaft. 

7. Berlin: Botanischer Verein der Provinz Brandenburg: Verhandlungen 

37. Jahrg. 1895. 

8. „ Deutsche geologische Gesellschaft: Zeitschrift, 47. Band, 

3.4. Heft, 48. Band, 1.2. Heft. 

9. „ Entomologischer Verein: Berliner entomol. Zeitschr. 40. Bd. 

2. 3. 4., 41. Bd. 1. 

10. „ Gesellschaft naturforschender Freunde: Sitzungs-Berichte, 

Jahrg. 18^5. 

11. „ Kgl. preul'sisches meteorologisches Institut: Ergebnisse etc., 

1996, Heft 2. 1896, Heft 1. 

12. „ Kgl. preufsisches statistisches Bureau. 

13. Blanken bürg: Naturwissenschaftlicher Verein des Harzes. 

14. Bonn: Niederrheinische Gesellschaft für Natur- und Heilkunde: 

Sitzungsb., 1895. 1896. 1. Hälfte. 

15. „ Naturhistorischer Verein der preufsischen Rheinlande, West- 

phalens und des Regierungsbezirks Osnabrück : Verhandlungen, 
52. Jahrg., 53. Jahrg. 1. Hälfte. 

16. Braunschweig: Herzogliches naturhistorisches Museum. 

17. „ Verein für Naturwissenschaft. 

18. Bremen: Naturwissenschaftlicher Verein: Abhandlungen, 13. Bd. 3., 

14. Bd. 1. 

19. Breslau: Schlesische Gesellschaft für vaterländische Kultur: 

73. Jahresbericht, Litteratur der L. u. V.-Kunde der 
Prov. Schlesien, 4. 

20. Calau-Cottbus: Niederlausitzer Gesellschaft für Anthropologie und 

Urgeschichte. 

21. Chemnitz: Naturwissenschaftliche Gesellschaft. 

22. Danzig: Naturforschende Gesellschaft: Schriften N. F. 9. Bd. 1. 

23. D a r m s t a d t : Verein für Erdkunde und der grofsherzogl. geologischen 

Landesanstalt. 

24. Dessau: Naturhistorischer Verein für Anhalt. 

25. Dresden: Kgl. sächs. statist. Bureau: Zeitschrift, 41. Jahrg., 

Heft 3 u. 4; 42. Jahrg., H. 1 u. 2. 

26. „ Naturwissenschaftliche Gesellschaft Isis: Sitzungsber. 

und Abhandlungen, Jahrg. 1895. 

27. Dürkheim: Pollichia: Mitteilungen, LUL, Jahrg. 9. 

28. Düsseldorf: Naturwissenschaftlicher Verein: 

Festschr. zum 50 j. Jubiläum. 

29. Elberfeld: Naturwissenschaftlicher Verein. Jahresber. 8. Heft. 

30. Emden: Naturforschende Gesellschaft: 80. Jahresbericht. 



Digitized by VjOOQ IC 



21 

81. Erfurt: Egl. Akademie gemeinnütziger Wissenschaften: Jahr- 
bücher, N. F., Heft 22. 

32. Erlangen: Physikalisch-medicinische Sozietät: Sitzungsberichte, 

26. Heft, 1894. 

33. Frankfurt a. M.: Physikalischer Verein: Jahresbericht 1894/95; 

das Klima von Frankfurt a. M., herausgeg. von 
J. Ziegler u. W. König. 

34. „ Bedaklion des „Zoologischer Garten." 

35. „ Senckenbergische naturforschende Gesellschaft. 

36. Frankfurt a. 0.: Naturwissenschaftlicher Verein des Reg.-Bez. 

Frankfurt: Helios, 13. Jahrg., Nr. 7—12, Soc. 
Litt., Jahrg. 9, Nr. 11 u. 12, Jahrg. 10, Nr. 1—6. 

37. Frei bürg i. Br.: Physikalischer Verein. 

38. Fulda: Verein für Naturkunde. 

39. Giefsen: Oberhessische Gesellschaft f. Natur- u. Heilkunde. 

40. Görlitz: Naturforschende Gesellschaft: Abhandlungen, 21. Bd. 

41. Göttingen: Kgl. Gesellschaft der Wissenschaften und Georg Augusts- 

Universität : Nachrichten, Mathem.-physik. Kl., 1895, 4. 
1896, 1 -3. Geschäftl. Mitteilungen, 1896, 1 u. 2. 

42. Greiz: Verein der Naturfreunde. 

43. Güstrow: Verein der Freunde der Naturgeschichte in Mecklenburg: 

Archiv 49. Jahr 1895, 1. u. 2. Abteilung. 

44. Halle a. S. : Entomologischer Verein. 

45. yy Landwirtschaftliches Institut an der Universität. 

46. „ Kaiserlich Leopoldino-Carolinische Deutsche Akademie 

der Naturforscher: Leopoldina, Heft XXXH. 

47. „ Naturforschende Gesellschaft. 

48. „ Naturwissenschaftlicher Verein. 

49. „ Thüringisch-sächsischer Gesamtverein für Erdkunde. 

50. „ Verein für Erdkunde: Mitteilungen 1896. 

51. Hamburg: Naturwissenschaftlicher Verein: Abb., 14. Band. 

52. „ Verein für naturwissenschaftl. Unterhaltung; Verh., 9. Bd. 

53. Hamburg-Altona: Naturwissenschaftlicher Verein. 

54. Hanau: Wetterauische Gesellschaft für die gesamte Naturkunde. 

55. Hannover: Naturhistorische Gesellschaft. 

56. Heidelberg: Naturhist.-medicin. Verein: Verhandlungen, N. F. 

V. Bd., 4. H. 

57. Hof: Nordoberfränkischer Verein f. Natur-, Geschichts- u. Landes- 

kunde: 1. Bericht. 

58. Karlsruhe: Naturwissenschaftlicher Verein: Verhandlungen, 11. Bd. 

1888 bis 1895. 

59. Kassel: Verein für Naturkunde: Abhandlungen und Bericht, XLI. 

60. Kiel: Naturwissenschaftlicher Verein für Schleswig-Holstein. 

61. Königsberg i. Pr.: Physikalisch-ökonomische Gesellschaft: Schriften, 

36. Jahrg., 1895. 

62. Landshut: Botanischer Verein: 14. Bericht, 1894—1895. 

63. „ Historischer Verein. 

64. Leipzig: Fürstl. Jablonowsky'sche Gesellschaft: Preisschriften 

Nr. 12 u. 13 der math.-naturw. Sektion. 

65. „ Kgl. sächsische Gesellschaft der Wissenschaften : Bericht 

über die Verhandl.; math.-phys. Kl. 1895, 5/6, 1896, 1. 2/3. 
Zur 50 jähr. Jubelfeier; Reden u. Register. 

66. n Naturforschende Gesellschaft. 

67. „ Verein für Erdkunde: Mitteilungen 1895; wissenschaftl. 

Veröffentl.: HI. Bd. 1. Heft, Baumann, die Insel Mafia. 

68. Lüneburg: Naturwissenschaftlicher Verein. 



Digitized by VjOOQ IC 



22 

69. Magdeburg: Naturwissenschaf tiicher Verem. 

70. Mainz: Rheinische naturforschende Gesellschaft. 

71. Mannheim: Verein für Naturkunde. 

72. Marburg: Gesellschaft zur Beförderung der gesamten Naturwissen- 

schaften: Sitzungsbericht 1895. 

73. München: Egl. Bayer.- Akademie der Wissenschaften: Sitzungsber. 

der math.-phys. Kl., 1895, H. 3, 1896, H. 1 u. 2. 

74. „ Bayer. Botanische Gesellschaft: Berichte, Bd.' 4. 

76. „ Geographische Gesellschaft: Jahresbericht für 1894 

und 1895. 

76. Münster: Westphälischer Provinzialverein für Wissenschaft und 

Kunst: 23. Jahresbericht für 1894/95. 

77. Neifse: Philomathie. 

78. Nürnberg: Arztlicher Verein: Sitzungsprotokolle, Jahrg. 1895. 

79. „ Bayr. Gewerbemuseum. 

80. „ Germanisches I^ationalmuseum : Anzeiger Jahrg. 1895, 

Mitteilungen Jahrg. 1895. 

81. „ Gymnasialbibliothek. 

82. „ Medicinische Gesellschaft und Polyklinik: Sitzungs- 

bericht 1895. 

83. „ Stadtbibliothek. 

84. „ Verein für Geschichte der Stadt Nürnberg. 

85. „ Verein für öffentliche Gesundheitspflege. 

86. „ Verein Merkur. 

87. Offenbach: Verein für Naturkunde. 

88. Osnabrück: Naturwissenschaftlicher Verein. 

89. Pas sau: Naturhistorischer Verein. 

90. Regensburg: Naturwissenschaftlicher Verein: Berichte, 5. Heft, 

1894-1895. 

91. Reichenbach: Voigtlftnd. Verein für -allgemeine u. spez. Landes- 

kunde. 

92. Reutlingen: Natur¥rissenschaftlicher Verein. 

93. Schmalkalden: Zeitschrift des Vereins d. Hennebergischen Ge- 

schichte und Landeskunde. 

94. Schneeberg: Wissenschaftlicher Verein. 

95. Schweinfurt: Naturwissenschaftlicher Verein. 

96. Sondershausen: Botanischer Verein für Thüringen. 

97. Stettin: Verein für Erdkunde. 

98. Stuttgart: Verein für vaterländ. Naturkunde in Württemberg: 

Jahreshefte, 52. Jahrg. 

99. Wernigerode: Naturwissenschaftlicher Verein des Harzes: 

Schriften, 10. Jahrg. 

100. Wiesbaden: Nassauischer Verein für Naturkunde: Jahrbücher, 

Jahrgang 49. 

101. Würzburg: Physikalisch-medicinische Gesellschaft: Sitzungsber., 

Jahrgang 1895. 

102. „ Polytechnischer Zentralverein für ünterfranken und 

Aschaffenburg : Gemeinnützige Wochenschrift, 46. Jahrr 
gang. 

103. Z erbst: Naturwissenschaftlicher Verein. 

104. Zweibrücken: Naturhistorischer Verein. 

105. Zwickau: Verein für Naturkunde: Jahresbericht, Jahrgang 1895. 



Digitized by VjOOQ IC 



23 

n. ött«rr«ioli-ü]igani. 

106. Agram: Kroatischer Natnrforscherrerein. 

107. Aufs ig a. E.: Naturwissenschaftlicher Verein. 

106. Baden bei Wien: Gesellschaft zur Verbreitung naturwissenschaft- 
licher Kenntnisse. 

109. Bistritz: SiebenbOrgisch-sächsische Gesellschaft (Gewerbeschule?) 

110. Brunn: K. k. mährisch-schlesische Gesellschaft zur Beförderung 

des Ackerbaues, der Natur- und Landeskunde: Notizen- 
Blatt der hist.-statist. Sektion, Jahrgang 1895. 

111. „ Naturforschender Verein : Verhandlungen, 84. Bd. ; 14. Ber. 

der meteorolog. Kommission. 

112. Budapest: K. ungarische naturwissenschaftliche Gesellschaft. 

113. Graz: K. k. steierm&rkische Gartenbau-Gesellschaft: Mitteilungen, 

22. Jahrgang. 

114. „ Naturwissenschaftlicher Verein für Steiermark : Mitteilungen, 

Jahrgang 1895. 

115. „ Verein f&r Arzte in Steiermark : Mitteilunffen, 82. Jahrg., 1895. 

116. Hermannstadt: Siebenbürgischer Verein für Naturwissenschaften : 

Verhandlungen und Mitteilungen, 45. Jahrgang; 
der siebenb. Ver.f.Nat. i. Hermannstadt nach seiner 
Entstehung, Entwickelung u. s. Bestände. 8® 1896. 

117. „ Verein füjr siebenbürgische Landeskunde. 

118. „ Siebenbürgischer Karpathenverein: Jahrbuch, 

16. Jahrgang, 1896. 

119. HoFic: K. k. Fachschule fär Bildhauer und Steinmetze, 18. Jahres- 

bericht. 

120. Innsbruck: Ferdinandeum f. Tirol n. Vorarlberg: Zeitschrift, 

8. Folge, 40. Heft. 

121. „ Naturwissenschaftlich-mediz. Verein. 

122. Klagenfurt: Naturhistorisches Landesmuseum f. Kämthen. 

128. Klausenburg: Siebenbürgischer Museumverein: Sitzungsber. der 
met.-naturw. Sektion, 17. Bd., 8. Heft, 18. Bd., I.Heft. 

124. Laib ach: Musealverein für Krain: Mitteil., 18. Jahrg., 1.— 6. H.; 

IzYestja. Letnik 5. S. 1—6. 

125. Leutschau (Lösce): ungarischer Karpathenverein. 

126. Linz: Museum Francisco-Carolinum : 54. Jahresbericht. 

127. Prag: K. Böhmische Gesellschaft der Wissenschaften: Sitzungs- 

berichte 1895, 1 u. .2. 

128. „ Naturhistorischer Verein Lotos : Abhandlungen, 1 . Bd., 1 . Heft. 

129. Pressburg: Verein für Heil- und Naturkunde. 

180. Reichenberg: Verein der Naturfreunde: Mitteilungen, 27. Jahrg. 

131. Salzburg: Städtisches Museum Garolino-Au^usteum. 

182. Triest: Societä adriatica di scienze naturah. 

188. Wien: Entomologischer Verein: 6. Jahresbericht. 

184. „ K. k. Gartenbaugesellschaft: Wiener illustr. Gartenzeitung 

1896, Heft 1-12. 
135. „ K. k. geographische Gesellschait. 

186. „ K. k. geologische Reichsanstalt: Verhandlungen, Jahr- 

gang 1895. 

187. „ Naturhistorisches Hofinuseum: Annalen, Bd. 10, Heft 8/4; 

Bd. 11, Heft 1/2. 

188. „ K. k. zoologisch-botanische Gesellschaft:. Verhandlungen, 

46. Bd. 1 -10, 46. Bd. 1—9. 

189. „ Naturwissenschaftlicher Verein an der Universität. 

140. „ Verein zur Verbreitung naturwissenschaftlicher Kenntnisse: 
Schriften, 85. Bd., 1894/95. 



Digitized by VjOOQ IC 



24 

HL Schwell: 

141. Basel: Natarforschende Gesellschaffc: Verhandlungen, Bd. 11, 

Heft 1 u. 2. 

142. Bern: Naturforschende Gesellschaft. , 

143. Ghur: Naturforschende Gesellschaft Graubündens: Jahresbericht. 

Neue F. 39. Bd. 

144. Frauenfeld: Thurgauische naturforschende Gesellschaft: Mit- 

teilungen, 12. Heft. 
146. St. Gallen: Naturwissenschaftliche Gesellschaft: Bericht 1893/94. 

146. Schweizerische naturforschende Gesellschaft. 

147. Solothurn: Naturforschende Gesellschaft. 

148. Zürich: Naturforschende Gesellschaft: Festschrift (1746—1896), 

1. u. 2. Teil, Vierteljahrsschrift, 40. Jahrg., 3. u. 4. Heft. 

IV. Belgien. 

149. Antwerpen: Acad^mie d'Arch^ologie : Bulletin 4. S, 2. P. 23—27. 

150. Bruxelles: Sociät^ beige de microscopie. 

151. „ Soci^t^ royale malacologique de Belgique. 

152. „ Soci^t^ royale Linnäenne. 

V. Frankreicli. 

153. Cherbourg: Soci^t^ nationale des sciences naturelles et math^- 

matique: Memoires T. 29. 

VI. Grossbritaimien. 

154. Dublin: Natural history society. 

155. Glasgow: Natural history society. 

Vn. Holland. 

156. Amsterdam: Genootschap Natura artis magistra. 

157. Haarlem: Mus^e Teyler. 

158. Leiden: Nederlandsche Dierkundige Vereeniging. 

Vin. Italien. 

159. Brescia: Ateneo: Commentari 1895. 

160. Catania: Accademia Giovania di scienze naturali. 

161. Firenze: Bibliotheca Nationale Centrale: Bolletino d. Public. Ital. 

Indici 1894; 1895 A-D; Num. 240—263. 

162. „ R. Istituto di studi superiori e di perfezionamento. 

163. „ Societä entomologica italiana: Bulletino anno 27, Trim. 

1 u. 2; 3 u. 4. 

164. Milano: B. istituto lombardo di scienze. 

165. Mode na: Societä dei naturalisti: Atti, S. 3, vol. 13, anno 28, F. 2; 

Fol. 14, anno 29, F. 1. 

166. Napoli: R. accademia delle scienze. 

167. Padova: Societa veneto - trentina di scienze naturali: Atti, S. 2, 

Yol. 2, F. 2; Bulletino T. 6, N. 2. 

168. Pisa: Societä malacologica Italiana. 

169. „ Societä Toscana di scienze naturali: Atti, Memoria vol. 14; 

Proc. verb. vol., 10. Januar— Juli 1896. 

170. Roma: R. accademia dei Lincei: Atti, anno 293, S. V, Rendiconti 

vol. 5, 1. Sem. F. 1-12; 2. Sem. F. 1, 3, 9—11. 



Digitized by VjOOQ IC 



25 

171. Borna: Biblioteca nazionale centrale Vittorio Emannele. 

172. „ R. comitato geologico d'Itaiia. 

173. Sassari: UniversitA. 

174. Torino: R. accademia delle scienze: Atti, yoI. 81, disp. 1 — 14; 

Osserv meteorol. 1895. 

175. Venezia: R. istituto delle scienze: Memorie toI. 25, 4, 5, 6. 

176. Verona: Accademia (Agricoltnra, scienze, lottere, arti e commercio) 

Memorie, vol. 71, S. 3, F. 2; vol. 72, S. 3, F. l u. 2. 

IX. Lnzembiirgr. 

177. Luxemburg: Soci^tä botanique de grand-duch^ de Luxembourg. 

178. „ Fauna, Verein Luxemburger Naturfreunde: Mit- 

teilungen aus den Vereinssitzungen, 5. Jahrg., 1895. 

X. RiiSBlAiid. 

179. Dorpat: Naturforscher-Gesellschaft: Archiv för die Naturkunde, 

Liv-, Ehst- u. Kurlands, 2. S., Bd. 1 1, Lfg. 1 ; Schriften, IX. 
Sitzungsberichte, 11. Bd., 1. H. 

180. Helsingfors: Societas pro fauna et flora fennica. 

181. Kiew: Naturforscher-Gesellschaft der Universität. 

182. M i t a u : Kurländische Gesellschaft für Literatur und Kunst : Sitzungs- 

berichte, 1895. 

183. Moskau: Sociät^ imperiale des naturalistes : Bulletin, 1896, Nr. l — 4. 

184. Riga: Naturforscher- Verein : Korrespondenzblatt 38. 

185. St. Petersburg: Hortus petropolitanus : Acto Tom. 14, F. 1., 

Tom. 15, F. 1. 

XI. Sohweden und Norwegen. 

186. Bergen: Museum: Aarbog for 1894/95 ; CrustaceaofNorway vol. 11. 

Part. 1, 2. 

187. Christiania: Universität. 

188. Stavanger: Museum: Aarsberetning for 1894. 

189. Stockholm: Konig Svenska Vetenskaps Academien: öfversigt af 

Förhandlingar 1895; Bihang 20. B, 21. B. 

190. Soci^t^ entomologique : Entomologisk Tidskrift, arg. 16, Haft 1—4. 

191. Tromsö: Museum: Aarsberetning ior 1893; Aarshefter 17. 

192. Upsala: Geological Institution of the university : Bulletin vol. 2, 

p. 2, Nr. 4. 

B. Amerika. 
L Argrentinien. 

193. Buenos aires: Museo Nacional; Annales tomo 4. (S. 2, t. 1). 

194. Cordoba: Academia nacional de ciencias de la republica Argentina. 

n. Brasilien. 

195. Rio de Janeiro: Museu nacional. 

in. Britisch Amerika. 

196. Halifax (Nova Scotia): Nova Scotian Institute of natural science: 

Proceedings and Transactions vol. 8 (2. S., v. 1.) 
lOT. Toronto (Ontario): Canadian Institute: Transactions Nr. 8 (vol. 4, 
Part 2.) 



Digitized by VjOOQ IC 



26 



IV. ChUe. 



198. Santiago: Deutscher wissenschaftlicher Verein. 
199: „ Sociöt^ scientifique du Chili: Actes: Tome II (1892) 

5? 1.; Tome V (1895) le-4« 1.; Tome VI (1896) 1« 1. 

200. „ üniversidad. 

201. „ Museo nacional. 



V. Costa Rica. 

202. San Jos^: Museo nacional: Antiguedades 1. Entr.; Informe 1896. 
Documentos Nr. 1. 

VI. (hulNL 

208. Hahana: Sociedad antropologica. 

Vn. Vereinifirte Staaten. 

204. Albany (N.-Y.): State museum of natural history: Reports ofthe 
State geologist 1884—86, 1888—90, 1891 (11), 1892 (12) u. 
1898 (18), Vol. I und Vol. IL 

206« Boston (Mass.): American academy of arts and sciences: Procee- 
dings N. S. vol. 22, 1894/96. 

206. „ Society of natural history: Proceedings vol. 26, 

part. 4, vol. 27, p. 1—74, Memoirs voL 6, N. 1—2. 

207. Buffalo (N.-Y.): Society of natural sciences. 

208. Cambridge (Mass.) : Museum of comp, zoology at Harvard College : 

Annual Report Bulletin vol. 27, N. 4, 6, 7, 
28, 2, 29, 1—6, 30, 1. Memoirs vol. 19, 1. 

209. Chicago (JH.): Academy of sciences: 88. Jahresbericht. Bulletin 

vol. 2, N. 2. 

210. Columbus (Ohio): Board of Agriculture. 

211. Davenport (Jowa): Academy of natural sciences. 

212. Madison (Wisc): Social de T^tat Wisconsin. 

218. „ Wisconsin Academy of sciences, arts and lettres : 

Transactions vol. 10, 1894/95. 

214. Meriden (Conn.): Scientific association Proceedings and trans- 
actions: Transactions vol. 7. 

216. Milwaukee: Natural history society of Wisconsin: 18. Jahres- 
bericht. 

216. Minneapolis (Minn.): Geological and natural history survey of 

Minnesota: 21. u. 22. Jahresbericht. 

217. New-Haven (Conn.): Academy of arts and sciences. 

218. New- York. (N.-Y.): Academy of sciences: Annais vol. 8, N. 6—12. 

Memoir 1, part. 1, Transactions vol. 14, 
1894/95. 

219. „ Microscopical society: Journal vol. 12, N. 1,2 U.8. 

220. Philadelphia (Pennsylv.): Academy of natural sciences: Procee- 

dings 1895, Part. 2, 8, 1896, Part. 1. 

221. „ American philosophical society: Procee- 

dings vol. 84. Nr. 148, 149. 

222. „ Wagner Free Institute of science: 

Transactions vol. 4. Jannary 1896. 

223. Roctiester (N.-Y.) : Academy of Science : Proceedings vol.2, Broch. 8,4. 



Digitized by VjOOQ IC 



27 

224. Salem (Mms.): Essex Insütate. 

225. St. Li o als (Miss.): Ac&dem^ of icience. 

226. „ Missoun botanical Garden. 

227. San Francisco (Cal.): California Academy of sciences: Procee- 

dings vol. 5, Part 1, 2. 

228. St. Paul (Minn.): Geological and natural history survejr. 

229. Topeka (Ark^: Kansas Academy of science: Transactions toI. U. 

230. TreDton (N.-Y.): Natural history society. 

231. Tufts College (IkUss). Studies. -IV. 

232. Washington: Bureau of Ethnology: 13. Jahresbericht 1891/92. 
.233. „ Department of Aniculture; Bulletin N. 8; North 

American Fauna N. 10, 11, 12. 

234. „ U. S. Geological Surrey: 16. Jahresbericht 1894/95. 

235. „ Smithsonian Institution: An account of the Smithsonian 

Insitution; 

Annual Report 1892/9$; 

Bulletin N. 48; 

Miscellaneons Collections 971, 972; 

Contribntions to knowledge 980, 989; 

Proceedings of theU. 8. National Museum vol. 17, 1894. 



Digitized by VjOOQ IC 



28 



in. Bericht über den Zuwachs zu den Sammlungen 



1. a: Zur Anthropoloirischeii 






nnd b: zur Ethnographischen 






Abteilnng: 






Schädelknochen, Kiefer, Röhren- 






knochen von Menschen, aus- 






gegraben 


Streitberg 


Bing, Kommerzienr. 


3 menschliche Unterkiefer, aus- 






gegraben 


Trödelmarkt,hier 


Stadtmagistrat. 


Menschliches Skelett, ausgegraben 


Roindelstr., hier 


Stadtmagistrat. 


Knochen , Bronceringe , Urnen- 






scherben, reconstruirte Urnen, 






Broncefibeln 


Sebaldiwald 


anthropol. Sektion. 


Theebüchse aus Bambusrohr; 






Castagnetten 


— 


Lambrecht, Herm. 


Messerscheide 


Cattaro. 


Lambrecht, Herm. 


2. Znr Zoologischen Abteilung: 




a. Säugetiere: 






Vespertilio pipistrellusFledermaus 


Bemeck 


Gallinger. 


Pteropus edulisGeoffr. Fliegender 






Hund, jung 


Australien 
Wittenberg a. der 


Kinkelin. 


Castor Fiber, Biber 


angekauft. 




Elbe, wohl die 






einzige Biber- 






kolonie, die 






noch in MiUel- 




b. Vögel; 


europa existirt 




Passer montanus, Feldsperling, 






Riugelspatz 


Sündersbühl 


Schwarz. 


Emberiza hortulana, Ortolan, 






Gartenammer 


Gostenhof 


Giggel, Büttnermstr. 


Aegintha Astrild, Heleua-Fasän- 






chen m 


eingeführt 


Lindner, Heinrich. 


Corvus corone, Krähe, 3 Eier . . 


Laubendorf bei 
Langenzenn 


von Huber-Liebenau. 


Paradisea raggiana, Paradiesvogel 


Holländisch Neu- 
Guinea 


angekauft. 


Epimachus speciosus 


Holländisch Neu- 
Guinea 


V 


Pitta brachyura 


Ceylon 


angekauft. 


Astur nisus, Sperber 


Nürnberg 


Schmidt, Postmstr. 



Digitized by VjOOQ IC 



29 



Otiis silyestris, Waldohreule . . 

Rhea novae HoUandiae, Erna; 
Balg 

Cbaradrias pluvialis Begenpfeifer 

Gallinnla chloropns, gr&nf&fsiges 
Rohrhnhn - - • 

Oidemia iiisca, Sammetente. Va- 
rietät 

Harelda gladalis, Eisente . . . 

Rhamphastiden, Handzeichnimgen 
von t Sturm, Lithographieen etc. 

c. Amphibien und Reptilien: 
Acanthodactylus vulgaris D. B. . 
Agama inermis Reufs 

„ pallida Reufs 

„ stellio (L.) 

„ sanguinolenta (Pall.) . . 

Anolis carolinensis D. B 

Chlamydosanrus kingi Gray. . . 
Diemenia psammophis Schlg. . . 

Diemenia textilis D. B 

Diporophora australis (Stdchr.) . 
Dipsadomorphus iuscus Gray . . 

Gehyra yariegata D. B 

Gymnodactylus platums (White) 

(helle u. dunkle Variet&t . . . 
Fhrynocephalus mystaceus (Pall.) 
Tupinambis tegurin (L.) .... 
üromastix hardwickei Gray. . . 
Yaranus punctatus (Gray) .... 

Yaranus rarius (Shaw) 

Coronella laeris Boie 

Dendrophis punctulatus (Gray) . 

Morelia argus D. B 

Pseudechis porphyriacus Shaw. 
Python spilotes (Lac^p.) var. 

variegata Gray 

Tropidonotus picturatus Schleg. 

yar. australis Gray 

Schlangen, diyerse 



Sperbersloh 

Neuholland 
Schnepfenreuth 

N&mberg 



Ebrachgrund, 
Franken 



Spanien 
Egypten 
Ober-Egypten 

Transkaspien 
S.O. Ver. Staaten 
Queensland 
Neu-Süd-Wales 
Queensland 



Hirschmann, M. 

„ Rosenaustr. 
Wiedder, Expeditor. 

Ullmer, Bankier. 

angekauft. 
Frankenbacher 
(Eigenthum). 



Voigt. 



Kinkelin. 



Transkaspien 
Westindien 
Egypten 
Queensland 


n 

Seyschab, Herrn. 
Kinkelin. 


Nürnberg 

Australien 
Queensland 


Enslin. 
Kinkelin. 

n 


n 

Queensland 
Nicaragua 


Kinkelin. 
üebersetzig, 
Matagalpa. 




Digitizedby Google 



30 



d. Insekten: 
Papilio Sephras, Buddha, glaucns, 

androgene 

Papilio Montezuma , I^ns , 

Hector, m., erethemis, sp.? . . 

Apatnra Lucasii 

„ Calina. m. Calogramma 

2 spec 

Danais Genutia,Chrisippa8,Gareti8 

Thetis. w 

Delias Encharis 

Dione Moneta, Hypolimnas ano- 

mala m. n. w. Milionea glauca , 

Precis iphita. Pyrhpy geapec, 

Phideas 

Tachyris Berenice m., Nabila w., 

Patola Macropa 

Tanmantis Odana 

Thyridia Pisidii 

Acherontia Atropos, Todenkopf, 

Raupe 

Gastropacha quercifolia, Kupfer- 

glucke 

Insekten aus Nicaragua .... 
Einige Insekten, Blatta orian- 

talis, u. a 



e. Molluscen: 
Solen vagina, Scheidemuschel . . 

f. Biologie: 

Metamorphose von Pelias berus, 
Kreuzotter, in Spiritus .... 

Metamorphose ron Hyla arborea, 
Laubfrosch, in Spiritus. . . . 

Metamorphose ron Salamandra ma- 
culosa, Molch, in Spiritus . . 

Metamorphose von Salmo fario, 
Bachforelle, in Spiritus. . . . 

Metamorphose von Oryctes nasi 
comis, Nashomk&fer, in Spiritus 

Metamorphose von Termes fatalis, 
Termite, in Spiritus 



exotisch 

>» 
Rio-Negro 

exotisch 

n 

Indo-australien 
exotisch 

n 

Bomeo 

St. Johannis 

Matagalpa 
Ostindien 

Adriatisch. Meer 



angekauft. 

Kaulfufs. 
angekauft. 

Kaulfufs. 
angekauft. 



Kaulfufs. 
angekauft 

Dr. Heinlein. 

Erhard. 
Uebersetzig. 

Gg. Beckh. 



Dr. Elliesen. 



angekauft. 



angekauft 
angekauft. 

Digitized by VjOOQ IC 



31 



g. Tierische Pathologie: 
2 DamiBteine 

1 Daimstein 

Harnblase mit Formverftndemiig 

S« Botanik. 

a. allgemeine Botanik, 
Biologie, etc. 

2 Tafeln, Zeichnungen über den 
morphologischen Anfbau der 
Pflanzen 

Holz von Ameisen macerirt. . . 

Yiscum albom, aof einem Föhren- 
ast aufsitzend 

Dancus Carota, Bube mit abnormen 
Wachstum 

Lupinus nanus mit Wurzel- 
knöUchen 

Wurzelknöllchen verschiedener 
Lupinusarten 

Pechnelke, Lychnis Yiscaria mit 
angeklebtem Schmetterling . . 

Bosa mit l^oliferation 

WurzelgaUe von der Erle . . . 

Physalis Alkekengi, Fruchtstand 
mit 8 Früchten 

Fracht von Aüanthus glandulosa 

2 Mango-Früchte 

Früchte von Gingko biloba . . . 

Caffebohnen etc. 

Fracht von Medicago Echinus u. 
Trifolium incamatum 

Fracht von Cucurbita, Kürbis . . 

Fracht von Lyriodendron , ver- 
schiedenen Quercus-Caria- und 
Juglanis-Arten, auch Zweige. . 

Korkeiche, Stamm, Binden, ge- 
schnittener Kork 



Pferd 
Herd 
Schwein 



b. zu den Herbarien: 
Phanerogamen zum Nürnberger 
liokalherbar, zum bayerischen 
Landesherbar, namentlich von 
Rothenburg, zum allgemeinen 
Herbar, ansUngam, PreuTsen etc. 



Nürnberg 

n 

Lichtenhof, cult. 

Lichtenhof, cult 

Lauf 

Gerasmühle 

Haimendorf 

Jura 

cult. Nürnberg 

Ostindien 

cult. Würzburg 

Arabien etc.* 

Neumarkt 
Nümbg., advent 

cult. Gerasmühl 
Sicilien 



Breuning. 

Metzger und Bühm. 

Bittermann. 



Ehrhard. 
Forchheimer. 

V. Huber-Liebenau. 

Baumgärtl. 

Dr. Wagner. 

Dr. Wagner. 

Knapp. 

Weidner. 

Paalzow. 

Rudel, Adalbert. 
Fleischmann. 
Beckh, Georg. 
Appel. 
Huber. 

Petersen. 
Schultheifs. 

Weidner. 
Bromig. 



Simon. 

Digitized by VjOOQ IC 



32 





Phanerogamen vom RieSfKissingen, 






München 





Rodler. 


Phaneroffamen 


Beilngries 
advent. Nürnberg 


Schnlthi^iffi 


Anchusa italica 


Schultheifs. 


Phanerogamen von München, Frei- 






sing, Würzhurg 


— 


Schwarz. 


Phanerogamen ans dem Fichtel- 






gehirg und dem Allgäu. . . . 


— 


Grofs. 


Phanerogamen aus dem nördlichen 






fränkischen Jura 


— 


Kaulfufs. 


Phanerogamen von Windsheim u. 






Treuchtlingen 


— 


Kränzle. 


Helleborus foetidus, Euphorbia 






amygdaloides 


Gravelotte 


Lucas. 


EucalyptuiB, Oliven, Acacien . . . 


Riviera 


Barbeck, Fritz. 


Cryptogamen aus verschiedenen 






Elassen 


divers. 


Simon. 


Thuidium Blandowii und viele 






andere Laubmoose 


Franken 


Kaulfufs. 


Laubmoose, Algen, Flechten, 






mikroscopische Präparate. . . 


— 


Kaulfufs. 


Pyrenula glalrata (leg. Schnabel) 


Grofshesselohe 


Kränzle. 


Ascomycetes : Fasciculus 24 . . 


— 


Dr. Rehm. 


Peridermium pini corticola auf der 


• 




Kiefer 


Fichtelgebirg 
Schweinau 


Gottl. Schmidt. 


Exoascus Pruni, Narrenzwetschgen 


V. Schädel. 


4. Geologie. 






a. Palaeontologie: 






Pterodactylus-Knochen in Kalk- 






platten, oberer Malm 


Solnhofen 


Hutzelmoier. 


Lamna cuspidata, Haifischzähne, 






Miocaen 


Ortenburg 


Ehrhard. 


Leptolepis sprattiformis, ob. Malm 


Solnhofen 


Preifs. 


Eryon arctiformis, oberer Malm . 


» 


Funk. 


Limulus spec, oberer Malm . . 


n 


Paalzow. 


Ammonideen und Verwandte aus 






der Kreide 


Genf 

Mainzer Becken 


Paalzow. 


Trochotoma sp. aus dem Oligocaen 


Knapp. 


Monotis salinaria aus dem alpinen 






Keuper 


Berchtesgaden 


Ehrhard. 


Monotis substriata, Lias, Monotis- 






platte 


Tauchersreut 


Schwarz. 



Digitized by VjOOQ IC 



33 





Pecten aequalis aus dem untern 






Lias, Bncklandisandstein . . . 


Roggenbrunn 


Spandel. 


Pecten solarimn aus dem Miocaen 


Ortenburg 


Ehrhard. 


Spondylns acnleiferus ans dem 






Dolomit (oberer Malm). . . . 


Wichsenstein 


Schwarz. 


Gryphaea arcnata aas dem untern 






Lias 


Altenthann 


Spandel. 




Metz 


Lucas. 


OstreaAbdrack ans demnntemLias 


Altenthann 


SpandeL 


Ostrea, zahlreiche Exemplare aas 






dem Miocaen 


Ortenburg 


Ehrhard. 


Bhynchonella laconosa aus dem 






Dolomit (oberer Malm). . . . 


Wichsenstein 


Schwarz. ' 


Ananch^s ovata aas der Kreide 


— 


Dr. Elliesen. 


Acer trilobatom aas dem Tertiaer 


— 


Paalzow. 


Verkieselter Holzstamm aas dem 






Eeuper oder Dilaviam «... 


Forchheim 


Rodler. 


Calamiten , andere Pfianzenab- 






drücke, Fische etc 


~ 


Esper, Kirchheim- 


diverse Petrefacten aas dem obem 




bolanden. 


Malm 


Solnhofen 


Oskar Bock. 


b. Geognosie: 




Bonter Lagergranit and Qaarze, 






Amberger üi^ebirg 


Freudenberg 


Schwarz. 


Baryt im Keaper 


Wendelstein 


• » 


Gelber Eeapersandstein mit Gagat- 






kohle, Rhaet ' . . 


Güntersbühl 


Huber. 


Pyritknollen aas dem Rhaet . . 


Haimendorf 


Paalzow. 


Geoden aas dem Amaltheenthon 


Reichenschwand 


n 




Söltenau 


Ehrhard. 


Grobkörniger Meeressand mit 






Conchylienresten. Miocaen . . 


Ortenburg 


» 


Homstein mit Pecten? DDayiam 


Steinplatte 


Ammon, jun. 


Gerollter Eisensandstein, Back- 






landisandstein, Dilayiam . . . 


» 


Schwarz. 


Eieselbildang aas demDilavialsand 


Mögeldorf 


Speckhard. 


Tropfsteinbildang, in einem Acker 






gefanden bei 


Pegnitz 


Voigt. 


Taff, KalkspatkrystaUe 


Sinnatengrün 


Oskar Gebhardt. 


Qaercas pedancalata, Abdruck in 






Lehm, recent 


Schmausenbuck 


Georg Schwarz. 


Basaltsäole and andere Eruptiv- 






producte 


Eifel 


Dr. V .Oefele. 






Digitizedby Google 



34 





5. Mineraloirie* 






Braankohle 





Dr. Löwi, Sulzbach. 


Calcit, Neubildung höchstens 




40 Jahre alt, Stollen der Grube 






Manfeld 


Thalbirkelheim 


Oskar Gebhardt. 


Malthazit aus dem Basaltbruch bei 


RedwitB 


» rt 


Orthoklas in einfachen Erystallen 


Fichtelgebirg 


t) n 


Orthoklas in einfachen Erystallen 






und Zwillingen 


Redwitz 


n n 


Granaten auf Glimmerschiefer . . 


Böhmerwald 


Schmidt, Optiker. 


Ghloritpseudomorph nachFeldspat 


Redwitz 


Oskar Gebhardt. 


Yoigtit in Syenitgranit 


» 


» n 


Eisenji^limmer 


Fichtelgebirg 


Schmidt, Privatier. 


Brauneisenstein 


— 


Dr. Löwi. 


Pyritkrystalle 


— 


n rt 


Proterobas Paterlesstein .... 


Bischoffsgrün 


Dr. Schmidt, Wun- 
siedel. 


6* Geographie* 






Karte über die Verbreitung der 






2 Kameelarten 


— 


Dr. Heerwagen. 


Altere Postkarte von Deutschland 


— 


Schwarz. 


Karte des schwäbischen Kreises 


— 


Lucas. 


Lepsius, geologische Karte des 






deutschen Reiches 


— 


angekauft. 



— — ►>x<<» 



Digitized by VjOOQ IC 



35 



IV. Jahresbericht der Verwaltimg für 1896. 

Die Verwaltung des Hauses und der Gesellschaftsräume zeigt 
das gleich gute Ergebnis, wie das des vergangenen Jahres. 

Der 2. Stock und das Hinterhaus ist an die Neue Nürnberger 
Frauenarbeitsschule vermietet, ebenso ein Keller an einen Obst- 
händler. 

Die Gesellschaftsräume waren an folgende Vereine vermietet: 

Architekten- und Ingenieur-Verein, Apotheker-Verein, Garten- 
bauverein, Hebammen- Verein , Jugendhort, Kunstgenossenschaft, 
Münzverein, Pegnesischer Blumenorden, Stenographen-Hort, Treu- 
Nürnberg, Verein für öffentliche Gesundheitspflege, Kommission für 
Ferien-Kolonien. 

Gröfsere unvorhergesehene Ausgaben sind nicht erwachsen, 
allein ein altes Haus bedarf öfters der Reparatur und so wird wohl 
auch für das kommende Jahr eine gröfsere Ausgabe für Neuanstrich 
des Hauses in Aussicht genommen werden müssen. 

Als Geschenke wurden 10 Schuldscheine im Betrage von 
Mk. 500 zurückgegeben. 

Das hochherzige Legat des Frhrn. v. Faber zu Mk. 1000 
ermöglichte mit anderen jährlichen freiwilligen Beiträgen und unter 
Entnahme von Mk. 200 aus der Gesellschaftskasse, eine Abzahlung 
von Mk. 1400 an der Hypothekenschuld. 

Für alle Geschenke und freiwilligen Beiträge wird geziemender 
Dank ausgesprochen« 

Da die Verwaltung noch immer einen grofsen Zuschufs aus 
der Gesellschaftskasse beansprucht, so kann eine Verlosung der 
Schuldscheine nicht vorgenommen werden. 



Abrechnung der Verwaltung. 

a. Immobiles Vermögen. 

Haus nebst Hinterhaus Schildgasse 12, 1. Januar 1896 m. ^ 

Hypothek hierauf % . . . T . . 51800 — 

Abzahlung hieran 1400 — 

sobin am 31. Dezember 1896 Hypothekenstand . . 50400 — 

Digitized b?G00gIe 



36 

b. Mobiliar. ^ ^ 

1. Jannar 1896 Stand desselben 2019 50 

Ab IWq Abnützung 202 — 

1817 60 

c. Schulden an Schuldscheinen. j^ ^ 

Gesamtausgabe von Schuldscheinen 30175 — 

1. Januar 1896 Stand derselben 25250 — 

davon 10 Stück als Geschenk zurückerhalten .... 500 — 

Stand am 31. Dezember 1896 . . 24750 — 

Jakob Gallinger. 



Digitized by VjOOQ IC 



37 

V. Kassenbericht für 1896. 
a. Ober die Gesellschaftskassa. 

Einnahmeii. Jk ^ 

Eassabestand 675 13 

Gnthaben bei der Sparkassa {Jk 767.50) — — 

Aofnahmsgebuhren 45 — 

Mitgliederbeiträge 4f271 Ä) 

Beitrag vom Stadtmagistrat Nürnberg 500 — 

Beitrag vom Landrat für Mittelfranken 300 — 

Freiherr Lothar von Faber'sches Legat 1000 — 

Summa . . 6791 43 

▲ vsgaben: Jk ^ 

Titel la. Einrichtung des Museums 1156 30 

Ib. Unterhaltung desselben 22 — 

IIa. Bibliothek 463 20 

IIb. Einrichtung derselben 71 30 

II c. Druck des Kataloges — — 

nia. Schreibbedarf 28 20 

mb. Porti 61 30 

nie. Inserate 85 — 

III d. Gehalt des Vereinsdieners 520 — 

nie. Feuerversicherung , . — — 

IV. Überzahlung zum Hauskonto 1460 40 

V. Jahresbericht und Drucksachen 339 05 

Via. Zuschuls zur anthropologischen Sektion . 250 — 

Vlb. > » botanischen Sektion .... 100 — 

VIc. » » geographischen Sektion. . . 50 — 

VId. » » histologisch-bakteriol. Sektion — — 

VIe. > . > chemischen Sektion .... 100 — 

VUa. Fond für das 100jährige Jubiläum. ... 100 — 

Vnb. Abzahlung der Hypothek 1200 — 

Vm. Reservefond 104 61 

Summa . . 6111 36 

Abschlags: Jk J^ 

Summa der Einnahmen 6791 43 

Summa der Ausgaben 6111 36 

Kassabestand a. Bar . . 680 07 

b. 2 Sparkassabücher mit . . 884 99 wovon 
zum Fond für das 100jährige Jubiläum Jk 300.— bestimmt sind. 



Digitized by VjOOQ IC 



38 

b. Ober die Verwaltungskassa. 
E i n n a h m e n : 

Extrabeiträge der Mitglieder zur Abzahlung an der J^ ^ 

Hypothek ..... ^ 136 — 

Miets-Erfrägnisse 2145 40 

Erlös für verkauftes Holz 24 — 

Erlös für Biergläser 5 — 

Eintrittsgelder in das Museum 4 80 

Überzahlung aus der Gesellschaftskassa 1460 40 

Summa . . 3774 60 

Ausgaben: JL ^ 

Abzahlung an der Hypothek 200 — 

Reparaturen und Bauarbeiten 323 47 

Steuern, Wasserzinse und Holzpfandgeld 432 03 

Hypothek-Zinsen 2062 13 

Ökonomie und l^egie 756 93 

Summa . . 3774 60 

AbsclilQss: o46 /^ 

Summa der Einnahmen 3774 60 

Summa der Ausgaben 3774 60 



Für die Richtigkeit: 
Nürnberg, den 8. Januar 1897. Beruh. Lang. 

Die Richtigkeit vorstehender Aufstellung und die Überein- 
stimmung mit den vorliegenden Belegen bestätigen 

Hümberg, den 11. Januar 1897. 

J. Kreutzer, Dr. Rud. Loewi, 0. Schultheifs* 



Digitized by VjOOQ IC 



39 

VI. Bericht über den Mitgliederstand. 

Vorstandschaft 
(nach der Wahl der Generalversammlang yom Januar 1897): 
Direktor: Herr Dr. med. Bernhard Baumüller, prakt. Arzt. 
/. Sekräär: Herr Dr. phil. August Heerwagen, k. Gymn.-Prof. 
//. Sekrdär: Herr Dr. phil. Karl Hartwig, k. Gynmas.-Prof. 
]IL Sekräär: Herr Gustav Förderreuther, k. Hauptmann a. D. 
BibUotkekar: Herr Eonrad Hör mann, Lithograph. 
Canservator: Herr Aug. Schwarz, k. Stahsveterinär. 
Schatzmeister: Herr Beruh. Lang, Kaufmann u. k. Konsul. 
Administrator: Herr Jakob Gallinger, Kaufmann und Armenpfleg- 
schaftsrat. 
Batüeckniker: Herr Emil Hecht, Architekt u. GemeindebeToUmächtigter. 

Kustoden: 

1) fär die anatoii^ische Sammlung: Herr Dr. Baumüller. 
2^ „ „ anthropologische Sammlung: Herr Wunder. 
8; „ „ botanische Sammlung und zwar: 

a. für das allgemeine Herbar: Herr Fr. Schultheifs; 

b. „ „ Kr3rptogamen-Herbar: Herr Kaulfufs; 

c. „ „ Nürnberger Herbar: Herr Schwarz; 

d. „ „ bayerische Landesherbar: Herr W. Rudel; 
4) für die chemische Sammlung und zwar: 

a. für die anorganisch-chemische: Herr Dr. Metzger; 
b- r» » organisch-chemische: Herr Wunder; 
5^ für die ethnographische Sammlung: Herr Dr. Baumüller; 

6) „ „ mikroskopische Sammlung : Herr Dr. Goldschmidt; 

7) „ „ lokal-geognostische Sammlung : Herr Schwarz; 

8) „ „ mineralogische Sammlung: Herr Dr. Zwanziger; 
^) Ti ji paläontologische Sammlung; Herr Spandel; 

JÖ) „ n physikalische Sammlung: \ „ r. Lessine- 

11) „ „ technologische Sammlung: / "®" ^^' ^«8"°«» 

12) „ „ zoologische Sammlung, und zwar: ' 

a. flir Säugetiere und Vögel: Herr Dr. Heerwagcn; 

b. „ Reptilien, Amphibien und Fische: Herr Kinkelin; 

c. „ Weichtiere und Conchylien: Herr Knapp; 

d. „ Insekten: Herr Manger; 

e. „ Arachniden und Myriapoden: Herr Dr. Koch sen.; 

f. „ Grustaceen und niedere Tiere: Herr Kinkelin. 



A, Ordentliche Mitglieder 

(Stand vom 81. Dezember 1896). 

1) Herr Adolf, Georg, Kau&aann. 

2) „ Aischberg, Joseph, Hopfenhändler. 
„ Dr. Altmannsperger, prakt. Arzt in Hersbruck. 
„ Ammon, GottMed, Kau&nann. 
„ Ammerbacher, Max, k. Postexpeditor in Fürth. 

6} „ Bach, Leo, Kaufmann. 

T\ „ Bach, Siegfried, Fabrikbesitzer. 

8) „ Bäumler, Job. Konrad, Kaufmann. 

9^ „ Dr. Bar ab 0, Adam, prakt. Arzt. 

10) „ Barbeck, Hugo, Buchhändler und Magistratsrat. 



Digitized by VjOOQ IC 



40 

11) Herr Barth, Johannes, Kaufmann in Weigelshof. 

12) „ B a r t h e 1 1 , Georg, Hopfenhändler. 
18^ „ Dr. Bauer, Friedrich, prakt. Arzt. 

14) „ Baur, Joseph Anton, Ingenieur. 

15) „ Dr. Baumüller, Bernhard, prakt. Arzt. 

16) „ B a u r i e d e 1 , Paul, Kunstmühlbesitzer. 

17) „ B e c k h , August, Apotheker. 

18) „ Dr. B e c k h , August, prakt. Arzt 

19) „ Beckh, £dwin, Fabrikbesitzer und Konunerzienrat. 

20) „ Beckh, Georg, Fabrikbesitzer. 

21) „ Dr. B e c k h, Wilh., Oberarzt am städt. Krankenhaus u. k. Hofrat. 

22) „ Berlin, Max, k. Oberlandesgerichtsrat. 

23) „ Dr. B ernett, Wilhelm, prakt. Arzt. 

24) „ Bernhold, Albert, Kaufmann. 

25) „ Bernstiel, Karl, Kaufmann. 

26) „ Dr. Bert hold, Eugen, prakt. Arzt. 

27) Bibliothek, Königliche, in Berlin. 

28) Herr Bing, Adolf, Kaufmann. 

29) „ Bing, Berthold, Kaufmann. 

80) „ Bing, Heinrich, Kaufmann. 

81) „ Bing, Hermann, Kaufmann. 

82) „ Bing, Ignaz, Konunerzienrat. 
88) „ Bing, Oskar, Kaufmann. 

84) „ Birkmann, Michael, Zimmermeister. 

85^ „ B irkner, Budolf, Bankier und Konsul der chil. Republik. 

86) „ Bloch, Samuel, Bankier. 

87) „ Bock, Georg, Zahnarzt. 

88) „ Bodky, Julius, k. Reallehrer. 

89) „ Boeck, Karl, Fabrikdirektor. 

40) „ Dr. Böhm, Gottfried, Assistent am bayrischen Gcwerbemuseum. 

41) „ Braun, Jean, Buchhändler. 

42) „ B r m i g , Hans, Kaufinann. 
48) „ Brunner, Martin, Kaufmann. 

44) „ B r u « t , Max, Kommerzienrat. 

45) „ Dr. Buchner, Wilhelm, prakt. Arzt. 

46) „ Bücking, Johannes, Privatier. 

47) „ Bürger, Leonhard, Architekt. 

48) „ Buz, Franz, k. Oberst und Regiments-Kommandeur. 

49) „ Cammerer, Fritz, k. Oberförster in £ibach. 
60) „ Campe, Friedrich, Apotheker. 

51) „ Garette, Georges, Kaufmann. 

52) „ Cnopf, Karl, Bankier. 

58) „ Dr. Cnopf, Rudolf, prakt. Arzt. 

54) „ Conradty, C, Fabrikbesitzer. 

55) „ C r ä m e r , Friedrich, Prokurist. 

56) „ Crailsheimer, Hugo, Kaufmann. 

57) „ Gramer, Fritz, Buchhändler in Würzburg. 

58) „ Gramer, Paul, Kaufmann. 

59) „ Dr. Deuerlein, Georg, prakt. Arzt. 

60) „ Dietrich, Theodor, k. Postoffizial in Schweinau. 

61 ) „ D i e t z , Georg, Grofshändler. 

62) „ D i e z , Gregor, Maurer- und Tünchermeister. 
68) „ Dormitzer, Louis, Kaufmann. 

64) „ Dr. Dürr, Felix, Reallehrer. 

65) „ Dürr, Konrad, k. Professor an der Industrieschule. 

66) „ Dr. £berle, Joh. Fr., k. Gymnasiallehrer. 



Digitized by VjOOQ IC 



41 

67) Herr £ckart, Ernst, Apothekenbesitzer and Magistratsrat. 

68) „ Dr. Eckart, Karl, Apotheker. 

69) „ Eckert, Hermann, Kaufmann in Heidelberg. 

70) „ Ehrenbacher, Sigmund, Hopfenhändler. 

71) „ Eisenbach, Georg, Kaiifmann. 

72) „ Dr. E 1 1 i e 8 e n , Paul, Apothekenbesitzer. 

73) „ Emmel, Theodor, Kunst- und Uandelsg&rtner. 

74) „ Dr. Emmerich, Max, prakt. Arzt. 

75) „ Engel, Kaspar, k. Reallßhrer a. D. 

76) „ Englert, Hans, Kaufmann. 

77) „ E n s 1 i n , Heinrich, Kaufmann. 

78) „ Dr. Epstein, Ernst, prakt. Arzt. 

79) „ Erdel, Friedrich, Lehrer in Mögeldorf. 
80^ „ Erdmann, Friedrich, Bankier. 

81 ) „ Erhard, Ludwig, Ingenieur. 

82) „ Erhard, Theodor, Apothekenbesitxer. 

83) „ Erlenbach, Max, Kaufmann. 

84) „ Ertheiler, Anton, Kaufmann. 

85) „ Ertheiler, August, Kaufmann. 

86) „ Etz, Friedrich, Kaufmann. 

87) „ Eyfser, Georg, Kaufmann und Fabrikbesitzer. 

88) „ Fischer, Karl, Privatlehrer. 

89) „ Fleischmann, Chemiker in Doos. 

90) „ Förderreuther, Gustav, k. Hauptmann a. D. 

91) „ Föttinger, Karl, Gasthofbesitzer. 

92) „ Fo rch heim e r, H. S., Kaufmann. 

93) „ Dr. V. Forst er, Sigm., prakt. Arzt. 

94) „ V. Frays, Freiherr, Philipp, Fabrikbesitzer. 
96) „ Dr. Frankenburger, Alex, prakt. Arzt. 

96) „ Frankenburger, Max, Fabrikbesitzer. 

97) „ Frauenfeld, Emil, Kaufmann. 

98) „ Frauenfeld, Karl, Kaufmann. 

99) „ Frauen feld, Moritz, Kaufmann. 

100) „ Frauenknecht, k. Notar und Justizrat. 

101) „ Dr. Friedl, Wüh., k. Reallehrer an der Kreislandwirt- 

schaftschule, Lichtenhof 

102) „ Friedrich, Johann, k. Reallehrer a. D. 

103) „ Dr. Fuchs, Wilhelm, prakt. Arzt. 

104) „ Füch t bau er, Gg., k. Rektor der Industrieschule a. Kreisreal- 

schale, MitgUed des obersten Schulrates. 

105) „ Funk, Stephan, Kaufmann. 

106) „ Gallinger, Jakob, Kaufmann und Armenpflegschaftsrat 

107) „ Gar eis, Wilhelm, k. Bezirksam tmann und Regierungsrat. 

108) „ Gebhardt, Heinrich, Fabrikbesitzer. 

109) „ Gebhardt, Ludwig, Kaufmann. 

110) „ Gebhardt, Wilhelm, Kaufmann. 

111) „ Geiershöfe r, Samuel, Kaufmann u. Gemeindebevollmächtigter. 

112) „ Dr. Geifsler, Gustav, prakt. Zahnarzt. 

113) n Gerngros, Ludwig, «Kaufmann und Kommerzienrat. 

114) „ Gerngros, Wilhelm, Kaufmann. 

115) „ Dr. Giulini, Ferdinand, prakt. Arzt. 

116) „ Giulini, Georg, Privatier. 

117) „ Dr. Giulini, Paul, prakt. Arzt. 

118) „ Glafey, Gottlieb, Fabrikbesitzer und k. Handelsrichter. 

119) „ Dr. Glanz, Adam, prakt. Arzt. 

120) „ Göbel, Otto, k. Veterinärarzt U. Kl. 



Digitized by VjOOQ IC 



42 

Herr Gösch el, Ludwig, Privatier. 

„ Goldmann, Max, Kaufmann. 

„ Dr. Goldschmidt, Ferdinand, prakt. Arzt. 

„ Gombrich, M., Instituts-Direktor. 

„ Gönner mann, Karl, Fabrikbesitzer und Kommerzienrat. 

„ G r e i n e r , Gustav, Kaufmann in München. 

„ Dr. Grether, Fritz, Apotheker. 

„ Griefsbach, Otto, Kaufmann. 

„ Grofs, Ludwig, k. Gyqinasiallehrer. 

„ V. Grundherr, Benno, Kaufmann und k. niederl. Konsul. 

„ Gütermann, Wilhelm, Kuufmann. 

„ Guldmann, Arthur, Kaufmann. 

„ Gutmann, Gustav, Bankier. 

„ Haas, Eduard, Fabrikbesitzer und Kommerzienrat. 

„ Haas, Karl, Bankier. 

„ Hammer, Karl, k. Direktor. 

„ Dr. med. dent. Hanau, Max, Zahnarzt. 

„ Dr. Hartwig, Karl, k. Gymnasialprofessor. 

„ H a u s e r , Joh. Friedrich, Ingenieur. ' 

„ Haymann, Julius, Direktor des städt. Gaswerks. 

„ Hecht, Emil, Architekt, Ingenieur u. Gemeindebevollmächtigter, 

„ Heerdegen, Alb recht, Kaufmann u. Armenpflegschaftsrat. 

„ Dr. Heerwagen, August, k. Gymnasialprofessor. 

„ H e i 1 i n g , Christian, Kaufmann. 

„ Heim, Hermann, Kaufmann. 

„ Heim, Karl, Kaufmann. 

„ Held, Hermann, k. Gymnasiallehrer. 

„ Heller, Friedrich, Fabrikbesitzer. 

„ Heller, Louis, Kaufmann. 

„ Hellmuth, Joseph, Rechtsanwalt. 

„ Hellmuth, Karl, städt. Bezirkstierarzt. 

„ Hellmuth, Sigmund, Fabrikbesitzer in Buch. 

„ Hering, August, Ingenieur. 

„ Hermann, Georg, Bezirkstierarzt in München-Schwabing. 

„ H e r t e 1 , Friedrich, Kaufmann. 

*„ Dr. Hefs, Hans, k. Reallehrer. 

„ Hesselberger, David, Kaufmann. 

„ Heydolph, Georg, Buchdruckereibesitzer. 

„ Heydolph, Hans, Rechtsanwalt. 

„ Hilpert, August, Fabrikbesitzer. 

„ Hilpert, Christian, Fabrikbesitzer. 

„ Dr. Hirsch, Jakob, Chemiker in Fürth. 

„ Dr. V. Hörmann, Fabrikdirektor. 

„ Hörmann, Konrad, Lithograph. 

„ Dr. Hof mann, Hans,' Assistent am bayer. Gewerbemasetun. 

„ Dr. Hof mann, Moritz, kgl. Landgerichtsarzt. 

„ Hoffmann, Paul, k. Rittmeister und Brigade- Adjutant. 

„ Hohenner, Albrecht, Privatier. 

„ Hohlweg, Eduard, Fabfikdirektor. 

„ Hopf, Eduard, Kaufmann. 

„ Hopf, Emil, Kaufmann. 

„ Hopf, Hans, Kaufmann. 

„ V. Huber-Liebenau, Theodor, k. Rittmeister. 

„ H u b e r , Friedrich H., Kaufmann. 

„ H u m b s e r, H., Bierbrauereibesitzer u. Kommerzienrat in Fürth. 

„ Hussong, Ludwig, Apotheker. 



Digitized by VjOOQ IC 



43 

177) Herr Jung, Heinrich, Kaufmann. 

178) „ Jungmann, Heinrich, Privatier. 

179) „ Dr. Kämmerer, Hermann, k. Professor an der Indastrieschole. 

180) „ Kann, Paul, k. Telegrapheningenieur. 

181) „ Kann, Samuel, Privatier. 

182) „ Kantenseder, Johann, Schreinermeister. 

183) „ Kaulfufs, Johann, städt. Trichinenschauer. 

184) „ Dr. Kayser, Robert, Chemiker. 

185) „ Kempe, Karl, Fabrikbesitzer. 

186) „ Kiefer, Andreas, k. Hauptmann und Kompagnie-Chef. 

187) „ Dr. Kiefer, Karl, prakt. Arzt. 

188) „ Kinkelin, Adolf, Apothekenverwalter. 

189) „ Dr. K i r s t e , Wilhelm, prakt. Arzt. 

190) „ Klein, Benedikt, Kaufmann. 

191) „ Knapp, Friedrich, Kaufmann, Magistratsrat u. k. span. Konsul. 

192) „ Dr. Koch, Heinrich, prakt. Arzt. 

193) „ Dr. K c h , Karl, prakt. Arzt. 

194) „ K h n , £mil, Kaufmann. 

195) „ Kohn, Ernst, Kaufmann. 

196) „ Kohn, Georg, Bankier. 

197) „ Kohn, Max, Kommerzienrat und Bankier. 

198) „ K r a k e n b e r g e r , Leopold, Kaufmann. 

199) „ Krakenberger, Max, Kaufmann. 

200) „ Kraussold, Max, k. Pfarrer und Senior. 

201) n Kr eil, Otto, Fabrikdirektor und Qemeindebevollmächtigter. 

202) „ K r e 1 1 , Otto, jun., Ingenieur. 

203) „ K r e 1 1 , Rudolf, Ingenieur. 

204) „ Kreutzer, Ludwig, Fabrikbesitzer. 

205) „ Kristfeld, Jean, Uhrmacher. 

206) „ Kr om well, Karl, Kaufmann. 

207) „ K r ü 1 1 , Fritz, Ingenieur. 

208) „ Kugelmann, Dalli, Reallehrer in Fürth. 

209) „ K u g 1 e r , Sal., Bankier. 

210) „ K u h 1 , Richard, Fabrikdirektor. 

21 1) „ Lambrecht, Hermann, Fabrikbesitzer. 

212) „ Dr. Landmann, Joseph, Rechtsanwalt. 

213) „ Dr. Landsberg, Luawig, Fabrikbesitzer. 

214) „ Lang, Bernhard, Kaufmann und k. schwed.-norweg. und 

dänischer Konsul. 

215) „ Lang, Ignaz, Kaufmann. 

216) „ Lang, Leopold, Kaufmann. 

217) „ Langermann, Moritz, Kaufinann. 

218) „ Lauer, Jean, Fabrikbesitzer. 

219) „ Lauinger, Leopold, Kaufmann. 

220) „ Lehnert, Wilhelm, Apotheker. 

221) „ Leidig, Georg Friedrich, Optiker und k. Hoflieferant. 

222) „ Dr. Lessing, Albert, Fabrikbesitzer. 

223) „ L e u c h s , Georg, KauÄnann und Chemiker. 

224) „ Dr. Leuchs, Karl, CTiemiker. 

225) „ Lex, Hans, Apothekenbesitzer. 

226) „ Leykauf, Georg, k. Hofstahl Warenfabrikant. 

227) „ Dr. Limpert, L., prakt. Arzt und Zahnarzt. 

228) n Lindmann, Jakob, Direktor des Gaswerks in Fürth. 

229) „ Lindner, Heinrich, Kaufmann. 

230) „ Lösch, Fritz, k. Postoffizial. 

321) „* Dr. Löwi, Rudolf, Notariatskonzipient. 



Digitized by VjOOQ IC 



u 

232) Herr Lotze, Hermann, Fabrikbesitzer in Mögeldorf. 

233^ „ L a c a 8 , Albert, k. Bankkommis in Hof. 

234) „ Dr. Maas, Markus, prakt. Arzt. 

236) „ Dr. Mayer, M. L., prakt. Arzt. 

236) „ Mayer-Dinkel, Albert, Kaufmann. 

237) „ Mandel, Karl, Kaufmann. 

238) „ Mang er, Karl, k. Reallehrer. 

239) „ Marlier, Julius, Kaufmann und U. Vorstand des Gemeinde- 

kollegiums. 

240) „ Martin, Eugen, Rechtsanwalt. 

241) „ Marx, Georg, Ober-Ingenieur. 

242) „ Dr. M^ehler, Heinrich, prakt. Arzt in Georgsgmünd. 

243) „ M eis er, Franz, Ingenieur. 

244) „ Dr. Merkel, Gottlieb, k. Medizinalrat und Krankenhaus- 

Direktor. 

245) „ Dr. Merkel, Wilhelm, prakt. Arzt. 

246) „ Merzbacher, Joseph, Kaufmann. 

247) „ Mesthaler, Joh., Fabrikbesitzer und Kommerzienrat. 

248) „ Metzgor, Ludwig, Kaufmann und Konunerzienrat. 

249) „ Dr. Metzger, Sigmund, Fabrikbesitzer. 

250) „ Michahelles, Georg, k. Hauptmann und Kompagnie-Chef. 

251) „ Dr. Mohr, Gustav, prakt. Arzt. 

252) „ Dr. Morgenstern, Friedrich, Fabrikbesitzer in Fürth. 

253) „ Müller, August, Kaufmann. 

254) „ Müller, Jean, Kaufmann. 

255) „ Dr. Müller, Wilhelm, prakt. Arzt. 

256) „ Dr. Münz, Pinkus, prakt. Arzt. 

257) „ Münzinger, August, Kaufmann. 

258) „ Munker, Georg, k. Professor a. D. 

259) „ Munzer, Julius, Kaufmann. 

260) „ Naar, Adolf, Privatier. 

261) „ N au e, Otto, Kaufmann. 

262) „ Dr. Neuberger, Jos., prakt. Arzt. 

263) „ Dr. Neuburger, S., Augenarzt. 

264) „ Dr. Neukirch, Richard, Oberarzt am städt. Krankenhaus. 

265) „ Neumeyer, Hans, Kaufmann. 

266) „ Neumüller, Konrad, Schreinermeister. 

267) „ Nister, £., Kunstanstaltsbesitzer und Kommerzienrat. 

268) „ Offenbacher, Joseph, Kaufmann. 

269) „ m e i s , Gottlieb, k. Notar und Justizrat. 

270) „ Dr. Oppler, Theodor, Chemiker. 

271) „ Ottenstein, Albert, Kaufmann. 

272) „ Ottenstein, Justin, Kaufmann. 

273) „ Ottenstein, Max, Kaufmann und Fabrikbesitzer. 

274) „ Paalzow, Richard, Kaufmann. 

275) „ P a b s t , Friedrich, Fabrikbesitzer. 

276) „ P a b s t , Julius, Fabrikbesitzer. 

277) „ Palm, Ludwig, Metallgiefsereibesitzer. 

278) „ Paulack, Theodor, Apotheker. 

279) „ Dr. Pauschinger, Leonhard, prakt. Arzt. 

280) „ Dr. Peretz, E., prakt. Zahnarzt. 

281) „ Peters, Hermann, Apotheker. 

282) „ Pfahl er, Christian, Zahntechniker. 

283) „ Pfautsch, Friedrich, Apotheker i. Weidenbach b. Triesdorf. 

284) „ Pfeiffer, Julius, Sprachlehrer. 

285) „ Pilhofer, Joh., k. ßahnexpeditor. 



Digitized by VjOOQ IC 



46 

286) Herr Dr. P ö s c h e 1 , Gustav, k. Bezirksarzt in Neustadt a. A. 

287) „ Popp, Adolf, Kaufmann. 

288) „ P reif 8, Konrad Philipp, Mechaniker. 

289) „ Prell, August, k. Ober-Bankbuchhalter. 

290) „ Pretzfelder, Julius, Kaufmann. 

291) „ Dr. P r i r , Eugen, Direktor. 

292) „ T. Puscher, Wilh., Privatier und Kommerzienrat 
29S) „ Putz in, Ludwig, Fabrikbesitzer. 

294) „ Raab, Karl, Fabrikbesitzer und Magistratsrat. 

295) „ Ratz, Heinrich, Apotheker. 

296) „ Rau, S. £., Kaufinann. 

297) „ Dr. Raum, W., Fabrikbesitzer. 

298) „ Kehlen, Wilhelm, Fabrikbesitzer und Magistratsrat 

299) „ Reif, Jean, Brauereibesitzer. 

800) „ Reif, Zacharias, Brauereibesitzer und Kommerzienrat. 

301) „ Dr. Reizenstein, Fritz, Assistent an der Universität 

Würzburg. 

302) „ Reizenstein, Hugo, Kaufmann. 

303) „ Rettclbusch, Ernst, Architekt. 

304) „ Rhau, Georg, Kaufmann und Fabrikbesitzer. 
805) „ Dr. Riedel, Heinrich, Apotheker. 

30e) „ Dr. Riegel, Wilhehn, prakt. Arzt. 

307) „ R i e p p e 1 , A., Fabrikdirektor 

308) „ Rifsmann, Ulrich, Kaufmann. 

309) „ Rockstroh, Gustav, Kaufmann. 

310) „ Rodler, Karl, Apotheker. 

311) „ Dr. R e 1 i g , Eduard, prakt. Arzt 

312) „ Rogner, Konrad, Direktor des städt Schlachthofes. 

313) „ R ohmer, Assistent an der Kreisrealschule. 

314) „ Dr. Ro s e n f el d, L., prakt. Arzt. 

315) „ Rosenfeld, Sigmund, Kaufmann. 

316) „ Rotte r, Johann, Gürtlermeister. 

317) „ Rudel, Georg, k. Oberst und Bezirks-Kommandenr. 

318) „ Rudel, Wilhelm, k. Pfarrer. 

319) „ Rupp recht, Friedrich, Privatier. 

320) „ Dr. Rupprecht, Georg, prakt Arzt. 

321) „ Rupprecht, Wilhelm, Kaufmann. 

322) „ Sachs, Karl, Grofshändler und Kommerzienrat 

323) „ Sachs, Wilhebn, Kaufmann. 

824) „ Schäfer, Jakob, k. Bezirkshauptlehrer in Fürth. 

325) „ Schaff, Leonhard, Kaufmann. 

326) „ Schafft, Emil, Charkutier. 

327) „ SchedelvonGreifenstein, Karl, Apotheker in Schweinau. 

328) „ Dr. Scheidemandel, Heinrich, praJct Arzt 

329) „ Scheuermann, Ferdinand, Privatier. 

330) „ Schilf fahrt, Karl, Bezirkstierarzt in Burglengenfeld. 

331) „ Schilling, Theodor, Grofshändler u. k. italienischer Konsul. 

332) „ Schlatter,k. Oberstlieutenant. 

333) „ Schlegel, Hans, städt Inspektor. 

334) „ Schmidmer, Chr., Fabrikbesitzer, Kommerzienrat und 

Gemeindebevollmächtigter. 

335) „ Dr. S c h m i d m e r , E., Chemiker. 

336) „ Schmidt, August kgl. Postmeister. 

337) „ Schmidt, Eduard, k. Bezirkstierarzt. 

338) „ Schmidt, Karl, Ingenieur. 

339) „ Schmidt, Rudolf, Optiker. 



Digitized by VjOOQ IC 



46 

840) Herr S c h n e b e I , Ignaz, Kaufmann. 

341^ „ Schönner, Georg, jun., ReiTszeugfabrikant. 

842) „ Scholl er, Frie3rich, Hauptagent. 

343) „ Schräg, Karl, Hofbuchhändler. 

844) „ Schreiber, August, Bildhauer und Yergolder. 

345) „ Dr. Schrenk, Friedrich, prakt. Arzt. 

346) „ Schröder, Christian, Optiker. 
„ Schröder, Theodor, k. Gymnasialprofessor. 
„ Dr. Schubert, Paul, prakt. Arzt. 

„ Dr. Y. Schuh, Georg, I. Bürgermeister der Stadt Nürnberg. 

„ Schuh, Heinrich, Fabrikbesitzer. 

„ Schuh, Wilhelm, Apotheker. 

„ Schultheifs, Friedrich, Apotheker. 

y, Schultheifs, Veit, st&dt. Trichinenschauer. 

„ Schultheifs, Oskar, Rechtspraktikant. 

„ Schwanhäuser, Gustav, Fabrikbesitzer u. Kommerzienrat. 

„ Dr. Schwanhäuser, Chemiker. 

„ Schwarz, August, k. Stabsveterinär. 

„ Schwarztrauber, Jobs., Veterinär, I. Klasse. 

„ Schwemmer, Christian, rechtsk. Magistratsrat. 

„ S e b al d , Hans, Buchdruckereibesitzer. 

„ Seiler, Christoph, Ingenieur und Fabrikbesitzer. 

„ Dr. Seiler, Hermann, prakt. Arzt. 

„ S e i t z , Georg, Fabrikbesitzer und Konmierzienrat. 

„ Dr. Siebenhaar, Johann, prakt. Arzt in Gräfenberg. 

„ Silbermann, Julius, Kaufmann. 

„ Simon, Johannes, Lehrer. 

„ Dr. Simon, Max, prakt. Arzt. 

„ S 1 g e r , Friedrich, Kaufmann. 

„ Sommer, Theodor, Assistent am bayer. Gewerbemuseum. 

„ S p a n d e 1 , Erich, Buchdruckereibesitzer. 

„ Speckhardt, Georg, Bäckermeister. 

„ Stadler, Zahnarzt. 

„ Stahl, Job. Christ, Kaufmann. 

„ Stau dt, Erdmann, Kaufmann. 

„ Dr. Stein, Oskar, prakt. Arzt. 

„ Dr. Steinhard, praüct. Arzt. 

„ Dr. Steinheimer, Ludwig, prakt Arzt 

„ V. Stengel, Freiherr, Stephan, k. Major. 

„ Dr. Stich, Eduard, k. Hofrat und Oberarzt 

„ Dr. Stockmeier, Hans, Vorstand am bayr. Gewerbemuseum. 

„ S t ö h r , August, Sekretär a. polyt. Zentral-Verein in Würzburg. 

„ Dr. S t r a u b , Adolf, Assistent a. d. städt. Untersuchungsanstalt 

„ Straus, Simon, Kaufmann. 

„ Straufs, Willy, Kaufmann. 

„ Dr. Straufs, Julius, Oberlehrer an der Handelsschule. 

„ Straufs, Louis, Kaufmann. 

„ V. Stromer, Fr., Freiherr, Rechtsanwalt. 

„ Dr. Sturm, Jakob, prakt. Arzt in Mögeldorf. 

„ Süfs, Clemens, Apothekenbesitzer. 

„ Tafel, Hermann, Fabrikbesitzer in St. Jobst. 

„ Thurnauer, Bernhard, Fabrikbesitzer. 

„ Tölke, Konrad, Kunstgärtner u. Gemeindebevollmächtigter. 

„ Tuchmann, Franz, Kaufmann. 

„ Tuchmann, Friedrich, Kaufmann. 

„ Tuchmann, Max Joseph, Kaufmann. 



Digitized by VjOOQ IC 



47 

396) Herr Ulm er, Julias, Bankier. 

397) „ Dr. Ulrich, August, Inspektor der höheren Töchterschale. 

398) „ Völker, Georg, Kaufmann. 

399) „ Voj^el, Bernhard, Privatier in Mögeldorf. 

400) y. Voigt, Gustav, Kau&nann. 

401) n Voit, Paul, Laufmann. 

402) „ Voit, Robert, Kaufmann. 

403) „ Voit, Rudolf, Schneidermeister. 

404) „ Vollhard, Oskar, k. Advokat und Justizrat. 

405) „ Vo 11 rath, Franz, Kaufmann. 

406) n Dr. Wagner, Friedrich, kgl. Professor in Lichtenhof 

407) „ Waydelin, W. Fr., Kaufmann. 

408) „ W e 1 g e 1 , Karl, prakt. Arzt in Berlin. 

409) „ W e i g l e , Theodor, Apotheker u. Gemetndehevollm&chtigter. 

410) „ Weil, Philipp, Kaufmann. 

411) „ Weinberger, Max, Fabrikant. 

412) „ Dr. Weinhart, Paul, Assistent an der Industrieschule. 
418) „ Weinschenk, Hermann, Kaufmann. 

414) „ Weifs, August, Apothekenbesitzer und Magistratsrat 

415) „ Weifs, Robert, Kaufmann in Chemnitz. 

416) „ W e 1 z e 1 , Karl, prakt. Arzt. 
417} „ W e n k , Richard, Buchhändler. 

418) n Wertheimer, Sigmond, Kaufmann. 

419) B Dr. Wiegmann, Assisent. 

420) n W i e 1 a n d , Peter, Privatier. 

421) „ Wieseler, Wilhelm, Kaufmann. 

422) „ W ö l f e 1 , Konrad, Metzgermeister. 
428) „ Wolf, Mathias, k. Postmeister. 

424) „ Dr. Wolf, W., Apotheker. 

425) „ Wunder, Justin, Chemiker. 

426) „ Dr. Zagelmeier, Hans, Veterin&rassistent. 

427) „ Zeltner, Johannes, Fabrikbesitzer. 

428) „ Z e 1 1 n e r , Johannes, jun., Kaufmann. 

429) „ V. Zenetti, Julius, Excellenz, k. Regierungspräsident in 

Ansbach. 

430) „ Zippe li US, August, Kaufmann. 

431) „ Dr. Zwanziger, Georg, k. Reallehrer. 



B. Korrespondierende Mitglieder. 

Herr Dr. Ascherson, Paul, k. Professor an der Universität Berlin. 
„ Dr. Biehringer, Joachim, Privatdozent am Polytechnikum zu 

Braunschweig. 
„ Dr. Böttger, Oskar, Professor in Frankfurt a. M. 
„ Dr. Braun, Heinrich, Naturforscher und Gemeinderat in Wien. 
„ Dr. Buchenau, Franz, Professor in Bremen. 
„ Dr. Dieudonn^, Adolf, k. b. Assistenz- Arzt in Berlin. 
„ ▼. Docoupil, Wilhelm, Direktor der k. k. Fachschule in HoHc. 
y, Dr. Fleischmann, Albert, Universitätsprofessor in Erlangen. 
„ Gebhart^ Oskar, Kaufinann in Markt Redwitz. 
„ Ooeringer, k. Oberst und Reg.-Komm. in Ingolstadt. 
„ Hall, J., Staatsgeolog in Jowa und Paläontolog für die Staaten 
New- York, Albany etc. 



Digitized by VjOOQ IC 



_J8 

Herr Dr. y. Heldreich, Direktor des botan. Gartens and Direktions- 
mitglied des naturhistorischen Mnseoms zu Athen. 

y, Dr. Herz, Fr. J., k. Konsalent für Molkereiwesen in Memmingen. 

„ Dr. H o 1 1 e r , August, k. Bezirksarzt in Memmingen. 

„ Homann, Karl, Redakteur in Rostock. 

„ Hornung, Heinrich, k. Reallehrer in Ansbach. 

„ LeJolis, Auguste, Direktor der Soci^te des sciences naturelles 
et mat^mathiques de Cherbourg. 

„ Dr. 1 8 s e 1 , Arthur, Professor in Genua. 

„ E 1 e y 1 e i n ,^Fakrikbesitzer in Gablonz. 

„ Dr. Klunzfnger, Benjamin, k. Professor in Stuttgart. 

„ E r ä n z 1 e , Joseph, k. Eorps-Stabs Veterinär a. D. in München. 

„ Erapfenbauer, Andreas, Apotheker in Manilla. 

„ Dr. E r^ t z m a n n , £., prakt. Arzt in Marienbad. 

„ Landauer, Robert, Apotheker in Wurzburg. 

„ Macco, Eduard, Eapitän. 

„ Dr. M a g n u s , Paul, k. Professor an der Universität Berlin. 

„ Dr. M e h 1 i 8 , Christian, k. Gymnasiallehrer in Neustadt a. H. 

„ Dr. Müller, W., ordentlicher Professor an der Universität Jena. 

f, Dr. Peters, Earl, Reichskommissar. 

„ Dr. Rehm, H., k. Medizinalrat in Regensburg. 

„ Dr. Reinsch, Paul, Privatgelehrter in Erlangen. 

„ Dr. Skofitz, A., Herausgeber der österr. botanischen Zeitschrift 
in Wien.* 

„ Temp8ky,Fr., Buchhändler in Prag, 

„ Teufel, Gustav, Ingenieur in München. 

„ Weidner, Gutsbesitzer in Gerasmühle. 

„ W e i g e 1 , Friedrich, Eaufmann in Ansbach. 

„ Dr. Will, Privatgelehrter in Erlangen. 

„ V. Wifsmann, kais. Gouverneur a. D. 

„ Wörlein, Gg., k. Zahlmeister a. D. in Nymphenburg. 



C. Ehrenmitglieder. 

Sr. Egl. Hoheit Dr. Carl Theodor, Herzog in Bayern. 
Herr A g a s s i z , Alexander, Professor in Cambridge. 
„ Arnold, Fr., k. Oberlandesgerichtsrat in München. 
„ Ball hörn, Hermann, Buchhändler in Würzburg. 
„ Dr. Blasius, R., Professor in Braunschweig. 
„ Dr. Büchner, Ludwig, prakt. Arzt in Darmstadt. 
„ Ca8tellanos,B. S., Direktor der k. archäologischen Academie 

in Madrid. 
„ Doval-Jouve,J., Ancien Inspecteur de l'Academie de Montpellier. 
„ Dr. Flügel, Felix, Privatgelehrter in Leipzig. 
„ Dr. von G um bei, Wilhelm, k. Oberbergamts-Direktor und üni- 

versitätsprofessor in München. 
„ Dr. Günther, Sigmund, k. Professor an der techn. Hochschule in 

München. 
„ Dr. V. Hauer, Ritter, Franz, k. Hofrat in Wien. 
„ Dr. V. E och. Gottlieb, Direktor des zoolog. Instituts in Darmstadt. 
., Dr. E c h , Ludwig, sen., prakt. Arzt in Nürnberg. 
„ Lambrecht, Fr., k. hoU. Hauptmann in Hannöverisch-Münden. 
„ L 1 1 e r , M., Waisenhausvater in Nürnberg. 
„ Dr. Morris, J. G., Pastor in Baltimore. 



Digitized by VjOOQ IC 



49 

Herr Dr. Müller, Karl, Priyatgelehrter in Halle a. d. Saale. 

„ Dr. V. Pettenkofer, M.,k. Geheimer Obermedizinalrat i. München. 

„ P h i 1 i p p i , R. A., Professor a. d. Academie in Santjago in Chile. 

„ Dr. Ranke, Johannes, k. Professor in München. 

, Dr. S e 1 e n k a , Emil, Professor hon. an der üniversitftt München. 

„ Dr. Snringer, W. F. R., Professor nnd Direktor in Leyden. 

„ Dr. Virchow, R., k. Geheimer Rat und Üniv.-Prof. in Berlin. 

Prof. Dr. Hartwig. 



Digitized by VjOOQIC 



60 

Vn. Jahresbericht der Sektion für Anthropologie, 
Ethnologie und Urgeschichte. 

Die Sektion zählte im Jahre 1896 37 Mitgheder. Sitzungen 
wurden 13 abgehalten. 

Obmann war Herr Dr. Scheidemandel, Schriftführer Herr 
Dr. Bernett, Kassier Herr Schultheifs. 

Durch Vorträge und Referate beteiligten sich an den Sektions- 
versammlungen die Herren: 
Dr. Baumüller: 

1. Durch Demonstration und Besprechung von vier Schädeln, 
welche der Naturhistorischen Gesellschaft und der Sektion 
zu Geschenken gemacht wurden, darunter zwei sogenannte 
Thurmschädel. 

2. Über Pithecanthropus erectus Dubois. 

3. Über darüber bekannt gewordene Publikationen von Virchow, 
Cunningham, Turner und Martin. 

4. Über eine Dissertation von Friedrich, das Verhältnis der 
Markräume zur Masse der Knochen. 

6. Über: Hirsch, die Bedeutung der Schienbeinformen. 

Bing: Untersuchung der Brunnsteinhöhle bei Streitberg. 

Dr. Bernett: 

1. Die Funde bei Münzinghof. 

2. Die archäologische Grund karte Bayerns. 

3. Hohlringe aus Bronze der Sammlung des historischen Vereins 
zu Neuburg a. D. 

4. Funde vom Goerauer Anger. 

5. Ausgrabung im Hardtwalde bei Langenzenn. 

6. Die zahlreichen litterarischen Einlaufe. 

Dr. V. Forster: 

1. Über menschliche Skelettreste in den Kieslagern von Galley- 
Hill bei Northleet (Kent) von Elliot im Jahre 1888. 

2. Gürtelblech im Spessart von Herrn Hauptmann v. Haxthausen 
gefunden. 

3. Antrag, gelegentlich der Landesausstellung eine Versammlung 
nordbayerischer Anthropologen und Prähistoriker abzuhalten. 

Huber: 

1. Gefäfsfunde bei Münzinghof. 

2. Ausgrabungen in der Brunnsteinhöhle bei Streitberg. 



Digitized by VjOOQ IC 



5 1 

Dr. Scheidemandel: 

1. Nekrolog auf Hofrat Dr. Jacob. 

2. Jacob, die Gleichberge bei Römhild. 

•Knapp: Vorgeschichtliche Befestigung am alten Rothenberg. 
Ketz in Streitberg: 

1. Skelettknochenfunde vom Menschen am hängenden Fels bei 
Streitberg. 

2. Mitteilung über Gräber bei Heckenhof, Oberfellendorf, Voigen- 
dorf und Leidingshof. 

3. Ober die Ausgrabungen auf dem Buchenberg bei Entenberg. 

Schultheifs: Funde von Skelettresten des Elephas 
meridionalis und Steinwerkzeuge am linken Ufer der Charente, 
im Prometheus publiziert. 

Stahl: Bronze- und Geföfsfunde von Mausbach bei Ems- 
kirchen. 

Wunder: 

1. Ober Ausgrabungen in der Stöcklach bei Ruckersdorf. 

2. Ober Gräber bei Behringersdorf, Buchenberg, Wilhermsdorf. 

3. Ober die Ausgrabung auf dem Buchenberg bei Entenberg, 
und Langenzenn im Hardtwald. 

Von der Sektion wurden im Laufe des Jahres 1 Grabhügel 
in der Stöcklach, 2 auf dem vorderen Buchenberge und 1 im Hardt- 
walde bei Langenzenn eröffnet, wobei besonders die Ausgrabungen 
in der Stöcklach interessante Bronzefunde der Hallstattzeit ergaben. 

Die Funde wurden der anthropologischen Sammlung einverleibt, 
welche auch durch Kauf eines Fundes vom Görauer Anger einen 
wertvollen Zuwachs erhielt 

Die Bibliothek wurde durch mehrfache Werke vergröfsert, 
darunter durch Anschaffung von Seite der Sektion von Buschan, 
vcrgl prähistorische Botanik und Centralblatt für Anthropologie, 
Ethnologie und Urgeschichte. 

Ein grofser Teil der Sektionssitzungen wurde durch die Be- 
sprechungen wie die von der Sektion beschlossene Versammlung 
nordbayerischer Anthropologen und Prähistoriker durchgeführt 
werden soll, in Anspruch genommen. Dank der Bereitwilligkeit 
aller beteiligten Behörden, Vereine und Gönner des Unternehmens 
konnte- dieselbe am 30. Mai gelegentlich der Nürnberger Landes- 
ausstellung in durchaus würdiger und gelungener Weise eröffnet werden. 

Die gleichzeitig mit dieser Versammlung veranstaltete Aus- 
stellung prähistorischer Funde aus Nordbayern ergab eine höchst 

Digitized by VjOOQ IC 



52 

instruktive Obersicht der vorgeschichtlichen, aufeinander folgenden 
Kulturperioden und ein lehrreiches Bild über die Vorgeschichte 
Nordbayerns. 

Allen, die sich um das Zustandekommen dieser Verdammlung 
und der Ausstellung bemüht haben, gebührt der aufrichtigste Dank 
der Sektion, insbesondere der verehrlichen Vorstandschaft des 
bayerischen Gewerbemuseums, der wir für ihre Unterstützung herz- 
lichsten Dank bewahren. 

Bezüglich der Vorträge während der Versammlung sei auf 
die ausführlichen Berichte in den prähistorischen Blättern von 
Dr. Naue verwiesen. 

Dr. Scheidemandel, 
Obmann. 



Vm. Jahresbericht der botanischen Sektion. 

Der Sektion^ welche am Beginn des Jahres 24 Mitglieder 
zählte, traten im Laufe desselben die Herren Neumüller, Paal- 
zo w und Hussong bei, so dafs sie am Schlufs des Jahres 27 Mit- 
glieder zählte. 

Die Vorstandschaft blieb dieselbe, wie im Vorjahr. 

Die Sektion hielt folgende Zeitschriften: 

Botan. Zentralblatt von Uhlworn, Deutsche botan. Monats- 
schrift von Leimbach, AUgem. botan. Zeitschrift von Kneucker, 
Österr. botan. Zeitschrift von Wettstein. Aufser diesen Schriften 
zirkulierten noch — von der Gesellschaft freundlich der Sektion 
überlassen — folgende : Biolog. Zentralblatt von Rosenthal, Prome- 
theus, Wiener Gartenzeitung. 

Folgende Werke wurden für die Bibliothek angeschafft: 

Gümbel, Geologie von Bayern, Schlufsheft ; Botan. Adrefsbuch 
von Dörfler; Rees, Lehrbuch der Botanik; Ascherson, Synopsis der 
mitteleurop. Flora, 1. u. 2. Heft; Warming, ökolog. Pflanzengeographie, 
Frank, Tierparasitäre Pflanzenkrankheiten. 

Geschenkt wurde von Herrn Professor Dr. Wagner, als 
Verfasser: Referat über den Alpenkurs des Schweizer alpenwirt- 
schaftlichen Vereins. 

Die botanischen Sammlungen erhielten wieder dankenswerte 
Zuwendungen von Seiten der Herren Kaulfufs, Kränzle, Rehm, 
Simon u. a. 



Digitized by VjOOQ IC 



53 

Die genaue Durchforschung unseres Florengebiets wurde eifrig 
fortgesetzt ; die Wanderungen einzelner MitgUeder sowie die Vereins- 
und Sektionsausflüge Heferten interessante Ergebnisse, besonders 
auch hinsichtlich der pflanzengeographischen Verhältnisse. Letztere 
wurden wieder durch zirka 90 vom Obmann der Sektion gefertigte 
Verbreitungskärtchen zu klarer Anschauung gebracht Während 
Herr Kaulfufs der Farn- und Moosflora sein Hauptaugenmerk 
zuwandte und seine mühevolle Arbeit auf diesem Gebiet durch 
mehrfache sehr wertvolle Funde belohnt sah, beobachtete neben 
andern Sektionsmitgliedern vornämlich Herr Fried r. Schultheifs 
die Adventivflora und konnte manchen neuen Ankömmling konsta- 
tieren. Auf Anregung von Prof. Magnus in Berlin war von 
einzelnen Mitgliedern eine Anzahl meist parasitärer Pilze gesammelt 
worden ; das gestammelte Material hat dann Prof. Magnus verarbeitet 
und unter dem Titel: »Beitrag zur Pilz-Flora von Franken, ins- 
besondere der Umgegend von Nürnberg«, in den Abhandlungen der 
Gesellschaft, Band IV, veröffentlicht. 

Über die phänolog. Verhältnisse hat Herr Friedr. Schult- 
heifs auf grund sorgföltiger Beobachtungen allmonatlich referiert, 
auch vier zusammenfassende Referate im General-Anzeiger ver- 
öffentlicht. 

In den 11 ordentlichen und 8 aufserordentlichen Sitzungen 
wurden folgende Referate geliefert: 

Von Herrn Dr. Buchner: über die Flora von Sexten, vom 
Ober- und Mittelpinzgau, über SUene pudibunda, Orchis 
Traunsteineri, Hieracium florentinum, Cynodon Dactylon, 
Calycanthus floridus. 

Von Herrn Erhard: über die Flora von Hohenschwangau 
und Reutte. 

Von Herrn Förderreuther: über die Flora von Hersbruck 
und Neumarkt 

Von Herrn Kaulfufs: über Leuchtmoos, über verschiedene 
Farn-Gattungen unter Vorlage trefllicher, von ihm selbst 
nach der Natur gezeichneter und gemalter Abbildungen, 
über die charakteristischen Unterschiede von Woodsia 
ilvensis, hyperborea und glabella. 

Von Herrn Prell: über die Flora des Ortlergebiets und des 
Contrinthals. 

Von Herrn Rodler: über die Flora von Südtyrol und der 
Schweiz, von Schweinfurt, Hafsfurt, Staffelberg; über 



Digitized by VjOOQ IC 



54 

Gnaphalium sil vaticum var. Einseieana ; Hieracium florentinum 
und über die Früchte von Ginkgo biloba. 

Von Herrn Rudel sr.: über Kohle aus dem rhätischen 
Keuper im Teufelsgraben bei Altdorf; über Cardamine 
amarapratensis bei Neumarkt. 

Von Herrn Rudel jr. : über die Flora von Starnberg-Parten- 
kirchen und von Südtyrol. 

Von Herrn Friedr. Schultheifs: über Phänologie; über 
Konjugation einer Spirogyne-Art, über die Flora unseres 
Gebiets, besonders die Adventivflora. 

Von Herrn V.Schultheifs: über Opuntia leucotricha, Stapelia 
deflexa, Mina lobata, mit Vorführung blühender Exemplare. 

Von Herrn Scjhwarz: über Medicago falcata, sativa und 
media; überTulipa silvestris, Bartramia pomiformis, Cuscuta 
Cesathiana und ihre mannigfachen Wirtspflanzen; über 
floristische und geognostische Beobachtungen im Velden- 
steiner Forst, in der Umgebung von Hollfeld und Heiligen- 
stadt. 

Herr Rechtsrat Schwemmer: über die Flora von Cortina, 
über Silene quadrifida und alpestris; über Sempervivum 
tectorum in den Alpen, über Hieracium florentinum, 
Calycanthus odorus. 

Von Prof. Dr. Wagner: über Bodenimpfung, besonders die 
von Höchst unter dem Namen Nitrogin in den Handel 
gebrachten Reinkulturen von Wurzelkoöllchen erzeugenden 
Bakterien; Ober Lathyrus Clymenum als Futterpflanze; 
über verschiedene landwirtschaftlich gebaute Lupinus- 
Arten, über die neue Kartoffelkrankheit : Alternaria Solani 
(Dürrfleckenkrankheit). 

An den drei Vereinsausflügen beteiligten sich mehrere 
Sektionsmitglieder; diese, sowie die Sektions-Exkursion, ergaben 
schätzenswerte floristische Beobachtungen. 

Am 9. März hielt die Sektion ihre 200. Sitzung, wozu ihr 
vom Direktorium der Gesellschaft Glückwünsche dargebracht wurden. 
Der Obmann hielt eine zu einträchtigem und freudigem fernerem 
Zusammenwirken ermunternde Ansprache, der Schriftführer gab 
einen Überblick über die Gründung und Entwickelung der Sektion 
und ihre bisherigen Leistungen. 



Digitized by VjOOQ IC 



55 

Schliefslich sei noch der wärroste Dank ausgesprochen fQr 
die finanzielle Unterstützung, die der Sektion von der Gesellschaft ge- 
währt wurde, sowie für das freundliche Entgegenkommen der Redaktion 
des General- Anzeigers, das dieselbe durch unentgeltliche Aufnahme 
der Einladungen zu den Sektions-Sitzungen bekundet hat 

A. Schwarz, W. Rudel, Pfarrer, 

Obmann. Schriftführer. 



IX. Jahresbericht der geographischen Sektion. 

In ihrem 9. Lebensjahr zählte die geographische Sektion 
30 Mitglieder. 

Von ihnen versammelte sich allmonatlich eine kleine Zahl 
zu 12 Sitzungen. In denselben wurden folgende Vorträge, Referate 
and Vorlagen gebracht: 

1. Am 18. Dezember 1895: 

Von Herrn Heerwagen: Wandtafeln von Geistbeck-Ehlers ; 
» » Aug. Schmidt: über den Inhalt des Archivs für 
Post und Telegraphie; 

Von Herrn Hör mann: über die LGsslandschaften des nörd- 
lichen Chinas nach Richthofen; 

2. am 20. Januar 1896: 

von Herrn Enslin: ältere Pläne von Nürnberg; 
derselbe: neuere Verkehrskarten; 

3. am 17. Februar 1896: 

von Herrn Hör mann: über den gegenwärtigen Stand der 
Polarforschung nach v. Drygalski; 

4. am 16. März 1896 : 

von Herrn Förderreuther: Über Ghillanys Werk : Der Ritter 
Martin Behaim; 

5. am 27. April 1896 : , 

wurden wie in jeder Sitzung vom Obmann vorgelegt: 

Petermanns geogr. Mitteilungen, die geographische Zeit> 
Schrift von Hettner und andere buchhändlerische Einlaufe, 
über deren Inhalt diskutorische Unterhaltung stattfand ; 

6. am 15. Mai 1896 : 

von Herrn Heerwagen: über Slatin Pascha und ein älteres 
Werk über Ungarn; 



Digitized by VjOOQ IC 



66 

7. am 15. Juni 1896: 

Von Herrn Aug. Schmidt: über Sven Hedins Durchcpierung 

der Takla-Makan- Wüste ; 
derselbe: über Entwickelung der japanischen Schiffahrt; 
Von Herrn Hörmann: die russischen Forschungen in Zentral- 

Asien; 

8. am 20. Juli 1896 : 

Von Herrn Heerwagen: über Elden's Artikel : Die japanische 
Konkurrenz, woran sich lebhafte Diskussion scfalofs; 

9. am 17. August 1896: 

Von Herrn Enslin: eine Reihe getreuer, mit groCsem Fleifs 
und Geschick ausgeführter Handzeichnungen seines Herrn 
Vaters aus der fränkischen Schweiz und anderen benach- 
barten Gegenden; 

Von Herrn Aug. Schwarz: über landeskundliche Literatur 
und Bildwerke das Nürnberger und benachbarte Gebiet 
betreffend ; 

10. am 21. September 1896: 

VonHerrnHeerwagen: über Matschie's Arbeit: Geographische 
Fragen aus der Säugetierkunde; 

11. am 19. Oktober 1896: 

Von Herrn Voigt: eine Karte von Bayern aus dem Jahre 1812; 
derselbe übergab als Geschenk eine Medaille auf 
eine Ehrung des Reisenden Martins; 

derselbe: einen Kalender aus dem Jahr 1783; 

12. am 18. November 1896: 

Von Herrn Hör mann: über das Wirtschaftsleben der Natur- 
völker, nach Panckow; 

Von Herrn Baumüller: über die drei ersten deutschen 
Geographentage. 

Aufserdem wurden über interessante Tagesfragen aus der ge- 
samten Geographie kürzere oder längere Kolloquien geführt, so z. B. 
über Nansens Polarexpedition, über Andrees Ballonversuch etc. 

Zur Bibliothek der Naturhistorischen Gesellschaft schaffte die 
Sektion aus eigenen Mitteln an: Geographisches Jahrbuch, Bd. XVII 
und XVIII. Verhandlungen und Zeitschrift der Gesellschaft für 
Erdkunde in Berlin. Deutsche Kolonialzeitung. Ratzel, Völker- 
kunde, I. Verhandlungen des XI. Deutschen Geographentags in 
Bremen. Dieselben Bd. I— VUI. 



Digitized by VjOOQ IC 



57 

Die Geschäfte der Sektion besorgten die Herren Dr. Bau- 
müller als Obmann, He er wagen als Schriftführer, Enslin 
als Kassier. 

Dr. Baumüller. 



Z. Jahresbericht der chemischen Sektion. 

Die chemische Sektion zählte am Anfang des Jahres 40 Mit- 
glieder; von diesen verlor dieselbe ein Mitglied durch Aufenthalts- 
veränderung, zwei Mitglieder traten aus, während 5 Mitglieder neu 
eintraten, so dafs die Mitgliederzahl am Ende des Jahres 43 betrug. 
Mit Ausschluls des Stiftungsfestes fanden im Laufe des Jahres 
9 Sitzungen statt, um 3 weniger als im Vorjahre. 

Diese Verminderung ist darauf zurückzuführen, dafs wegen 
der Landes-Industrie- und Gewerbeausstellung das Sommersemester 
bereits am 8. Mai geschlossen und das Wintersemester erst am 
10. November begonnen wurde. Aufserdem versammelten sich 
zahlreiche Mitglieder am 17. August zu einer Ehrensitzung für die 
anwesenden Herren Professoren Dr. Erlenmeyer sen. und jun. 
in einer der Ausstellungsrestaurationen. 

In den 9 wissenschaftlichen Sitzungen wurden von 10 Mit- 
gliedern und 1 Gast 12 Vorträge, darunter 4 mit Demonstrationen 
und 6 Referate gehalten; gegenüber dem Vorjahre ergibt sich eine 
Minderung um 2 Vorträge und 8 Referate, welche indes auf die 
geringere Zahl von Sitzungen zurückzuführen ist. 

Die Themate der erstatteten Vorträge und Referate lauteten: 
Sitzung am 11. Februar : Reallehrer Kugelmann: Die Verflüssigung 
schwer verdichtbarer Gase mit besonderer Berücksichtigung 
des neuen Linde'schen Verfahrens. 
25. Febr. Dr. Zwanziger: Die Konstitution des Wasserstoffsuper- 
oxydes. 
» > Dr. Lessing: Eine neue Methode zur Darstellung des 

Bleiweilses auf elektrolytischem Wege. 
» > Dr. Landsberg: Ein neues Verfahren zur Darstellung 
von Paraamidobenzaldehyd. 
24. März. Dr. R e iz e n st e i n : Neue Nitroseverbindungen des Eisens 
and eine neue Klasse von Metallammoniakverbindungen. 
» > Dr. Morgenstern; Die Nürnberger Bleistiftindustrie und 
ihre Arbeiter nach Dr. Schwanhäuser. 

Digitized by VjOOQ IC 



58 



24. März. Dr. Lessing: Ein neues Verfahren zur Darstellung von 
Bleistifthülsen aus Holzmehl. 

> » Dr. Oppler: Die Schrift Lunge's über den Bildungstrieb 

der Stoffe. 
14. April. Dr. Schwanhäuser: Die Synthese ringförmiger Ver- 
bindungen mit Oxalester. 

> > Dr. Zwanziger: Die geognostische Beschaffenheit des 

Lahnthaies. 
28. » Prof. Dr. Wagner: Über Kunstdünger. 
8. Mai. Derselbe: Über Kunstdünger. 
10. Nov. Direktor Wunder: Das Ultramarin in geschichtlicher und 

technischer Beziehung. 
» » Dr. Lessing: Eine neue Sorte galvanischer Kohlen. 
24. » Direktor Wunder: Die Konstitution des Ultramarins. 

> » Dr. Zwanziger: Die Mineralien der Sodalithgruppe und 

ihre Beziehungen zum Ultramarin. 
» » Prof. Dr. Wagner: Die einseitige Fettsteigerung der 

Kuhmilch. 
8. Dez. Dr. Stockmeier: Über Kunstseide sowie über Viscose 
und Viscoid. 
Von diesen 18 Vorträgen und Referaten waren somit 
6 theorethischen, 
10 technischen, 

2 mineralogischen bezw. geologischen Inhalts. 
Der Besuch der Versammlungen war zwar ein sehr wechselnder, 
im allgemeinen aber ein guter, denn es betrug 

die höchste Teikehmerzahl 41 (Vorjahr 47) 
» geringste > 14 ( » 10) 

» mittlere » 24 ( » 23) 

Prof. Dr. Kaemmerer. 



-^5^-» 



Digitized by VjOOQ IC 



r" 



Jahresbericht 



der 



NaturUstorischen Gesellschaft 



Nürnberg 



für 



1897. 



Nürnberg 

1898. 



Digitized by VjOOQ IC 



U. E. Sobald, Nttrnberg- 

Digitized by VjOOQ IC 



Jahresbericht 

der 

Naturhistorischen Gesellscliaft 

zu Nürnberg 

für 1897. 



L Bericht über die Thätigkeit der Oesellscliaft. 

JLyie Naturhistoriscbe Gesellschaft zählt am Schlüsse 
dieses Jahres 433 ordentliche Mitglieder gegen 431 im vorigen 
Jahr, indem 3 durch Tod, 20 durch Austritt, davon 6 infolge 
Wegzuges von hier aus der Mitte derselben schieden, während 
15 Neuaufgenommene zu verzeichnen sind. 

Durch Tod verlor die Gesellschaft die Herreh: 
Engel, Kaspar, kgl. Reallehrer a. D, 
Geier shOf er, Samuel, Kaufmann und Gemeinde- 
bevollmächtigter, 
Hammer, Karl, kgl. Direktor, 
drei langjährige und verdiente Mitglieder, deren Andenken die 
Gesellschaft stets in ehrendem Gedächtnis bewahren wird. Die 
Zahl der korrespondierenden Mitglieder hat sich um 3, die der 
Ehrenmitglieder durch das Ableben des Herrn Dr. Morris, 
Pastors in Baltimore, um eines verringert. 

Die Yereinsversammlungen erfreuten sich eines guten 
Besuches. Die Sitzung am 1. Dezember kam aus dem Grund 
zum Ausfall, da an diesem Abend Herr Physiker Karl Garoli 
aus Manchen einen Vortrag über »Telegraphie ohne Draht« 
hielt, für dessen Besuch derselbe den Mitgliedern der Gesell- 
schaft gewisse Vergünstigungen gewährt hatte. Dagegen er- 
freute Herr Bürgermeister Dr. Ritter v. Schuh in einer aufser- 

Digitized by VjOOQIC 



ordentlichen Sitzung, welche am 15. Januar 1897 eine grofse 
Zahl der Vereinsmitglieder nebst ihren Angehörigen im Saale 
des Hotel Straufs vereinigte und zu welcher auch der Verein 
*Treu-Nürnberg« Einladung erhalten hatte, die Zuhörer durch 
einen höchst interessanten Vortrag über seine Reise zur Er- 
öffnung des Eisernen Thores, welcher allseitigen verdienten 
Beifall erntete. Ebenso sei hervorgehoben, dafs die Gesellschaft 
in der Sitzung am 24. März das Vergnügen hatte, ihr verdientes 
Ehrenmitglied Herrn Dr. v. Koch, Direktor des naturhisto- 
rischen Museums in Dartnstadt, in ihrer Mitte begrüfsen zu 
dürfen, dessen Ausführungen den Abend zu einem besonders 
anregenden gestalteten. Vielen Dank schuldet die Gesellschaft 
auch Herrn Dr. Glück in Heidelberg, welcher in der letzten 
Sitzung des Jahres einen durch Vorführung prächtiger Präparate 
durch das Skioptikon unterstützten höchst lehrreichen Vortrag 
aus dem Gebiet der Pflanzenanatomie hielt 

Die in den Sitzungen abgehaltenen Vorträge, wie die ge- 
brachten Referate und Demonstrationen sind in nachfolgendem 
zusammengestellt: 

1. Sitzung am 6. Januar: 

Herr Kinkelin, Schenkung und Demonstration der Sand- 
eidechse, Gyolodus gigas, aus Australien; 

» Schwarz, Mitteilungen über das Vorkommen der Spon- 
dylus-Arten unter Vorlage von Sp. aouleiferus aus 
dem Dolomit vom Wichsenstein; 
derselbe, Übergabe von blättrigem Planulatenkalk aus 
den Gräfenherger Steinbrüchen, Geschenk des Herrn 
Braumeister Rogg und einer durch Insektenstich 
degenerierten Eichenblattknospe von Herrn Eiswerks- 
besitzer Meifsenbach; 

» Dr. Heerwagen, Bericht über den literarischen Einlauf; 

» Schwarz, Demonstration zweier Paradiesvögel, Paradisea 
raggiana und Epimachus speciosus; 

2. Sitzung am 13. Januar: 

Herr Kinkel in, Schenkung von Agama sanguinolenta aus 
Transkaspien; 

» Kaul f ufs , Vorlage eines mikroskopischen Dauerpräparats 
von Goelosphaerium Kitzingianum; 

• V. Schultheifs, Vorlage von Abbildungen des Kakao- 
baumes; 

Digitized by VjOOQ IC 



3. Sitzung am 27. Januar: 

Herr Dr. Heer wagen, Bericht über den literarischen Einlauf; 
» Kinkelin, Schenkung von Amphibolurus barbatus aus 
Queensland; 

• Dr. Baumüller, Vorlage des von der chemischen Sektion 

an ihrem Stiftungsfeste herausgegebenen humoristischen 
Festblattes; 
» Eaulfufs, Schenkung mehrerer Insekten und eines bota- 
nischen Werkes; 

4. Sitzung am 3. Februar: 

Herr Hoermann, Vortrag über »Das Inkareich, Skizze einer 
prähistorischen Gesellschaftsverfassung« ; 

• Dr. Baumülier, Vorlage eines ttelbhaubenkakadus, Plic- 

tolophus sulfureus; 
derselbe, Übergabe eines Paares bulgarischer Kinder- 
schuhe und eines bemalten Flaschenkürbisses, Ge- 
schenke des Herrn Rottmeister Jos. Zopf; 

• Huber, Schenkung eines Pbaestins von Kupferberg in 

Oberfranken; 
» Kinkelin, Schenkung von Lygosoma tenue aus Queens- 
land; 
derselbe, Vorzeigung einer zum Andenken an die grofse 
Überschwemmung durch die Pegnitz 1784 geprägten 
Münze; 

• Schwarz, Mitteilungen über die Flufsgebiete der Pegnitz, 

Wiesent, Schwarzach und Rednitz und über den Ein- 
flufs der geognostisehen Verhältnisse auf die in diesen 
Flufsgebieten stattfindenden Überschwemmungen, unter 
Vorlage von Kartenskizzen; 
» Dr. Baumüller, Mitteilungen über abnormes Gröfsen- 
wachstum von Menschen, unter Vorlage lebensgrofser 
Abbildungen; 

5. Sitzung am 10. Februar: 

Herr Kinkelin, Demonstration und Schenkung des Riesen- 
gürtelschweifs^ Zonurus giganteus, aus Südafrika; 

• Dr. Baumülier, Übergabe des für die Bibliothek an- 

geschafften Werkes: Dumeril und Bibron, Allgemeine 
Herpetologie; 

• Dr. Heerwagen, Bericht über den literaiischen Einlauf ; 

Digitized by VjOOQ IC 



6 

Herr Dr. Baurattller, Übergabe eines illustrierten Werkes, 
Geschenk des Herrn Konsul Lang; 

• Hoermann, Übergabe einer interessanten BrocbUre über 

Mexiko, Geschenk des Herrn Huber; 
» Schwarz, Demonstration der Frucht von Citrus medica; 
derselbe, Mitteilungen über Pastor roseus und Tichodroma 

muraria unter Vorlage verwandter Vögel; 
9 Paalzow, Vorlage von Granaten und Schwefeleisen aus 

Norwegen, Geschenk des Herrn Oberingenieur Friese; 
» Dr. Baumü 1 1er, Übergabe eines bäuerlichen Kopfschmucks 

aus der Nabburger Gegend, vom vorigen Jahrhundert, 

Geschenk der Frau Rottmeister Zopf, unter Vorlage 

anderer Kopfbedeckungen aus der Sammlung^ 
» Schwarz, Vorlage einer Serie getrockneter Pflanzen, 

Geschenk des Herrn Lehrer Simon; 

6. Sitzung am 17. Februar: 

Herr Paalzow, Vortrag »Über die geologischen Verhältnisse 
der Umgegend von Genft unter Vorlage einer grofsen 
Anzahl von Mineralien und Versteinerungen; 
» Dr. Baumüller, Vorlage einiger ethnographischer Gegen- 
stände, Geschenk des Herrn Kleylein in Gablonz; 
derselbe, Vorlage von Holzschuhen aus Niederbayern, 
slavischer Obangen von Poschega und der nach seiner 
Anordnung verfertigten »Kiefernadel - Gesundheits- 
Schient ; 

• Kinkelin, Schenkung einer Baumschlange, Diemenia 

psammophis aus Neusüdwales; 

• Füchtbauer, Mitteilungen über ein älteres physika- 

lisches Werk; 
» S p a n d e 1 , Demonstration verschiedener Versteinerungen ; 

7. Sitzung am 24. Februar: 

Herr Schlegel, Vortrag Ȇber das Vorkommen von Gold in 
Bayern« und über den früheren Bergbau im Fichtel- 
gebirg und im Böhmerwald; 

» Kinkelin, Vorlage von Golderzen aus Queensland. 

» Dr. Metzger, Vortrag über die Herstellung von Obst- 
und Beerenobstweinen; 

» Dr. Baumüller, Vorlage einer angekauften Riesen- 
schlange und einer Kartoffel mit eingewachsenem Ring 
mitgebracht von Herrn Sprachlehrer Pfeiffer; 

Digitized by VnOOQ IC 



Herr Schwärs, Vorlage eines aus den Erträgnissen der 
SammelbQcbse angeschafften älteren Werkes; 

8. Sitzung am 8. März: 

Herr Dr. Heerwagen, Bericht Ober den literarischen Einlauf; 
» Haber, Schenkung einer sehr grofsen Anzahl Ton Werken 
Ober die verschiedenen Staaten Amerikas; 

> Kinkel in, Demonstration und Schenkung eines Apo- 

tbeker-Skinks, Scincus ofßcinalis. aus Ägypten; 
derselbe, Vorzeigung eines blühenden Eranthis hiemalis; 

• Dr. B a u m Q 1 1 e r , Übergabe Ton 142 Glasringen , in 

Oablonz fabriziert, als Armschmuck für die Parsi- 
frauen, und zweier Idole, Oeschenk des Herrn Eleylein 
in Gablonz; 

• Hoermann, Vorlage serbischer Schuhe und eines 

serbischen Puppenkopfbchmuckes, Geschenk des Herrn 
PreidB; 

> Eaulfufs, Vorlage selbstgefertigter Abbildungen von 

exotischen Schmetterlingen; 

* Stadler, Demonstration einer Serie ausländischer 

Papilioniden; 

9. Sitzung am 10. März: 

Herr Dr. Wagner, Vortrag über »Die Stickstofffrage und 
Bodenimpfung in der Landwirtschaft«; 

* Dr. Baumüll er, Vorlage Ton Heinemann, Die Schmetter- 

linge Deutschlands und der Schweiz, Geschenk von 
Herrn Meier; 

• Einkelin, Schenkung eines Exemplars Ton Lygosoma 

guichenoti aus Neusüdwales; 

* Schwarz, Vorlage einer Serie von Heuschrecken und 

Pflanzen aus Argentinien, Geschenk von Herrn 
Scutellari, und eines Eiefernrindenstückes mit Frafs- 
gängen verschiedener Insekten; 

10. Sitzung am 17. März: 

Herr Dr. Hartwig, Experimental vertrag über die praktischen 
Mafse des elektrischen Stromes und über die Akku- 
mulatoren; 
» Dr. Baumüller, Vorlage verschiedener Metallschliffe 
zur Sichtbarmachung des Korns, Geschenk der Herren 
Gebrüder BOhler in Wien; 

Digitized by VjOOQ IC 



8 

Herr Förderreuther, Demoostration von Frühlingspflanzen 
vom Moritzberg und FrUhlingsblüten von Colchicum 
autumnale; 

11. Sitzung am 24. März: 

Herr. Dr. BaumQlIer: Vorlage einer weiteren Geschenksen- 
dung des Herrn Eleylein in tiablonz (Armreife der 
Hindus in Kalkutta); 

» Dr. Heerwagen, Bericht über den literarischen Einlauf; 

» Dr. V. Koch, Mitteilungen über die Empflndung von 
Schatten bei Tieren ohne Gesichtsorgane; 

• Kinkel in, Schenkung von Diporophora australis, einer 

Eidechse auH Queensland; 
» Paalzow, Demonstration einer Anzahl von Mineralien 
und Gesteinsarten; 

• Dr. Baumüller, Bericht über einen stattgehabten Gesell- 

schaftsausflug nach Lind und die dortigen Trichter- 
gruben; 

12. Sitzung am 81. März: 

Herr Schwarz, Vortrag über die Kompositen unter Vorlage 
von Petasites niveus aus dem Isarthale; 

» Paalzow, Übergabe von Funden von der vorhistorischen 
Kulturstätte in Altenberg bei Pöfsneck in Thüringen, 
Geschenk des Herrn Spandel; 

» Dr. Baumüller, Mitteilungen über die historische Ent- 
wicklung der Schuhbekleidung; 

» Hör mann, Vorlage des vom Verein für Geschichte der 
Stadt Nürnberg herausgegebenen Plans der Stadt 
Nürnberg vom Jahre 1608. 

» Kinke lin, Schenkung einiger Exemplare von Pectunculus 
pilosus, am Fufse des Berges Karmel gesammelt; 

• Stadler, Demonstration einer sehr schönen Kollektion 

exotischer Käfer; 
» Hub er, Mitteilungen über die Einrichtung des Kinemato- 
graphen; 

18. Sitzung am 7. April : 
Herr Dr. Baumüller, Übergabe einiger Versteinerungen, Ge- 
schenk des Herrn Kudielka, eines Paars mumifizierter 
Gemsfüfschen und einer Wassernufs, Geschenk des 
Herru Zitherlehrers Huber zu Neugrofsreuth; 



Digitized by VjOOQ IC 



9 

Herr V. Schultheifs, Demonstration zweier Euphorbien; 

» Dr. B a u m Q 1 1 e r , Über die Benennung von gewissen 
Teilen der Organe des mensohliohen Körpers nach ihren 
Entdeckern; 

» Schwarz, Demonstration des von Herrn Apotheker 
Schultheifs aufgefundenen Bastardes von Vaccinium 
Vitis Idaea und V. Hyrtillus; 

> Stadler, Demonstration Ton biologischen Zusammen- 
stellungen verschiedener Schmetterlinge; 

» Dr. BaumOller, über die Herstellung mikroskopischer 
Präparate und deren Färbung; 

• Schwarz, über den Blütenbau von Daphne Mezereum; 
^ Ertheiler, Schenkung einer Beschreibung der Harmor- 
brüche von Eiefersfelden und Oberalm; 

14. Sitzung am 14. April. 

Herr Dr. Heerwagen, Bericht über den literarischen Einlaut; 
» Li n d ner , über durch Aluminiumschabine hervorgerufene 
Explosionen und Brände; 

• Dr. Baumüller, Vorlage eines Elefantenzahnes aus 

unserem deutschen Schutzgebiet; 

» Dr. Fleischmann, Mitteilungen über die interessanten 
Beziehungen zwischen der Anatomie der Tiere und 
dem Medium, in dem sie leben; 

» A. Schmidt, Schenkung und Demonstration eines männ- 
lichen Nagelrochens , Raja clavata, dessen Anatomie 
durch Sektion seitens der Herren Dr. Fleischraann und 
Dr. BaumOller erläutert wird; 

» V. Schultheifs, Demonstration von Polyporus füliginosus 
auf Ribes grossularia; 

15. Sitzung am 21. April: 

Herr Rhau, Vortrag über Aluminium und Aluminiumbronze 
mit Experimenten; 
» Th. Erhard, über Bildung und Zweck der Eorkbildung 
unter Vorlage eines Stückes der Eorkulme; 

• Schwarz, über den Anbau von Arzneipflanzen in der 

Umgebung von Nürnberg; 
» Ei n ke 1 i n , Mitteilungen über den Eoala oder australischen 
Beutelbären, Phascolarctus cinereus, unter Vorzeigung 
eines Felles; 

Digitized by VjOOQ IC 



10 _ 

16. Sitzung am 28. April: 

Herr Dr. Neuburger, Vortrag über den Bau des Fischauges 
und Demonstration der Augen von Raja olavata; 

» Wunder, Mitteilungen über die Resultate der in einer 
Trichtergrube bei Lind vorgenommenen Ausgrabung; 

» Voigt, Übergabe der Exemplare der Gattung Glausilia 
aus der Sturmschen Sammlung, Geschenk des Herrn 
Apotheker Voigt in Höchstadt; 

» Dr. Frankenburger, Referat über neue bakteriologische 
Arbeiten von Robert Koch und Hans Buchner; 

» kinkelin, Schenkung von Lepidosiren paradoxa vom 
Amazonenstrom undDemonstration chinesischer Visiten- 
karten; 

» Schwarz, Übergabe von Steinen aus dem Meer bei 
San Remo, Geschenk des Herrn Heiling und von 
Früchten der Weymuthkiefer, Geschenk des Herrn 
Dr. Buchner; 

» Ertheiler, Schenkung zweier Schwalbennester mit Eiern; 

17. Sitzung am 5. Mai: 

Herr Dr. Baumüller, Besprechung einer Lieferung des ana- 
tomischen Atlas von F. Toldt; 

» Einkelin, über die Verfälschung von Anissamen mit 
solchen von Gonium maculatum; 
derselbe, Schenkung eines Hornhechts, Belone acus, aus 
dem Mittel meer; 

» Schwarz, Demonstration der Hülsen vom Türkenklee 
und Mitteilungen über die Verbreitung von Pflanzen 
längs der grofsen Verkehrsstrafseu; 

» Stadler, Demonstration von Noktuen und Geometriden; 

» Schwarz, Demonstration von Viola palustris am Dutzend- 
teich; 

18. Sitzung am 12. Mai: 

Herr Dr. Heerwagen, Bericht über den literarischen Einlauf; 

» Einkelin, Vortrag über die Erebsaugen; 

» Dr. Neuburger, Vortrag über die Akkommodations- 
fähigkeit des menschlichen Auges; 

• Dr. Baum Uli er, Projektion einer Reihe von Diapositiven 
mittelst des Skioptikons; 

» V. Schultheifs, Demonstration von Epiphyllum Russel- 
lianum Gaertneri im blühenden Zustand, des Dimor- 

Digitized by VjOOQ IC 



11 

phismus von Rbipsalis Hariota salicornioides und der 
Frucht von Medioago echinus; 
Herr Eaulftifs, Scbeökung von Moosen der Gattung Sphagnum 
von neuaufgefundenen Standorten; 

19. Sitzung am 19. Mai: 

Herr A. Schmidt, Vortrag Ober ^Griechenland und seine 
Stellung im Oriente; 

> K i n k e 1 i n , Referat über die Frage, ob Efsgeschirre u. dgl. 

aus Aluminium hygieinisch zulässig sind; 
» Rh au, über die Herstellung von gekörntem Aluminium; 
» V.Schultheifs, Demonstration von Phyllooactus Courtisii 

und Gkusteria maoulata in blühendem Zustand; 

• Rud. Schmidt, Schenkung eines Elefantenzabnstückes 

mit Projektil; 

> Schwarz, Vorlage eines jungen Dachses und eben solchen 

Fuchses, Qeschenk des Herrn Meisenbach; 
» Bürger, Vorlage der Blüte von Galy^canthus floridus; 

20. Sitzung am 26. Mai: 

Herr V. Schultheifs, Demonstration von Aloe glauca humilis 
und Aloe Haworthia retusa im blühenden Zustand; 

21. Sitzung vom 2. Juni: 

Herr Kinkel in, Demonstration eines 5 Jahre alten lebenden 
Exemplars von Alligator mississippiensis; 

■ Bing, Vorlage von Höhlenbärenzähnen aus der Brunn- 
steinhöhle bei Streitberg; 

» Seh war z , Vorlage einer Sammlung exotischer Schmetter- 
linge; 

» Dr. Heerwagen, Demonstration der Hautzähne von 
Raja clavata; 

• Voigt, Vorlage von Blättern und BiUten der Aristolochia 

Sipho; 
» Dr. Heerwagen, Bericht über den literarischen Einlauf; 

• Paalzow, Vorlage von selbstgefertigten Aquarellen von 

Fossilien aus dem Eocän von Patagonien; 
» Schwarz, Übergabe einer Brochüre tU^er das Vor- 
kommen von Vaccinium intermedium, Geschenk des 
Herrn Rechtspraktikant Pöverlein; 

• Probst, Schenkung eines Stammstückes von Fraxinus 

excelsior mit Frafszeichnungen des Eschenbastkäfers; 

Digitized by VjOOQIC 



12^ 

Herr V.Schultheirs, DemoDsiration von Ecbinopsis Pentlandi, 
Mammillaria Wildiana und Mammillaria Boccosana; 
derselbe, Übergabe eines Araselnestes mit Gelege, Ge- 
schenk des Herrn Preils; 

22. Sitzung am 9. Juni: 

Herr Kinkelin, zweites Referat über Efs- und Trinkgescbirre 
aus Aluminium; 
derselbe, Demonstration zweier lebender Eidechsen, uro- 
mastix hardwickei aus Beludscbistan und Uromastix 
acanthinuriys aus Algier; 

23. Sitzung am 16. Juni: 

Herr Dr. Baum ül 1er, Vorlage einer Brochüre: »Theoretische 
Studien über das Wasser und seine Verwandlungen«, 
Geschenk des Verfassers Herrn Ingenieur F. Hauser; 

» Wunder, Berjcht über die Ausgrabungen in der Breiten- 
loh, an welchen sich eine lebhafte Diskussion anschlofs; 

» Dr. Baum ü Her, Bemerkungen über die Grobe der 
Menschen der Bronzezeit; 

» K i n k e 1 i n , Demonstration dreier lebender Eidechsen, 
Plesliodon aldrovandi aus Algier, Scincus ofQcinalis 
aus Nordostafrika und Gongylus ocellatus aus Nord- 
ostafrika, sowie einer lebenden Ringelnatter, Geschenk 
des Herrn Kastrupp; 

» V. Schult he ifs, Demonstration von Phyllocactus Bos- 
welliana und Aloe Haworthia cymbifolia, beide blühend; 

• Schwarz, Demonstration des Eschenbastkäfers Hylesinus 
fraxini; 

» Huber, Schenkung eines Paares Pantöffelchen aus dem 
Tessin und eines Steins aus dem Lago Maggiore; 

24. Sitzung am 23. Juni : 

Herr Schwarz, Mitteilung über eine neu zugewanderte Um- 
bellifere, Bifora radians, aus Süditalien, beobachtet von 
Herrn Fr. Sohultheifs; 

derselbe, Vorlage einer reichhaltigen Serie von Roh- 
produkten aus der Engelhardtsohen Lackfabrik, Ge- 
schenk des Geschäftsführers Herrn Paul Tasch, woran 
sich eine Diskusssion über die Verarbeitung derselben 
knüpfte; 

derselbe, Vorlage einer Blätterkoralle, Fungia, Geschenk 
des Herrn Kauftnann König; 

Digitized by VjOOQ IC 



«^_ 

Herr Y. Sohultheifs, DemoDstratioD von Mammillaria nigra 
pulchella im blühenden Zustand, einem in die Blüte 
geschorsten Kohlrabi und von Pyrethrum Parthenium; 
» Schwarz, Mitteilungen über die Entwicklung der 
Oestrusfliegen ; 
derselbe, Vorlage einer Kollektion anatomischer Atlanten 
der Firma Löwensohn in Fürth, Bemerkungen über 
den Wiederkäuermagen; 

25. Sitzung am 30. Juni: 

Herr Schwarz, Demonstration von Hippobosca equina; 

derselbe, Vorlage eines vergifteten Pfeils vom Tangai^ika 
See, Geschenk des Herrn Heisenbach; 
' Kinkelin, Demonstration eines etwa 5 Jahre alten leben- 
den Exemplars vom Riesenskink, Macroscincus coctaei; 
» Th. Erhard, Schenkung zweier Stücke Tertiärkalk aus 
dem Sürswassersteinbruch bei Nördlingen mit Hydropia 
trochilus und C3rpris nordlingensis; Vorlage von 
Euphorbia virgata vom StofTersberg bei NOrdlingen; 
» Schwarz, Mitteilungen über die Verbreitung dieser 
Pflanze, 
derselbe, Bemerkungen über die vorgelegten Gopal- und 
Damarharze ; 

26. Sitzung am 7. Juli: 

Herr Dr. Heerwagen, Bericht über den literarischen Einlauf ; 
> Schwarz, Mitteilungen über die Verbreitung von Pflanzen 
längs der Verkehrswege unter Vorlage von Rumex 
pulcher und Reseda lutea; 
derselbe, über Dolinen in der fränkischen Schweiz; 
» Paalzow, über solche im Karst; 

" Schwarz, über Mifsbildungen an einer Rosa centifolia; 
» V. Schultheifs, Demonstration von Echinocereus 
Roemeri und Gereus speciosissimus im blühenden Zu- 
stand ; 
* Schwarz, Übergabe eines am Kornmarkt ausgegrabenen 
Rindsunterkiefers, Geschenk des Herrn Sattlers Stoll; 
derselbe, Vorlage von Melolontha Fullo; 

27. Sitzung am 14. Juli: 

Herr Kinkel in, Demonstration eines lebenden Leguans, 
Leguana tuberculata, aus Brasilien; 

Digitized by VjOOQ IC 



14 

Herr Schwarz, Schenkung einer Oeode aus dem Lias bei Rasch, 
Hitteilung über Bildung und Vorkommen von solchen; 
derselbe, Vorlage zweier von Herrn Bildhauer Scharrer 
geschenkter Bücher; 

28. Sitzung am 21. Juli: 

Herr Dr. Heer wagen, Bericht über den literarischen Einlauf; 
derselbe, Demonstration einiger ausgestopfter Tiere für 
die Sammlung und einer Sendung der Linnäa; 
» Paalzow, Schenkung einer Reihe von Versteinerungen 

aus dem Dogger bei Ützing; 
» V. SchultheiTs, Demonstration von Echinocactus seti- 
spinus und Stapelia variegata im blühendem Zustand 
» Kinkelin, Demonstration eines lebenden Mauergecko, 
Tarentoia mauritanioa aus Tunis; 

29. Sitzung am 28. Juli: 

Herr JDr. Heerwagen, Bericht über den literarischen Einlauf ; 

• Einkelin, Schenkung eines Spirituspräparats der Perl- 

eidechse, Lacerta ocellata, var. pater aus Algier; 

• V. Schultheifs, Demonstration von Echinocactus Lecontei; 
» P a a 1 z w, Schenkung von Solnhofener Plattenkalk,welcher 

das Bild von Verwerfungen darstellt; 

50. Sitzung am 4. August: 

Herr Dr. Baumüller, Bericht über den Buchhändlereinlauf; 
s Schwarz, Biologische Bemerkungen über die Nostocalge 
undVorzeigung mikroskopischer Präparate ; Mitteilungen 
über Guscuta- Arten, über die Zecken und Raupen von 
Gossus ligniperda als Schädling des Ahorn, von Herrn 
Tölke übergeben; 

• Kinkel in, Demonstration und Schenkung von Uromastix 

acanthinurus aus Äg^ypten; 

» V. Schultheifs, Demonstration von Blüten des Gereus 
Seideli und Gereus peruvianus, Haworthia, sowie blühen- 
der Exemplare von Aloe margaritifera und semimarga- 
ritifera ; 

» Dr. Heerwagen, Schenkung einer Messerscheide, Solen 
vagina, von einem nicht genannt sein wollenden Herrn; 

51. Sitzung am 11. August: 

Herr Dr. Heerwagen, Vorlage von Tauschschriften; 

Digitized by VjOOQ IC 



Herr V, Scbultheifs, Demonstration von Cereus formosus 
monstrosus und Grassula falcata, einer Aloe und einer 
Agave mit Bemerkungen über den Geotropismus; 

• &g. RQdel, Demonstration von Saxifraga stellaris ; 

SS. Sitzung am 18. August: 
Herr Dr. BaumUller, Vorlage einiger Schriften und von 
Zähnen fossiler Thiere; 
i V. S c b u Ith e i f s, Demonstration von Porree, bei welchem 
die jungen Pflanzen aus dem Blutenstand hervorgehen ; 

SS. Sitzung am 25. August: , 

Herr V, Schultheifs, Demonstration von Echinocactus hetera- 
canthus und E. scopa. 
» Dr. Heerwagen, Vorlage einiger fttr die Sammlung aus* 
gestopfter Vögel; 

54. Sitzung am 1. September: 

Herr Dr. Heerwagen, Vorlage von Tauschschriften ; 
9 Dr. Baum tt 11 er, Hitteilungen Ober die Struktur der 
Haut und partielle Leukopathie; 

• Paalzow, Mitteilungen Ober Fossilien des lithographischen 

Schiefers von Solnhofen unter Vorlage von Belege- 
stttcken aus seiner Sammlung; 

• V. Schultheifs, Demonstration einer blähenden Eucomis 

punctata ; 

55. Sitzung am 8. September : 

Herr Dr. Neger, Referat Ober die Robinsonsioseln, speziell 

Juan Fernandez; 
» Dr. Heerwagen, Bericht über den literarischen Einlauf; 
> Kinkel in, Schenkung eines Spirituspräparats von Tiliqua 

nigrolutea, Fam. der Skinke, aus Neubolland; 
» V: Schultheifs, Demonstration von Echinocactus phyila- 

canthus und Echeveria gibbiflora; 

56. Sitzung am 15. September: 

Herr Wunder, Demonstration einer Verbänderung bei Ginster; 

• E i n k e 1 i n , Schenkung eines Spirituspräparats von Anolis 

carolinensis aus den Vereinigten Staaten; 
' V. Schultheifs, Vorlage von Euphorbia oSicinarum; 

57. Sitzung am 28. September: 

Herr Dr. BaumQller, Vorlage zweier Wappen der Stadt 
NQrnberg, eingesandt vom Magistrat; 

Digitized by VjOOQ IC 



Herr Dr. Heerwagen, Bericht über den literarischen Einlauf; 
» Kinkelin, Schenkung eines Spirituspräparats von Uro- 

mastix hardwiokei; 
» V. SchultheiTs, Demonstration von Rhipsalis Saglionis 

und Hariota salicornioides und Vorlage eines sonderbar 

geformten Hühnereis. 

58. Sitzung am 6. Oktober: 

Herr Dr. Heerwagen, Vorlage des literarischen Einlaufs; 

» Kinkelin^ Schenkung und Demonstration der carolini- 
schen Fangheuschrecke, Stagmomantis Carolina, und 
zweier riesiger Früchte von Cucurbita maxima; 

t W. Rudel, Vorlage von Baumschwämmen und Mineralien, 
Geschenk des Herrn Karl KrafTt, einer botanischen 
Schrift und der Frucht von Garica Papaya, Geschenk 
des Herrn Dr. Appel in Würzburg; 

» Dr. Fleischmann, Vortrag über Seescheiden und Salpen ; 

59. Sitzung am 13. Oktober: 

Herr Lambrecht, Schenkung eines Hessers aus Lappland; 
• Kinkelin, Demonstration von Rhipidodendron plicatile; 
» Knapp, Schenkung verschiedener Conchylien; 

40. Sitzung am 20. Oktober: 

Herr Ho er mann, Vortrag Ober Meitzen »Wanderungen, An- 
bau und Agrarrecht der Völker Europas nOrdlich der 
Alpen«; 

» Dr. Heer wagen, Vorlage des literarischen Einlauft; 

» Rudel, Demonstration der Struktur des Wurzelstocks 
einer Seerose; 

» Kinkel in, Schenkung von Ophisaurus apus; 

» Dr. Wagner, Vorlage von Reblauspräparaten, Geschenk 
des Herrn Voigt und Mitteilungen über die Entwick- 
lung dieses Schädlings; 

» Dr. He erwägen, Mitteilungen über Garica Papaya; 

» Hoermann, Vorlage einiger Brochüren, Geschenk des 
Herrn Schwarz; 

41. Sitzung am 27. Oktober: 

Herr Dr. Heerwagen, Bericht über den literarischen Einlauf; 
» Dr. Frankenburger, über die anatomischen Verhält- 
nisse der Nase, des Rachens und des Ohres mit De- 
monstration eines Modells; 

Digitized by VjOOQIC 



17 

Herr Dr. LOwi, Vorlage einiger sehr sohOner Mineralien; 

■ Lindner, Schenkung eines Eies Tom Grauedelsänger ; 

t Paaizow, Schenkung einer Anzahl Ton Fossilien aus 
dem Lias; 

• y. SchultheiTs, Demonstration yob Phyllooactus Gour- 

tisii und Euphorbia cereiformis; 

■ Kinkel in, Übergabe einer Schrift für die Bibliothek, 

Geschenk des Herrn Dr. Leyh, eines Zweiges von Pinus 
cephalonica Tom Isthmus von Korinth und einiger 
Exemplare von Desroonota variolosa aus Brasilien; 
» Wiesel er, Schenkung einer Klapper aus Kamerun, 
einiger Proben der Seidenbaumwolle und Ton Aron 
centaurus; 

42. Sitzung vom S. November: 
Herr Huber, Vortrag über »Elektrogravure« ; 
» Dr. Frankenburger, Referat über neue Versuche zur 
Feststellung des wirksamen Prinzips bei der Hefe- 
gärung; 

■ Dr. Heerwagen, Vorlage von Fiederblättern der Kal- 

lanchoe pinnata, Geschenk des Herrn Dr. Appel in 
Würzburg; eines Stückes fossilen Holzes und zweier 
Exemplare von Geaster hygrometricus, Geschenk des 
Herrn stud. Lindinger; 

• Hub er, Demonstration einer mit dem Rieder*schen 

Apparat hergestellten Münze: 

4S. Sitzung am 10. November: 
Herr Kempe, Demonstration einer nach einem Verfahren von 
Dr. Pauli-Darmstadt hergestellten Stahlgravure; 
» Dr. Heer Waagen, Bericht über den literarischen Einlauf; 
Herren Hub er und Kempe, Mitteilungen über Elektro- 

gravure; 
Herr Wunder, Bericht über neuere Ausgrabungen von Hügeln 
und Trichtergruben auf dem Weifsenbrunner Berg; 
» Kinkel in, Schenkung und Demonstration von Dacty- 

lopterus volitans und Exocoetus evolans; 
> Schwarz, Mitteilungen über Einwanderung von Teucrium 
Scorodonia in unser Gebiet; Vorlage eines Bovists und 
eines Rindenstückes von Pinus silvestris mit Borken- 
käfergängen; 

Digitized^y Google 



18 

44. Sitzung am 17. November: 

Herr Dr. Neuburger, Vortrag über »Wachstums Verhältnisse 
von Gehirn und Auge, sowie über einige vergleichend 
anatomische Beobachtungen am Sehorgan«; 

» Lindinger, Demonstration und Schenkung einer zwei- 
schwänzigen Eidechse; 

» Kinkel in, Demonstration und Schenkung von Lacerta 
muralis var: coerulea von Gapri; 

» Dr. Heerwagen, Übergabe einiger auf die Landesaus- 
stellung in Nürnberg bezüglichen Schriften, Geschenk 
des Herrn Enslin, und einiger von der geographischen 
Sektion angekaufter Werke; 

» Wieseler, Übergabe eines Schöpflöffels aus Holz, einer 
Akazienfrucht aus Kamerun und von Erdbohnen aus 
Dualla, Geschenk des Herrn Missionär Keller in 
Kamerun ; 

» W. Rudel, Mitteilungen über die Seidenbaumwolle und 
deren Herkunft; 

» V. Schultheifs; Demonstration einer Frucht von Gereus 
peruvianus und Ornithogalum arabicum; 

» Schwarz, Demonstration eines Hechtkopfes, Geschenk 
des Herrn Meisenbach; Schenkung eines Bandes der 
Zeitschrift des deutsch -österreichischen Alpen Vereins; 

45. Sitzung am 24. November: 

Herr Dr. Heerwagen, Vorlage des literarischen Einlaufs; 
* Voigt, Vorlage einer Anzahl wertvoller Manuskripte 

der Gebrüder Sturm, Geschenk des Herrn Dr. v. Koch 

in Darmstadt; 
» Paalzow, Referat über eine Arbeit, betr. die ameri- 
kanischen Pilze; Mitteilungen über Laterit; 
» Schwarz, Vorlage einiger Schriften, Geschenk zur 

Bibliothek; 
» Huber, Vorlage eines goldhaltigen Quarzes aus Transvaal 

und eines silbernen Bechers mit eingravierter Schach- 

blumc; 
» Ertheiler, Vorlage eines in seinem Hause vorgefundenen 

Schwertes; 
» Dr. NeubuFger, Referat über das Parietalauge; 
» Schwarz, Demonstration einer Frucht von Physalis Al- 

kekengi mit maceriertem Kelch; 

« Digitized by VjOOQ IC 



19 

Herr A. Schmidt, Demonstration eines mit einem musohel- 
förmigen Polyporus besetzten HolzstOckes, Geschenk 
des Herrn Lenz; 

> Schwarz, weitere Mitteilungen über die Einsohleppung 

von Teucrium Soorodonia; 

46. Sitzung am 8. Dezember: 

Herr Dr. Riegel, Vortrag Qber »das Auge und einige seiner 
wichtigsten Erkrankungen« ; 

> Schwarz, Demonstration einer von Herrn Apotheker 

Erhard vorgelegten Sammlung von Alpenpflanzen. 

• Kinkelin, Demonstration einiger von Herrn Wiesel er ge- 

schenkter tropischer pharmakologischer Früchte; 

• Dr. Heerwagen, Bericht über den literarischen Einlauf; 

47. Sitzung am 15. Dezember: 

Herr Dr. Metzger, Vortrag über »natürliche und synthetisch 

hergestellte RiechstofTe« ; 
» Y. SchultheiTs, Demonstration von Sempervivum tabu- 

laeforme; 
» Huber, Mitteilungen über ein Verfahren Hohlgetäfse auf 

elektrolytischem Weg herzustellen; 
» Schwarz, Demonstration eines in der Form abweichenden 

fiolzschwammes und Schenkung einiger Jahrgänge der 

Zeitschrift des deutsch - österreichischen Alpen Vereins; 
» Huber, Schenkung zweier Schriften von der Brüsseler 

Ausstellung; 

• Kinkel in, Demonstration und Schenkung von Goluber 

erythrurus aus Manila; 

48. Sitzung am 22. Dezember: 

Herr A. Schmidt, Vortrag über »Die Stundenbezeichnung 
der Alten«; 

• Dr. Frankenburger, Demonstration eines zweimonat- 

lichen menschlichen FOtus; 

» Rhau, Vorlage von menschlichen Knochen, gefunden bei 
Neuwetzendorf; 

» Kinkel in, Schenkung und Demonstration einer Netz- 
oder Gitterschlange, Python reticulatus; 

» Schwarz, Vorlage und Erläuterung einer Serie von 
Pflanzen, gesammelt von Herrn Bauriedel in Tunis und 
in den Pyrenäen; 

Digitize3by Google 



»0 

Herr Dr. Heerwagen, DemoDstr^tion eines Nasenbären, Nasua 
sooialis, Geschenk des Herrn Richard Ludloff in Er- 
langen; 
» Schwarz, Demonstration eines Pirols, Oriolus galbula, 
Geschenk des Herrn Stephan Häring; 

49. Sitzung vom 29. Dezember: 
Herr Dr. Glück, Vortrag über »Die Leitungsbahnen im Stamm 
von Blutenpflanzen und GefUfskrytogament mit Demon- 
strationen mittelst Mikroskop und Skioptikon; 
» Schwarz, Demonstration eines blühenden Exemplars von 

Helleborus niger aus Reichenhall; 
* Kinkel in, Schenkung und Demonstration einer Baum- 
schlange aus Ostindien, Dendrophis pictus. 
In der am 20. Januar stattgehabten ordentlichen General- 
versammlung wurde Herr Hörmann zum Bibliothekar gewählt, 
während die übrigen Vorstandsmitglieder verblieben. 

Die Führung der Protokolle besorgten abwechselnd der II. 
und III. Sekretär, die Herren Dr. Hartwig und Förderreuther. 
Nachdem letztgenannter Herr, welcher seit Oktober 1895 seines 
Amtes mit gröfstera Eifer waltete, durch Wegzug von hier 
aus der Vorstandschaft scheiden müfste, trat Herr Rechts- 
praktikant Schultheifs an dessen Stelle und da auch dieser 
wenige Wochen darauf infolge von Domizilveränderung aus- 
schied, wurde Herr Dr. Frankenburger zum III. Sekretär 
erwählt. Bibliothek und Sammlungen erfuhren auch im 
heurigen Jahr reichen Zuwachs durch Ankauf, wie durch 
Schenkungen, worüber in den Spezialberichten Näheres zu 
finden ist. Ganz besonders verdienen die reichen Zuwendungen, 
durch welche unser unermüdlich thätiges Mitglied, Herr 
Apotheker Kinkel in, vorzugsweise die Reptiliensammlung 
auch heuer wieder beträchtlich vergröfserte, den wärmsten 
Dank der Gesellschaft, den sie genanntem Herrn auch für ge- 
schmackvolle Anordnung und Etikettierung einzelner Teile 
unserer Sammlungen schuldet. Herr Direktor Dr. v. Koch 
in Darmstadt überliefs der Gesellschaft in uneigennützigster 
Weise eine Anzahl Manuskripte von der Hand der berühmten 
Naturforscher Sturm, welche gleich grofsen historischen und 
wissenschaftlichen Wert für uns besitzen. 

Leider macht sich der Raummangel in unseren Samm- 
lungen in sich immer mehr steigerndem Mafs geltend und 

Digitized by VjOOQ IC 



81 

hindert uds, die Reicbha]ligkeit derselben in das richtige Licht 
KU setzen, insbesondere mufsten die anthropologischen Samm- 
luDgen, um für die durch den reichen Tauschverkebr immer 
mehr anwachsende Bibliothek Raum zu schaffen, vorerst in 
einem für deren Aufstellung sehr ungünstigen Raum unter- 
gebracht werden. 

Der auch heuer gewährten Zuschüsse der städtischen Be- 
hörden and des Landrats yon Mittelfranken murs, als unsere 
Zwecke besonders fordernd, mit ehrerbietigem Dank gedacht 
werden. Ebenso sei allen denjenigen, welche durch Rückgabe 
von Schuldscheinen, durch geschenkweise Zuwendungen yon 
Bachern und Naturalien und sonstwie ihr Interesse für unsere 
Gesellschaft bethätigt haben, der aufrichtige Dank derselben 
ausgesprochen, und- wir wagen damit die Bitte an das verehrte 
Publikum zu verknüpfen, auch fortdauernd für das Wachstum 
unserer Sammlungen und die Förderung unserer Ziele in gleicher 
Weise thätig zu sein. Dank schulden wir endlich auch den ver- 
ehrlichen Redaktionen des »Fränkischen Kurier«, des »Oeneral- 
anzeiger«, der »Nordbayerischen Zeitung« und »Fränkischen 
Morgenzeitung« für die bereitwillige unentgeltliche Aufnahme 
der Berichte über unsere Wochen Versammlungen. 

Ein im Monat März stattgehabter Familienausflug hatte 
als Ziel Lind bei Zirndorf und den Zweck der Besichtigung 
der dortigen unterirdischen Gänge, welche gegenwärtig zum 
Teil als Keller benützt werden, sowie der sog. Trichtergruben, 
welche prähistorischen Ursprungs sind. Der Linder Bück 
ist auch von pflanzengeographischem Standpunkt aus sehr 
interessant und war eine Art Eldorado der älteren Botaniker 
Nürnbergs. 

Der Anschlufs unseres Hauses an das städtische Elektrizi- 
tätswerk ermöglichte es, unser Skioptikon für elektrisches Licht 
SU montieren. Die Ausführung dieser Einrichtung, sowie die 
InstaliatiDn der Beleuchtung im Parterresammlungsraum und 
den Bibliotheksräumen erfolgte durch die Elektrizitäts-Aktien- 
g^ellschaft vormals Schuckert & Co., welcher wir an dieser 
Stelle für den bereitwilligst gewährten Nachlafs von 25 ®/o des 
Fakturenbetrags den verbindlichsten Dank aussprechen. 

Interne Angelegenheiten der Gesellschaft veranlafsten 
leider im September den bisherigen langjährigen Administrator 
der Gesellschaft Herrn Kommerzienrat Gallinger seine Stelle 

Digitized by VjOOQ IC 



SS 



niederzulegen und zugleich eine Wiederwahl abzulehnen. In 
der Sitzung vom 13. Oktober 1897 legte auch der bisherige 
Direktor Herr Dr. Bauraüller seine Stelle nieder. So verlor 
die Yorstandschaft zwei Männer, welche derselben eine lange 
Reihe von Jahren angehörten und deren jeder in seiner Art 
unserer Gesellschaft die erspriefslichsten Dienste geleistet hat. 
Herr Eommerzienrat Oallinger gehörte seit 1883 dem Bau- 
ausschufs und nach Aufhebung desselben der Yorstandschaft 
als Administrator an; praktischer Sinn, Umsicht und Gewissen- 
haftigkeit in der Yerwaltung der Hausangelegenheiten waren 
ihm ebenso eigen, wie ein warmes Interesse fUr die Bestrebungen 
der Gesellschaft überhaupt. Herr Dr. BaumUller war seit 
1887 I. Sekretär und hat seit 1894 die Stelle des Direktors be- 
kleidet. Mit gediegenen Kenntnissen auf dem weiten Gebiete 
der Naturwissenschaften ausgerüstet und von aufrichtiger Be- 
geisterung und Hingabe für die Sache des Yereins beseelt, war er 
allezeit bestrebt, die ihm anvertraute Stellung bestensauszufülleo. 
Dank den beiden Männern, welche für die Yereinssache in so 
unermüdlicher und selbstloser Weise thätig waren. In einer 
aufserordentlichen Generalversammlung vom 13. Oktober wurde 
der bisherige I. Sekretäi* Dr. Heerwagen zum Direktor, Herr 
Pfarrer Rudel zum I.Sekretär und Herr Buchdruckereibesitzer 
Sebald zum Administrator gewählt 



Digitized by VjOOQ IC 



SS 



n. BibUotheksbericht für 1807. 

Der Zuwachs betrug: 

1. Durch Ankauf und Geschenke 191 Nummern mit 
insgesamt 420 Bänden. Am Sl. Dezember waren S585 Katalog- 
Nummern vorbanden. 

Von den Geschenken, die der Bibliothek gemacht wurden, 
sind besonders hervorzuheben: dasjenige des Hrn. Fr. Huber, 
die offiziellen Berichte der meisten amerikanischen und anderen 
Staaten für die Weltausstellung in Chicago 1893; eine grorse 
Anzahl BQcber von Herrn Gg. Rhau; Bücher und Zeitschriften 
von Herrn Dr. Herz -Memmingen; ein sehr wertvolles Geschenk 
an Manuskripten der Naturforscherfamilie Sturm, Vater und 
Söhne, aberreicht durch das Ehrenmitglied der Gesellschaft 
Herrn Dr. Gottl. v. Koch. 

Die üniversitätsprofessoren Herr Dr. Fleischmann und 
Herr Dr. R. v. W ettstein ehrten die Gesellschaft durch Dedicier- 
ung ihrer neuen Veröffentlichungen: »Lehrbuch der Zoologie« 
und »die europäischen Arten der Gattung Gentiana«. Das gleiche 
geschah seitens der Herren Dr. J. Biehringer, Prof. Dr. Fr. 
Buchenau, Dr.Dieudonnö, Dr. A.Geigenberger, Dr.Gor- 
don-Habana, Job. Fr. Hauser, Dr. Herz, Prof. Dr. Issel, 
Tb. ^Kämpfer, Dr. Kinkelin, Dr. Friedr. Leyh, Dr. F.W. 
Neger, H. Poeverlein, Prof. Dr. Fr. Wagner. 

2. DurchTausch vermehrte sich die Bi bliothek um 588 Ein- 
sendungen, welche sich auf 141 Tauschgesellschaften verteilen. 

Eine Anzahl von Gesellschaften hat der Bitte um Nacb- 
sendung älterer Jahrgänge oder fehlender Bände und Hefte 
entsprochen; es sind dies: Bonn, Naturh. Verein der pr. Rhein- 
lande; Görlitz, Naturforschende Gesellschaft; Wien, k. k. 
Gartenbau-Gesellschaft und Wien, k. k. Geograph. Gesellschaft. 
Eine Reihe anderer liefs die Bitte leider unbeachtet. 

Dem Tauschverkehr sind folgende 5 Gesellschaften, resp. 
Redaktionen neu beigetreten: Budapest, Rovartani Lapok; 
Ghristiania, Meteorologiske Institut; La Plata, Bureau g^n. de 
statistiqae de la Prov. de B^! A^, Montevideo, Museo nacional; 
Portland, Portland society of natural history. 

Während des Jahres 1897 wurden 182 Werke an 114 Ent- 
leiher ausgeliehen. Am stärksten in Anspruch genommen war 
das Gebiet der Geographie (mit 40), dann das der Anthropologie 
(mit S2), der Botanik und der Geologie (mit je 28 Werken). 

Digitized by VjOOQ IC 



24 

HerrSebald bat der Bibliothek einen Zettelkatalog zum 
Geschenk gemacht, der dadurch hergestellt ist, dafs jede Nummer 
unseres in den Jahresberichten geführten Bücherverzeichnisses 
ausgeschnitten und auf Karton aufgeklebt ist. Dieser Zettel- 
katalog wird die Benutzung der Bibliothek bedeutend erleichtern. 
Seine wissenschaftliche Ordnung und Aufstellung ist für die 
Bibliothek die wichtigste Arbeit des kommenden Jahres. 



Verzeichniss der Körperschaften, mit denen wir im Schriftenauetausch 
stehen und der Einsendungen, die uns 1897 zugegangen sind: 

A. Europa. 
L Dentsokea Beioh. 

1. Altenburg: Naturforschende Gesellschaft des Osterlandes: Mit- 

teilgn. N. F. 1896, VII. Bd. 

2. Annaberg: Annaberg-Buchholzer Verein für Naturkunde. 

3. Ansbach: Historischer Verein (Ür Mittelfranken: 44. u. 45. Jahres- 

bencht 1892. 1896. 

4. Augsburg: Naturwissenschaftlicher Verein. 

6. Bamberg: Gewerbeverein: Wochenschrift, 45. Jahrgang. 1896. 
»Bamberg a. d. IL B. L.-I.-G.- u. K.-AusstUg. 1896.« — 
Festschrift z. F. d. 50 i. Bestehens d. G.-V. i. B. 

6. » Naturforschende Gesellschaft. 

7. Berlin; Botanischer Verein der Provinz Brandenburg. 

8. » Deutsche geologische Gesellschaft: Zeitschnft, 48. Band, 

3.4. Heft. 49. Band, 2. Heft. 

9. » Entomologischer Verein : Berliner entomol. Zeitschr. 41. Bd. 

4. 42. Band 1. 2. 
10. » Gesellschaft naturforschender Freunde : Sitzungs-Berichte, 



Jahrg. 1896. 



11. » Kgl. preufsisches meteorologisches Institut : Ergebnisse etc. , 
1893, Heft 3. 1896, Heft 2. 1897, Heft 1. Bericht 1896. 

Gewitter-Beob. 1892, 1893, 1894. Niederschi. Beob. 1894. 

12. » Kgl. preufsisches statistisches Bureau. 

13. Blankenburg: Naturwissenschaftlicher Verein des Harzes. 

14. Bonn: Niederrheinische Gesellschaft ftlr Natur- und Heilkunde: 

Sitzungsb. 1896, 2. Hälfte. 

15. > Naturhistorischer Verein der preufsischen Rheinlande, West- 

phalens und des Regierungsbezirks Osnabrück: Verhand- 
lungen, 29. Jahrg. 2. Hälfte ; 44. Jahrg. 2. Hälfte ; 53. Jahr- 
gang. 2. Hälfte. 

16. Braunschweig: Herzogliches naturhistorischcfs Museum. 

17. » Verein fOr Naturwissenschaft : 10. Jahresbericht. 

1895/6; 1896/7. 

18. Bremen: Naturwissenschaftlicher Verein: Abhandlungen, 14. Bd., 

2. Heft. 

19. Breslau: Schlesische Gesellschaft fär vaterländische Kultur: 

74. Jahresbericht, Litteratur der L. u. V.-Kunde der 
Prov. Schlesien, Heft 5. 



Digitized by VjOOQ IC 



25 

20. Calau-Cottbus: Niederlausitzer Gesellschaft för Anthropologie 

und Urgeschichte. 

21. Chemnitz: Naturwissenschaftliche Gesellschaft: 13. Bericht vom 

1. Juli 1892—31. Dei. 1896 [18%]. 

22. Danzig: Naturforschende Gesellschaft : Schriften N. F. 9. Bd.,2.Heft. 

23. Darmstadt: Verein fQr Erdkunde und der grofsherzogl. geologi- 

schen Landesanstalt: Natizbl. IV. Folge 17. Heft 18%. 

24. Dessau : Naturhistorischer Verein far Anhalt. 

25. Dresden: Kgl. sächs. Statist. Bureau: Zeitschrift, 42. Jahrg. H. 3 

u. 4; 43. Jahrg., H. 1 u. 2. 

26. > Naturwissenschaftliche Gesellschaft Isis: Sitzungsber. 

und Abhandlungen, Jahrg. 18%. Juli — Dezember. 

27. Dürkheim: PoUichia: Mitteilungen, Lin. Jahrg., Nr. 10, 1896; 

54. Jahrg., Nr. 11, 18%; Dr. Mehlis, Drachenfels b. 
Dürkheim. 

28. Düsseldorf: Naturwissenschaftlicher Verein. 

29. Eiber fei d: Naturwissenschaftlicher Verein. 

30. Emden: Naturforschende Gesellschaft: 81. Jahresbericht 1895/6. 

31. Erfurt: Kgl. Akademie gemeinnütziger Wissenschaften: Jahr- 

bücher. N. F., Heft XXm. 

32. Erlangen: Physikalisch-medicinische Sozietät : Sitzungsberichte, 

28. Heft, 18%. 

33. Frankfurt a. M.: Physikalischer Verein: Jahresbericht 1895/%. 

34. » Redaktion des »Zoologischer Garten.« 

35. > Senckenbergische naturforschende Gesellschaft: 

Abhdign. 20. Bd. 1. Heft; 22. Bd. 1896; 23. Bd. 
3. Heft, 4. Heft; Anhang; 22. Bd. Bericht 1897. 

36. Frankfurt a. O. : Naturwissenschaftlicher Verein des Reg.-Bez. 

Frankfurt: Helios, 14. Jahrg., Nr. 7—12, Soc. 
Litt., Jahrg. 10, Nr. 7—12; Jahrg. 11, Nr. 1—6. 

37. Freiburg i. Br.: Physikalischer Verein. 

38. Fulda: Verein fftr Naturkunde. 

39. Giefsen: Oberhessische Gesellschaft f. Natur- und Heilkunde: 

31. Bericht 18%. 

40. Görlitz: Naturforschende Gesellschaft: Abhandlungen, 6. Bd., 

2. H.; 16. Bd. 

41. Göttingen: Kgl. Gesellschaft der Wissenschaften und Georg 

Augusts-Universität: Nachrichten, Mathem.-physik. 
Kl., 18%, 4 ; 1897, 1, 2. Geschäftl. Mitteilungen, 1897. 

42. Greiz: Verein der Naturfreunde. 

43. Güstrow: Verein der Freunde der Naturgeschichte in Mecklen- 

burg: Archiv 50. Jahr 1896, 1. u. 2. Abteilung, Jubi- 
läumsbd. s. Inhaltsverz. zu d. Jahrg. XXXI.— L. 

44. Halle a. S.: Entomologischer Verein. 

45. > Landwirtschaftliches Institut an der Universität. 

46. » Kaiserlich Leopoldino-Carolinische Deutsche Akademie 

der Naturforscher: Leopoldina, Heft XXXIII. 

47. » Naturforschende Gesellschaft. 

48. » Naturwissenschaftlicher Verein. 

49. » Thüringisch-sächsischer Gesamtverein für Erdkunde. 

50. > Verein für Erdkunde: Mitteilungen 1897. 

51. Hamburg: Naturwissenschaftlicher Verein: Abh., 15. Band; Verh. 

in. F. rV., 1896. 

52. > Verein für naturwissenschaftl. Unterhaltung. 
53.Hamburg-Altona: Naturwissenschaftlicher Verein. 

54. Hanau: Wetterauische Gesellschaft far die gesamte Naturkunde. 

Digitized by VjOOQ IC 



J6 

55. Hannover: Naturhistorische Gesellschaft. 

56. Heidpiberg: Naturhist.-medicin. Verein : Verhandlungen , N. F. 

V. Bd., 5. H. 

57. Hof: Nordoberfränkischer Verein f. Natur-, Geschichts- u. Landes- 

kunde. 

58. Karlsruhe: Naturwissenschaftlicher Verein. 

59. Kassel: Verein för Naturkunde. 

60. Kiel: Naturwissenschaftlicher Verein für Schleswig-Holstein : 11. Bd., 

1. Heft. 

61. Königsberg i. Pr.: Physikalisch-Ökonom. Gesellschaft: Schriften, 

37. Jahrg., 1896. 

62. Landshut: Botanbcher Verein. 

63. » Historischer Verein. 

64. Leipzig: FOrstl. Jablonowsky*sche Gesellschaft. 

65. » Kgl. sächsische Gesellschaft der Wissenschaften : Be- 

richte über die Verhandl. ; math.-phys. Kl. 1896, 4, 5/6 ; 
1897, I/n— rv. Sach-Regbter der Ber. u. Abh. 

66. > Naturforschende Gesellschaft : Sitzgsber. 22 u. 23. Jahrg., 

1895/96. 

67. » Verein fQr Erdkunde: Mitteilungen 1896; wissenschaftl. 

VeröfTentl. : ni. Bd. 2. Heft, Baumann, die Insel Sansibar. 

68. Lüneburg: Naturwissenschaftlicher Verein. 

69. Magdeburg: Naturwissenschaftlicher Verein. 

70. Mainz: Rheinische naturforschende Gesellschaft. 

71. Mannheim: Verein für Naturkunde. 

72. Marburg: Gesellschaft zur Beförderung der gesamten Naturwissen- 

schaften: Sitzungsberichte 1896. Schriften Bd. XIII. 
Abhdl. 1. 

73. München: Kgl. Bayer. Akademie der Wissenschaften: Sitzungsber. 

der math.-phys. Kl., 1896, H. 3 ; 1897, H. 1, 2. Boden- 
seekarte. 

74. » Bayer. Botanische Gesellschaft : Berichte, Bd. 5. 1897. 

75. » Geographische Gesellschaft. 

76. Münster: Westphälischer Pro vinzial verein für Wissenschaft und 

Kunst : 24. Jahresbericht für 1895/96. 

77. Neifse: Philomathie. 

78. Nürnberg: Arztlicher Verein. 

79. » Bayr. Gewerbemuseum. 

80. » Germanisches Nationalmuseum : Anzeiger Jahrg. 1896, 

Mitteilungen Jahrg. 18%. 

81. > Gymnasialbibliothek. 

82. » Medicinische Geselbchaft und Polyklinik: 18.Sitzungs- 

bericht 1896. 

83. > Stadtbibliothek. 

84. » Verein für Geschichte der Stadt Nürnberg: Jahres- 

bericht 1895, 1896; Mitteilgn. 12. Heft, 1. Abt. m. 
»Prospekt d. Sudt Nbg.« 

85. » Verein für öffentliche Gesundheitspflege. 

86. > Verein Merkur. 

87. Offenbach: Verein für Naturkunde. 

88. Osnabrück: Naturwissenschaftlicher Verein: 11. Jahresber. 1895 

und 1896. 

89. Pas sau: Naturhistorischer Verein. 

90. Regensburg: Naturwissenschaftlicher Verein. 

91. Reichenbach: Voigtländ. Verein fttr allgemeine u. spez. Landes- 

kunde. 



Digitized by VjOOQ IC^ 



27 



92. Reutlingen: Naturwissenschaftlicher Verein. 

93. Schmalkalden: Zeitschrift des Vereins d. Hennebergischen Ge- 

schichte und Landeskunde. 

94. Schneeberg: Wissenschaftlicher Verein. 

95. Schweinfurt: Naturwissenschaftlicher Verein. 

96. Sondershausen: Botanischer Verein für Thüringen. 

97. Stuttgart: Verein für vaterländ. Naturkunde in Württemberg : 

Jahreshefte, 53. Jahrg. 

98. Wernigerode: Naturwissenschaftlicher Verein des Harzes : 

Schriften, 11. Jahrg., 1896. 

99. Wiesbaden: Nassauischer Verein rar Naturkunde: Jahrbücher, 

Jahrgang 50. 
100. Würzburg: Physikalisch-medicinische Gesellschaft : Sitzungsber., 



Jahrgang 1896. 
^oh ■ • - 



101. > Polytechnischer Zentralverein für Unterfranken und 

Aschaffenburg: Gemeinnützige Wochenschrift, 47. 
Jahrgang. 

102. Z erb st: Naturwissenschaftlicher Verein. 

103. Zweibrücken: Naturhistorischer Verein. 

104. Zwickau: Verein fQr Naturkunde: Jahresbericht, Jahrg. 18%. 

n. öftarreiek-ÜBganL 

105. Agram: Kroatischer Naturforscherverein. 

106. Aufsig a. E. : Naturwissenschaftlicher Verein. 

107. Baden bei Wien: Gesellschaft zur Verbreitung naturwissen- 

schaftlicher Kenntnisse. 

108. Brunn: K. k. mährisch-schlesische Gesellschaft zur Beförderung 

des Ackerbaues, der Natur- und Landeskunde: Central- 
Blatt» 76. Jahrgang, 18%. 

109. > Naturforschender Verein: Verhandlungen, 35. Bd.; 15. 

Ber. der meteorolog. Kommission. 

110. Budapest: K. ungarische naturwissenschaftliche Gesellschaft. 

111. » Rovartani Lapok (entomolog. Monatsschrift). IV. 

Kötet 1897. 

112. Graz: K. k. steiermärkische Gartenbau-Gesellschaft: Mitteilungen, 

23. Jahrgang. 1897. 

113. > Naturwissenschaftlicher Verein ftlr Steiermark: Mitteilgn., 

Jahrgang 18%. (D. g. R. 33. Heft.) 

114. » Verein für Ärzte in Steiermark : Mitteilgn.. 33. Jahrg., 1896. 

115. Hermannstadt: SiebenbürgischerVerein für Naturwissenschaften : 

Verhandlungen und Mitteilungen, 46. Jahrg., 18%. 

116. > Verein für siebenbürgische Landeskunde : Archiv, 

N. F. 27. Bd., 2.. 3. Heft; Programm d. evang. 
Gymnasiums A. B. 1895/6; Jahresber. 18%/97. 

117. > Siebenbürgischer Karpathenverein : Jahrbuch, 

17. Jahrgang, 1897 u. »Beilage«. 

118. HolFic: K. k. Fachschule rar Bildhauer und Steinmetze, 14. Jahres- 

bericht. 

119. Innsbruck: Ferdinandeum f. Tirol u. Vorarlberg: Zeitschrift, 

3. Folge, 41. Heft; Register zu d. ^itschr. bis z. 
40. Heft. 

120. > Naturwissenschaftlich-mediz. Verein: Bericht XXII. 

Jahrgang 1893-1896. 

121. Klagen fürt: Naturhistorisches Landesmuseum für Kämthen: 

Jahrbuch, 24. Heft ; Seeland, Diagramme d. magnet. 
u. meteorol. Beobachtgn. 1896. 

Digitized by VjOOQ IC 



28 



122. Klausenburg: Siobenbürgischer Museumverein : Sitzungsber. der 

med.-naturw. Sektion, 18. Bdr, 2. u. 3. Heft. 

123. Laib ach: Musealverein för Krain. 

124. Leutschau (Lösce): Ungarischer Karpathen verein. 

125. Linz: Museum Francisco - Carolinum : 55. Jahresbericht nebst 

49. Lief, der Beiträge; Baucalari, Bibliothekskatalog des 
Museum Fr.-Carol. 

126. Prag: K. Böhmische Gesellschaft der Wissenschaften: Sitzungs- 

berichte 1896, 1 u. 2; Jahresber. 1896. 

127. » Naturhistorischer Verein Lotos. 

128. Pressburg: Verein für Heil- und Naturkunde. 

129. Reichen berg: Verein der Naturfreunde : Mitteilungen, 28. Jahrg. 

130. Salzburg: Städtisches Museum Carolino-Augusteum : Jahrcsb.1895. 

131. Triest: Societä adriatica di scienze naturali. 

132. Wien: Entomologischer Verein: 7. Jahresbericht, 1896. 

133. > K. k. Gartenbaugesellschaft : Wiener illustr. Gartenzeitung 

1897, Heft 1—12 ; versch. Hefte Ergänzungen aus d. Jahrg. 
1879, 1880, 1881, 1882, 1883, 1886 u. 1888. 

134. » K. k. geographische Gesellschaft: Mitteilgn., Band 36—39, 

1893 - 96. 

135. > K. k. geologische Reichsanstalt: Verhandlungen, Jahr- 

gang 1896. 

136. » Naturhistorisches Hofmuseum: Annalen, Bd. 11, Heft 3/4. 

137. » K. k. zoologisch-botanische Gesellschaft: Verhandlungen, 

46. Bd., 10. Heft. 

138. > Naturwissenschaft. Verein an der Universität : Mttlgn. 1896. 

139. » Verein zur Verbreitung naturwissenschaftlicher Kenntnisse : 

Schriften, 37. Bd., 1896/97. 

nL SohwelB : • 

140. Basel: Naturforschende Gesellschaft. 

141. Bern: Naturforschende Gesellschaft. 

142. [ » ] Schweizerische naturforschende Gesellschaft: Actes, 78:; 

Session 1895; Verhandlgn., 79. Versammig. 18%. 

143. Chur: Naturforschende Gesellschaft Graubündens: Jahresbericht, 

Neue F. 40. Bd. 1896/97. 

144. Frauen feld: Thurgauische naturforschende Gesellschaft. 

145. St. Gallen: Naturwissenschaftliche Gesellschaft : Bericht 1894/95. 

146. Solothurn: Naturforschende Gesellschaft. 

147. Zürich: Naturforschende Gesellschaft :Vierteljahrsschrift, 41. Jhrg., 

Supplement. 42. Jahrg., 1. u. 2. Heft. 

nr. Belgien. 

148. Antwerpen: Acad^mie d'Arch^ologie: Bulletin 4. S. 2. XXVIII 

bis XXX. 

149. Bruxelles: Soci^t^ beige de microscopie. 

150. > Soci^t^ royale malacologique de Belgique. 

151. » Soci^t^ royale Linn^enne. 

T. Fnuikreioh. 

152. Cherbourg: Soci6t6 nationale des sciences naturelles* et mathö- 

matique. 

VI. Grossbritaiinien. 

153. Dublin: Natural history society. 

154. Glasgow: Natural history society: Transactions (N. S.) Vol FV. 

Part ni; Vol. V., Part I. 

Digitized by VjOOQ IC 



29 



Tn. Holluid. 

165. Amsterdam: Genootschap Natura artis magistra. 

156. Haarlem: Mus^e Teylcr: Archives, Ser. IL, Vol. V., 3« partie. 

157. Leiden: Nederlandsche Dierkundige Vereeniging. 

TUL IttlieB. 

158. Brescia: Ateneo: Commentari 18%. 

159. Catania: Accademia Gioenia di scienze natural!: Bnllettino, 

Marzo 1897, Fase. XLVI. 

160. Firenze: Bibliotheca Nationale Centrale: Bolletino d. Public. Ital. 

Indici 1897. No. 264—287; 1895, S. 97— XCVILL 

161. > R. Istituto di studi superiori e di perfezionamento. 

162. » Societä entomologica italiana: BuUetino anno 28, Trim. 

3 u. 4. 

163. Milano: R. istituto lombardo di scienze. 

164. Modena: Societä dei naturalisti: Atti, S. 3, Vol. 14, anno 29, F. 2. 

165. Napoli: R. accademia delle scienze. 

166. Padova: Societa veneto-trentina di scienze natural!: Atti, S. 2, 

vol. 3, fasc. 1. 

167. Pisa: Societä malacologica Italiana. 

168. > Societä Toscana di scienze naturali: Atti, Memorie vol. 15; 

Proc. verb. vol. 10, 22. Novem. 1896— Maggio 1897. 

169. Roma: R. accademia dei Lincei: Atti, anno 294, S. V., Rendiconti 

voL 6, 1. Sem. F. 1—12; 2. Sem. F. 1— 12e Indice; Ren- 
diconto deir adunanza solenne dei 5. Giugno 1897. 

170. » Biblioteca nazionale centrale Vittorio Emanuele. 

171. > R. comitato geologico dltalia. 

172. S a s s a r i : Uni versitä. 

173. Torino: R. accademia delle scienze: Atti, vol. 32, disp. 1 — 5, 

7—16, Dr. Rizzo, Osserv. meteorol. 1896. 

174. Vene zia: R. istituto delle scienze: Memorie vol. 25, 8. 

175. Verona: Accademia (Agricoltura, scienze, lettere, arti e commercio) 

Memorie, vol. 12, S. 3, F. 3 u. 4. 

DL Lvxemlrarg* 

176. Luxemburg: Soci^t^ botanique de grand-duch6 de Luxembourg. 

177. , Fauna, Verein Luxemburger Naturfreunde: Mit- 

teilungen aus den Vereinssitzungen, 6. Jahrg., 1896. 

X. Bnstluid. 

178. Dorpat: Naturforscher-Gesellschaft: Archiv fiir die Naturkunde, 

Liv-, Ehst- u. Kurlands, 2. S., Bd. 11, Lfg. 2; Sitzungs- 
berichte, 11. Bd., 2. H. 

179. Helsingfors: Societas pro fauna et flora fennica: Acta, Vol. XI; 

Meddelanden 22. Heft. 

180. Kiew: Naturforscher-Geselbchaft der Universität. 

181. Mi tau: Kurländische Gesellschaft för Literatur und Kunst: 

Sitzungsberichte, 1896. 

182. Moskau: Soci^t^ imperiale des naturalistes : Bulletin, 18%, Nr. 3, 

183. Riga: Naturforscher- Verein : Korrespondenzblatt 39, 18%; Ver- 

zeichnis z. Samlg. abnormer Wildhühner. 
W. St. Petersburg: Hortus petropolitanus : Acta Tom. III, Nr. 2 
bis 5; Tom. IV. 1-6; Tom. V, 1—6; Tom. VI, 
1—6; Tom. VII, 1. 

Digitized by VjOOQ IC 



80 

XI. Sohwedmi und Norwegen. 

185. Bergen: Museum: Aarbog for 1896; Sars, Crustacea of Norway 

vol. n. Part. 3—8. 

186. Christiania: Universität. 

187. > Editoriai Committee of Den Norske Nordhavs- 

Expedition 1876 bis 1878: No. XXUI, Zoologi. 
No. XXIV. Botanik. 

188. Stavanger: Museum: Aarsberetning tor 1896. 

189. Stockholm: Konig Svenska Vetenskaps Academien: öfversigt 

af Förhandlingar 1896; Bihang vol. 22, Sect. 1—4; 
28. Handlingar. 

190. Stockholm: Soci^tö entomologique : Entomologisk Tidskrift, 
irg. 17, Haft 1—4, 1896. 



191. Tromsö: J^useum: Aarsberetning for 1894; Aarshefter 18, 1895. 
eological Institution of t " 
p. 1, Nr. 6. 



192. Upsala: Geolosical Institution of tlve university: Bulletin vol. 3, 



B. Amerika. 
L ArffeBÜBieii. 

193. Buenos aires: Museo Nacional: Annales tomo 5 (S. 2, t. 2); 

Memorias 1894, 1895, 1896. 

194. C o r d o b a : Academia nacional de ciencias de la republica Argentina. 

195. La Plata: Bureau g^n^ral de Statistique: Carl. Salas, l'agriculture, 

r^l^vage, rindustrie et le commerce dans 1. prov. de 
Buenos Ayres 1895. 

IL Bradliei« 

196. Rio de Janeiro: Museu nacional. 

HL Britiseli Amerika. 

197. Halifax (Nova Scotia): Nova Scotian Institute of natural science: 

Proceedings andTransactions Vol.9Part.2(2. S., Vol. II). 

198. Toronto (Ontario): Canadian Institute: Transactions No. 9 vol. 5, 

Part. 1); Proceedings, N. S., Vol. V, part. 1, No. 1. 

TV. Cliile: 

199. Santiago: Deutscher wissenschaftlicher Verein : Verhandlungen, 

Bd. m, Heft 3, 4, 1896. 

200. > Soci^tö scientifique du Chili: Actes: Tome V (1895) 

5e 1.; Tome VI (1896) 2e-5^ 1.; Tome VII 1« l. 

201. » üniversidad: Annales, Tomo XCI— XCIV: Philippi, 

Plantas nuevas chilenas. 

202. > Museo national. 

T. GetU Rica. 

203. San Jo s^ : Museo nacional : Informe 1896—97 ; Mamfferos de Costa 

Rica 1897; Moluscos terrestres y fiuviatiles 1897; 
Tristan, Insectos de C. R. 1897. 

YL Caba. 

204. Habana: Sociedad antropologica. 

YIL VmgüMj. 

205. Montevideo: Museo Nacional: Anales Vn, Tomo II. 

Vm. Tereiniffte Staaten. 

206. Albany fN.-Y.): State museum of natural history: Reports of the 

State geologist 1894 (14); James Hall, prelim. Geologie 
Map of New- York 1 : 316,800. 

207. » University of the State of N.-Y.: 48th annual report 

1894. 2 Bände u. 1 Atlas. DigitizedbyGoOgk 



81 

208. Boston (Mass.): American academy of arts and sciences: Procee- 

dingrs N. S. vol. 23, 1895/6 (W. S. 31); Vol. 32, No. 1—14. 

209. > Society of natural history-. Proceecüngs vol. 27, p. 75 

bis 330, No. 3-14. 

210. Bnffalo (N.-Y.): Society of natural sciences. 

211. Cambridge (Mass.): Museum of comp. Zoology at Harvard 

College: Annual Report 1895/6; Bulletin vol. 28, 
3—5, 30, 3, 6. 31, 1—4. Memoirs vol. 19, 2. 20. 
21, I. u. n., 22 mit Atlas. 

212. Chicago (111.): Academy of sciences: 39. Jahresbericht. Bulletin 

No. 1, Calkins, Lichen-Flora. 

213. Colorado Springs (Colo.): Colorado College: Studies, Vol. VI. 

214. Columbus (Ohio): Board of Agriculture. 

215. Dave np ort (Iowa): Academy of natural sciences: Proceedings, 

Vol. VI, 1889—97. 

216. Madison (Wisc): Soci^t^ de T^tat Wisconsin. 

217. » Wisconsin Academy of sciences, arts and lettres. 

218. Meriden (Conn.): Scientific association: Proceedings and Trans- 

actions. 

219. Milwaukee: Natural history society of Wisconsin : 14.annual Report. 

220. Minneapolis (Minn.): Geological and natural history survey of 

Minnesota. 

221. > Minnesota Academy of natur. Sciences: Bulletin 

Vol. IV, No. 1, Part. 1. 

222. New-Haven (Conn.): Academy of arts and sciences. 

223. New- York (N.-Y.): Academy of sciences: Annales vol. IX., No. 4, 

5. Transactions vol. XV. 1895/96. 

224. > Microscopical society: Journal vol. Xm., No. 1—3. 

225. Philadelphia (Pennsylv.) : Academy of natural sciences : Procee- 

dings 1896, Part 2, 3; 1897 Part 1. 

226. > American philosophical society: Procee- 

dings vol. 35. No. 151, 152; vol. 36, 154. 

227. » Wagner Free Institute of science. 

228. Rochester (N.-Y.): Academy of Science. 

229. Salem (Mass.): Essex Institute. 

230. St. L ouis(Miss.): Academy ofscience :TransactionsVol.VII.,No.4— 16. 

231. > Missouri botanical Garden. 

232. San Francisco (Cal.): California Academy of sciences. 

233. St. Paul (Minn.): Geological and natural history survey. 

234. Topeka (Ark.): Kansas Academy of science. 

235. Trenton (N.-Y.): Natural history society. 

236. Tafts College (Mass.). 

237. Washington: Bureau of Ethmology: 14. Jahresbericht 1892/93, 

2. Bde.; 15. Jahresb. 1893/94. 

238. » Department of Agriculture : Bulletin No. 54; North 

American Fauna No. 13 ; Yearbook 1896. 

239. » U. S. Geological Survey : 17. Jahresbericht 1895/96, 

Part III, 1 u. 2. 

240. > Smithsonian Institution : Langley , Memoir of 

George Brown Goode. 

Annual Report 1894, I u. H; 1895. 

Bulletin No. 47. 49. 

Miscellaneous Collections 1035, 1038, 1039, 1071, 

1072. 1073, 1075, 1077. 

Contributions to knowledge 1034. 

ProceedingsoftheU.S.NationalMuseum,Vpl.l8,18pS. 

Digitized by LjOOQIC 



S2 



m. Bericht über den Zuwachs zu den Sammlungen. 






Gegenstand 



Fundort 



Schenker 



64 

65 

66 

63 

.135 

136 

137 

152 

159 

44 



132 
14 
67 
10 
80 
81 
39 

11 

57 

144 

180 

94 



154 

60 

59 

116 

99 

47 
110 



la. Anthropologie. 

Schädel, Schenkelknochen . . . 

Urnenscherben 

Bemsteinring 

Nadeln, messerartiges Instrument 

Eupferring 

Knochen 

Steinwerkzeage 

Menschliche Knochen ..... 
Skelettteile eines jugendlichen 

Menschen 

Eisenschlacken, ümenscherben . 

Ib. Ethnographie« 

Messer 

Kopfputz, aus vorigem Jahrhundert 

Sandalen, Schuhe 

Kinderschuhe 

Holzschuhe und 

sla?ische Obangen 

6chuhe, Bekleidungsgegenst&nde, 

Kopfschmuck 

Gef&fse aus Flaschenkürbis . . . 
Vergiftete Pfeilspitze, Waffe . . 

Schöpflöffel, geschnitzt 

Klapper 

Zwei Idole 

8« Zoologie. 

a. Säugetiere. 

Nasua, Nasenbär 

Meles, Dachs, jung 

Ganis yulpes, 2 junge Füchse . . 

Halmaturus, Känguruh 

Elephantenzahn , mit einge- 
drungener Kugel 

Gemse, 2 Füfse, mumificiert . . 
Bos, Kiefer, ausgegraben .... 



Palgem Flur 

auf dem 
Juraplateau 
bei Altdorf 

Schniegling 

Nürnberg 
Poesneck 



Lappland 
Nabburg 
Tessin 
Bulgarien 
Poschega^an der 
Save 

Serbien 

Tangaivjikasee 
Kamerun 



Hypora 



Asuncion 



Heroldsberg 



Neuholland 



Anthropo- 
logische Sektion, 
Wunder. 



Rhau. 

Magistrat. 
Spandel. 

Lambrecht. 
Zopf. 
Huber. 
Zopf. 
Forchheimer. 



Preifs. 
Zopf. 

Meisenbach. 
Wieseler. 



Kleylein. 



Ludloff, Er- 
langen. 
Meisenbach. 

n 

angekauft. 



Schmidt 
Alpen Heuber, M. 

hier Stell, Sattler. 

Digitized by VjOOQ IC 



88 



Gegenstand 

b. Vögel. 

Sylm spec 

Hinrndo, 2 Nester mit Gelegen . 

Tichodroma mararift 

Pastor roseof 

Oriolns galbola 

Jynx torqnüla 

Otos brachyotos 

Cotymbns septentrionallB .... 

„ , rotkebliger Seetaocber 

Podicepi minor ^ 

(^Amphibien and Reptilien. 

Eidechse mit 2 Schwänzen . . . 

I4u;erta ocellaU yar. pater . . . 

Lacerta mnralis var. tiligaerta 
rabY. coemlea 

Anolis carolinensis 

Agama sangninolenta 

Ljgosoma gnichenoti 

„ tenae 

üromastix acanthinoms .... 
„ hardwickei 

Amphibolnras barbatos 

Cydodns gigaa 

Zomnu giganteos, Biesengürtel- 
schweif 

Sdnciu offieinalis 

Tfliqaa nigrolntea 

Ophisaams apoi 

Diporoi^ora anitralis 

Boa, Biesenscblange 

Python reticnlatus, junge Riesen- 
schlange 

Diemenia psammophis 

Dendrophis pictas ..!.... 

Tropidonotos natrix 

Colnber erythroms 

d. Fische. 

Baja dayata, Rochen, Zähne . . 

Rochen, riesiges Exemplar . 



Fundort 



Reichswald 

Nürnberg 

Südeoropa 

Gkitsberg 
Erlenstegen 
Franken 
Ansbach 

Veflhof 

Erlangen 
Nordafiika 

Gapri 

Nordamerika 

Transkaspien 

Neastkdwales 

Queensland 

Egypten 

Bengalen 

Qaeensland 

Australien 

Südafrika 

Egypten 

NenhoUand 

Dalmatien 

Queensland 

Brasilien 

Ostindien 
Australien 

Nürnberg 
Manila 



Sohenker 



Fri. Straub. 

Ertheiler. 

angekauft. 

Haering. 

Meisenbach. 

Sizt. 

Pfiantsch. 

angekauft. 

Lechner. 

Lindinger. 
Einkelin. 



I 



angekauft. 
Einkelin. 

w 
n 

Eastrupp. 
Einkelin. 

Prof. Dr.Fleisch- 



Blümel^m. . 

Digitizeday'L.OOgle 



84 



H 
141 

66 
189 
140 

62 



111 

128 

72 

106 

6 

23 

128 

188 

7 

8 

9 



46 
61 

73 

138 
61 

102 
36 



Gegenstand 

Esox lacius, Hecht, 11 Pfand 

schwer, Kopf 

Belone acas, Hornhecht .... 

Dactyloptems volitans 

Exocoetns eyolans 

Lepidosiren paradoxa 



e. Insekten. 

Melolontha Fullo 

Desmonota yariolosa 

Gossus ligniperda BanpeinAhom- 

b&omen 

Hippobosca equina 

Myrmecoleon formicarios .... 

Heuschrecken 

Stagmomantis Carolina 

Reblaos-Pr&parate 

Cicata plebeja 

Gentrotos comutus 

Euplix producta 

Ixodes ricinus, Hundszecke . . 

f. Molluscen und niedere 
Tiere. 

Pectunculus pilosus 

Glausilia, reiche Sammlung von 

Arten dieser Gattung .... 

Solen vagina 



Diverse Gonchylien. • 
Fungia, Bl&tterkoralle 



g. Biologie. 
Stammstück der Esche mit Frafs- 

gängen des Eschenbastkäfers . 
Rinde der Föhre mit Frafsg&ngen 

des Borkenk&fers 



8. Botanik. 

a. Morphologie, Physiologie, 

Pharmacologie etc. 
Stamm von Nuphar mit zerstreuten 
Gef&fsbündeln | Erlangen 



Fundort 



Altmühl 
Mittelmeer 



Amazonenstrom 

Nürnberg 
Brasilien 



Nürnberg 



Argentina 
Garolina 



Moritzberg 



Schanker 



Meisenbach. 
Einkelin. 



Dr. Rnpprecht. 

TTinlrftlin 

Tölke. 

Schwarz. ' 

Eaulfufs. 

Scudellari. 

Kinkelin. 

Voigt. 

Eaulfufs. 



Schwarz. 



Syrien 


Kinkelin. 




Voigt, Apothek., 


— 


H6ch8tadta.A. 


Spikeroog,Nord- 


Ungenannt. 


see 




— 


Knapp. 


— 


König. 




Probst, Drechs- 


Franken 


lermeister. 


Reichswald 


Schwarz. 



Dr^01ück.T 

Digitized by VjOOQ IC 



8S 



Gegenstand 



Fundort 



Schanker 



Stamm von Nymphaea mit xer- 
streuten Gefäfsbündeln . . . . 

Aristolochia Sypho, Bl&tter und 
Blüten 

Fracht von Trapa natans . . . 

jt „ Citnu medica . . . 

„ „ Carica Papaya . . . 

„ Momordica invola- 

crata (Natal) 

Fracht von Vacciniam macro- 
carpom 

3 Frachtzapfen von Pinas Strobas 

Cladonia-Photographieen, reiche 
Serie 

Gkaster hygrometricas 

Banmschw&mme 

BaamBchwamm, flach gewachsen. 

Famkraatprothallien mit Arche- 
gonien and Antheridien . . . 

Fiederblatt yon Kallanchoe pin- 
nata mit Bfldang janger Sprofse 
in den Kerben 

Bi^hne Meseream, Bltkte. . . . 

Kartoffelknölle mit eingewachse- 
nem Bing 

Rosa centifolia, Blüte mit Darch- 
wachsang 

Aststück mit Pilzbildang .... 

Ast von Qaercas mit Insektenstich 

Gentiana latea, riesige Worzeln. 

Blüte Ton Trifoliam montanam 
als Brastthee 



b. Pflanxengeographie. 
Aste and Zapfen von Pinas Pa- 

milio 

Taxas baccata 

Teacriam Scorodonia 

Chenopodiaceae , reiche Serie, 

firisdL Atriplex nitens, Blitom 

f irga t am , Chenopodiam striatom 
Früchte von Qaevina Avellana . 



Datzendteich 

calt. 

ünterbürg 

Palermo 

h. b. Würxbarg 



h. b. Würzbarg 



Nordamerika 
calt. Eitzingen 

Erlangen 

Spessart 
hört, botan. 
Würzbarg 



Nürnberg 



hört. Schwabach 
Sankt Johannis 
Nürnberg 
Algäa 



Lappersdorf 
Eibenthal, Plech 
Hochenbrack 



Würzbaiig 
Ghüe 



Bürger. 

Voigt. 

Haber. 

Sixt 

Dr. AppeL 



Einkelin. 
Dr. Bachner. 
Dr. Arnold, 
München. 
Lindinger. 
Kraft, Karl. 
Schwarz. 

Dr. Appel. 



Wülfel, Karl. 

Pfeaffer. 

Pohl,Schwabach. 
Lenz. 

Meisenbaeh. 
Ertheiler. 

Motz, Stallmeist. 



Meisenbach. 

Zeidler. 

Schwarz. 



Dig, 



Landaaer. 
Wie8eler,Keller. 

3* ^e 



86 









^ 

A 


Gagenstand 


Fundort 


Schanker 


148 


Litschipflanmeii (yon Nepheliioa 








Litschi) 


Japan 




146 


ZabacajanOsse (Samen TonLecythia 


Wieseler, 
KeUer. 




OUaria) 


Kamerun 


145 


^ •^/ ••••••••••• 

Samen yon Voandyeia sabterraaea 


n 




131 


Seidenbanmwolle 


— 


Wieseler. 


181a 


Aron centannu 

c. Zu den Herbarien. 


~" 


»> 


147 


Rubns-Bastarde, determ. ütsch . 


Flora Nürnberg 


Simon. 


16 


Phanerogamen ans Brandenburg, 


Tirol, Ungarn 


»» 


96 


Phanerogamen aus 


Oberbayem 


Kranzle. 


84 


y, ans denCordilleren 


La Gumbra 


Scudellari. 


161 


„ aas der 


Schweiz 


Paalzow. 


98 


Sphagna, Lanbmoose 


Franken 


Kanlfufs. 


165 


Pihe, parasit&r auf Knltnrpflanzen 


fr&nk. Jura 


Dr. Wagner. 


166 


» I» » » 


Lichtenhof 


»» »> 


167 


n r, rt wfldenPflanzen 


Ntkmberg 


Fdr.Schultheifs. 


170 


„ wüden und 


Nürnberg, Neu- 


Schwarz. 




cnlÜT. Pflanzen 


markt 




171 


Pila, parasit&r auf Beta imlgaris 

4. OMlogle. 

a. Palaeontologie. 


Oberhessen 


»» 


100 


ürsos spelaens, Zähne 


Streitberg 


Bing, Kommen. 


112 


n » » 


fr&nk. Jura 


Heinemann. 


56 


Gervos sp. Geweihfragment in 






, 


einem Tofflager bei 


Eschenbach 


Bürger. 


119 


Mastodon sp.? Z&hne. Diluvium. 




Hupf, Regensbg. 


160 


Plateosaurus Engelhardi. Knochen, 








Wirbel 


Lauf 


Wunder jnn. 


108 


Puppa nordlingensis, Sorswasser- 








kalk 


Nördlingen 


js^hrharQ. 


118 


Ammonites species divers. Jura 






francon. super 


Uetzing 


Paalzow. 


127 


Ammonites, Belemnites etc. aus 








dem Dörlbacher LiasaufschluTs 


Altdorf • 


1» 


46 


Verschiedene Versteinerungen. . 


— 


Kudielka. 


92 


Fossiles Holz, Braunkohle . . . 
b. Geognosie. 


Oberösterreich 


Lindinger. 


60 


Gerollte Gesteine der Kaste des 


ligurisch. Meeres 


Heyling. 


68 


St4>dn, gerollt 


Lago Maggiore 


JJaber. , 



Digitized by VjOOQ IC 



87 



5? 



Gegenstand 

Gerolhe jurassische und Urge- 
birgsgesteine (Bahnbaa) . • . 

GeroUte Kopaie 

Geode aas dem Amaltbeenthon . 

Plattenkalk 

SfiTswasserkalk mit Hydropia und 
Pnppa 

Gesteine ans dem Miocaen von 
Moosbach bei 

6. Hineralegle. 

Granaten 

Schwefeleisen 

Bosenqoarz von Pleistein bei . . 

Qoarze, diverse 

Phaestin vom Peterlstein bei . . 

6. Oeogimpkie. 

Karten von Nürnberg, Deutsch- 
land etc 

7. TechAologle, 

Metallschliffe 

einige Kopaie mit umgebendem 

Gestein 

Kopaie, Erdpeche, reiche Serie 

verschiedener Sorten 

142 Glasringe, bunt, indischer 

Schmuck 

Armreife der Hindus, Galcutta . 

Armreife 

3 Amulette (för Madagascar) . . 

Schnupfdose 

Afflnletteft&r denOberarm(Bombay) 
5 Kopfiiadeln (China) 



Fundort 



Sohenker 



168 

105 
114 
126 
107 



16 
17 
70 
124 
12 



148 



41 
78 

104 

88 

42 
95 
74 
75 
76 
77 



Mariaort, 
Regensburg 

Rasch, Altdorf 
Solnhofen 

Nördlingen 

Wiesbaden 



Norwegen 
nOrdl. Norwegen 
Vohenstraufs 

Knpferberg 



S&daustralien 
div. 



Schwärs. 
Dasch, P. 
Schwarz. 
Paalsow. 

Ehrhard. 

Spandel. 



Friese. 

Glenk. 
K. Krafft. 
Fr. Huber. 



Rhan. 



Böhler, Wien. 

Kleylein. 
Dasch, Engel- 
hard, Lackfabr. 

Kleylein, Gablonz 



Der Konsenrator: A. Schwara. 



Digitized by VjOOQ IC 



38 



IV. Jahresbericht der Verwaltung für 1897. 

Die Vermietung der verschiedenen Räume des Hauses 
war die gleich günstige, wie im Vorjahr. Der zweite Stock 
des Vorderhauses und das Hinterhaus ist an die Neue Narnberger 
Frauenarbeitsschule vermietet, ebenso ein Keller an einen 
Obsthändler. 

Die Gesellschaftsräume waren vermietet an : Architekten- 
und Ingenieur -Verein, Gartenbauverein, Hebammen -Verein, 
Pegnesischer Blumenorden , St^nographenhort , Technische 
Kommission für Gesundheitspflege, Kommission für Ferien- 
kolonien und an die Schulkommission. 

Zur jährlichen Bezahlung von 200 M an unserer Hypothek 
haben sich auch in diesem Jahre eine Anzahl Herren mit 
Extrabeiträgen beteiligt, wofUr herzlicher Dank ausgesprochen 
wird, gleich dankend ist die Zurtlckgabe von S Schuldscheinen 
im Gesamtbetrage von ISO M zu verzeichnen. Eine Scbuld- 
scheinverlosung konnte leider wiederum nicht vorgenonmien 
werden, da die Verwaltung noch mit den grOfsten Schwierig- 
keiten zu kämpfen hat und die Gesellschaftskassa auch dieses 
Jahr einen bedeutenden Zuschufs leisten mufste. 



Der Vermögensstand beziffert sich wie folgt: 

a. Immobiles Vermögen. 

Haus nebst Hinterhaus Schildgasse 12, 1. Jan. 1897 jk, 4 

Hypothek darauf 50400 — 

Abzahlung hieran . 200 — 

sohin am 31. Dezember 1897 Hypothekenbestand 50200 — 

b. Mobiliar. ^ 4 

1. Januar 1897 Stand desselben 1817 50 

Ab 10«/o Abnützung 181 75 

16S5 75 

c. SohuMen an Sohuldscheinen. jtk 4 

Gesamtausgabe von Schuldscheinen 80175 — 

1. Januar 1897 Stand derselben 24760 - 

Javon S Stück als Geschenk zurückerhalten . . . 150 •— 

Stand am Sl. Dezember 1897 . . 24600 — 



H. Sebald. 

Digitized by VjOOQ IC 



89 

V. Kassenbericht für 1897. 
a. Ober die GeseHschaftskassa. 

ElMBakmeBi M. ^ 

Kassabestand 680 07 

Guthaben bei der Sparkassa (j«l 884.99) - — 

Aafnahmsgebahren 86 —' 

Mitgliederbeiträge ; . . . 4154 45 

Beitrag vom Stadtmagistrat Nürnberg 500 — 

Beitrag vom Landrat Itlr Mittelfranken 800 — 

Legat des Privatiers Herrn Hohenner 125 — 

Summa . . 5795 52 

▲ asgabeBi Jk /^ 

Titel la. Einrichtung des Museums 882 60 

Ib. Unterhaltung desselben 258 81 

IIa. Bibliothek 271 25 

IIb. Einrichtung derselben ........ 149 — 

II c. Druck des Kataloges — — 

Illa. Schreibbedarf 84 40 

lUb. Porti 68 54 

IIIc. Inserate 102 60 

III d. Gehalt des Vereindieners 582 48 

nie. Feuerversicherung (1897/1902) .... 825 — 

IV. Oberzahlung zum Hauskonto 2492 20 

V. Jahresbericht und Drucksachen .... 1 50 

Via. Zuschufs zur anthropologischen Sektion 200 — 

VIb. * » botanischen Sektion . . • 100 — 

VIc. » . » geographischen Sektion . 50 — 

VId. * * histor.-bakteriol. Sektion. — — 

VIe.' » » chemischen Sektion ... 100 — 

VII a. Fond Wr das 100jährige Jubiläum . . 100 — 

VUb. Abzahlung der Hypothek ...... 200 — 

Vm. Reservefond 188 28 

Summa . . 5446 66 

▲ bscblass: yik ^ 

Summa der Einnahmen . . 5795 52 

Summa der Ausgaben . . 5446 66 

Eassabestand a. Bar . 848 86 

b. 2 Sparkassabücher mit . . 1018 85 wovon 

zum Fond fllr das 100jährige Jubiläum A 400.— bestimmt sind. 



Digitized by VjOOQ IC 



40 

b. Ober die Verwattunglkatia. 

EinBabmeM: M ^ 

Extrabeiiräge der Mitglieder zur Abzahlung au der 

Hypothek 125 - 

Miets-Erträgnisse 2192 20 

Erlös für verkauftes Holz 14 — 

Für verkaufte Gasuhr 10 — 

Erlös für Biergläser 8 50 

Eintrittsgelder in das Museum 3 20 

Beitrag zur Strassenreinigung von Frl. Winter . . 5 — 

Oberzahlung aus der Gesellschaftskassa 2492 20 

Summa . . 4850 10 

AvsgabeM: Ji 4 

Abzahlung an der Hypothek 200 — 

Reperaturen und Bauarbeiten 1871 86 

Steuern, Wasserzinsö und Holzpfandgeld 422 Ol 

Hypothek-Zinsen 2008 17 

Ökonomie und Regie 848 56 

Summa . . 4850 10 

Absoblvss: Ji ^ 

Summa der Einnahmen . . . 4850 10 
Summa der Ausgaben . . . 4850 10 



Für Richtigkeit: 
Nttmberg, den 18. Januar 1898. BeroJi. Lang. 

Die Richtigkeit vorstehender Aufstellung und die Über- 
einstimmung mit den vorliegenden Belegen bestätigen 

Ntrnberg, den 18. Januar 1898. 

J. Kreutzer, Robert Voit, August Ertheiler. 



, Digitized by VjOOQIC 



41 



VI. Mitgliederverzeichnis. 

(Stand vom 31. Dezember 1897.) 
YontaadMluift: 

DirMor: Herr Dr. phil. August Heerwagen, k. Gymn.-Prof. 

/. Sekretär: Herr Wilhelm Rudel, k. Pfarrer. 

IL Mretär: Herr Dr. phil. Karl Hartwig, k. Gymn.-Prof. 
ni, Sekretär: Herr Dr. Alexander Frankenbureer, prakt. Arzt. 

BibUo(hekar: Herr Konrad Hörmann, Lithograph. 

Oontervator: Herr Aug. Schwarz, k. Stabsveterinär im I. Chev.-Rgt. 
Sekatsmeiiier: Herr Beruh. Lang, Kaufmann u. k. schwed. Konsul. 
A dm m t krator: Herr Hans Sebald, Buchdruckereibesitzer. 
BmUeekniker: Herr Emil Hecht, Architekt und Gemeindebevoil- 
mächtigter. 

1) für die anatomische Sammlung: Herr Dr. Frankenburger; 

2) » > anthropologische Sammlung: Herr Wunder; 

3) > » botanische Sammlung und zwar: 

a. för das allgemeine Herbar: Herr Fr. Schultheifs; 

b. > > Ki^rptogamen-Herbar : Herr Kaulfufs; 
c » » Nürnberger Herbar: Herr Schwarz; 

d. » > bayerische Landesherbar: Herr W. Rudel; 

4) Ar die chemische Sammlung und zwar: 

a. fOr die anorganisch-chemische: Herr Dr. Metzger; 

b. » > organisch-chemische: Herr Wunder; 

5) ftr die ethnographische Sammlung: Herr Dr. Heerwagen; 



6) 
7) 
8) 
9) 
10) 

12) 



mikroskopische Sammlung: Herr Dr. Goldschmidt; 

> lokal-geognostische Sammlung: Herr Schwarz; 

» mineralogische Sammlung: Herr Dr. Zwanziger; 

» paläontologische Sammlung: Herr Spandel; 

» physikalische Sammlung: \ „^^ p., » •«o;««. 
r^/u«^i^«*:.^u^ c« »,»,f ..!!». i Herr Dr. Lessmg; 

> technologische Sammlung: f *' 

> zoologische Sammlung, und zwar: 

a. für Säugetiere und Vögel: Herr Dr. Heerwagen; 

b. > Reptilien, Amphibien und Fische: Herr Kinkelin; 

c. » Weichtiere und Conchylien: Herr Knapp; 

d. > Insekten: Herr Manger; 

e. » Arachniden und Myriapoden: Herr Dr. Koch sen.; 

f. > Crustaceen uud niedere Tiere: Herr Kinkelin. 



A. Ehrenmitglieder. 

St. Kßl. Hoheit Dr. Carl Theodor, Herzog in Bayern. 
Herr Agassis, Alexander, Professor in Cambridge. 

> Arnold, Fr., k. Oberlandesgerichtsrat in München. 

> Ballhorn, Hermann, Buchhändler in Würzburg. 

> Dr. Blasius, R., Professor in Braunschweig. 

> Dr. Büchner, Ludwig, prakt. Arzt in Darmstadt. 

> Castellanos, B. S., Direktor der k. archäologischen Academie 

in Madrid. 
» Doval-Jouve,!., Ancien Inspecteur de 1' Academie de Montpellier. 

> Dr. Flügel, Fdix, Privatgelehrter in Leipzig. 



Digitized by VjOOQIC 



48 

Herr Dr. von G um bei, Wilhelm, k. Oberbergamts-Direktor und Uni- 
versitätsprofessor in München. 

> Dr. Günther, Sigmund, k. Professor an der techn. Hochschule 

in München. 
» Dr. V. Hauer, Ritter, Franz, k. Hofrat in Wien. 
» Dr. V. Koch , Gottlieb, Direktor des zoolog. Instituts in Darmstadt. 

> Dr. Koch, Ludwig, sen., prakt. Arzt in Nürnberg. 

> L ambrecht, Fr., k. holl. Hauptmann in Hanno verisch-Münden. 
» Lotter, M., Waisenhausvater in Nürnberg. 

» Dr. Müller, Karl, Privatgelehrter in Halle a. d. S. 

» Dr. V. Pettenkofer, M., k. Geheimer Obermedizinalrat in 

München. 

» Philippi, R. A., Professor a. d. Academie in Santjago in Chile. 

» Dr. Ranke, Johannes, k. Professor in München. 

> Dr. Selenka, Emil, Profestor hon. an der Universität München. 

> Dr. Suringar, W. F. R., Professor und Direktor des botanischen 

Gartens in Leyden. 
» Dr. Virchow, R., k. Geheimer Rat und Universitäts-Professor 
in Berlin. 



B. Ordentliche MltgUeder. 



1) Herr Adolf, Georg, Kaufmann. 



?! 



8^ 
9* 
lO) 
11 
12' 
13 
14 
16 
16 
17 
18' 
19; 
20 
21 

22 
23 
24' 
25 
26 



Aischberg, Joseph, Hopfenhändler. 



iberg, 
Ammon, Gottfried, Kaufmann. 
Ammerbacher, Max, k. Postexpeditor in Fürth. 
Bach, Leo, Kaufmann. 
Bach, Siegfried, Fabrikbesitzer. 
Bäum 1er, Joh. Konrad, Kaufmann. 
Dr. Barabo, Adam, prakt. Arzt. 
B arbeck, Hugo, Buchhändler und Magistratsrat. 
Barth, Johannes, Kaufmann in Weigelshof. 
Barthell, Georg, Hopfenhändler. 
Dr. Bauer, Friedrich, prakt. Arzt. 
Dr. Bauer, Karl, Assistent. 
Baur, Joseph, Anton, Ingenieur. 
Dr. Baumüller, Bernhard, pr. Arzt. 
Bauriedel, Paul, Kunstmühlbesitzer. 
Beckh, August, Apotheker. 
Dr. Beckh, August, prakt. Arzt. 
Beckh, Edwin, Fabrikbesitzer und Kommer zienrat. 
Beckh, Georg, Fabrikbesitzer. 
Dr. Beckh, Wilhelm, Oberarzt am städt. Krankenhaus u. 

k. Hofrat. 
Berlin, Max, k. Landgerichtsrat. 
Dr. Bernett, Wilhelm, prakt. Arzt. 
Bernhold, Albert, Kaufmann. 
Bernstiel, Karl, Kaufmann. 
Dr. Berthold, Eugen, prakt. Arzt. 
27^ Bibliothek, Königliche, in Berlin. 

28) Herr Bing, Adolf, Kaufmann. 

29) > Bing, Berthold, Kaufmann. 

30) » Bing, Heinrich, Kaufmann. 

31) » Bing, Hermann, Kaufmann. 

32) » Bing, Ignaz, Grofshändler und Kommerzienrat. 



Digitized by VjOOQ IC 



4S 



33) Herr Bing, Oskar, Kaufmann. 



S 

37) 
38) 
39) 
40) 
41) 
42) 
43) 
44) 
45) 
46) 
47) 
48) 
49) 
50) 
51) 
52) 
53) 
54) 
55) 
56) 
57) 
58) 
69) 
60) 
61| 
62) 
63) 
64) 
65) 
66) 
67) 
68) 
69) 
70) 
71) 
72) 
73) 
74) 
75) 
76) 
77) 
78) 
79) 
80) 
81) 
82) 
83) 
84) 
85) 
86) 
87) 
88) 



Birkmann, Michael, Zimmermeister. 

Birkner, Rudolf, Bankier und Konsul der chil. Republik. 

Bloch, Samuel, Bankier. 

Bock, Georg, Zahnarzt. 

Bodky, Julius, k. Reallehrer. 

Boeck, Karl, Fabrikdirektor. 

Dr. Böhm, Gottfried, Assistent am bayr. Gewerbemuseum. 

Braun, Jean, Buchhändler. 

Bromig, Hans, Kaufmann. 

Brunn er, Martin, Kaufmann. 

Brust, Max, Kaufinann. 

Dr. Buchner, Wilhelm, prakt. Arzt. 

Bücking, Johannes, Privatier. * 

Bürger, Leonhard, Architekt. 

Buz, Franz, k. Major und Regiments-Conmiandeur. 

Cammerer, Fritz, k. Oberförster in Eibach. 

Carette, Georges, Kaufmann. 

Cnopf, Karl, B^ikier. 

Dr. Cnopf, Rudolf, prakt. Arzt. 

Conradty, C, Fabrikbesitzer. 

Crämer, Friedrich, Prokurist. 

Crailsheimer, Hugo, Kaufmann. « 

C ramer, Fritz, Buchhändler in Würzburg. 

C ramer. Paul, Kaufmann. 

Dr. Deuerlein, Georg, prakt. Arzt. 

Dietrich, Theodor, k. Postoffizial in Schweinau. 

Dietz, Georg, Grofshändler. 

Diez, Gregor, Maurer- und Tünchermeister. 

Dormitzer, Louis, Kaufmann. 

Dr. Dürr, Felix, Reallehrer. 

Dürr, Konrad, k. Professor. 

Dr. Eberle, Joh. Fr., k. Gymnasiallehrer. 

Eckart, Ernst, Apothekenbesitzer und Magistratsrat. 

Dr. Eckart, Karl, Apotheker. 

Eckert, Hermann, Kaufmann in Heidelberg. 

Ehrenbacher, Sigmund, Hopfenhändler. 

Eisenbach, Georg, Kaufmann. 

Dr. Elliesen, Paul, Privatier. 

Dr. Emmerich, Max, prakt. Arzt. 

Engelhardt, Adolf, k. Pfarrer. 

En giert, Hans, Kaufmann. 

Enslin, Heinrich, Kaufmann. 

Dr. Epstein, Ernst, prakt. Arzt. 

Erdet, Friedrich, Lehrer in Mögeldorf. 

Erdmann, Friedrich, Bankier. 

Erhard, Ludwig, Ingenieur. 

Erhard, Theodor, Apothekenbesitzer. 

Erlenbach, Max, Kaufmann. 

Ertheiler, Anton, Kaufmann. 

Ertheiler, August, Kaufmann. 

Etz, Friedrich, Kauünann. 

Eyfser, Georg, Kaufmann und Fabrikbesitzer. 

Fischer, Karl, Privatlehrcr. 

Fleischmann, Chemiker in Doos. 

Förde rreuther, Gustav, k. Hauptmann a. D. 

Digitized by VjOOQ IC 



44 



137) 
138) 
139) 
140) 
141) 
142) 
143) 



Forch heimer, H. S., Kaufmann. 

Dr. V. Förster, Sigm., prakt. Arit. 

Dr. Frankenburger, Alex, prakt. Arzt. 

Frankenburger, Max, Fabnkbesitzer. 

Frauen feld, Emil, Kaufmann. 

Frauen feld, Karl, Kaufmann. 

Frauen feld, Moritz, Kaufmann. 

Frauenknecht, k. Notar u. Justizrat. 

V. Frays, Freiherr, Philipp, Fabrikbesitzer. 

Friedrich, Johann, k. Reallehrer a. D. 

Dr. Fuchs, Wilhelm, prakt. Arzt. 

Fuchs, Hans, Kaufmann. 

Füchtbauer,' Gg., k. Rektor u. Oberstudienrat. 

Funk, Stephan, Kaufmann. 

G allinger, Jakob, Kaufmann und Kommerzienrat. 

Gareis, Wilhelm, k. Regierungsrat und Bezirksamtmann. 

Gebhardt, Heinrich, Fabrikbesitzer. 

Gebhardt, Ludwig, Kaufmann und Kommerzienrat. 

Gebhardt, Wilhelm, Kaufmann. 

Geifsler, Gustav, prakt. Zahnarzt. 

Gerngros, Ludwig, Kaufmann und Kommerzienrat. 

Gerngrofs, Wilhelm, Kaufmann. 

Dr. Guilini, Ferdinand, prakt. Arzt. 

Giulini, Georg, Privatier. 

Glafey, Gottl., Fabrikbesitzer und Handelsrichter. 

Dr. Glanz, Adam, prakt. Arzt. 

Göbel, Otto, k. Veterinärarzt IL Kl. 

Göschel, Ludwig, Privatier. 

Dr. Goldschmidt, Ferdinand, pr. Arzt. 

Gombrich, M., Instituts-Direktor. 

Gonnermann, Karl, Fabrikbesitzer und Kommerzienrat. 

Dr. Gramming, Rechtsanwalt. 

Grein er, Gustav, Kaufmann. 

Dr. Grether, Fritz, Apotheker. 

Griefsbach, Otto, Kaufmann. 

Grofs, Ludwig, k. Gymnasiallehrer. 

V. Grundherr, Benno, Kaufmann und k. niederl. Konsul. 

Gütermann, Wilhelm, Kaufmann. 

Guldmann, Arthur, Kaufmann. 

Gut mann, Gustav, Bankier. 

Haas, Eduard, Fabrikbesitzer und Kommerzienrat. 

Haas, Karl, Bankier. 

Dr. Hanau, Max, Zahnarzt 

Dr. Hartwig, Karl, k. Gymnasialprofessor. 

Hauser, Joh. Friedrich, uigenieur. 

Haymann, Julius, Direktor des städt. Gaswerks. 

Hecht, Emil, Architekt, Ingenieur und Gemeindebcvoll- 

mächtigter. 
Heerdegen, Albrecht, Kaufmann u. Armenpflegschaftsrat. 
Dr. Heerwagen, August, k. Gym'nasialprofessor. 
Heilin g, Cluistian, Kaufmann. 
Heim, Hermann, Kanfmann. 
Heim, Karl, Kaufmann. 
Held, Hermann, k. G3rmna8iallehrer. 
Heller, Friedrich, Fabrikbesitzer. 



Digitized by VjOOQIC 



45 



144) Herr Heller, Louis, Kaufmann. 

146) 

146) 

147) 

148) 

149) 

150) 

151) 

152) 

153) 

154) 

155) 

156) 

157) 

158) 

159) 

160) 

161) 

162) 

163) 

164) 

165) 

166) 

167) 

168) 



169) 
170) 
171) 
172) 
173) 
174) 
175) 
176) 
177) 
178) 
179) 
180) 
181) 
182) 
183) 

184) 
185) 
186) 
187) 
188) 
189) 
190) 
191) 
192) 
193) 
194) 
195) 
1%) 
197) 



Hellmuth, Joseph, Rechtsanwalt. 

Hellmuth, Karl, städt. Bezirkstierarst. 

Hellmuth, Sigmund, Fabrikbesitxer in Buch. 

Hering, August, Ingenieur. 

Hermann, Georg, Bezirkstierarzt in München-Schwabing. 

Hertel, Friedrich, Kaufmann. 

Dr. Hefa, Hans, k. Reallehrer. 

Hesselberger, David, Kaufinann. 

Heydolph, Georg, Buchdruckereibesitzer. 

Heydolph, Hans, Rechtsanwalt. 

Hilpert, August, Fabrikbesitzer. 

Hilpert, Christ., Fabrikbesitzer. 

Dr. Hirsch, Jakob, Chemiker in Fürth. 

Dr. V. Hörmann, Fabrikdirektor. 

Hörmann, Konrad, Lithograph. 

Dr. Hofmann, Hans, Assistent am bayr. Gewerbemuseum. 

Dr. Hof mann, Moritz, kgl. Landgerichtsarzt. 

Hoffmann, Paul, k. Rittmeister und Brigadeadjutant. 

Hohlweg, Eduard, Fabrikdirektor. 

Hopf, Eduard, Kaufmann. 

Hopf, Emil, Kaufmann. 

Hopf, Hans, Kaufmann. 

Huber, Friedrich, Kaufinann. 

Humbser, H., Bierbrauereibesitzer und Kommerzienrat 

in Fürth. 
Hussong, Ludwig, Apotheker in Kauf heuern. 
Jung, Heinrich, Kaufmann. 

tungmann, Heinrich, Privatier, 
^r. Kämmerer, Hermann, k. Professor an der Industrieschule. 
Kann, Paul, k. Telegrapheningenieur. 
Kann, Samuel, Privatier. 
Kantenseder, Johann, Schreinermeister. 
K a u 1 f u f s , Johann, städt. Trichinenschauer. 
Kempe, KTarl, Fabrikbesitzer. 

Kiefer, Andreas, k. Hauptmann und Kompagniechef 
Dr. Kiefer, Karl, prakt. Arzt. 
Kinkel in, Adolf, Apothekenverwalter. 
Dr. Kirste, Wilhelm, prakt. Arzt. 
Klein, Benedikt, Kaufmann. 
Knapp, Friedrich, Kaufmann, Magistratsrat und k. span. 

Konsul. 
Dr. Koch, Heinrich, prakt. Arzt. 
Dr. Koch, Kari, prakt. Arzt. 
Kohn, Emil, Kaubnann. 
Kohn, Ernst, Kaufmann. 
Kohn, Georg. Bankier. 
Kohn, Max, Kommerzienrat und Bankier. 
Krakenberger, Leopold, Kaufmann. 
Krakenberger, Max, Kaufmann. 
Kraussold, Max, k. Pfarrer und Senior. 
K r e 1 1 , Otto, Fabrikdirektor und Gemeindebevollmächtigter. 
Krell, Otto, iun., Ingenieur. 
Krell, Rudolf, Ingenieur. 
Krefs, Johann, Grofsfleischer. 
Kreutzer, Ludwig, Fabrikbesitzer. 

^ Digitized by VjOOQ IC 



46 



198) Herr Kristfeld, Jean, Uhrmacher. 

199) > Kromwell, Karl, Kauftnaiui. 

200) > Kugler, Sal, BaJnkier. 

201) > Kuhlo, Richard, Fabrikdirektor. 

202) > Lambrecht, Hermann, Fabrikbesitzer. 

203) » Dr. Land mann, Joseph, Rechtsanwalt. 

204) » Dr. Landsberg, Ludwig, Fabrikbesitzer in Doos. 

205) > Lang, Bernhard, Kaufmann und k. schwed. Konsul. 

206) > Lang, Ignaz, Kaufmann. 

207) > Lang, Leopold, Kaufmann. 

208) » Langermann, Moritz, Kaufmann. 

209) » Lauer, Jean, Fabrikbesitzer. 

210) > Lauinger, Leopold, Kaufmann. 

211) » Lehnert, Wilhelm, Apotheker. 

212) > Leidig, Georg Friedrich, Optiker und k. Hoflieferant. 

213) » Lenz, Ernst, Erzgiefser. 

214) > Dr. Lessing, Albert, Fabrikbesitzer. 
216) » Leuchs, Georg, Kaufmann und Chemiker. 

216) » Dr. Leuchs, Karl. Chemiker. 

217) » Lex, Hans, Apotheker. 

218) » Leykauf, Georg, k. Hofstahl Warenfabrikant. 

219) » Dr. Limpert, L., prakt. Arzt und Zahnarzt. 

220) » Lindinger, Leonh., stud. rer. nat. 

221) » Lindmann, Jakob, Direktor des Gaswerks in Fürth. 

222) > Lindner, Heinrich, Kaufmann. 

223) > Lösch, Fritz, k. Postoffizial. 

224) » Dr. Löwi, Rudolf, Notariatskonzipicnt. 

225) » Lucas, Albert, k. Bankcommis. 

226) > Dr. Maas, Markus, prakt. Arzt. 

227) » Mandel, Karl, Kaufmann. 

228) » Manger, Kari, k. Reallehrer. 

229) » Mar Her, Julius, Kaufmann und II. Vorstand des Gcmeindcr 
Kollegiums. 

Martin, Eugen, Rechtsanwalt. 
Marx, Georg, Ober-Ingenieur. 
Dr. Mayer, M. L., prakt. Arzt. 
Mayer-Dinkel, Albert, Kaufmann. 
Dr. Mehler, Heinrich, prakt. Arzt in Georgsgmünd. 
Meiser, Franz, Ingenieur. 

Dr. Merkel, Gottlieb, k. Medizinalrat und Krankenhaus- 
direktor. 
Dr. Merkel, Wilhelm, prakt. Arzt. 
Merzbacher, Joseph, Kaufmann. 
Mesthaler, Joh., Fabrikbesitzer und Kommerzienrat. 
Metzger, Ludwig, Kaufmann und Kommerzienrat. 
Dr. Metzger, Sigmund, Fabrikbesitzer. 
Michahelles, Georg, k. Hauptmann und Kompagniechef. 
Dr. Mohr, Gustav, prakt. Arzt. 

Dr. Morgenstern, Friedrich, Fabrikbesitzer in Fürth. 
Müller, Jean, Kaufmann. 
Dr. Müller, Wilhelm, prakt. Arzt. 
Dr. Münz, Pinkus, prakt. Arzt. 
Münzinger, August, Kaufmann. 
Munker, Georg, k. Professor a. D. 
Münz er, Julius, Kaufmann. 
Narr, Adolf, Privatier. 

Digitized by VjOOQ IC 



^7 

252^ Herr Naue, Otto» Kaufmann. 

253) > Dr. Neuberger, Jos., prakt. Arzt 

Dr. Neubur.ger, S., Augenarzt. 

Dr. Neukirch» Richard, Oberarzt am städt. Krankenhaus. 

Neumeyer, Hans, Kaufmann. 

Neumüller, Konrad, Schreinermeister. 

Nister, £., Kunstanstaltsbesitzer. 

Nowack, Lorenz, Fabrikdirektor. 

Offenbacher, Joseph, Kaufmann. 

Omeis, Gottlieb, k. Notar und Justizrat. 

Dr. Oppler, Theodor, Chemiker. 

Ottenstein, Albert, Kaufmann. 

Ottenstein, Justin, Kaufmann. 

Ottenstein, Max, Kaufman und Fabrikbesitzer. 

Paalzow, Richard, Kaufmann. 

Pabst, Friedrich, Fabrikbesitzer. 

Pabst, Julius, Fabrikbesitzer. 

Palm, Ludwig, Metallgielsereibesitzer. 

Dr. Pauschinger, Leonhard, prakt. Arzt. 

Dr. Per et z, E., prakt. Zahnarzt. 

Peters, Hermann, Apotheker. 

Pfahler, Christian, Zahntechniker. 

Pfeiffer, Julius, Sprachlehrer. 

Pilhofer, Joh., k. Bahnexpeditor. 

Dr. Pöschel, Gustav, k. Bezirksarzt in Neustadt a. A. 



254 

255] 

256 

257 

258 

259 

260^ 

261 

262 

263 

264 

265 

266 

267 

268 

269] 

210] 

271 

272^ 

273^ 

274] 

275 

276' 

277 

278) 

279) 

280) 

281) 

282 

283] 

284^ 

285 

286^ 

287) 

288) 

289) 

290) 

291) 

292) 
293) 
294) 
295) 
2%) 
297) 
298) 
299) 
300) 
301) 
302) 
303) 
304) 
305) 
306) 



Popp, Adolf, Kaufmann. 
Preifs, Konrad Philipp, Mechaniker. 
Prell, August, k. Ober-Bankbuchhalter. 
Pretzfelder, Julius, Kaufmann. 
Dr. Prior, Eugen, Direktor. 
V. Puscher, Wilh., Privatier und Kommerzienrat. 
Putzin, Ludwig, Fabrikbesitzer. 
Raab, Karl, FaS)rikbesitzer und Magistratsrat. 
Ratz, Heinrich, Apotheker. 
Rau, S. E., Kaufmann. 
Dr. Raum, Fabrikbesitzer. 

Rehlen, Wilhelm, Fabrikbesitzer und Magistratsrat. 
Reif, Jean, Brauereibesitzer. 

Reif, Zacharias, Kommerzienrat und Brauereibesitzer. 
Dr. Reitzenstein, Fritz, Assistent am ehem. Universitäts- 
Laboratorium in Würzburg. 
Reitzenstein, Hugo, Kaufmann. 
Rettelbusch, Ernst, Architekt. 
Rh au, Georg, Kaufmann und Fabrikbesitzer. 
Dr. Riedel, Heinrich, Apothekenbesitzer. 
Dr. Riegel, Wilhelm, prakt. Arzt. 

Rieppel, A., Direktor der Maschinenbauaktiengesellschaft. 
Rockstroh, Gustav, Kaufmann. 
Rodler, Karl, Apotheker. 

Rogner, Konrad, Direktor des städt. Schlachthofes. 
R ohmer, Assistent an der Kreisrealschule. 
Rohn, Severin, Chemiker in Buch. 
Dr. Rosen fei d, L., prakt. Arzt. 
Rosenfeld, Sigmund. Kaufmann. 
Rotter, Johann, Gürtlermeister. 
Radel, Georg, k. Oberst und Bezirkskommandeur. 



Digitized by VjOOQ IC 



48 



307) Herr Rüdcl, Wilhelm, k. Pfarrer. 

308) » Rupprecht, Friedrich, Privatier. 

309) * Dr. Rupprecht, Geore, prakt. Ar^t. 

310) » Rupprecht, Wilhelm, Kaufmann. 

311) » Sachs, Karl, Kaufmann. 

312) » Sachs,* Wilhelm, Kaufmann. 

313) » Sandner,jFriedr., stud. rer. nat. 

314) » Schäfer, Jakob, k. Bezirkshauptlehrer in Fürth. 

315) > Schaff, Leonhard, Kaufmann. 

316) » Schafft, Emil, Charkutier. 

317) » Schedel von Greifenstein, Karl, Apotheker in Schweinau. 

318) > Dr. Scheidemandel, Heinrich, prakt. Arzt. 

319) » Scheuermann, Ferdinand, Privatier. 

320) > Schilffahrt, Karl, st&dt. Sanitätstierarzt. 

321) » Schilling, Theodor, Grofshändler und ital. Konsul. 

322) » Schlatter, k. Oberstiieutenant. 

323) > Sehe gel, Hans, städt. Inspektor. 

324) > Schlegel, Hermann, Apotheker. 

325) » Schmidmer, Chr., Fabrikbesitzer und Kommerzienrat. 

326) > Dr. Schmidmer, £., Chemiker. 

327) » Schmidt, August, k. Postmeister. 

328) » Schmidt, Eduard, Bezirkstierarzt. 

329) > Schmidt, Rudolf, Optiker. 

330) » Schnebel, Ignaz, Kaufmann. 

331) » Schönner, Georg, jun., Reifszeugfabrikant. 

332) » Scholler, Friedrich, Hauptagent. 

333) > Schrap, Karl, Hofbuchhändler. 

334) » Schreiber, Jean, Vergolder und Fabrikant. 

335) » Dr. Schrenk, Friedrich, prakt. Arzt. 

336) » Schröder, Christiaif, Optiker. 

337) > Schröder, Theodor, k. Gymnasialprofessor. 

338) » Dr. Schubert, Paul, prakt. Arzt. 

339) » Dr. v. Schuh, Georg, I. Bürgermeister der Stadt Nürnberg. 

340) » Schuh, Heinrich. Fabrikbesitzer. 

341) > Schuh, Wilhelm, Apotheker. 

342) » Schultheifs, Friedrich, Apotheker. 

343) > Schultheifs, Veit, städt. Trichinenschauer. 

344) > Schultheifs, Oskar, Rechtspraktikant. 

345) » Schwanhäuser. Gustav, Fabrikbesitzer u. Kommerzienrat. 
846) » Dr. Schwanhäuser, Chemiker. 

347) » Schwarz, August, k. Stabsveterinär. 

348) > Schwarztrauber, Jobs., Veterinär, I. Klasse. 

349) > Schwemmer, Christian, rechtsk. Magistratsrat. 

350) > Sebald, Hans, Buchdruckereibesitzer. 

351) » Sebald, Kalkwerkbesitzer. 

352) > Seiler, Christoph, Ingenieur und Fabrikbesitzer. 

353) > Dr. Seiler, Hermann, prakt. Arzt. 

354) > Seitz, Georg, Fabrikbesitzer und Kommerzienrat. 

355) > Sichling, Richard, Kaufmann. 

356) » Dr. Siebenhaar, Johann, prakt. Arzt in Gräfenberg. 

357) > Silb ermann, Julius, Kaufmann. 

358) » Simon, Johannes, Lehrer. 

359) » Dr. Simon, Max, prakt. Arzt. 

360) > Solger, Friedrich, Kaufmann. 

361) » Sommer, Theodor, Assistent am Gewerbemuseum. 

362) > Spandel, Erich, Buchdruckereibesitzer. 

Digitized by VjOOQ IC 



49 



374) 
375) 
376) 

377) 
378) 
379) 
380) 
381) 
382) 
383) 
384) 
385) 
386) 
387) 
388) 
389) 
390) 
391) 
392) 
393) 
394) 
395) 
396) 
397) 
398) 
399) 
400) 
401) 
402) 
403) 
404) 
405) 
406) 
407) 
^ 408) 
409) 
410) 
411) 
412) 
413) 
414) 
415) 
416) 
417) 



Stadler, Friedrich, Zahntechniker. 
Stahl, Joh. Christ., Katifmann. 
Staudt, Erdmann, Kaufinann. 
Dr. Stein, Oskar, prakt. Arxt. 
Dr. Steinhard, Ignaz, prakt. Arzt. 
Dr. Steinheimer, Ludwig« prakt. Arzt. 
Dr. Stich, Eduard, k. Hofrat und Oberarzt. 
Dr. Stockmeier, Hans, Vorstand am bavr . Gewerbemuseum. 
St Öhr, August, Sekretär a. polyt. Zentrafverein in Würzburg. 
Dr. Straub, Adolf, Assistent an der städt. Untersuchungs- 
anstalt. 
Dr. Straufs, Julius, Oberlehrer an der städt. Handelsschule. 
Straufs, Louis, Kaufmann. 
St raus, Simon, Kaufmann. 
Strand, Willv, Kaufmann. 
Dr. Sturm, jakob, prakt. Arzt in Mögeldorf. 
Süfs, Clemens, Apotheker. 
Tafel, Hermann, Fabrikbesitzer in St. Jobst. 
Tauber, Christ., Baumeister. 
Thurnauer, Bernhard, Fabrikbesitzer. 
Tölke, Konrad, Kunstgärtner u. Gemeindebevollmächtigter. 
Tuchmann, Franz, Kaufmann. 
Tuchmann, Friedrich, Kaufinann. 

Tuchmann, Max Joseph, Kaufmann. « 

Uhl, Adolf, Kaufmann. 
Ulmer, Julius, Bankier. 

Dr. Ulrich, August, Inspektor der höh. Töchterschule. 
Völker, Georg, Kaufinann. 
Vogel, Bernhard, Privatier in Mögeldorf. 
Voigt, Gustav, Kaufmann. 
Voit, Paul, Kaufmann. 
Voit, Robert, Kaufmann. 
Voit, Rudolf, Schneidermeister. 
Vollhard, Oskar, k. Advokat und Justizrat. 
Vollrath, Franz, Kaufmann. 

Dr. Wagner, Friedrich, k. Professor in Lichtenhof 
Waydelin, W. Fr., Kaufmann. 
Weigel, Kari, prakt. Arzt in Berlin. 

Weigle, Theodor, Apotheker u. Gemeindehe voUmächtigter. 
Weil, Philipp, Kaufmann. 
Weinberger, Max, Fabrikant. 

Dr. Weinhart, Paul, Assistent an der Industrieschule. 
Weinschenk, Hermann, Kaufmann. 
Weifs, August, Apotheker und Magistratsrat. 
Weifs, Robert, Kaufmann in Chemnitz. 
Dr. Welzel, Karl, prakt. Arzt. 
Wenk, Richard, Buchhändler. 
Wertheimer, Sigmund, Kaufmann. 
Dr. Wiegmann, Assistent. 
Wieland, Peter, Privatier. 
Wieseler, Wilhelm, Kaufmann. 
Wölfel, Konrad, Metzgermeister. 
Wolf, Mathias, k. Postmeister. 
Wolf, W.. Apotheker. 
Wunder, Justin, Fabrikdirektor. ^ , 

Digitized by|^OOQlC 



so 

418) Herr Dr. Zagelmeier, Hans, Tierarzt. 

419) » Zeltner, Johannes, Fabrikbesitzer. 

420) » Zeltner, Johannes, jun., Kaufmann. 

421) » V. Zenetti, Julius, Ritter, Excellenz, königl. Regierungs- 

präsident a. D. 

422) > Zippelius, August, Kaufmann. 

423) » Dr. Zwanziger, Georg, k. Reallehrer. 



C. Korrespondierende Mitglieder. 

Herr Dr. Ascherson, Paul, k. Professor an der Universität Berlin. 
> Dr. Biehringer, Joachim, Privatdozent am Polytechnikum zu 
Braunschweig. 

Dr. Böttger, Oskar, Professor in Frankfurt a. M. 

Dr. Braun, Heinrich, Naturforscher und Gemeinderat in Wien. 

Dr. Buchenau, Franz, Professor in Bremen. 

Dr. Dieudonn^, Adolf, k. Stabsarzt in Würzburff. 

V. Docoupil, Wilhelm, Direktor der k. k. Fachschule in Hoftc. 

Dr. Fleischmann, Albert, Universitätsprofessor in Erlangen. 

Gebhart, Oskar, Kaufmann in Markt Redwitz. 

Goeringer, k. Oberst und Reg.-Komm. in Ingolstadt. 

Hall, J., Staatsgeolog in Jowa und Paläontolog für die Staaten 
New- York, Albany etc. 

Dr. V. Heldreich, Direktor des botan. Gartens und Direktions- 
mitglied des naturhistorischen Museums zu Athen. 

Dr. Herz, Fr. J., k. Konsulent ftlr Molkereiwesen in Memmingen. 

Dr. Holler, August, k. Bezirksarzt in Memmingen. 

Ho mann, Karl, Redakteur in Berlin. 

Hornung, Heinrich, k. Reallehrer in Ansbach. 

Le Jolis, Auguste, Direktor der Soci^t^ des sciences naturelles 
et mat^mathiques de Cherbourg. 

Dr. Issel, Arthur, Professor in Genua. 

Kleylein, Fabrikbesitzer in Gablonz. 

Dr. klunzinger, Benjamin, k. Professor in Stuttgart. 

Kränzle, Joseph, k.. Korps-Stabsveterinär a. D. in München. 

Krapfenbauer, Andreas, Apotheker in Manilla. 

Dr. Kratzmann, £., prakt. Arzt in Marienbad. 

Landauer, Robert, Apotheker in Würzburg. 

Mac CO, Eduard, Kapitän. 

Dr. Magnus, Paul, k. Professor an der Universität Berlin. 

Dr. Mehlis, Christian, k. Gymnasiallehrer in Neustadt a. H. 

Dr. Müller, W., ordentlicher Professor an der Universität Jena. 

Dr. Peters, Karl, Reichskommissar a. D. 

Dr. Rehm, H., k. Medizinalrat in Regensburg. 

Dr. Rein seh, Paul, Privatgelehrter in Erlangen. 

Tempsky, Fr., Buchhändler in Prag. 

Teufel, Gustav, Ingenieur in München. 

Weidner, Gutsbesitzer in Gerasmühle. 

Weigel, Friedrich, Kaufmann in Ansbach. 

Dr. Will, Privatgelehrter in Erlangen. 

V. W i f s m a n n , kais. Gouverneur a. D. 

Wo r lein. Gg., k. Zahlmeister a. D. in Nymphenburg. 



Digitized by VjOOQ IC 



81 

Vn. Jahresbericht der Sektion für Anthropologie, 
Ethnologie und Urgeschichte. 

Die Zahl der Mitglieder der anthropologischen Sektion im 
Jahre 1897 war 35. 

Die Sektion bedauerte, dafs Herr Dr. Scheidemandel 
die auf ihn gefallene Wahl zum Obmann der Sektion nicht 
annehmen zu können erklärte, und ernannte Chemiker Wunder 
zum Obmann, und da auch Herr Dr. Bernett gebeten hatte, 
ihn von seinen Pflichten als Schriftführer entbinden zu wollen, 
so wurde Herr Dr. von Forster ersucht, die Schriftführer- 
stelle zu versehen, die derselbe in provisorischer Weise über- 
nahm. 

Am ersten Montage jeden Monats wurden die Sektions- 
sitzungen abgehalten, und es wurde in den Sitzungen über 
folgendes verhandelt: 

Sitzung 1. Eine Anfrage des Herrn Stabsveterinär 
Schwarz nach dem Vorkommen von Gerealien in mittel- und 
oberfränkischen Grabfunden wird dahin beantwortet, dafs solche 
bei unseren Ausgrabungen noch nicht gefunden worden sind, 
und wird dem Torhaben zugestimmt, eine Sammelforschung 
über Funde von vorgeschichtlichen Gerealien zu veranstalten. 
Es wird eine briefliche Mitteilung des Herrn Meisenbach über 
2 vermutlich prähistorische Grabhügel im Buttendorfer Revier 
bei Ammerndorf verlesen und deren Besichtigung in Aussicht 
genommen. Herr Dr. Bernett bespricht den litterarischen 
Einlauf. Herr Dr. von Forster teilt mit, dafs im Somalilande 
Kies- und Quarzit-Steinwerkzeuge gefunden wurden, die mit 
denen der neolithischen Stationen Europas in Form und 
Technik übereinstimmen, als Beweis für die Einheit des Menschen- 
geschlechtes. Derselbe macht Mitteilung über mit Ocker über- 
malte Thierzeichnungen an den Wänden der Höhle von La 
Mouthe im Departement de la Dordogne. 

Sitzung 2. Herr Dr. B a u m ü 1 1 er spricht über die unter- 
schiede in der Schädelform bei den Menschen und höheren 
Affen unter Vorlagt vortrefflicher Abbildungen aus dem 
Bischoff*schen Werke. Herr Dr. B e r n e 1 1 legt den litterarischen 
Einlauf vor. 

Sitzung S. Besprechung der Mitteilung des Herrn Paul 
Craemer über unterirdische Gänge in Lind und an der Dooser 
Brücke, über 7S Trichtergruben am Linder Bück, übei: einen 

Digitizec^ LjOOQ IC 



52 

Grabbügel in der Erlacb bei Weinzierlein von 25 m Duroh- 
messer und IVt m Höhe und über die von J. Wunder mit 
Herrn Paul Graemer vorgenommene Besichtigung zweier 
Steinhügel zwischen Buttendorf und Fernabrünst. Die Be- 
sichtigung der Linder Gruben und der unterirdischen Gänge 
in Lind und bei Doos wird angeregt und soll dann über deren 
Erforschung weiter verfügt werden. 

Herr Dr. Bern ett hat bei Einhofen eine und bei Bebringers- 
dorf 12 Wolfsgruben aufgesucht, die Schürfung an denselben 
hat kein Resultat ergeben. Weitere Trichtergruben sind bei 
Osterdorf und am Nagelberg bei Treuchtlingen, zum Teil mit 
Schächten. Bei deren Schürfung wurde ein Feuersteinsplitter 
gefunden. Von Erhard wurden solche Gruben bei Hohenalt- 
heim entdeckt und Feuersteinsplitter und Knochenreste von 
Pferden darin gefunden. Eine künstliche HOhle mit 2 Gängen 
hat Herr Dr. Bernett bei Stadelhof gesehen, Funde fehlten. 
Nach Herrn Dr. Bernett haben Schürfungen bei Weinzierlein 
kein Resultat ergeben. 

Herr Dr. von Forst er legt den litterarischen Einlauf 
vor. Herr Dr. Bernett berichtet über die neue Methode von 
Boll, den Innenraum von Schädeln durch AusguTs einer in den 
Schädel eingeführten Eautschuckblase mit Wasser zu messen, 
ferner über ein Verfahren von Folgheraiter, aus der Bestimmung 
der magnetischen Inclination von Funden deren Alter zu 
entdecken. 

Der Naturhistorischen Gesellschaft wird für die Be- 
willigung der erbetenen 200 M. Dank ausgesprochen. 

Sitzung 4. Herr Dr. von Forster gibt einen kurzen 
Bericht über den Ranke'schen Vortrag über Zittel, Paläozoologie 
und Zittel, Grundzüge der Paläontologie. Herr Huber über- 
gibt die Zeichnung einer Herrn Pfund in Streitberg gehörigen 
Steinplatte mit Fufsspuren eines ausgestorbenen Vogels. 

In der Versammlung, zu welcher alle Spender eingeladen 
waren, welche zurAusrüstung der Ausstellung prähistorischer 
Funde aus Nordbayern und der Versammlung nordbayrischer 
Prähistoriker beigesteuert hatten, wurde über den Überschufs 
von 264.44 Jk Verfügung getroffen. 

Sitzung 5. Bericht J. Wunders über die Ausgrabung 
zweier Trichtergruben bei Lind. Die eine hatte 7 m Durch- 
messer und 1,8 m Tiefe, die andere 6 m Durchmesser und 1,7 m 

Digitized by VjOOQIC 



^58 

Tiefe, unter dem Laub kam eine 0,3 m dicke Schicht von 
Humusboden, darunter gelber Lehm mit unregelmärsig ein- 
gebetteten Sandsteinen von S — 5 % Gewicht. 0,1 m unter der 
Lehmoberfläche (0,4 m unter der Bodenoberfläche) kam in jeder 
Grube eine ziemlich dichte Holzkohlenschicht in OSO, in einer 
Grube 0,5 m von der Mitte und gegen die Mitte hin etwas ge- 
senkt, in der anderen Grube i m von der Mitte und gegen S 
hin etwas gesenkt, die Mitte war ohne Kohlen. Ärtefacte fanden 
sich nicht. Die Fortsetzung der Grabungen wird beschlossen, 
und zwar zunächst die einer ausgefällten Grube. 

Herr Kommerzienrat Bing hat bei Fortsetzung seiner 
Grabungen in der Brunnsteinhöhle 2,2 m tief im Diluvium ein 
Stück Kiefer mit Zähnen von Rhinoceros antiquitatls Blumen- 
bach, nach der Bestimmung des Herrn Dr. Blankenhorn, ge- 
funden und HeiT Huber zeigt den Fund vor. 

Sitzung 6. Bericht J. Wunders Ober die Ausgrabung 
einer ausgefüllten Gh*ube bei Lind. Die Ausfüllung bestand 
aus rotem und gelbem Lehm, untermischt mit Sandsteinen. In 
Vt— 1 m Tiefe fanden sich an allen Stellen Holzkohlenspuren, 
Brandschichten und vom Feuer gerötete Steine. In ifi m Tiefe 
kam ein Steinpflaster, bestehend aus einer gröfseren Sandstein- 
platte von den Mafsen 1,2/0,6/0,25 m, daran 2 kleinere, auch 
noch 0,7/0,45/0,15 m grofs, und kleineren Steinen. Unter dem 
Steinpflaster und um dasselbe herum war gewachsener Boden. 

Sitzung 7. J. Wunder berichtet über mit Herrn Paul 
Graemer angesehene kleinere Trichtergruben in einem Wäldchen 
bei der Schwadermühle bei Kadolzburg und über nordöstlich 
von Traunfeld angesehene Wolfsgruben von bis 20 m Durch- 
messer und SVi m Tiefe. 

Herr Dr. Baum ül 1er berichtet über mit J. Wunder 
unter Führung des Herrn Hauptlehrers Roth von Schambach 
gesehene Trichtergruben auf dem Nagelberg und bei Osterdorf, 
ein Reihengräberfeld bei Dettenheim, Grabhügel bei Schambach 
und bei Geislohe, eine prähistorische Strafse bei Schambach, 
eine Römerstrafse bei Osterdorf, Römerniederlassungen bei 
Weinbergshof und bei Schambach und eine Sternschanze auf 
dem Schlichtberge bei Dettenheim, Alles bei Treuchtlingen. 

Sitzung 8. Bericht J. Wunders über die Ausgrabung 
eines Grabhügels in der Breitenloh auf dem Weifsenbrunner 
Berge. Der Grabhügel von 14 m Durchmesser und 1 m Höhe 

Digitized by VjOOQIC 



S4 

enthielt wenige Scherben, darunter 2 mit tiefen Linienornamenten, 
viele stark verwitterte Menschenknochen von S Leichen, ein 
scheibenförmiges Bronzemesser (sogenanntes Rasiermesser), eine 
ornamentirte Bronzepincette, eine 33 cm lange Bronzenadel^ 
eine kleinere Bronzenadel, einen Bronze-Haarring, in unserer 
Sammlung die ersten Bronzezeitfunde aus einem Grabhügel. 
Es wird beschlossen, weitere Grabhügel dort abzugraben. 
Diskussion über die Bohrung von Steinwerkzeugen. Herr Dr. 
Baumüller berichtet über den litterarischen EinlauC 

Sitzung 9. Herr Eommerzienrat Bing hat Topfscherben 
am Eingange zur Brunnsteinböhle ausgegraben, die Herr Huber 
vorlegt. Berichte der Herren Dr. Baumüller und Dr. Bernett 
über den litterariscben Einlauf. 

Sitzung 10. Bericht J. Wunders über die Ausgrabung 
des Grabhügels auf dem Yogelherd auf dem Weifsenbrunner 
Berge. Der Hügel hatte 9 m Durchmesser und 0,7 m Hohe. 
3 m von der Mitte im Osten , 0,3 m tief fanden sich die stark 
verwitterten Knochen einer ausgestreckt liegenden Leiche, der 
Kopf südlich, die Füfse gegen Norden. An der Leiche lag ein 
Armring von Metall, das unter der Patina die Röte einer 
deutschen Kupfermünze hat, bei dem durch Grünspan grün 
gewordenen Armknochen. Bei der Leiche lag noch ein schön 
geschlagenes Feuersteinstückchen in Form einer Pfeilspitze. 
Viele andere Menschenknochen lagen so zerstreut, wie sie durch 
Wurzelgraben allein nicht werden konnten, darunter noch 3 
Feuersteinsplitter. 

Sitzung 11. Diskussion über bie bisherigen Ausgrabungen 
auf dem Weifsenbrunner Berge und Besprechung einer weiteren 
dort vorzunehmenden Ausgrabung. 

Sitzung 12. Bericht J. Wunders über die Ausgrabung 
eines Grabhügels und Schürfung einer Trichtergrube auf dem 
Weifsenbrunner Berg in der Balgeten. Ein kleiner länglicher 
Hügel von 4 auf 5 m Durchmesser und Vi m Höhe enthielt 
eine oben offene Steinkiste, sehr verwitterte Knochen und an 
der äufseren Seite der Steinkiste nördlich einen offenen Bronze- 
Armring mit Punkt- und Strichornamentik und in der Nähe 
2 kleine Bronze-Hohlringe (vielleicht Ohrringe). Ein grofser 
Hügel in der Nähe erwies sich bei vorgenommener Schürfung 
als zerfallener Kalkofen. Ein Hügel an der Trichtergrube 
enthielt nichts und besteht wohl aus den dem Trichter ent- 

Digitized by VjOOQIC 



56 

nommenen Steinbrocken. Der Trichter zeigte wieder wie alle 
bisherigen ScbOrfungen an Trichtergruben verschiedene starke 
Feuerspnren auf beiden Seiten eines den Trichter durchziehenden 
Walls in V« ^ und 0,7 m unter dem Boden. Der tiefste Teil 
des Trichters hatte bis in 1,2 m Tiefe und noch tiefer nur 
steinfireie Erde, während der Wall aus Erde und Steinen, also 
aufgefülltem Schutt besteht Die steinfreie Erde ist wohl durch 
Regen eingeschwemmt, wozu sehr lange Zeiträume gehören. 
Der gewachsene Boden ist fester Jurakalk. 

Herr Dr. Scheidemandel referiert über die XXVIII. 
allgemeine Yersammluog der deutschen anthropologischen Ge- 
sellschaft in Lübeck am 8. ÄUjgust 1897. 

Die bei den Ausgrabungen gemachten Funde wurden dem 
Naturhistorischen Museum Obergeben. 

Ein Oesellschaftsausflug an die Linder Gruben hatte zahl- 
reiche Beteiligung. 

In die Bibliothek wurden die auch schon bisher gehaltenen 
Zeitschriften, nämlich: 
Eorrespondenzblatt der deutschen Gesellschaft für Anthro- 
pologie, Ethnologie und Urgeschichte von J. Ranke, 
Naue, prähistorische Blätter, 
Limesblatt, 

Nachrichten über deutsche Alterthumsflinde, 
Beiträge zur Anthropologie und Urgeschichte Bayerns, 
Zentralblatt für Anthropologie, Ethnologie und Urgeschichte 
von Buschan, 
und folgende neue Werke einverleibt: 
Hoernes, Urgeschichte des Menschen, 
Eöstler, Handbuch der Gebiets- und Ortskunde des König- 
reichs Bayern, 
Much, Kupferzeit in Europa, 
Frhr. von Sacken, das Grabfeld von Hallstadt, 
Undset-Mesdorf, 1. Auftreten des Eisens in Nordeuropa, 
Schmeltz, ethnographische Musea in Midden-Europa, 
Das GaU'sche System der Schädellehre (Cranio8copie),Wandtafel, 
Robertson, Anthropometry (Saturday-Review), 
Renard, 19 Tafeln Kupferstiche, Menschenrassen, 
Das RGmercastell Biricianus. 
Von Tauschschriften: 
Ratzel, Anthropogeographie, 
Mehlis, der Drachenfels bei Dürkheim. 

Digitized by VjOOQ IC 



^Jl 

Die VermessungeD der Grabhügel und Eintragang in 
die Flurpläne wurden foriges'etzt. Es sind jetzt 144 Grab- 
hügel eingetragen, von denen 7S anscheinend intakt sind. Die 
Sektion hat bis jetzt 48 Grabhügel eröffnet. 

J. Wunder, Obmann. 



Vm. Jahresbericht der botanischen Sektion. 

Der Sektion, die am Beginn des Jahres 26 Mitglieder 
zählte, traten indessen Verlaufe die Herren Bürger, Heerwagen 
und Lindinger bei, so dafs sie am Schlüsse des Jahres 29 Mit- 
glieder umfafste. 

Die Vorstandschaft blieb dieselbe wie im Vorjahre. 

Die Sektion hielt folgende Zeitschriften: Uhlworm, Botan. 
Zentralblatt; Leimbach, Deutsche botanische Monatsschrift; 
Kneucker, Allgemeine botanische Zeitschrift; Wettstein, öster- 
reichische botanische Zeitschrift. Aufser diesen Schriften 
zirkulierten noch — von der Gesellschaft freundlich überlassen 
— folgende: Rosenthal, Biologisches Zentralblatt; Prometheus; 
Wiener Gartenzeitung. 

Folgende Werke wurden für die Bibliothek neu angeschafft: 
Potoniö, Lehrbuch der Pflanzenpalaeontologi« ; Ascherson, Fort- 
setzung der Synopsis. Geschenkt wurden von Herrn Dr. Herz 
in Memmingen: Schimper, Synopsis muscorum europaeorum; 
Focke, Synopsis ruborum Germaniae; Christ, die Rosen der 
Schweiz; von Herrn Dr. Wagner: Nr. 2 der Mitteilungen des 
Hopfenbau Vereins; Nr. S der Mitteilungen des landwirtschaft- 
lichen Vereins für Bayern. 

Die botanischen Sammlungen erhielten dankenswerte Zu- 
wendungen vonseiten derHerren Appel, Buch n er, Bürger, 
Erhard, Glück^ Kaulfufs, Kränzte, Landauer, Lin- 
dinger, Meisenbacb, Rodler, Fr. Schultheifs, 
Schwarz, Simon. 

Die Durchforschung des Florengebietes wurde eifrig fort- 
gesetzt. Herr Paalzow widmete sein Hauptaugenmerk den 
grOfseren Pilzen, während sich an der auf Anregung des Herrn 
Professor Magnus-Berlin vor zwei Jahren begonnenen Samm- 
lung parasitaerer Pilze die Herren R od 1 e r , Fr. und V. S c h u 1 1- 
heifs, Schwarz und Wagner beteiligten. Herr Kaulfufs 
setzte seine Arbeiten auf dem Gebiete der Farn- und Moosflora 

Digitized by VjOOQIC 



87 

fort. Die Resullate bilden die zweite Abhandlung im fünften 
Heft des X. Bandes der Yereinspublikationen. In derselben sind 
einige Formen neu aufgestellt; pflanzengeograpbiscb wichtig 
ist die Konstatierung einer fQr Süddeutschland, einer selbst 
für Mitteleuropa neuen Form. Bezüglich der Phanerogamen 
beschäftigte sich Herr Fr. Scbultbeifs besonders mit der 
Adventivflora, während in Bezug auf pflanzengeographische 
Verhältnisse die bisher weniger bekannten benachbarten Gebiete 
der Oberpfalz von ihm und Herrn Schwarz bearbeitet wurden, 
wobei sich sehr dankbare Resultate ergaben. 

Für Phänologie war, wie bisher, Herr Fr. Scbultbeifs 
gewissenhafter Referent, der hierüber in mehreren Nummern 
des Generalanzeigers berichtete. 

In 11 ordentlichen und 7 aufserordentlichen Sitzungen 
wurden folgende Referate mit Demonstrationen geliefert: 

Büchner: Alpine Flora ; Fruchtbildung von Pinus Strobus; 

Cardamine pratensis + amära bei Nürnberg. 
Erhard: Süfsholz wurzeln; Euphorbia virgata von Nörd- 

lingen; zur Flora von Südtirol. 
Kaulfufs: Gattung Aspidium; Equisetum palustre + 
arvense; Aquarelle von Farnen, Laubmoose, Sphagna. 
Kinkelin: Heimat des Sareptasenfes ; Vacciuium macrocar- 

pum. 
Prell: Zur Flora von Südtirol. 
Rodler: Zur Flora von Oberbayern. 
Rudel: Zur Flora von Südtirol. Cardamine pratensis + 

amara bei Neumarkt. 
Fr, Schnüheifs: Phänologie; Adventivflora; Flora um 
Parsberg; Vaccinium intermedium, Bastard von Preifsel- 
und Schwarzbeere. 
V. SehuUheifs: Cacteen, Agaven, etc. 
Schwarz: Fruchtbildungsverhältnisse der Cruciferen; 
Polygalaceen; Peronospora Alsinearum; Gentianeae, 
Gruppe Endotricha nach Wettstein; Gattung Pisum; 
Flora des Göfsweinsteiner Dolomites; Veilchen und 
Veilchenbastarde; floristisches und geognostisches aus 
dem Oberpfälzer Jura. 
Schwemmer: Gattung Thalictrum. 
Wagner: Bodenimpfung behufs Lupinenbau auf Sand und 
Kalk, und Bodenimpfüng im Allgemeinen. 

Digitized by VjOOQ IC 



58 

Die Sektion konnte sich der Mitwirkung ferner stehender 
Kreise erfreuen, indem Herr GlOok-Heidelberg zwei eingehende 
Vorträge über die biologischen Verhältnisse der Wasserpflanzen 
brachte, die er durch zahlreiche Demonsti*ationen illustrierte. 
Herr Appel- Würzburg überschickte interessante Produkte aus 
dem botanischen Garten in Würzburg. Herr Laqdauer-Wflrz- 
burg sandte eine reichhaltige Serie von Ghenopodiaceen in 
frischem Zustand ein. 

Der von Seiten der kgl. botanischen Gesellschaft in 
Regensburg angeregten Ausgabe einer Flora exsiccata fiavarica 
wurde auch diesseits näher getreten. 

Die freundschaftlichen Beziehungen zur bayerischen 
botanischen Gesellschaft in München, zur botanischen Ver- 
einigung in Würzburg, und zu einigen Freunden in Eulmbach 
und Neumarkt wurden, wie bisher, weiter gepflegt. 

Schliefslich betrachtet die Sektion als einen Markstein 
ihrer bisherigen Thätigkeit die Fortsetzung der vom Obmann 
veröffentlichen Flora von Nürnberg— Erlangen, deren allge- 
meiner Teil zum Abschlufs gebracht wurde, während vom 
speziellen Teil die Thalamifloren veröffentlicht werden konnteta. 

Schliefslich sei noch der wärmste Dank ausgesprochen 
für die finanzielle Unterstützung, die der Sektion von der Ge- 
sellschaft gewährt wurde, sowie für das freundliche Entgegen- 
kommen der Redaktion des General -Anzeigers, das diese durch 
unentgeltliche Aufnahme der Einladungen zu den Sektions- 
Sitzungen bekundet hat. 

A. Schwarz, W. Rudel, 

Obmann. Schriftführer. 



IX. Jahresbericht der geographischen Sektion. 

Im Jahre 1897 zählte die Sektion SO Mitglieder. Es wurden 
10 Sitzungen abgehalten, in welchen folgende Vorträge und 
Referate gebracht wurden: 
I. am 21. Dezember 1896: 

Dr. Baum Uli er spricht ausführlich über die vorliegende 
Litteratur. 
II. am 25. Januar 1897: 

Dr. Baumüller über Thoroddsen, Geschichte der islän- 
dischen Geographie und an der Hand einer Earten- 

Digitized by VjOOQ IC 



59 

Skizze über den Lauf der Donau und deren Durch- 
bruchstellen. 

III. am 15. Februar 1897: 

Vorlage von Tauschschriften und bucbhändlerischen Ein- 
laufen durch den Obmann. 

IV. am 15. März 1897: 
Desgleichen. 

V. am 26. April 1897: 

Hör mann über das Werk von Sapper, das nördliche 

Mittelamerika; 
Dr. Baum Q 11 er über Hennann Meyers Expedition nach 

Zentralbrasilien ; 
Hör mann über die Frage: »Entspricht die altperuanische 

»Marca« der alten deutschen Mark unter Verlesung 

eines hierzu Stellung nehmenden Briefes von Dr. E. W. 

Middendorf, Berlin.« 

VI. am 17. Mai 1897: 

Dr. Heerwagen legt eine neue physikalische Wand- 
karte vor; 

Einkelin zeigt und erläutert Abbildungen aus Palästina; 

Dr. Heerwagen referiert über Kükenthals Forschungs- 
reise in den Molukken und Borneo. 

VII. am 22. Juni 1897: 

Dr. Heer wagen über die Katalanische Weltkarte der 
Bibliotheca Estense zu Modena von Kretschmer; 

Kinkelin legt Ansichten von Jerusalem vor und bringt 
höchst interessante Mitteilungen über seine Reise- 
erlebnisse und die dortigen Verhältnisse. 
Vin. am 19. Juli 1897: 

Dr. Heer wagen übergibt als Geschenk eines Nichtmit- 
gliedes eine Anzahl ethnographischer Photographien; 

Voigt legt zur Ansicht vor alte Trachtenbilder von den 
8 Kreisen Bayerns und schenkt einige Karten und 
Oedenkblätter. 
IX. am 18. Oktober 1897: 

Dr. Heer wagen referiert über Ceylon, Tagebuchblätter 
und Reiseerinnerungen von Wilh. Oeiger und andere 
litterarische Einlaufe. 
X. am 15. November 1897: 

Dr. Heerwagen legt eine neue farbige Reliefkarte von 
Deutschland und den Alpenländern vor; ^ . 

Digitized by VjOOQ IC 



60^ _ 

Postmeister Schmidt spricht über Sven Hediii*8 zweite 
Reise durch die Takla-Makan wüste. 

Aufserdem wurde durch den Obmann über den Inhalt der 
zahlreichen Einlaufe, sowie der Zeit- und Tauschschriften in 
jeder Sitzung ausführlich referiert und zu mannigfachen Be- 
sprechungen Anlafs gegeben. Für die der Sektion zu Teil 
gewordenen oben aufgeführten Geschenke wird den Sehern der 
beste Dank ausgesprochen. 

Aus eigenen Mitteln schaffte die Sektion folgende Zeit- 
schriften und Werke an: 
Geographisches Jahrbuch, Band 19 und 20, 1. Hälfte, 
32. Bd. der Verhandlungen u. Zeitschrift d. Gesell, f. Erd- 
kunde in Berlin, 
Deutsche Eolonialzeitung, 
Ehrenreich, ürbewohner Brasiliens, 
Deutschland und seine Kolonien, 
Kannenberg, Kleinasiens Naturschätze, 
Sapper, Nördliches Mittelamerika, 
Wegener, Zum ewigen Eise. 

Die Geschäfte der Sektion besorgten die Herren Dr. Bau- 
müller als Obmann, Dr. Heerwagen als Schriftführer, Ensl in 
als Kassier. Der Rücktritt des Obmanns als Vorstand der 
Naturhistorischen Gesellschaft hatte für die Sektion die be- 
dauernswerte Folge, dafs derselbe auch seine Funktionen als 
Obmann derselben, als welcher er seit Beginn des Jahres 1888 
thätig war, uud als Kustos der ethnologischen Sammlung, 
niederlegte. 

Es wird demselben für seine langjährige aufopferungs- 
volle Thätigkeit und sein unermüdliches Bestreben, dieSitzungen 
der Sektion anregend zu gestalten, auch an dieser Stelle der 
beste Dank ausgesprochen. 

Bis zum Schlufs des Geschäftsjahrs übernahm der Unter- 
zeichnete die Obmannscbaft und Herr Hör mann das Schrift- 
führeramt. 

Dr. Heerwage u. 



Digitized by VjOOQ IC 



61 



X. Jahresbericht der chemischen Sektion. 

Die Mitgliederzabi der chemischen Sektion betrug bei 
Beginn des Jahres 4S; von diesen traten 5 wegen Aufenthalts- 
veränderung aus, während 6 Neuanmeldungen erfolgten; die 
Mitgliederzahl ist demnach gegenwärtig 44. Im Laufe des 
Jahres fanden IS wissenschaftliche Sitzungen statt, 4 mehr als 
im Toijahre und aufserdem feierte die Sektion am 2S. Januar 
im Hotel zum roten Hahn ihr Stiftungsfest. 

In den IS wissenschaftlichen Sitzungen wurden von 8 
Hitgliedem und 4 auswärtigen Gästen 14 Vorträge gehalten, 
sowie 4 Referate bezw. Mitteilungen erstattet, darunter 6 Vor- 
träge und 4 Referate mit Demonstrationen. Bei den Demon- 
strationen kam wiederholt das neue ausgezeichnet funktionierende 
Skioptikon der naturhistorischen Oesellsohaft zur Verwendung 
und ist die Beschaffung desselben als eine sehr wirksame 
Unterstützung der wissenschaftlichen Bestrebungen auf das 
Freudigste zu begrüfsen. OegenQber der wissenschaftlichen 
Thätigkeit im Vorjahre ergibt sich eine Mehrung um 2 Vorträge, 
dagegen eine Minderung um 2 Referate. Die Beteiligung an 
den Sitzungen war im allgemeinen eine gute, denn es betrug 
die höchste Teilnehmerzahl SS, Vorjahr 41 
die geringste » 14, » 14 

die mittlere » 25, » 24 

Als regelmäfsige Gäste beteiligten sich an den Sitzungen 
der Sektion ein Teil der Herren Assistenten der staatlich sub- 
Teni Brauerei Versuchsstation, sowie die Herren Schüler des 
1 Kurses der chemischen Abteilung der Egl.' Industrieschule. 
Von den 14 Vorträgen und 4 Referaten behandelten 
8 rein theoretische 
10 technische Thematas. 
An denselben waren beteiligt die Herren 
Professor Dr. Kaemmerer mit 1 Vortrag 
Dr. Prior »2 Vorträgen 

» Dr. Wagner » 1 Vortrag 

- Dr. Zwanziger »1 » 

Dr. Metzger » 2 Vorträgen 

Dr. Oppler » 1 Vortrag 

Inspektor Schlegel »1 » 

Dr. Lessing mit S Referaten 

Direktor Wunder » 1 Mitteilung. 



Digitized by VjOOQ IC 



62 

Als Gäste der Sektion hielten Vorträge die Herren 
Dr. Üllmaun-Genf 
Dr. Zeis er- Heidelberg 
Dr. Ouggenheimer-Paris 
Dr. Thurnauer-Aurora-IIlinois. 
Die Tagesordnung der einzelnen Sitzungen war folgende: 
12. Jan. Inspektor Schlegel: Über ßoldvorkommnisse in 

Bayern. 
* » Dr. Metzger: Über die Herstellung von Obst- und 
Beerenobstweinen unter Vorführung der Professor 
Müller'schen sogenannten alkoholfreien Getränke. (Mit 
Demonstrationen.) 
9. Febr. Dr. Prior: Das Gesetz der Beziehungen zwischen alko- 
holischer Gährung und dem osmotischen Druck. 
2S. » Dr. Lessing: Die elektrischen Ofen zur Metallge- 
winnung und Metallraffination. (Mit Demonstrationen.) 
9.März.Dr. Oppler: Über die am IS. Dezember 1896 in der 
Fabrik elektrischer Zünder in Aschaffenburg erfolgte 
Explosion. 
28. » Dr. Prior: Über spektrometrisch araeometrische Bier- 
analysen. (Mit Demonstrationen.) 
Dr. ül 1 m a n n , Genf: Über einige von dem Vortragenden 
ausgeführte neueArbeiten,nämlich über Diphenylderivate 
und über die Verwendung der Kupferbronze zur Zer- 
setzung der Diazochloride. (Mit Demonstrationen.) 

11. Mai. Professoi" Dr. Wagner: Über die Gesetze derFleisch- 

und Fettbildung im TierkOrper. 

25. * Professor Dr. Eaemmerer: Über Pyronine und ver- 

wandte Farbstoffe. 
22. Juni. Dr. Zeis er (Gast): Über neue Diacetylverbindungen. 
» Über Seien- u. Tellur Verbindungen 

der aromatischen Reihe. 

12. Okt. Dr. Lessing: Bericht über die Versammlung der 

deutschen elektrochemischen Gesellschaft im Jahre 1897. 
Dr. Lessing: Über Marconi's Telegraphie ohne Draht 
(Mit Demonstrationen.) 

26. » Dr. Guggenheim er (Gast): Über Röntgenstrahlen. 

(Mit Demonstrationen.) 

Direktor Wunder: ROntgenphotographien. 

Digitized by VjOOQ IC 



68 

9. Nov. Dr. Thurnauer (öast): Über Erfahrungen in der 
BleihQttenpraxis. 

Ö- » Dr. Zwanziger: Über Goldgewinnung im Gaplande. 

1*. Dez. Dr. Metzger: Über synthetisch hergestellte Riech- 
stoffe. (Mit Demonstrationen.) 

Prof. Dr. Eaemmerer 
Obmann der chemischen Sektion. 



• m tm 



Digitized by VjOOQ IC 



Digitized by VjOOQ IC 



66 



Zugänge zur Bibliothek 

vom 1. Januar bis 31. Dezember 1897. 



S401. Adurmamn, Dr. Karl, Repertorium d. landeskundl. Litteratur 

f. d. preuÜB. R.-fi. Gassei. 8<>. 176 S. 
8402. — Bestimmung der erdmagnetischen iDklinatioii von Gassei. 

8». la S. 
Aärefibueh, s. Nfirnberg. 
SS48. Älbrieh tmh,, CL, G^chichte d. evang. Gymnasiums z. Her- 

mannstadi 189»/96. 40. ltf6 S. 
S88i a. ÄUgem. DmU$€her Bäder- Faröofuf.Verhandlungen des — Offiz. 

Bericht über d. 1. öfL JahresversammL d. Verbandes. 

Bad Kosen i89S. 8«. YUI u. 111 S. 
8S81b. ~ Yeröffentl. d. S. ord. u. öff. VerbandsTers. Wiesbaden. 

1898. 80. Vm u. 198 S. 
S444. Ättgm. DmUehe Real-Enoifelopädiefiir die gebüdeien Stände. 

18 Bde. 7. Aufl. Brockhaus. Leipzig 1827. 
i816U. Äipetwerein, Z^tschr. d. d. u. ö. A.-y. Jahrg. 1888. 
1816 m. ~ > > 1884. 

lS16iy. ~ > > 1885. 

8475. Andere, Älb, Äug,^ Der Europäische Nomade oder der 

Tentsche Zuaye auf Yorpost. i d. Umgebung y. Algier. 

4. Aufl. Grimma 18U. 80. 194 S. 
8436. ArbeUen d. DeuiecK Landioirtedurfie'GeeeUeeh^ft 8«.: 

Heft 1. Dr. J. H. Vogel, Die keimtötende Wirkung 
d. Torfmulls. 4 Gutachten. 1894. 126 S. 

Heft 14. F. y. Sybel, Der Schutz gegen Flurbeschädig- 
ungen durch gewerbL Einwirkungen. 1896. X 
u. 88 S. 

Heft 16. G. Siemssen, Verbrauch an Ealirohsalzen i. d. 
D. Landwirtschaft i. d. J. 1890 u. 1894. 1896. 
82 S. 
8446. Arendey Dr. Carl, Leitfaden 1 d. 1. wissenschaftl. Unterricht 

i. d. Natorgeschidite. kl. 8«. Regensburg 1871. XII 

u. 866 S. 
8808. Arnold, Dr. F., Liohenenflora yon Labrador. 1896. 8«. 18 S. 
8400. Baefmann, Fr., Die landeskundliche Literatur über d. Grolä- 

herzogtOmer Mecklenburg. Güstrow 1889. S^. XVIII 

u. 512 S. r^ I 

Dioitized by VjOOQ IC 



66 

8880 a. Bäder-Älmanaeh. Mitteilung d. Bäder, Luftkurorte u. Heil- 
anstalten in Deutschland, Österreich, Schweis u. an- 
grenz. Gebiete. 2. Ausg. 8». 1884, XXXIll u. 884 S. 

8880 b. — 8. Ausg. 1886. X u. 818 S. 

8880 c — 4. Ausg. 1889. VIII u. 876 S. 

8882. Bamberg auf d. IL bayer. Land es- Ausstellung s. Nflmberg; 
Töm Gewerbe-Verein B. 8<>. Illuskriert «6 S. 
BamM/m, Dr. 0., siehe Verein f. Erdkunde. 

8880. Baumgartmy Jahresbericht über d. Fortschritte i. d. Lehre 

V. d. pathogenen Mikroorganismen. X. Jahrg Braun- 
schweig 1894. 8<>. Xu. 846 S. 

8881. Batmgarien, Namen u. Sachregister hiesu fttr Jahrg. I— X, 

1896. 80. 280 S. 
Bayerische Landesausitellung siehe Nürnberg. 
— Hopfen- u. (xerstenausstellung Riebe Nürnberg. 

8459. Bapem'8 permanente Giyilliste. Eine landständische Yer- 
hdlg. i. J. 1884. München, kl. S^. XII u. 180 S. 

8257. Bekm- Wagner, siehe geograph. Jahrbuch. 

8891. Benard, 19 Tafeln Rupferstiche. Menschenrassen. 4®. 

8404. Berieht, amtlicher, über d. 25. Versammlung deutscher Land- 
u. Forstwirte eu Dresden. 1865. 80. Vill u. 610 S. 

8869 a. — der Gentralkommission f. Wissenschaft!. Landeskunde t. 
Deutschland für 1889/91. S. A. IX d.Geogr. Tag 1891. 

8369 b. — dto. für 1898/95. S. A. XL d. Geogr.-Tag. 189ö. 

8399. — über die Verwaltung d. kgl. Sammlungen t Kunst o. 
Wissenschaft z. Dresden in 4872 u. 78. 4^ geh. 24 S 

8812. Bemhold, Jul., Manuskripte 4<^. Notizen aus Vorlesungen 
von 1844/45 über: a. allgem. Bofanik. b. Pflanzengeo- 
graphie, c Pflanzenphysiologie, d. im bot. Garten de- 
monstr. Pflz. e. Mcdicin. Botanik, f. Analytische Be- 
ridite. g. Ghem. Analysen Ton Vogel, h. Buchners 
Ghemie. i. Organ. Chemie, k. Pharmacognosie. LPhar- 
macopoßa bavarica. m Schemata, n. Vogels Ghemie. 
0. Mineralogie, p. Voriesungsrerzeichnis München S.- 
S. 1844/45. 

8448. Bertouehe, Ernst v., die grofsen nordischen Fluten u. deren 

Folgen. Wiesbaden 1898. 8«. 42 S. 
8842. BeoershUs, M., de St. Pietersberg. Maasluis 1894. 8<>. 8S. 
8408. Bezold, W. v., D. kgL preufs. meteorolog. Institut i. Berlin 

und dessen Observatorium b. Potsdam. 1890. S^, IV 

Tafeln u. 76 S. 

8870. BibUothsk für NahrungsmiUelchemiker. Bd. 5. Dp. Bugen 
Prior, Ghemie u. Physiologie des Malzes u. des Bieres. 
Leipzig 1896. 8 «. X u. 598 S. 

Digitized by VjOOQ IC 



67 

SS96. Biehrmger, Dr. J,, MaDUskript: Köllicker, Prof. Dr.: Die 
Entwickelungsgeschichte des Menschen u. d. höheren 
Tiere. 1881. 4®. 98 S. 

SS88. — , Vortrag Aber Meteorologie. Verein f. öff. Gesundheits- 
pflege. 40. IS S. 

5509. • — I. Ober die Farbstoffe der Pyroningruppe. S. A. 1896. 

8<». 11. Ober die Electrolyse organ. Körper. S.A. kl. 8<». 
S480. Biichoff, Dr. Th. L., Ober die Verschiedenheit in der Schä- 

delbildong des Gorilla, Ghimpanse u. Orang-Oatang, 

Torzflglich nach Geschlecht u. Alter. 2S Taf. München 

1896. 4<>. 94 S. 
SS75. Blankenkom, Dr., Mag, Das DiluTium der Umgegend von 

Erlangen. S. A. 1895. 8». 48 S. 
lU. Bkmu9, Dr, W., Beiträge luf Kenntn. der Vogelfauna von 

Gelebes. S. A. a. d. Z. f. d. gea, Ornithologie. Budapest 

1886. 8». IL Seite 81—179. III. Seite 198—810. 
S407. Boianische AnMtaUen Wiens im J^hre iSU. 11 Abb. Beilage 

1. J. 1898 der österr. bot Zeitschr. 4<>. 68 S. 
S8S7. Baueher de Perthes, Antiquitös celtiques et antediluviennes. 

Paris 1864. 8». 1. Bd. XII u. 628 S. 2. Bd. XVI u. 

618 S. 8. Bd. XXU u. 682 S. u. XII pl. 
Braun, Hieran,, s. Nflrnberg. 
S299. Buehenau, Dr, Frz., Flora der ostfriesischen Inseln. 8. Aufl. 

Leipzig 1896. 8«. VIII u. 206 S. 
S841. -, Flora yon Bremen. 8. Aufl. 1885. 8«. 822 S. 
St96. Bueehan, Gg., Vorgeschichtliche Botanik der Kultur- ii. Nutz- 
pflanzen der alten Welt auf Grund prähistorischer Funde. 

1896. 
3489. Caesaris, C. JulU, commentarii de hello gallico et civili. 8^ 
Chicago WeUausMMhsng 1893. Handbflcher zu Informationen 

während der — . 
$558. — Guide to the World'» Fair Groonds and Buildings and off. 

Directory with Map. Ulustr. 8<>. 40 S. 
AuHTika. A. United States Territories. 

5510. — Älasea, all about — Issned by Padflc coast steamship Co. 

illustr. 8». 74 S. 
S51L — Arkansas. An accurate and reliable description of the state 

of — for the Information of the farmer, the home-seeker 

and the inrestor. 80. 40 S. ill. Karte. 
8511--.— üandbook of —, Alabama, South Carolina, Virginia. 

Proceedings of the conrentlon of southern goyemors, 

held in the dty of Richmond. 1893. 80. ill. 82 S. 
Baston, s. auch Massachusetts. 
S51S. — .— Report of the trustees of the Massachusetts hospital for 

dipsomaniar-s and inebriates. 1893. 8^. iJl. 28 S.^ . 

g+izedbyLiOOgle 



68 

Chicago WeUaunielhmg £898. 
8tfi4. — Bo9ton. The insiructiTe district nuraing assodatioD. Its 

seyenth annual repori for the year ending January 81. 

1893. 8<>. 40 S. 
3508. — . — The Cambridge Idea in Temperance Reform and Maaaachu- 

setts Laws for dealing with Drunkenness by £. A. Whit- 

man. 8<^. 36 S. 
8513. — CaUfornia. Locaüon, Resources, Attractions and De?eIoppe- 

ment of the Kern Delta, Kern Gounty, California and 

its exhibit at the Worlds Coiumbian Eiiposition. 8<^. 

84 S. ill. 
8816. — . — , Annual report of the State bord of horticoltnre of the 

State of C. for 189S. Sacramento 189S. 8«. Karten u. 

Tab. 464 S. 
8517. — .— , Southern. The iand of suneshine. An aathentic de- 

scription of its natural features, resources and prospecis. 

80. m. 96 a 
8618. — .— , Olire industry. Sacramento 1892. 8<^. 68 S. 
8588. — Colorado, A report on the resources and industrial dere- 

loppemmit of Colorado. 1898. 8 o. 196 S. 
8519. >- Dakota, North — The golden wheat State. 8<>. .111. Karte. 

8580. — .— South ^, moro facta about ~, regarding agriculture, 

sheep raising, dimate, soil, and its other resources. 8 o. 
iU. 48 S. 

8581. — Georgia. Clarke county and the city of Atiiens. Ry Ch. 

IL Strahan, Athens 1893. Mit Karten u. iUufltr. 8<>. 

88 S. 
3883. — Komas. Geology and mineral resources of — by Robert 

Hay. Topeka 1893. 8<>. iU. 66 S. 
8584. — .—, mineral resourses of — , 8^. 84 S. 
3585. — .— , State board of agriculture. Topeka 1893. 8<>. 60 S. 
8586. — .— , A directory of the Kansas historical exhibit in tiie 

Kansas State Ruilding at the Worlds Col. Exp. 1898. 

8 0. 86 S. 
8687. — Ma9$aohuieU8» 18. annual report of the M. agricultural Col- 
lege. 1898. Roston. 8<>. 138 S. 
8550. —.— , Catalogue of the Officers and Students of the State 

Agricultural College of Michigan. 1891—8. 8^. ül. 76 S. 

8588. — MmneapoUa. 10. annual report of the trade and commerce 

of M. for 1898. 8<>. Karten. 840 S. 

8589. — Mi$90uri at the worlds fair. Catalogue of the Ressources of 

the State. ilL 8«. 176 S. 
3548. — . — , Annual Statement of the trade and commerce of St 
Louis for 1898. Reported to the merchants exchange 
of St L. by Geo U. Morgan. 8^. iU. 858 S. 

Digitized by VjOOQ IC 



69 

Chicago WeUausMtßIhmg 1893. 
S880. — Montana. History, Resources, PosBibilities. 189S. 8^ 64 S. 
3581. — Nebraska. Annual Report, State Roard of Agricoltore. 189S. 

8«. 510 S. 
S507. — Nwada. an Adress to the people of — on Water Storage 

and Irrigation by Franc 6. Newlands. fllostr. by Maps 

and diagrams (1890). 4®. 20 S. , 

85M. — . — , Report of the Surveyor-€^neral and State Land Register 

of the SUte of- for the years 1891 and 1891 8«. 112 S. 
S588. — New Jereey. Tvrentieth Annual Report of the Roard of Agri- 

eulture. 1892-^98. S^. 528 S. n. 84 S. Append. 

8584. — New Mexico, Golfaz Gounty. Its Resourees and Opportuni- 

ties. iU. 80. 16 S. 

8585. — New Toris. Central and Hudson River Railroad: Health 

and Pleasure on »Amerieas greatest Railroad c De- 

scriptive of Summer Resorts and Excursion Routes. 

1898. Mit Tielen Karten u. Ulustr. 8® 352 o. GU S. 
3886. — .— Gancer Hospital. EighOi Annual Report 1892. 8« 86 S. 
8887. — Oregon, the Resources of the State of —. 1892^ mit Karte. 

80. 280 S. 

8588. — . — , the Resonrses of the State of eastem — . 1892. 8^. 112 S. 

8589. — Pacific Raüroad, 6000 miles through Wonderland by Olin 

D. Wheeler. Reich illustr., Karten. 8«. 106 S. 

8540. — Penneyhania. — Eisenbahn nach d. Golumb. Welt-Aosstellg., 

Ulustr., Karten. 1892. 8« 182 S. 

8541. — .— limited. (Auszug aus d. rorigen.) illustr. 8®. 18 S. 
8551. — .— Gatalogue of the exhibits of the State of — and of Penn- 

sylvanians at the Worlds Fair. 1898. S^, illust. 218 S. 
8509. — Rhode Island, the Isochronal Glock inyented by H. Gonant. 
illust, engl. u. französ. Pawtucket qu. 8®. 14 S. 

8544. — Texas. Trough —. A. Series of interesting Letters by Walter 

R. Sterens. St Louis 1892. 8<^. illustr. 108 S. 

8545. — Utah. P. Donau, a peep into a mountain vralled treasury 

ofthegods. 1891. 8<». Reich illustr. 96 S. 

8548. , 6. annual Report of ^t Lake Chamber of Commerce. 

1898. 80. illust 70 S. 

8546. — Washington. The evergreen State souTonir containing a 

reriew of the resources, wealth, Tariod Industries and 
commercial adrantages of the State of W. by J. 0. Hest- 
wood. 1898. 8«. ill. 72 S. 
8584. — .— How the latin American Markets may be reached by 
the Manufacturers of the U. St Karte. 8®. 506f S. 

8547. — Wyoming. An agricultural sunrey of W. ü. S. Dep. of 

agriculture. Dirision of statistics. Miscell. ser. report 
Nr. 7. Washington 1898. 8 «. 72 S. ^ t 

Digitized by VjOOQ IC 



70 

Chicago Weltausstdl/ung £893. 

8548. — .— , a complete and compreiensive description of the agri- 

culiural, stock rauing and mineral resources of W. 4. 
Ed. 1893. 80. 120 S. 

8549. — YeUowBione Nationalpark, a 16 Lichtdrucke, qu. S^. 

— — b. via the Northern Pacific Rail- 

road. ilL 1 Bogen. 
B. Andere Staaten. 
8558. — Canada. An official handbook of Information relating to the 

Dominion of Ganada. 1898. 8^. Karte, 88 S. 
3554. — . — Western Ganada and its great resources the testimony of 
Bettlers, farmer delegates and high authorities. 1898. 8 ^. 
ill. 38 S. 

8555. — BriMi Columbia, The Pacific Proyince of the Dominion 

of Ganada. Its positions, resources and cliroate. 8®. 
ill., Karte. 82 S. 
8S94. — Mexico. Mexico? Si Seüor. By Thos. L. Rogers, illustr. 
Boston 1898. 8^. 294 S. 

8556. — .— Datos Mercantiles compilados por Ricardo de Maria y 

Gampos. Mexico 1892. S^ IV u. 776 u. XIV S. Appendix. 
3567. — . — Gatalogo de las Frutas, Raices y Tuberculos que se pro- 
ducen y expenden en el estado de Mixoacän de Ocampo. 
(Mexico) Morelia 1898. 4». 78 S. 

8558. -> . — Tropical tours to Toltec Towns in Mexico. (Mex. Nat Rail- 

Road.) ill. 80. I. 60 S. u. Index. II 40 S. u. Index. 

8559. — Co9ta Bica. Gatalogo General de los objetos que la repüb- 

lica de G. R. enria ä la £xp. Uniy. de Ghicago. San 
Jose 1892. 40. Text 56 S. u. 46 S.; 58 S. Appendix, 
entiialtend Dr. Dar. J. Guzmän, Estudio sobre el cultifo 
de algunas plantas y ärboles industriales en la Rep. 
de G. R. 

8560. — Guaiomala, A descriptire account of the Republic of 6. 

8». 40 S. 

8561. — Jamaiea. ^ ai Chicago. An account descriptire of the colony 

of J., with historical and other appendices. 8^. iJl. 96 S. 
8272. — Brasilien. The state of Parä. New-York 1893. 8«. illustr. 

Karten. 150 S. 
3273. — UrugtMy. The oriental Republic of U. 1 Karle. Monterideo. 

1893. 80. 54 S. 

8562. — Vmezuela. The United SUtes of — in 1893. 8^. illustr., 

Karten. 152 S. 

Europa. 
8568. — England. Royal Gomm. for the Ghic Exp. 1893. Hand- 
book of Regulations and General Information. Final 
Ed. May 1893. 8^. iü. Karten. 228 S. 

Digitized by VjOOQ IC 



71 



CMeago WeUaunieUunff 4893. 
S564. — England, The Bureau of Gharities and Gorreetion. Intro- 

duction to the Bnglish Bzhibitis. 8<^. VlI Taf. n. 48 8. 
3567. — Frankreieh. I. Gatalogue offidel (Freneh and EngUah). IL 

Gatalogne offidel, Palaia des femmes. 2 Bde. S^. S66S. 

tt. 70 8. 
S568. — . — Gorapte des ProduHs et des D^penses de la DirecÜon 

gtotode des Festes et des T616graphes, en 1891. l^. 

104 8. 
S669. — . — Notice on the commereial instruetioD orgauised by the 

Paris Ghamber of Gommeree. 4®. 192 8. u. Gontents. 
S271. ~. — Algier. Aimtfnach du petit Golon aig6rien. Alger. 1898. 

Karte. iUust. 8<>. 191 8. 
8566. — Russkmd. A Short historical sketch of the labours of the 

Jmp. Rnssian Techuical 8oc. firom its foundation to Jan. 

Ist 1898. St Petersburg 1898. 8 0. 40 8. 
8566. — .— Gatalogue of the Russian Seetion. 8®. 672 & 

Afrika. 
8582. — lAberia. 1847—1898. 8<». iUust 82 8. 
8588. — The Ortmge Free State RepubUe. South Afriea. Karte. 8«. 168. 

Asien« 

8576. — Briüeh North Bomeo. The new tobaeoo conntry. London. 

1892. 80. 16 8. 

8570. ~ Japan. GaUlogne of Ol^eets ezhibited at the W. Gol. Bx. Ghic. 

1898. By the Department of Edueation. Tokyo 1893. %\ 
114 S. 

8571. — .— - Japanese Womens Gommission for the W. G. Exp. 

1898. 40. 8 S. 

8572. — .— Detaib of the Industrial Specimens by the Bureau of 

Gommeree and Industry. Dep. of Agrieulture and Gom- 
meree. Tokyo 1898. 8^. 22 8. 
8578. — . — Ghambers of Gommeree in the Empire of Japan. Tokyo 
1898. 8«. 22 S. 

8574. — .— Report on the Metereologieal Obseirations made at high 

lerel stations in Japan. Tokyo 1893. 4^. iil. 208. 
Text, 52 8. Appendix. 
8585. — . — Kuroda, S., Outlines of the Mah&y&na as taught by Budda. 
For oircttlat among the members of the Parliament of 
Religions to be held in Ghicago. edit by the Bukkigo 
Gakkuwai, Tokyo (1898). S^ 80 8. 

8575. — Indien. The industrial Art Manufacturers of the Indian Em- 

pire. 8®. 86 8. 

8577. — .— india, Ghina, Japan^^Australia, Tasmania, New-Zealand, 

Penninsolar Sß Oriental 8team Narigation Gompany. 8^ 
iUust. 1 Tat tt. 88 8. 

Digitized by VjOOQ IC 



72 

Chieaao Weltausaielhmg 4893. 
Avstrallen« 
8K79. - Nmv South Wales. Statistics, Uisiory, Resources. S^. 160 S. 
8578. --.— Gatalogue of New South Wales Ezhibits. DepartonentA. 
Agriculture, Food and its accessories, machinery tnd 
appliances. Sydney 1898. 8<>. 188 S. 

8580. — . — The Rise, Progress and preseot Position of Trade and 

Commerce in New South Wales. By Edw. Pulsford. 8®. 
52 S. 

8581. — .— Social, industrial, political and cooperatire AssociatioDS, 

etc. in New S. W Sydney 1892. 8«. IV. u. 24 S. 
8439. Christ, Dr. H,, Die Rosen der Schweiz mit Berücksichtig. 

der umliegenden Gebiete Mittel- u. Südeuropas. Basel) 

Genf, Lyon 1878. 80. 220 S. 
8426. Qraemer, Paul, Die Jagd im Spessart in Sage u. Geschichte. 

Pläne, BUder, 1 Karte. München 1892. 8<>. 166 S. 
8415. CreoUn Pearson in der Landwirtschaft u. Tierheilkunde, kl. 8®. 

64 S. 
8829. Dalla Torre, Wörterbuch d, botan. Fachausdrücke. Erginzg. 

zu dem vom D. u. O.A.-y. herausg. Atlas der Alpen- 
flora. Salzburg 1884. 8^. 280 Abb. VI u. 94 S. 
8890 a. DartDins insectiTorous plants. Reoension in Saturday Review. 

Nr. 1086. 1875. FoL 
8828. Deutsche Zoologische GeseUsehcfiy Das Tierreich. %^. 2LieC 

Berlin 1897. 
8424. Deutschland u. s, Kolonien im J. 1896. Amtl. Ber. über die 

1. deutsche Kolonial-Ausstell. ^Berlin. 1897. ül. fol. 
8806. DieudonnS, Dr. Ä., Ergebnisse d. Sammelforscbung über d. 

Diphtherieserum 1895/96. 4<>. S. A. a. d. Arbeiten d. 

D. Gesundheito-A. S. 254—292. 
8888. — Eine einfache Vorrichtung zur Erzeug, von strömenden 

Formaldebyddämpfen f. Desinfectionszwecke. S. A. dsgL 

S. 584-548. 
8504. Dippel, Dr. Leop., Das Mikroscop u.s. Anwendung. ^[2. Aafl. 

1. Teil : Handbuch der ailgeu^. Mikroscopie..^ 2 Befte 

1882, 1 Heft 1888. 2. Teil : Anwendung des Mikrosc 

auf die Histologie d. Gewächse. 1. Abt 1896.'*.1 Abt 

1898 m. 182 Holzsch. S. 445-660. 
8858. Dörr, W., Die erste allrussische hygienische Ausstellung ?. 

21. Mai bis 10. Okt 1898. St Petersburg 1894. 8*. 

Vffl u. 78 S. 
Drinkwater, s. Irby. 
8817. Dumäril, M. C. et Q. Sibron, Erp6tologie g6n6rale ou histoire 

naturelle complöte des reptiles. Paris 1884—54. 10 Bde. 

80. 1 Bd. Atlas, gr. 8. 



Digitized by VjOOQ IC 



73 

8S61 Eblm, Bemh., Über die Waldresie des Averaer Oberihaies. 

Ein Beitrag sur Kenntnis unserer alpinen Waldbestftnde. 

1896. 80. 4 Taf. 64 S. 
SItS. Ehrenrmehy Dr. Paul, anthropologische Stadien über die 

Urbewohiv^r Brasiliens, bes. d. Staaten Matte Grosso, 

Goyaz o. Amaionas. (Purus Gebiet) Zahlr. Abb. u. 

Taf. 1897. gr. 4«. 
S4S1. EgpoiiüoH mUmtUkmale BmxeUes 1897. Gatalogue g6n6rale 

officiel. 8<». SYol. in 8 Teüen. 587 S., 896 S., 182 S. 

8. auch Masui Th. 
8460. F. Ä., Die Lehre ?on den Landständen nach 'gemeinem 

deutsdiem Staatsrecht Lemgo 1841. S\ XII u. 186 S. 
S89S. Fe$i9ckrifi sur Feier des BO-jfthr. Bestandes des Museums 

Francisco Garolinum in Leipzig 1868. Fol. 68 S. 
34S8. Fmtrbuiathmg: I. Feuerbestattungsapparat System Rieh. 

Schneider 1890. S«. 18 S. 
n. Wettig, Herrn., Die Leichenverbrennung u. der Feuer- 

besUtt-App. in Gotha, m. Aufl. 6 Vollbüder. 8» 48S. 
IIL 18. Jahresbericht des Vereins fOr F. u. 6. Jahresber. d. 

Verwaltung des Grematoriums in Hamburg für 1896. 8 \ 

ilL 16 S. 
8S69. Flei$ehmann, Dr, Ä,, Lehrbuch d. Zoologie. Wiesbaden. 8®. 

8 Teile. Aligem. TeU. 1897. 188 Abbildgn. 198 S. 

Speüeller Teil: L Die Wirbeltiere. 1896. 98 Abb. u. 

8 Taf. VIII u. 164 S. II. Die wirbellosen Tiere. 1898. 

180 Abb. Xn S. n. 166-408 S. 
3440. Pocke, Dr. 0, W., Synopsis ruborum Germaniae. Die deut- 
schen Brombeerarten. Herausgeg. vom Naturw. Verein 

Bremen. 1877. S^. VI u. 484 S. 
8457. Pomoiari, A. /.-, Edler v. Veree, theor.-prakt Anleitung 

zur Erlernung der ital. Sprache. 6. Aufl. Wien 1880. 

80. 488 S. 
8487. Franklin, Dr. Bm^amin, The works of — Gampes edition 

Ntlmberg and New-York. seh. 8«. XII u. 812 S. 
8416. Fröhner, Prof. Dr. med,, Aus dem Lehrbuch der tierftrztl. 

Arzneimittellehre. Stuttgart 1888. kl. 80. 12 S. 
8884. Gal^eehes Syeiem d. Schädellehre (Granioscopie), Ober die 

Fälligkeiten u. Kräfte des Menschen u. die Verricbtg. 

des Gehirns. Wandtafel. 
3850. Qeigenbmrger, A., Zur Ckognosie, Agronomie u. Hydrographie 

des Ober- u. Untergrundes der Stadt Erlangen u. ihrer 

nächsten Umgebung. Inaugural-Diss. 8®. 66 S. u. 8 

Karten. 
8827. Qmibeek, Dr. Äloit, s. Verein f. Erdkunde, Leipzig. 

Digitized by VjOOQ IC 



74 

8857. OeographMches Jahrbuch. I Bd. 1866, hertasgegbn. t. E. 

Behm. Xllf. Bd. 1889 - XX. Bd. 1897, bregbn. v. H. 

Wagner. Gotha. 8 «. 
8816. Giminmg, Dr. Fr., Kaiser Wilhelm I. Festgabe der Stedt 

Nürnberg an die Jugend % n. März 1897. Illustr. 8<>. 

80 S. 
8816. Gordon y de Aco9ta, Dr. D. AnUmio de, 7 discursos and 7 

kleinere Aufsätze. Habana. 1894/97. 14 Hefte 8<^. 
8411. Gräael, Dr. Arnim y Grundzüge d. Bibliothokslehre m. bib- 

liograph. u. erläuternden Anm. Ncubearbtg. v. Dr.Jul. 

Petzhold (Webers iU. Katechism.) Leipzig S^. 
8471. Grebner, /o«. von, Tierärztliches Taschenrezeptbueh. Ulm 1880. 

kl. 8« 116 S. 
8846. Grüner, GoWieb Sigm., Die Eisgebirge d. Schweizerlandes. 

Bern 1760. kl. 80. 8 Teile XX u. 888 S. XU o. 884& 
XIV u. 280 S. 
8489. Gümbely Dr. C. W., Die geognostische Durch forschnng 

Bayerns.' Rede i. d. öfL Sitz, der k. A. d. W. am 88./8. 

1877. 4«. 80 S. 
Guzmän, Dr. Don Danid /., s. Chicago (Costa Rica). 
8199. Haeekel. Emeiy Systematische Phylogenie der wirbellosen 

Tiere. (In?ertebrata) 11. Teil des Entwurfes einer 

System. Stammesgeschichte. Berlin 1896. 8^. XYIII 

u. 780 S. 
8888. Hagen, Dr. Max, Die Influenza. Inangnral-Diss. Erlangen 

1888. 80. 84 S. 
8418. Handtke, F., Karte d. Balkanhalbinsel. 1 : 1.780,000. 11 Aufl. 

Haseelberger, Jf., s. Wiesbaur, J. B. 
8801. Haeskarlj J. K., Filices Javanicae. IV Hymenophylleae. 4^. 

82 S. 
8844. Hauser, Joh. Fr., Theoretische Studien über Wasser u. s. 

Verwandlungen. NOmberg 1897. 8®. 80 S. 
8479. Hebel, J. P., Allemanische Gedichte für Freunde ländl. Natur 

u. Sitten. 4. Aufl. Karlsruhe 1808. 8^4 Taf. Noten, 

X u. 196 S. 
8818. Heinemann, H. v., Die Schmetterlinge Deutschlands u. d 

Schweiz. 8 Bände. 8^. 

I. Abt Grofsschmetterlingc. 1889. XXIV u. 850 S., nebst 

Anhang 118 S.: Tabellen z. Bestimmung d. Schmetter- 
linge. 

n. Abt Kleinschmetterlinge. 1868. 

Bd. 1. Heft 1. Die Wickler. 848 u. 40 S. 
- > 3. Die Zünsler. IV 814 u. 88 S. 

Bd. 8. Motten u. Federmotten. Heft 1. 888 S. Heft 1 

VI u. S. 889-886 u. 104 S. TabeUen. 1870. 



Digitized by VjOOQ IC 



^6 

H4lmhoU%, Anna v., s. Tyndtll. 

SS04. Eertnann OUOy /. S, v. PetSnyi, Der Begrflnder d. wissen- 
schaftl. Ornithotoi^e in Ungarn. Budapest 1891. Fol. 
1S8 S. 

3476. HerscheUy Sir John, Hdehst merckwfirdige astronom. Ent- 
deckungen, den Mond u. seyne Bewohner belr., neuste 
Berichte von Kap dw g. Hoifnung darüber. Hamburg 
1886. kL 80. 116 S. 
Hertha, a. Nürnberg, Berichte. » 

8484. Herz, Dr. J. F., Die KAsekost. 2. Aufl. München 1895. 
t4 S. 80. 

S486. — Alpenwirtschaftl. Blätter. Zeitschr. x. Förderung d. Al- 
penwirtsch. im Allgftu. 1895. 8«. 156 S. 

8487. — Mitteilgn. d. MikhwirtschaftL Yereina i. Allgäu (0. f. d. 

gea. Milchwirtsch. d. b. Aligfiu) 8«. YLBd. 7. Jahrg. 1893 
bis 11. Jahrg. 1897. 
Beatwood, J, 0., s. Chicago (Washington.) 
Hiraoh, Carl Chrteüan, s. Nürnberg. 

8861. Hlawaieeh, C, Ober eine neue Kupfer-Antimon- Yerbindg. 
aas der k. k. Hütte eu Brizlegg. S. A. Wien 1895. 8«. 
1 LichtdruekUfel SS S. 

8SSS. Hoeek, P. P. C, Gompte renda des söances du 3me. con- 
gr^ internationale de Eoologie. Leyde 16.- Sl. Sept. 
1895. 8«. 544 S. 

3S95. Hoernes, Dr. M,, Die Urgeschichte des Menschen. 

8868. Huber, Rud., Die Niederschlftge im Kanton Basel in ihrer 
Besiehangzad. orograph. Verhältnissen. Inaugurai-Diss. 
Zürich 1894. 4«. SO S. 

SS5S. HiUmer, Georg, Statist. Tabellen, herausg. y. Juraschek. 1895. 
— dto. 1896. 

SS5S. Hühner^ OUo, geogr. Statist. Tabellen, hrsg. ?. F. v. Jura- 
schek. 1897. 

8SS1. Hu^ley, Tham., übersetzt yon G. Vogt. Ober unsere Kennt- 
nis von den Ursachen der Erscheinungen in d. organ. 
Natur. 6 Vorlesungen für Laien. 11. Aufl. m. Holzschn. 
Braunschweig 1896. 80. XVI u. 144 S. 

8488. Irby, Charles Leonard, and Jamee Manglee, travels in Egypt 

and Nubia, Syria and the holy land. London 1844. 
VUl u. 150 S. Derselbe Band enthält noch : 
DrinkvMUer, John, A history of the siege of Gibraltar 
1779— 88.8 ^ 17S S. 
8860 a. leeel, A., Genno sula costitusione geologica e sui fenomeni 
geodinamici dell' isola di Zante. Roma 1898. S^. 40 S* 
b. — I. 1 bradisismi dltalia secondo i piu recenti studi. 

IL Inturos alla proroga del concorso aperto nel 1898 

Digitized by VjOOQIC 



76 

per un Uyore illastratiyo delle caveme di una regione 
d'Italia. S. A. Roma 1895. 8» IS & 

c. — la rape oscillante e le voragini di eelafonia. S. R. Roma 

189K. 8«. 18 S. 

d. — Geano di an paroisismo cruttiTO osserrato neue sorgenti 

bitiimenifere di Zaote. S. A. 1896. 8<^. IS S. 

SS77. KämpffeTj Th,, Das Wesen der Naturkrftfte in neuer Auf- 
fassung. Barmen 1897. 8<^. 88 S. 

84S2. Kannenberg, Karl, Kleinasiens Naturschätze, seine wichtigsten 
Tiere, Kulturpflanzen u. Mineralschätze. Berlin 1897. 
81 Vollbilder, 2 Pläne. 8». XH u. S74 S. 

8S10. Ketlhaek, Dr Kanr,, Lehrbuch d. prakt Geologie. Arbeits- 
u. Untersuchungs-Methoden a. d. (rebieten d. Geologie, 
Mineralogie u. Paläontologie. Stuttgart 1896. 8<>. XVI 
u. 688 S. 

8819. Ki^er/^elden, Aktiengesellschaft in, Beschreibung ihrer Mar- 
morbrüche Ton dort u. Oberalm. 8^. SO S. 

8S84. Kiepert, H., Spezialkarte d. griech.-tfirk. Grenzgebiete mit 
Angabe der griech. Sprachgrenze. 1 : 500,000. 1897. 

88S5. Kinkelin, Dr. F., Einige seltene Fossilien des Senckenberg- 
schen Museums. S. A. 1896. 4^. 46 S. u. VT TaC 

S408. KtHfih, Dr, P., Flora d. nordfries. Inseln. Kiel u. Leipzig 

1895. 80. Xu. 16S S. 

8409. - Flora der Insel Helgoland. Kiel 1896. B^. S8 S. 
8886. Koeh, Dr. G.v., Das Skelett der Steinkorallen. S. A. Leipzig 

1896. 40. S. S51— S76. 

8888. ^oZoma^sss/i^tfA^^, Jahresbericht d. deutsch., 1896. S^, 80 S. 
Könia, Prof,, s. Ziegler, Dr. J. 

8297. Köstler, K., Handbuch d. Gebiets- u. Ortsknnde d. Kdnigr. 
Bayern. II. Bd. 1. Abschn. Urgeschichte u. Rdmer- 
herrschaft bis z. Auftreten d. Bajoarier. München 1896. 
4» Xn u. 190 S. 

8826. Kraue, Franz, Höhlenkunde. Wege n. Zweck d. Erforsch- 
ung unterirdischer Räume; mit 156 Illustr., Karten u. 
Plänen. Wien 1894. 8«. 808 S. 

3445. KreiB'Landwiriechafteechule Liehknhof b. Nürnberg. 8 Ta- 
bellen über Tabaksbau in Mittelfranken. 
Kuroda, S,, s. Chicago (Japan). 

3468. Lahner, Leonh. Chriet, Binleitg. in d. bürgerl. Rechte, bes. 
die Nümbergischen. Frankfurt u. Leipzig 1875. 8^. 
510 S. u. Reg. 

8482. Lellmann, Dr. Eng., Prinzipien d. organ. Synthese. Berlin 
1887. 8». xn u. 512 S. 

8644. Lepeius, Dr. Riehard, Geolog. Karte des deutsch. Reiches. 
27 Blatt 1 : 500,000. Namen?erzeichnis Gotha 1897. fol. 

ö*? S. Digitizedby Google 



) 



77 

3418. L0ydekker, R., Die ^eograph. Verbreitung o. geolog. Ent- 

wickelung d. Säugetiere; aus dem engl, yon Prot 6. 

Siebert, Jena. 1897. S^. 68S S. 
S4I0. Leyh, Dr. Fr., Beiträge z. Kenntnis des Paiäosoieum der 

Umgegend von Ilof a. d. S. Inaugural-Diss. 1897. S^. 
S4ä8. Lochner, Qg. Wolfgang Karl, Ghronolog. geordn. Oberblick 

der deutseh. Geschichte vom 1. Erscheinen der deutsch. 

Völker bis auf die Errichtg. des d. Bundes. Nürnberg 

1837. 80. Xu. 184 S. 
8874. Lätffolhoh v. Colberg, C. Frähorr, Die Drehungen d. Brd- 
kruste in geolog. Zeiträumen. München 1895. 8^ XII 

u. 248 S. 
8354. Lormz, Dr. P,, Die Ergebnisse der sanitarischen Unter- 
suchungen d. Kantons Graubünden in den Jahren 1875 

bis 1879. Bern 1895. 4<» mit 4 Karten, 109 S. 
Luer$sm, s. Mannscript. 
8897. Manutor^: Sachs, syst Botanik; Anal Morph, u. Physiol. 

der PÜansen ; Luerssen, Moose u. Gefäüskryptogamen ; 

Schenk, allg. Bot. 4<>. 
8858. MarUni Friedl, afrikan. Skixien. München 1894. 8». VIU 

u. 186 S. 
8506. Matui, Th,, Guide de la section de T^tat independant du 

Gongo ä Texposition de Bruxelles-Tenrueren en 1897. 

8«. Xm u. 5S4 S. 
Maurer'6$$änge, s. Nürnberg. 
8840. MaximiUanS'Höhle bei Krottensee. 8 Grofsfol.-Photogr. 
8866. Mayorhcfer, Franz, Prakt Anleitung z. Bau einer neuen 

Futterpflanze, LathyrussilyestrisWagneri. München 1898. 

4 Aufl. 8<». m. 22 S. 
8851. MMis, Dr, C, Der Drachenfels bei Dürkheim a. d. H. 

1. Abt mit 1 topogr. Plan, 32 S. 2. Abt mit 2 Tafeln, 42 S. 
8885. Meit%en,x Äug,, Siedelung u. Agrarwesen d. West- u. Ost- 
germanen, Kelten, Römer, Finnen u. Slaven. 8. Bd. u. 

1 Bd. Atlas. Berlin 1895. 8«. 
Merkel, Dr. Sigmund, s. RudeL 
Meedorf, J., s. Undset. 
8808. Müde, Dr. J,, Filices Europae et Atlantidis, Asiae minoris 

et Sibiriae. 1867. S^. IV u. 810 S. 
8895. Moreno, Franeieeo R, Le Mus^ de la Plata. Rapide eoup 

d'oeil sur sa fondation et son d^veloppement Mit 

Tafeln. 8«. 82 S. 
Morgan, s. Chicago (St Louis). 
8481. Moeaik-FahHhaiion, Mosaikbüden, Miniatur-Mosaik, Architekt. 

decor. Mos., Rom. Bildermos., Floreni. Mos. Manu- 

scripte. 4«. 4 Blätter. 

Digitized by VjOOQ IC 



78 

8460. Nafieil, Dr. Chriai. ffemr.y Lehrbach der ebenen Geometrie. 

12. Aufl. 300 HolBSdiD. Ulm 1869. S^ VI u. 144 S. 

74 8. Anhang. 
S410. Nan^m, Friäffcf, In Nacht u. Eis. Die norweg. Polarezpe- 

dition 1898-— 96. Mit einem Beitrag ▼. Kap. Sverdrup. 

207 Abb. 8 Ghromotafeln, 4 Karten. 1897. 2 Bde. 
8442. Neger, Dr. F. W,, Die Araucarienwälder in Chile u. Argen- 
tinien, ill. S.-A. aus der forsU. natarwiss. Ztschr. 4897. 

8». S. 416-426. 
8468. Nürnberg, Adrefebueh, yoUstind., u. Handelsschematismas 

d. St. Namberga.d. ganzen Burgfriedens. 1842. 8 <>. 198S. 
8425. — Bayer, Landeeausslellung 1896: 

I. Offiz. Katalog. Hrsg. y. B. Gewerbemus. S^. 256 S. 

II. » Führer durch dies. y. Dr. P. R6e. •8«. . 

Hl. Nfimberger Ausstellungsberichte u. Führer d. Bayern 
• in Wort u. Bild. Hrsg. y. Gen.-Ans. 68 N^f- Folio. 
8605. — Berichte über d. Versammlungen der Hertha. 4^ 8 Hefte 
Manuskripte. 1869-1878. 1. 1-21. SiUung. U. 22— 
46. Sitzg. Ul. 47 88. Silzg. 
8807. — Carl Chritüan Hirsch Sr Andreae Würfel, Ausführi. Beschrei- 
bung aller u. jeder Kirchen, Klöster etc. wie auch derer 
Siechköbel in u. yor Nürnberg, benebst genauem Yer- 
zeychnis simmtl. H.H. Geistlichen. Nürnberg 1766 m. 
Kupfern. 4^. 512 S. 
8889. — Die Ki^emepannemol im Nürnberger Reichswald. Nr. 187 
der Augsb. Ab.-Ztg. 1895. 
Flora V. Nürnberg, s. Sturm J. W. 
8818. - Hieron. Braun, Prospekt d. St. Nürnberg y. J. 1608. gr. fol. 
Beilage z. d. MitUgn. d. Y. f. Gesch. d. St. Nbg. 1896. 
8417. — Kaialog d. Bay. Hopfen- u. Gersten-Ausstell. in Nbg. 1897. 

8«. 80 S. 
8480. -> Maurer-OeMänge für die Loge z. d..8 Pfeilen im Orient y. 

Nürnberg Nr. 1, 1790. kl. 8«. 96 S. 
8898. — Medic. Geeelleeh. Sr PoUkUfUk, Wissenschaftl. Bericht der 
Nürnberger, für 1889. S. A. 8<». 6 S. 
- - — für 1890. 4 S. 

8497. — Neue Beiträge zur Geschichte d. SUdt Nflrnberg. X. Heft. 

1791. 8 0. S. 57-127. 
8369. — NOmberg's lebende Raths- u. Gerichtofähige Familien der 
yormaiigen Reychsstadt. 8. Fortsetzung des genealo- 
gischen Handbuchs ders. Nürnberg 1818. 8. VI u 200 S. 
-.- 4. ForUetzung 1827. 80 VUI u. 188 S. 
8814. - /tt^/^iVo/'.JSr., Die Witterung Nürnbergs im J. 1896. schm.fol. 
— . — u. Dr. Siegm. Merkel. Bericht über d. Witterungs- u. 
Krankheitsyerhftltnisse Nürnbergs. 12 Berichte. 8^. 
Jan.-De.. 1897. ,^g,^^, ,^ GoOglc 



79 

8SB9. Nürnberg, SehnUheifs, Fr., B^obtchtongsdaten d. phiooL Station 

NürnlMNrg a. d. J. 188S— 1891. 8 TabeHen. 8^ 
3494. - Phänol. Mitteilgn. 1894. 95. 96. 97. (a. d. Gen.-Anz.) 

8495. — Sekwar%, Q., Plan d. k. b. SUdt MOniberg n. d. SUnd t. 1. 

I. 1878. 1:5000. 

8462. -^ Siebenkeeg, Dr. Joh. Chr., v. d. InteaUt-Erbfolge n. NOrnb. 

Recht. 1787. B^ XU o. 196 & 
8466. — .— Naehrickten y. Armeofltiftuiigen in NOrnberg 1792. S^, 

Vorr. u. 60 8. 
8878. — Vtrhandimmgmi der 82. Wanderyersammlang b. Landwirte 

10 Nürnberg 1895. 8<». 142 S. 
8411 - Wappm, a. der ehenial. Reichsstadt Nfiniberg. b. Jongfem- 

adler. 2 Tafeln. 4». 
8867. Ormay , Ähgander , Sapplementa fttnnae coleopterum in 

transsilyania. Nagj-Sieben 1888. 8«. 54 S. 

8496. P^el, Dr. JuUus, BinfOhrong in die Geschichte d. Medicin. 

25 Yorlesangen. Berlin 1898. S«. XU u. 574 8. 
8488. PtaUner, Carl, Frieär,, Die Probirkunst mit dem Löthrohre. 
8. Aufl. 78 Holzschn. Leipzig 1858. 8^ XXII u 716 S. 
8849. PSveriem, H., Ober das Vorkommen yon yaccinium inter- 
mediam Rathe in Bayern. S. A. 1897. 8^ 
Prior, Dr. E., s. Bibliothek fOr Mahrongsmittelchemiker. 
Ratoel, Fr., s. Verein fOr Erdkunde. 
8865. ReUzemiem, Dr. FrU%, 1. Zur Kenntnis des Diketohydrindens. 

II. Ober Anhydrobidiketohydrinden, ein Gondeosations- 
prodnkt des Diketohydrindens. Wanbttrgl892. 8<>. 48 S. 

8890b. Robertson, anthropometry Recension in Saturday Reyiew. 
1878. fol. 

8406. Römerka$teU ßirieiam$, das, Altertumsverein Weissenburg 
a. S. S. A. 1891. 80. 8 S. 
Rudel, Prüf. K,, s. Nttmberg. 
iSodbt, s. Manuskript 

3848. Saekm, Dr. E. Freiherr von. Das Qrabfeld yon HailsUtt in 
Oberösterr. n. dessen Altertflmer. 26 Taf. Wien 1868. 
4». IV u. 156 S. 

8824. Sapper, Dr. Carl, Das nördl. Mittel- Amerika nebst ein. Aus- 
flug nach d. Hochland y. Anahuac; mit Karten u. Abb. 
Braunschweig 1897. 8<>. XII u. 486 S. 

8495. Sauer, Karl, Der Moritxberg, aus Nr. 285, 1897 des Fr&nk. 
Kurier. 

8S|I(7. SeheUong, Dr. 0., Die Klimatologie der Tropen nach den 
fKrgebn. des Fragebogenmateriales in A. d. deutschen 
Koloniaigeseliach. 1. Bericht Berlin 1891. 8«. 48 S. 
Sf^ienk, s. Manuskript 

8477. Seherzburger Aktenetücke 1820/1. 8». 78 S. 

Digitized by VjOOQ IC 



80 

S478. Schiff' 4* Seewesmapiel, zur Unterfa. u. Bei. f. K. u. Erw. m. 
Tiellen Kupfferleyn, gedruckt in diessem Jahr. Nürn- 
berg. 8 <>. 160 S. 

S441. Sehmper, HUI. W., Synopsis muscorum europaeorum prae- 
missa introduetione de elementis bryologicis tractante. 
Tabellen, Karte, YUI Taf. Stuttgartiae 1860. 8<». GLIX 
u. 784 S. 

8410. . Schlegel, Dr. Fr,, Die yerschiedenen Methoden der Heilkunst 
1858. 8». Vm u. J12 S. 

8805. Sefuneltz, Dr. J, D. E., Ethnographische Musea in Midden- 
Europa. ill. Leiden. 1806. 

8405. Sekrüfery Dr.. Theod., Das Keuper- u. Liasgebiet östL von 
Bamberg. GeognosL-oroplast. Skiue mit Rücksicht auf 
d. Yegetationsyerhältn. Bamberg 1887. %\ 64 S. 

3498. Schul-ÄUas nach Stielers Handatl. ?erkl. 1885. SO Karten. 
Querfol. 

8856. Sehulardnung für d. iechn. LehraneetUen m Bayern. Würz- 
burg 1864. 18 0. 50 S. 
SchuUheifs, Fr., s. Nürnberg. 
Schwarz, Q,, s. Nürnberg. 

8394. Senckenberg. Nalurf, Gesell., Lieder z. Jahresfeier der, 1884. 
8«. 4 S. 

8864. Siebenbürg. Verein f. Nakmeieeeneehirfi , Der, in Hermann- 
stadt, seine Entstehung, EntwickeAang, Bestand; Hermann- 
sUdt 1896. 80. 68 S. . 
Siebenkeee, Dr. Jtfh, tihriei., s. Nürnberg. 
Siebert, Q., s. Lydekker. 
Siemssen, Q., s. Arbeiten d. D. Landwirtsch.>6esell8ch. 

3388. Simonkai, Enumeratio florae teanssilvanicae yesculosae cri- 
' Uca. (kgl. ung. naturw.Ges.) Budapest 1886. 8^. L. u. 678 S. 

3414 Stalulen d. Qeeelleohaft d. Naiurfarecher u. Ärzie. Von d. 
Jahresversammig. in Halle, beschl. den S8. Sept. 1891. 
8« 12 S. 

8486. Sleme , A sentimental joumey through France and Italy. 
Paris and Lyon 1887. 12<>. 186 S. 

8498. Siurm, Priedr., Manuscript Kritische Besprechungen und 

bruchstückweise Übersetzungen ?on: 
Lesson R. P., Histoire naturelle des oiseauz mouches, 58 S. 
— . Histoire naturelle des colibris 41 S. 
— , Les Trocbüidöes ou les colibris et les oisoaux mou- 
ches. 46 S. 1882/88; mit einer kolor. Bleistiftzeich ng. 

8499. — Manuscript: Cber einige Vögel toq Chile, beobachtet 

im März u. Anf. April 1827 v. F. H. v. Kittütz, Naturf. 
d. Exped. des Seniarin., übers, aus d. M6m. pr. k TAcad. 
J. d. Bcienoes de Si-P^tersbonrg. Tome 1, 2me Utt. 
1880. 48 S. u. 8 Blatt color. Bleistiftzeichn. 4«. 



81 

8800. Sturm, Fr., M anuscript : Yeneichnis d. Land- u. Flufs-Gonchy- 
lien in d. Sammliiny r. Friedr. Stunn. Nürnbergl886. 4 ^ 
164 S. Text, 10 kolor. vu 1 unkolor. Knpfeniich, 1 Blei- 
•tüUeichng., Tenehied. Zettel; ein Yeneiehnif t. aus 
Amerika erhaltenen Gonehyliea. Femer eine 10 8. ftarke 
Handachrift: Dotaaaen Katalog. Erlangen 1889. 

8601 Sturm, Joe, S4 Tafeln Bntomolog. Kuj^erstielie ohne Text, 
kl. 8«. Nflrnberg 1704. 

8608. — Mannscript. Hymenoptera (Untersnebongen flh. d.'Merk- 
male zur leichteren Gattungsbestimmang der Hymen- 
optera n. Diptern.) S18 S. 

8601. Sturm, /. W., Flora t. NOmberg. Manoacript. 8^ 80S 8., 
10 8. Register, 4 Beilagen. 
Sf^, F. V., 8. Arbeiten d. D. Landirirtach. GeaelL 

8847. Ta§dkmiberg, Dr, B. L., Die Hymenopteren Deatachlanda 
nach ihren Gattungen u. teilweiae n. i. Arten. Leipzig 
186«. 8«. S78 a 

84S7. Toldi, Dr. Carl, Anatom. Atlaa für Stadierende n. Arzte. 
Unter Mitwirkg. Dr. Alois Dalla Rosa. Wien u. Leip- 
zig 1896/97. schmal 4» 

8898. TyndaU, John, deatsche Ausg. ron Anna t. Helmholts o. 
Clara Wiedemann. Die W&rme betrachtet als eine Art 
der Bewegong. 1S6 Holaachn. o. 1 Tat 4. Aufl. Braun- 
schweig 1894. S^ XXXIY u. 718 8. 

8878. Und$et, Dr. Ingvald, Das erste Auftreten des Eisens in Nord- 
Europa. Deutsch T. J. Mestorff. Hamburg 1881 8 ^ 
100 Hohschn. 8S Tal XYl u. 6S4 8. 

88S7. Vereinfßr Erdhunde zu Leipmg. Beilage z. d. Mitteilgen. des .. : 
Dr. Alois Geistbeck, die8een der deutsch. Alpen. 1886. 
foL WissenschaftL Yeröifentlichungen : Beitrftge z. 
Geographie des festen Wassers. S KarteUi 1 Profil 
u. Abb. Leipzig 1891. 8». Yl u. 814 8. 
Fr, Ratzei, Anthropo-geograph. Beiträge. Zur (Gebirgs- 
kunde, TorzflgL Beobachtg. 6b. Höhengrenzen u. 
Höhengflrtel. Yiele Karten. 1896. 8 ^. 86S 8. 
Dr, (kear Bcnmtmn, Der 8ansibar-ArchipeL 8^. 

a. Die Insel Mafla:i896. 1 Karte 88 8. 

b. > > 8ansibar 1897. 1 Karte 48 8. 

S667. Y$rhandkmom des 1—11 deutschen Geographentages. 8^ 

13 B&nde. 1881—1897. 
2659« Ttrhandtunim d€r Ge$ell$öhftfi dmUtim Naiurfartcher u. 

Ar%t^ 66. Yersammlung zu Nflmberg. Leipzig 8^. 

1. TeiL Xn u. 670 8. 1898. 

1 Tefl, 1. HiUle: Matunrissenschaftl. Abhandlungen. 
— 1 » Medisinische Abhandlungen. 1894u 

Digitized by^OOQlC 



82 

8464. Verhandlungm der Kammer der Abgeordneten dee Eönigr. 
Bayern \m 1894. (IfH den Y. tiber den Ludwigg-Donaa- 
MaiD-Kanal.) IS. Bd. Mlbichen. 8^ 116 S. 
Vogel, Dr. J, Ä., s. Arbeiten d. D. Landw. Gesellsch. 

8482. Vogh Dr. JbA. Nep., Dom-Sagen. Wien 1858. 4. Aufl. Ge- 
dichte. 8«. loe S. 

8452. regier, Dr. Wilh. Friedr,, LeitftidoB beim 1. Unterr. in der 
Länder- u. Völkerkunde. 4. Aufl. Hannover 1880. S^. 

ym o. 106 s. 

Vegi, €., 8. Hiudey. 

8491. Yolkert, Äug,, Meilenbereelmnng*- u. Postkarte Ton Mittel- 
europa. Münehen 1848. 1 : 3,400.000. 

8889. Wagner^ Dr, Fr„ Der Alpenwanderkors des^schweis. alp- 
wirtooli. Vereins. 8f 12 S. 
Wagner, fF, siebe Geograph. Jahrbuch. 
W a n d erv e r e ammlung b. Ltmdmrie, s. Nürnberg. 

8876. Weber, Fr., 1. Streiflichter auf Prftbistorisches aus alten 
SchriftsteUen. 4 S. 2. Bericht über neue .vorgesch. 
Funde in Bayern für 1892. 10 S. S. A. a. Beiträge 
zur Urg. Bayerns. 4^. 

8802. Wegener, Gg», Zum ewigen Eise. Eine Sommerftdurt ins 
nOrdl. Polarmeer. 1897. illustr. 8<». XU u. 860 S. 

8298. Wegteeieer d. eehteed. Tourieten^Yer. Nro. 10: Stockholm, 
die Hauptstadt Schwedens; übers, t. Dr. P. Wittmann, 
illustr. Sto^holm 1895. qu. 4®. 148 S. 

8468. Weidenkeiler, D. J. J., Von dem Nutsen u. der Notwendig- 
keit der teehn.-dkonom. Brsiehungs-Institilte. II. Aufl. 
Nürnberg 1842. 80. X u. 256.8. 

8879. Weinber g , Dr. med. R., Das Gehirn der Letten aus dem 
anat. inst der k. Unir. Dorpat. Kassel 1896. 

1. Teil T^xt 8«. Vorwort u. 206 S. 

2. > Atlas. 20 Tafeku Fo). 

8898. Weiebaeh, Dr. Älbim^ Synopsis Mineralogica. Syst Ober- 
sicht des Minerakeicbs. 8. Avfl. Freiburg 1897. S^. 
98 S. 
WeUig, s. Feuerbestattung. 
8820. WeUeiein, R. von, Die europ. Arten der Gattung (}entiana 
aus der Section Endotricha Froel u. ihr entwickelungs- 
gesohichtticher Zusammenhang. Wien 1896. 4<^. 74 S. 
u. IV Tafeln. 
8800. Wheeler, C. OHberi, Medical Gbeoustry, ind. the ontlines of 
organie and physiological chenistry. 5 th. Ed. Chicago 
1890. 
Wheeler, (%fi J^ s. Chicago (Paciic R.) . 
Wkiänmm, ». Chieago (Boston)« 

Digitized by VjOOQ IC 



83 

Wiedemofin, Clnra, s. Tyndall. 

S48i. Wisdmnann, fieorg Chritt. Friedrich, Gedichte von dems. 
Nürnberg 1826. kl. $<>. 96 S. 

3878. Wiesbauer, J. B. u. Mich, Haeelberger, Beitrige s. Rosen- 
flora V. Oberösterr. Salzburg u. Böhmen. Linz 1891. 
8«. VI u. 40 S. 

3371. WildbergeTy Dr. Joh., 3. Bericht üb. d. Orthopäd. Heilanstalt 
in Bamberg. Bamberg 1839. 6 Abb. 8^ 60 S. 

3387. WüMädier, D. Rieh., Untersuchungen L d. Tropingruppe. 
HabilitationsschrifL München 1896. S» in S. 
Wiitmann, Dr. P., s. Wegweiser. 

3345. Wörlem, /. W., Die Houbirg od. €reschichte d. Nürnberger 
Schweiz, Hersbrack, Altdorf u. Lauf mit ihren Umge- 
bungen im weltbistor. Zusammenhang. Nürnberg 1888. 

u. 80. XX u. ns S. 

3458. Wörierbueh, Deutsch, Französisch, Italienisch, Englisch, La- 
teinisch u. Spanisches. I. Theyl. Nürnberg 1786. 8^ 
820 S. 
Würfel, s. Hirsch G. G. 

3197. ZeUeehrififür wieeeneehqfU. Mikroeeopie. Heft 2 v. Bd. 8. 8 <>. 

3835. Ziegler, Dr. M. u. Prttf. Dr. WaUher König, Das KUma 

von Frankfdrt a. M. Frankfurt 1896. 4<» mit 10 Tat 
LXXXIY u. 32 S. 
3461. ZoU- u. Mautordmmg für die Gesammtstaaten des Königr. 
Bayern. 8» 104 S. 

3836. Zürich, Gatalog der Sammlungen der antiquar. Gesellschaft 

in — , 1. Teil Vorröm. Abteilung 216 S. 4« 

2. Teil. Griech.-ital.-röm.. Assyr-Bgypt Abtlg^l66 S. 

3. t Alamanisch-Burgund. Gräberfunde. Mittelalter). 

Abtlg. 108 S. 



Digitized by VjOOQ IC 



Digitized by VjOOQ IC 



Jahresbericht 



der 



Naturhistorischen Gesellschaft 



zu 



Nürnberg 



für 



1898. 



->->^<- 



Nürnberg 
1899. 



j 



Digitized by VjOOQ IC 



ü. E. Sebald, Nürnberg. 

Digitized by VjOOQ IC 



Jahresbericht 



der 



Naturhistorischen Gesellschaft 

zu Nürnberg 

für 1898. 



L Bericht über die Thätigkeit der Oesellschaft. 

LJie Ansahl der ordentlichen Mitglieder betrug am Ende 
des Jahres 41S gegen 42S zu Anfang desselben ; die Gesellschaft, 
der im Laufe des Jahres 17 Mitglieder beitraten, verlor durch 
Austritt resp. Wegzug 18, infolge Ablebens 7, nämlich die 
Herren Bernhard B a u m ü 1 1 e r , Dr. med. u. prakt. Arzt; Karl 
Bock, Fabrikdirektor; Herm. Kämmerer, Dr. u. kgl. Professor 
an der Industrieschule; Max Kohn, Kommerzienrat; H. 
Humbser, Kommerzienrat in Fürth; Leonhard Schaff, Grofs- 
händler; Oskar Stein, Dr. med. u. prakt. Arzt, welche sämtlich 
ihr warmes Interesse an der Naturhist. Gesellschaft stets in 
dankenswertester Weise an den Tag legten, während Herr 
Dr. Baumüller in seiner Stellung als langjähriger Sekretär 
und Direktor derselben und Herr Dr. Kämmerer als Obmann 
der chemischen Sektion Gelegenheit hatten, sich in ganz be- 
sonderer Weise um die Gesellschaft verdient zu machen. Allen 
den Dahingeschiedenen wird die Gesellschaft ein treues An- 
denken bewahren. Die Zahl der korresponcUerenden Mitglieder 
— zur Zeit 40 — hat sich um S vermehrt, nämlich die Herren 
Dr. Hugo Glück, Privadocent für Botanik an der Universität 
Heidelberg; Gordon y de Acosta, Präsident der Akademie 
in Habana und Karl Warnstorf, Professor in Neuruppin. 

Digitized by VjCjOQIC 



Von den Ehrenmitgliedern verloren wir durch den Tod Herrn 
Geheimrat Dr. W. v. Gümbel, Oberbergamtsdirektor und 
UniversitHtsprofessor zu München. Sein Hingang bedeutet 
nicht nur für die Wissenschaft im Allgemeinen einen überaus 
schweren Verlust, sondern ganz speziell für Bayern, dessen 
geologische Erforschung von ihm in trefflicher Weise durchge- 
führt und in seinem Werke in mustergiltiger Weise zur Darstell- 
ung gebracht wurde; ja auch Nürnberg ist ihm zu besonderem 
Dank verpflichtet für das ausführliche Gutachten, das er be- 
züglich der Ursprungs- Wasserleitung erstattet hat. Neu ernannt 
wurden zu Ehrenmitgliedern: Herr Dr. Wilhelm BlasiuR, 
Geh. Hofrat, Professor und Direktor des Naturhistor. Museums 
und des Botanischen Gartens in Braunschweig, und Herr August 
Müller, Kaufmann dahier, eines der langjährigsten und treusten 
Mitglieder unserer Gesellschaft. Die Zahl der Ehrenmitglieder 
beträgt zur Zeit 24. 

Zu den bisher bestehenden 4 Sektionen trat im Laufe des 
Jahres eine zoologische hinzu. Die Vereinsversammlungen, 
welche regelmäfsig an jedem Mittwoch stattfanden, erfreuten 
sich meist einer regen Beteiligung. Allen, die durch Vorträge 
oder kürzere Referate und Demonstrationen den Mitgliedern in 
manchfaltigster Weise Anregung und Belehrung boten, spricht 
die Vorstandschaft verbindlichsten Dank aus, insbesondere 
Herrn Dr. Glück, der uns durch eine Reihe von Vorträgen 
aus dem Gebiete der allgemeinen Botanik erfreute, sowie Herrn 
Dr. Barabo, der an 3 Abenden über seine Reise zum medi- 
zinischen Kongreis in Moskau überaus interessant Bericht er- 
stattete. Bei den Demonstrationen trat wiederholt der Wert 
des Skioptikons zu Tage. 

Nachstehend folgt ein Verzeichnifs der in den Sitzungen 
des Jahres 1898 gehaltenen Vorträge und Referate: 

1. Sitzung am 5. Januar: 

Herr Wunder, Über wertvolle Knochenreste von Plateosaurus 
Engelhardti, gefunden von Herrn stud. rer. nat. Wunder 
nach Blanckenhorn JiSaurierfunde im Fränkischen 
Keuper« ; 

» Dr. Heerwagen, Bericht über den literarischen Einlauf; 

p Dr. Frankenburger, über Knochenreste aus dem Sohäff- 
scben Anwesen in der Köhnstrafse; 

Digitized by VjOOQ IC 



5 

Herr Dr. Biehringer, Schenkung von Vierkandt JiVolks- 
diohte im westlichen Afrika«; 
> Ertbeiler, Demonstration abnorrogroFser £nzianwurzeln 

und über Bereitung des Enzianschnapses; 
» Schwarz, über die Verbreitung einiger Sucoulenten und 
Übergabe einiger Geschenke. 

2. Sitzung am 12. Januar: 

HerrPaalzow, Vorlage eines Stückes Thonschiefer mit Ab- 
drücken 5 verschiedener Farnspezies; 

* Dr. He er wagen, Referat über Beziehung einiger Vögel 

der Verein. Staaten zur Landwirtschaft. 

3. Sitzung am 19. Januar: 

Herr Engelhardt, Vortrag: *Bilder aus dem Karst« und 
Beschreibung eines Ausflugs von Triest nach Miramare ; 

* Dr. Bernett, Übergabe eines Ealkspatskalnoeders aus 

Grofssachsenheim in Württemberg, geschenkt von Herrn 

Dr. Friz; 
» Hub er, Vorzeigung der Wirbelsäule eines kleinen Tieres 

mit durchgewachsener Pflanzenwurzel; 
» Dr. Heer wagen, Demonstration eines Olrü (Proteus 

anguinus). 

4. Sitzung am 26. Januar: 

Dieselbe schlofs sich an die Generalversammlung an und war 
nur durch geschäftliche Obliegenheiten ausgefüllt. 

5. Sitzung am 2 Februar : 

Herr Dr. Heer wagen, Bericht über den literar. Einlauf; 

* Kinkel in, Schenkung zweier Reptilien, Amphibolurus 

barbatusGuv. und Tropidonotus piscator Schneid., sowie 

einer Schrift von Dr. F. Hefs über Vergährung der 

Saccharose etc.; 
» Schwarz, Vorlage einer Wildkatze und eines Blendlings 

von Hauskatze und Wildkatze, über Kennzeichen und 

Vorkommen derselben; 
derselbe, Vorlage einiger Geschenke und Anschaffungen; 
» Dr. Frankenburger, Referat über die Einwirkung 

intensiven Lichtes auf Bakterien; 
» Schwarz, über Wanderungen in der Oberpfalz. 

Digitized by VjOOQ IC 



6 

6. Sitzung am 9. Februar: 

Herr Rudel: Vorlage von Korallen (Geschenk des Herrn 
Kaufmann Eichner in Bombay); 

» Dr. Heerwagen, Erläuterung zu dieser Schenkung und 
Vorlage von Fucus vesiculosus aus der Nordsee, Ge- 
. schenk des Herrn Pfarrer Wild; 

* Schwarz, Vorzeigung eines mikroskop. Präparats von 
Milzbrandbacillen ; 

» Dr. Frankenburger, Bemerkungen über Milzbrand- 
erkrankung des Menschen; 

» Schwarz, Vorlage einer Quappe aus der Pegnitz, Ge- 
schenk des Herrn Braumeister Rogg nebst Mitteilungen 
über die Systematik der Fische. 

7. Sitzung am 16. Februar: 

Herr Dr. Wagner: Vortrag über »Die verschiedenen Kalk- 
düngerarten, deren Wert und praktische Verwendung^; 

» Dr. Heerwagen, Vorlage des literarischen Einlaufs; 

» Paalzow, Demonstration von Ghiastolith und Eklogit 
(Geschenk des Herrn Huber); 

» Veit Schultheifs, Demonstration von Echeveria retusa. 

» Schwarz, Demonstration von Gidaris coronatus aus der 
Gegend von Betzenstein, geschenkt von Herrn Kommer- 
zienrat Sachs. 

8. Sitzung am 23. Februar: 

Herr Dr. He er wagen, Vorzeigung eines durchscheinenden 
Quarzgerölls von Rottenburg a. d. Laber, mitgeteilt 
von Herrn Ferd. Kullmann, zweier Häute brasiliani- 
scher Schlangen, Geschenk des Herrn Dr. Koch sen. und 
einer Emys europaea, Geschenk des Herrn Dr. Schubert, 
nebst Mitteilungen über Vorkommen der Schildkröten 
überhaupt. 

derselbe, Vorlage einer Sammlung südamerikanischer 
Amphibien undReptilien, Geschenk des Herrn Dr.Barabo. 
» Kinkelin, Demonstration und Schenkung von Grotalus 
horridus und Lachesis Schlegeli, Vorlage einer Schen- 
kung von Herrn Uebersetzig in Matagalpa (Nicaragua), 
bestehend aus mehreren Schlangen und einem Frosch; 

derselbe, Mitteilungen über Giftschlangen, die Wirkung 
des Giftes und gebräuchliche Gegengifte; 

Digitized by VjOOQ IC 



Herr Dr. Frankenburger, Mitteilungen über Serumimmuni- 
sierung gegen Schlangenbifs, Serumbehandlung von 
Schlangenbissen und Schutzwirkung der Öalle; 

* Schwarz, Demonstration eines von Herrn Paalzow ge- 

schenkten Herbars. 

9. Sitzung am 2. März: 

Herr Dr. Bar abo: Vortrag Ober seine Reise zum internationalen 
medizinischen Kongrefs in Moskau, I. Teil, unter Vor- 
lage zahlreicher Photographien; 

« Kinkelin, Schenkung eines jungen ostindischen Leisten- 
krokodils (Grocodilus porosus); 

« Schwarz, Vorzeigung einer für die Sammlung erworbenen 
Kollektion von Schmetterlingen. 

10. Sitzung am 9. März : 

Herr Apotheker Erhard, Vortrag JiÜber Medizinaldroguen 
aus Amerika« unter Vorzeigung der betreff. Pflanzen 
und Produkte; 

Herr Dr. Heer wagen, Vorlage des literarischen Einlaufs; 
« Dr. Frankenburger, Vorlage einiger Pflanzen aus 
Italien, Geschenk des Herrn Konsul Dinkelsbühl er; 

* Rudel, Besprechung derselben; 

* Kinkelin, Schenkung von Python reticulatus (Spiritus- 

präparat). 

11. Sitzung vom 16. März: 

Herr Dr. Barabo, Vortrag über seine Reise, II. Teil; 
» Wunder, Mitteilungen über Ausgrabung prähistorischer 
Grabhügel bei Schwend, veranstaltet durch Herrn 
Kommerzienrat Bing, unter Vorzeigung der Funde; 

* Kinkelin, Demonstration und Schenkung einer Baum- 

schlange Dendrophis pictus und einer Eidechse Gecko 
verticillatus ; 
» Dr. Heerwagen, Vorlage des literarischen Einlaufs und 
Besprechung einer vom Württembergischen Landes- 
fiscbereiverein herausgegebenen Tafel, die Fische Süd- 
deutschlands darstellend. 

12. Sitzung vom 23. März: 

Herr Dr. Glück, Vortrag über die *Morphophologie und Ana- 
tomie der Wurzele unter Vorführung zahlreicher 
Präparate mittelst Mikroskop und Projektionslampe; 

Digitized by VjOOQ IC 



8 

Herr Kinkel! D, Schenkung einer Büdamerikaniscben Natter 
Rhadinaea merremi. 
t Veit Sob ul th ei fs, Demonstration des Wnrzelballens von 
Agapantbus umbellatus. 
IS. Sitzung vom 30. März: 
Herr Hub er, Vortrag über tEmaillierung« mit Demonstrationen 
und Schenkung der demonstrierten Gegenstände für 
die Sammlung; 
B Schwarz, Besprechung einiger zur Bibliothek g^chenkten 
Bücher; 
derselbe, Vorlage einiger Gesteine von Bodenwöhr, Ge- 
schenk des Herrn Eiswerksbesitzers Meisenbach, und 
einer Ansichtssendung der Linnaea. 
» Kinkel in, Vorlage von Hydrus platurus (Seeschlange) 
aus dem Indischen Ozean. 

14. Sitzung vom 6. April: 

Herr Dr. Heerwagen, Vorlage einer Geode, Geschenk des 
Herrn Kommerzienrat Sachs; 

» Dr. Frankenburger, Vorlage und Demonstration von 
zwei Kulturen von Milzbrand- und Tetanusbazillen, 
Geschenk des Herrn Privatdozent Dr. Appel in Würz- 
burg; 

# Kinkelin, Demonstration und Schenkung einer Wüsten- 
schlange Psammodynastes pulverulentus Boie und von 
Gyclocorus lineatus; 

» Dr. Heer wagen, Vorzeigung und Erläuterung einer 
Reihe nach dem Verfahren von Moeller in Neu-ulm 
hergestellter Präparate; 
derselbe, Über Salamandra atra. Vorkommen und Unter- 
schiede der Salamanderarten. 

15. Sitzung am 13. April: 

HeiT Dr. Glück, Vortrag über die Morphologie und Anatomie 

des Blattes mit Demonstrationen; 
» Veit Schul theifs, Vorlage von Stechapfelfrüchten; 
» Kini^elin, Schenkung von Scolopendra gigantea aus 

Queensland ; 
» Schwarz, Über die Verbreitung von Erica carnea. 

16. Sitzung vom 20. April: 

Herr Dr. Barabo, Vortrag über seine Reise, III. Teil, mit 
Demonstration zahlreicher Bilder; ^ , 

Digitized by VjOOQ IC 



9 

Herr Dr. Heerwage n, Vorlage des literarischen Einlaufs; 
» Dr. Barabo, Schenkung eines Delphinscbädels, der Säge, 
Schwanzflosse und eines WirbelkOrpers vom Sägefisch 
und einer Koralle; 

* Dr. Heerwagen, Vorlage einer Anzahl wertvoller älterer 

naturwissenschaftlicher Bücher, eines sog. Sternberger 
Euchens, eines fliegenden Fisches und eines Herbars, 
Geschenk des Herrn Dr. Koch sen.; 

• Kinkelin, Demonstration und Schenkung einer austra- 

lischen Eidechse, Tupinambis nigropunctatus, sowie 
eines feinen und grofsen Gewebes einer afrikanischen 
Spinne^ Geschenk der Frau Apothekers witwe Kleemann; 

> Seel, Schenkung einer geschnitzten Cocosnufsschale aus 
Neuguinea; 

» Veit Schultheifs, Demonstration von Mamillaria pusilla 
texana, Echinocactus setispinus, beide mit Früchten, 
und eines Löcherpilzes von einem Stachelbeerstrauch; 

* Schwarz, Vorlage eines Barsches und eines Werkes: 

Nitzsche, die Nonne (Liparis monacha), beide geschenkt 
von Herr Braumeister Rogg. 

17. Sitzung am 27. April: 

Herr Dr. Heer wagen, Vorlage des literarischen Einlaufs; 
» Hoermann, Referat über den 15. Jahresbericht des 

Bureau of American Elhnology, Washington ; 
» Paalzow, Demonstration von Geaster hygrometricus; 
j> Kinkel in, Demonstration und Schenkung eines Pirols 

(Sericulus mellinus) aus Queensland und einer Natter 

(Lycodon aulicus) aus Manila; 

• Schultheifs, Vorlage von Mammillaria gracilis und 

Echeveria pubescens, beide blühend; 

* Paalzow, Bericht über einen Erdrutsch bei Frauendorf 

und Vorlage zahlreicher Fossilien aus dem Dogger von 
Hetzing bei Staffelstein; 
» Schwarz, Bericht über einen Ausflug in die Hersbrucker 
Gegend unter Vorlage von Gesteinsproben und Pflanzen. 

18. Sitzung am 4. Mai : 

Herr Spandel, Vortrag über die Entwicklungsgeschichte der 
Echinodermen; 

• Dr. Heerwagen, Vorlage eines Spirituspräparats einer 

grofsohrigen Fledermaus, Geschenk des Herrn stud. 
Lindinger; r^^^^T^ 

Digitized by VjOOQIC 



10 

Herr KinkeliD, SchenkuDg einer EoralleDSchlange (Erythro- 
lamprus aesoulapii var. veDustissima) aus SQdamerika; 
» Veit Schultheifs, Demonstration von Ghisteria maculata 
und verrucosa. 

19. Sitzung am 11. Mai: 

Herr Erbard, Vortrag über die Papyruspflanze und ibre Ver- 
arbeitung unter Vorlage eines Stückes Papyrus, ge- 
schenkt von Herrn Dr. Stählin; 

» K i n k e I i n , Demonstration und Schenkung einer brasilian. 
Wassernatter (Helicops leopardinus); 

» Schwarz, Vorlage von Fossilresten aus dem Diluvium 
der Steinplatte, geschenkt von Herrn Ammon, und 
Gesteinen von Roding, geschenkt von Herrn Meisenbach; 

» Paalzow, Demonstration von Tricholoma Georgii var. 
albellum vom Schmausenbuck ; 

» Schwarz, Demonstration einer Anzahl von Pflanzen aus 
dem Dr. Koch'schen Herbar; 

* Veit Schultheifs, Demonstration einer sog. Meerzwiebel 

20. Sitzung am 18. Mai: 

Herr Dr. Hartwig, Vortrag über die Wirkungsweise des 
Stereoskops ; 
» Dr. Heerwagen, Demonstration einer grofsen Anzahl 
südamerikanischer Vögel, im Besitz des Herrn Dr. Loewi ; 

* Hoermann, Vorlage eines vulkanischen Gesteins aus 

Marienbad, Geschenk des Herrn Preifs; 
Kinkelin, Demonstration eines lebenden Gürtelschweifs 
aus Madagaskar, Zonurus giganteus; 

* Veit Schultheifs, Vorlage von Gasteria lingua var. 

nigrescens, Mammillaria elongata und Maxiilaria stelli- 
gera aurea; 

* Schwarz, Demonstration von Gallen an einem Zweig 

von Quercus pedunculata. 

21. Sitzung am 25. Mai : 

Herr Dr. He er wagen, Vorlage des literarischen Einlaufs und 
einer Reihe von Geschenken für die Sammlung; 

* Seel, Demonstration einer Kollektion aus Neuguinea 

stammender Schmetterlinge; 
» Veit Schultheifs, Demonstration von Cereus Mallisoni 
und Phyllocactus Courtisii; 

* Dr. Zwanziger, Vortrag über PseudomorphQsen. 

Digitized by LnOOQ IC 



11 

22. Sitzung am 1. Juni: 

Herr Seel, Vortrag über die Erontauben unter Vorzeigung 
des Kopfschmuckes einer Fäcbertaube; 

» Paalzow, über die geognostischen Verbältnisse von 
Eehlheim und Umgegend unter Vorlage von Gesteins- 
proben ; 

» Rudel, Besprecbung einiger älterer Werke, vorgelegt 
durch Herrn Greiner; 

» Veit Schultheifs, Demonstration einiger Pflanzen; 

» Einkelin, Demonstration eines üromastix acanthinurus 
aus Ägypten, einer Äsche (Thymallus vulgaris), Ge- 
schenk des Herrn Braumeister Rogg und einer Stein- 
axt aus Queeosland; 

• Schwarz, Demonstration einiger Pflanzen. 

23. Sitzung am 8. Juni: 

Herr Dr. Neger, Vortrag: »Botanische Erinnerungen aus Chile« 
mit Skioptikondemonstration einer Reibe von Land- 
scbaflsbildern und Vorlage seines Herbars; 
■ Veit Schultheifs, Demonstration von Phyllocactus cour- 
tisii und Bollweileriana; 

• Einkelin, Demonstration einer Reihe von Geschenken 

des j»Aquarien-In8tituts Nürnberg« und eines Opals 
aus Queensland. 

24. Sitzung am 15. Juni: 

Herr Dr. Heerwagen, Vorlage des literarischen Einlaufs; 
derselbe, Vorlage eines Affenfells, Geschenk des Herrn 
Paul Eramer; 

• Dr. Zwanziger, Vortrag über die Webauer Braunkohlen- 

industrie und -destillation unter Vorlage von Präparaten 
und Demonstration einiger Mineralien von Eammsdorf; 
» Seel, Schenkung eines aus muschelverziertem Geflecht 
bestehenden Armbands aus Neuguinea; 

• Staedtler, Demon.stration europäischer und aufsereuro- 

päischer Ordensbänder; 
» Einkelin, Schenkung einer Grubenotter Lachesis flavo- 

maculata aus Manila und Vorlage von Buntkupfererz 

vom Mount Perry in Queensland; 
> Dr. Barabo, Schenkung einer jungen Riesenschlange 

und einer tropischen Frucht; 

Digitized by VjOOQ IC 



12 

Herr Dr. He er wagen, Demonstration von Ostraceon cubicus 

und eines Tetrodon, gleichfalls Geschenke des Herrn 

Dr. Barabo; 
» Veit Schul th ei fs, Demonstration von Gasteria trigona, 

Sempervivum Lagascae und aracbnoideum; 
B Schwarz, Bericht über einen Gesellschaftsausflug nach 

dem Hohenstein und die dabei gemachte Ausbeute; 
» Erhard, über Verwendung des Papyrus; 
* Dr. Heerwagen, Übergabe einer Schenkung des Herrn 

Medizinalrat Dr. Kehm in Regensburg zum Herbar 

und eines Nymphensittichs (Psittacus Novae-HoHandiae), 

Geschenk von Frau Schnerr. 

25. Sitzung am 22. Juni: 

Herr Füchtbauer, Schenkung einer Tafel Vogelbilder; 

» Seel, Demonstration eines Königsparadiesvogels und 
Mitteilungen über Vorkommen, Gattungen und Biologie 
der Paradiesvögel überhaupt; 

> Staedler, Mitteilungen über die Zucht der verschiedenen 
Seidenspinner unter Vorlage der Entwicklungsstadien 
von Bombyx mori, lebender Raupen und Gocons des 
japanischen Seidenspinners, lebender Raupen und aus- 
geschlüpfter Falter des amerikanischen Seidenspinners 
etc.; 

» Dr. Heerwagen, Vorlageder Paradiesvögel der Sammlung; 

» Schwarz, Mitteilungen über Einwanderung, Vorkommen 
und Verbreitung von Galinsogaea parviflora in unserer 
Gegend, dann über die Verbreitun^smittel der Kompo- 
siten. 

26. Sitzung am 29. Juni: 

Herr Schwarz, Vorlage von Fr. Knapp: »Die Bergfestung 
Rothenberger, geschenkt vom Verfasser; 

» Ho er mann, Vorlage der Geologischen Karte des deut- 
schen Reichs von Lepsius und eines Steins aus dem 
Römerbad Göggingen, letzterer geschenkt von Herrn 
Preifs ; 

» Kinkelin, Demonstration einer Reihe von Reptilien aus 
Brasilien, Geschenk des Herrn Dr. Barabo; 

» Schwarz, Demonstration von Daedalia querciana aus 
Buchberg bei Neuraarkt, Geschenk des Herrn F. Niestrate 

Digitized by VjOOQ IC 



13 



und einer Frucht von Phytelephas macrocarpa, Ge- 
schenk des Herrn Dr. Barabo; 
Herr Veit Schultheifs, Demonstration von Phyllocactus auran- 
tiacus superbus und Stapelia planiflora; 

* Schwarz, Erläuterung einiger botanischer Funde von 

einem Ausflug in die Gegend von Oberweihersbuoh 
bei Stein. 

i7. Sitzung am 6. Juli: 
Herr Kinkelin, Schenkung eines gefleckten Leguans (Iguana 
tuberculata); 
» Paalzow, Demonstration eines von der Blutlaus befallenen 
Apfelzweigs : 

* Schwarz, Demonstration dreiflügeliger Früchte von Acer 

platanoides; 
> Dr. Frankenburger, Mitteilungen Ober Einwirkung der 

Elektrizität auf den menschlichen Körper; 
» Veit Schultheifs, Vorlage von Phyllocactus General 

Garibaldi, Gasteria acinacifolia und EchinocactusLinkii; 
» Schwarz, Demonstration einer reichen CoUektion von 

Erzeugnissen unserer Kolonien. 

28. Sitzung am IS. Juli: 

Herr Dr. Heer wagen, Vorlage des literarischen Einlaufs; 

* Paalzow, Referat über Tümpel, die Geradflügler; 

» GreinBr, Vorlage von D. Valentini*s Natur- und Ma- 
terialienkammer 1704; 

» Schwarz, Demonstration eines bei Roth erlegten Sperber- 
weibchens mit 4 Jungen und einer Ringelnatter mit 
i Gelegen ; 

' V. Schultheifs, Demonstration einerblühenden Euphorbia 
globosa und zweier Pilzbildungen. 

29. Sitzung am 20. Juli: 

Herr Kinkeli n , Demonstriettion von Barbus fluviatilis, Geschenk 
des Herrn Braumeister Rogg, eines Ringelnattergeleges 
und zweier Meerspinnen (Maja squinata), Geschenk 
des Aquarium-Instituts hier; 
» V. Schultheifs, Vorlage vonSesuvium portula castrum 
und Echinocactus longihamatus , in ganz flachen 
Scherben gezogen; 



Digitized by VjOOQ IC 



14 

Herr K i n k e 1 i d , Vorlage von Herrn Schwarz der Bibliothek 
zugewendeter Bücher; 
» Schwarz, Bericht über die geologischen Verhältnisse 
der Gegend von Neumarkt i. 0. und die Beziehungen 
der Bodenverhältnisse zur Flora. 

30. Sitzung am 27. Juli: 
Herr Dr. Heer wagen, Vorlage eines Stückes Pappelholz mit 
eingewachsener Kette, übergeben von Herrn Prager; 

» Kinkel in, Demonstration von Chersydrus granulatus, 
Geschenk des Herrn Prof. Dr. 0. Boettger in Prank- 
furt a. M.; 

» Wunder, Besprechung eines Geschenkes des Herrn 
V. Loeffelholz in Regensburg (Gefäfscherben römischen 
Ursprungs) ; 

» V. Schultheifs, Demonstration einer blühenden Stapelia 
picta; 

* Hub er, Referat über eine neue Erfindung (Vakuum- 

Motor) ; 
» Hoermann, Vorlage bemalter sog. Schellenbögen von 
Neumarkt i. 0. 

Sl. Sitzung am S. August: 
Herr Dr. He'er wagen, Vorlage des literarischen Einlaufs; 
» Wunder jun., Vortrag über rezente und fossile Schwämme; 
t Kinkelin, Schenkung eines jungen Katzenhais, Scyllium 
canicula; 

* Dr. Heerwagen, Vorlage von Geschenken des Herrn 

V. Loeffelholz in Regensburg; 
» V. Schultheifs, Demonstration einer Opuntia Schottii 

und eines prachtvoll blühenden Cereus speciosissimus; 
» Schwarz, Mitteilungen über AUium oleraceum, dann 

über die geologische Beschaffenheit der Gegend von 

Oberleinleiter und Übergabe einer Reihe von Petre- 

fakten von ebendaher. 

32. Sitzung am 10. August: 
Herr Wunder, Vortrag über die Ausgrabungsresultate zweier 
Grabhügel im Forstarat Behringersdorf und zweier 
Hügel im Forstamt Engelthal mit Ausstellung der 
gefundenen Objekte; 

Digitized by VjOOQ IC 



Herr Dr. He er wagen. Vorlage eines Leptolepis und eines 
Aptychus aus dem lithographischen Schiefer von Soln- 
hofen, Geschenk des Herrn Fritz Theisen; 

» Kinkel in, Mitteilungen über die ägyptische Brillen- 
schlange, Naja haje unter Vorlage eines prachtvollen 
Exemplars, eines Geschenks des Aquarium-Instituts; 

» V. Schultheifs, Demonstration von Agapanthus umbella- 
tus und Echinopsis Eyricsii var. Wilkensis in Blüte; 

» Schwarz, Bericht über die botanischen Ergebnisse eines 
Besuches der Pattenhofer Gegend, über Equisetum 
eburneum und über Staminodienbildung. 

33. Sitzung am 17. August: 

Herr Dr. Heerwagen, Vorlage des literarischen Einlaufs; 

* V. SchultheiTs, Vorlage von Dipsacus silvestris; 

» Hoermann, Referat über Frh. v. Richthofen »Schantung 
und seine Eingangspforte Eiautschou«; 

* Müller, Vorlage Solnhofener Versteinerungen. 

34. Sitzung am 24. August: 

Herr Wiesel er, Mitteilungen über eine von Herrn Missionär 
Keller in Kamerun herrührende Sammlung ethno- 
graphischer namentlich dem Götzendienst dienender 
Gegenstände; 

» V. Schul theifs, Demonstration von Gereus Seideli und 
über den Schellenbaum Cerbera Ahobai; 

» Staedtler, über Acherontia atropos aus Kamerun und 
über Orchia antiqua; 

» Paalzow, Demonstration eines Jaspisknollens von Raben- 
stein. 

35. Sitzung vom 31. August: 

Herr Dr. Heerwagen, Vorlage einiger von Herrn Optiker 
Schmidt aus Georgenthal in Thüringen eingesendeter 
Pflanzen ; 

* Wunder, Vorläufige Mitteilungen über die Ausgrabungen 

in der Beckersloh; 
» V. Schultheifs, Demonstration von Echinocactus Scopa 
und E. Scopa var. candidus. 

36. Sitzung am 7. September: 

Herr Rudel, Vorlage des literarischen Einlaufs; 



Digitized by VjOOQ IC 



16 

Herr Wunder jun., Mitteilungen über die Anatomie derSüfs- 
wasserschwämme und Schenkung eines grofsen Exem- 
plares; 
» Rudel, über Stratiotes aloides, Menyanthes trifoliata und 
Trapa natans; 

* Kinkelin, Vorlage von Gerberus rhynchops und Rana 

tigrina, Geschenk des Herrn Professor Dr. Boettger 

in Frankfurt a. M. ; 
derselbe, Demonstration einer lebenden Stutzechse (Trachy- 

saurus rugosus aus Australien; 
« Rudel, Vorlage von Eiern des Katzen hais, Geschenk des 

Herrn Sekondlieutenant Frhr. v. Pechraann; 
» V. Schultheifs, Demonstration von Oxalis comiculata 

purpurascens und Sedum fruticosum var. cristatum 

mitVerbftnderungen und einer abnormen Begonienblüte; 
» Paalzow, Vorlage einiger Fossilien aus der Eifel. 

37. Sitzung am 14. September: 

Herr Dr. He er wagen, Vortrag des literarischen Einlaufs; 
» Kinkel in, Schenkung und Demonstration von Ophiodes 
striatus, sowie Vorzeigung einer lebenden Uromastix 
hardwicki ; 

* Wunder jun.. Botanische Mitteilungen. 

38. Sitzung am 21. September: 

Herr Dr. Glück, Vortrag »Über die Vegetationsorgane der 
Wasserpflanzen« (Mit Skioptikondemonstrationen); 

» Seel, Vorlage von Waffen aus Neuguinea, sowie einiger 
Pflanzen ; 

» Dr. Heerwagen, Vorlage des Balges eines sog. Feuer- 
marders, Geschenk des Herrn Paul Kramer; 

» V. Schultheifs, Demonstration von Crassula Cooperi 
und gracilis. 

39. Sitzung am 28. September : 

Herr Seel, Vortrag über die Beschneidung bei den heidnischen 
Völkern des Altertums und der Neuzeit; 

D August Schmidt, über die Zeiteinteilung der Chinesen; 

» Kinkelin, Schenkung einer Schlange aus Ceylon, Anci- 
strodon hypnale; 

* Schwarz, Vorlage von Hexenbesen von Pinus silvestris, 

einer Adventivpflanze Chaiturus Marrubiastrum und 
von Lunaria annua aus Kandel (Rheinpfalz); 

Digitized by VjOOQ IC 



17 

Herr RQdel, Blüten von Colchicum (byzantinum?), übergeben 
von Herrn Schlachthofverwalter Luff; 
» V. Schu Itheif 8, Versteigerung zweier blühender Stapelieo 
zu Gunsten des Arohäopteiyx. 

40. Sitzung am 5. Oktober: 

Herr Dr. Heer wagen, Vorlage des literarischen Einlaufs; 

• Schwarz, Demonstration verschiedener Geschenke und 

Funde, namentlich einer Reihe von abnormen Frucht- 
bildungen ; 

• Seel, Demonstration einer Sammlung von Schmetterlingen 

aus Neuguinea; 

• Kinkel in, Demonstratioo und Schenkung von Hydrophis 

spiralis und Vorzeigung einer lebenden Wühlechse aus 
Australien (Egemia ounninghami); 

• V. Schultheifs, Demonstration von Aloe abessinica und 

Melilotus macrorrhizus. 

41. Sitzung am 12. Oktober: 

Herr Dr. Glück, Vortag *Ober Flechtent. (Mit Skioptikon- 
demonstrationen) ; 
» Seel, Vorlage einiger geschnitzter Pfeile; 
» V. Schultheifs, Demonstration zweier Agavenarten. 

42. Sitzung am 19. Oktober: 

Herr Dr. Heer wagen, Vorlage des literarischen Einlaufs und 
einer Schlangenhaut (Geschenk des Herrn Konsul Knapp) ; 

• Kinkelin, Demonstration und Schenkung von Calamaria 

sumatrana ; 
> Schwarz, Botanische Mitteilungen, besonders über die 
Verbreitung von Stratiotes aloides in der Nürnberger 
Gegend ; 

• Seel, Schenkung ethnographischer Gegenstände; 

" V. Schultheifs, Demonstration verschiedener Pflanzen; 

• Rodel, Übergabe von Dr. Zander, Beiträge zurKrypto- 

gamenflora, Geschenk des Verfassers; 
•» Dr. Heerwagen, Demonstration mehrerer für die Samm- 
lung ausgestopfter Vögel. 

43. Sitzung am 26. Oktober: 

Herr Schwarz, Vortrag JiNaturhistorische Beobachtungen aus 
dem Gebiet des letzten Manövers«; 

Digitized by VjüOQ IC 



18 

Herr Seel, Demonstration der Entwicklung verschiedener 
Schmetterlinge; 
» Erhard, über eine neue Art von Herbarium; 

* V. Schultheifs, Demonstration von Gasteria acinaefolia; 

* A. Schmidt, Demonstration vonLepista procera, Amanita 

muscera und Cantharellus flavus; 
ö Kinkel in, Schenkung von Psammodynastespulverulentus 

und Oligodon sublineatus aus Ostindien; 
» Knapp, Schenkung mehrerer Konchylien und eines 

Minerals. 

44. Sitzung am 2. November: 

Herr Wunder, Vortrag »Bericht über die Ausgrabungen iu 
Beckei-slohet ; 

» Dr. He er wagen, Vorlage von Nüssen aus Texas, Ge- 
schenk von Frl. Bessi Schenk; 

» Aug. Schmidt, Demonstration von Zeuzera pirina (aesculi); 

» Webel, Demonstration der Biologie von Lasiocampa 
fascitella und Mitteilungen über Zuchtversuche mit 
diesem Schmetterling; 

» Huber, über Garborundum; 

* Schwarz, Bericht über den Gesellschaftsausflug nach 

Kloster Pillenreulh ; 
» Eckert, Schenkung mehrerer Photogramme, aufgenommen 
bei der Ausgrabung in Beckerslohe; 

* V. Schultheifs, Demonstration der Blüten von Cereus 

peruvianus ; 
»> Städtler, Über Acherontia atropos von Kamerun und 

Demonstration von Morphiden aus Columbien und Indien ; 
» Kinkelin, Schenkung von Scyllarus arctus aus dem 

Mittelmeer; 
» Schwarz, Schenkung von Wiedemann »Die Umgebungen 

Nürnbergs«. 

45. Sitzung am 9. November: 

Herr Dr. Heerwagen, Vorlage des literarischen Einlaufs; 
» Dr. Hartwig, Referent über Plehn »Eine neue Theorie 
der Mondsflnsternisset; 

* Paalzow, Vorlage einiger Mineralien; 

» Kinkelin, Schenkung einer Schiauge, Lycodon aulicus 
var. adultus von Manila; 

Digitized by VjOOQ IC 



19 

Herr Schwarz, Demonstration von Rallus aquaticus, Geschenk 
des Herrn Braumeisters Rogg, und sonstigeMitteilungen; 

• Staedtler, über Microgaster nemorum; 

» V. Schultheifs, Vorlage eines auf einem Kirschbaum 

gewachsenen Pilzes: Polyporus versicolor; 
» Hoermann, Vorlage einiger Geschenke für die Bibliothek. 

46. Sitzung am 16. November: 

Herr Dr. Lessing, Experimentalvortrag über das Goldschmidt- 
sche Verfahren; 
•• FQchtbauer, über die minimale Ausdehnung einer 
Nickel-Stahl-Legierung ; 

• Kinkel in, über Früchte von Kamerun, geschenkt von 

Herrn Missionär Keller; 

• Seel, Demonstration eines Paradiesvogels aus Deutsch 

Neu-Öuinea, Paradisea Augustae Victoriae; 
» Paalzow, über eine eigentümliche Verwachsung bei 
Tricholoma nudum; 
derselbe, Demonstration von Kieselnadeln von Schwämmen 
unter dem Mikroskop; 

• Staedtler, Demonstration der sogen, springenden Bohnen. 

47. Sitzung am 23. November: 

Herr Knapp, Schenkung einer Goldstufe aus Californien; 

• Dr. Neuburger, Vortrag über die sog. ägyptische Augen- 

krankheit; 
" Paalzow, Demonstration einer Kohle von Pilsen mitein- 
geschlossenem Zahn von Diplodus Bohemicus. 

48. Sitzung am SO. November: 

Herr Dr. Heerwagen, Vorlage des literarischen Einlaufs; 
» Knapp, Schenkung einer Kollektion Schwefelkies auf 

Ossegger Braunkohle; 
< Kinkelin, Schenkung von Scyllium stellare; 

• Paalzow, Demonstration von Ostrea pectiniformis aus 

dem mittleren Dogger von Eschenbach, geschenkt von 
Herrn Hans Freiherr v. Ebner. 

49. Sitzung am 7. Dezember: 

Herr Erhard, Vortrag Ober seine Reise in das Ortlergebiet; 
' Kinkelin, Schenkung von Cancer pagurus; 
» Dr. Loewi, Demonstration einiger Mineralien aus dem 
bayrischen Wald. 

Digitizedby(^OgIe 



20 

50. Sitzung am 14. Dezember: 

Herr Dr. Hartwig, VorführuDg physikalischer Experimente; 

» Dr. Heer wagen, Vorlage des literarischen Einlaufs; 

» Hoermann, Mitteilungen betr. den Tauschverkehr mit 
anderen Gesellschaften ; 

» Paalzow, über die Struktur der Korallen unter Vor- 
zeigung solcher aus dem Jura; 

» Kinkel in, Demonstration von Eiern des Katzenhais, 
einiger Mineralien aus Queensland und verschiedener 
bei Ausgrabungen in Urnenscherben gefundener Samen ; 

» V, Schultheifs, Demonstration von Sempervivumtabulae- 
forme. 

51. Sitzung am 21. Dezember: 

Herr Dr. Heerwagen, Vorlag des literarischen Einlauf; 
Ä Schwarz, Demonstration seltener Eingeweidewürmer des 

Pferdes ; 
* Dr. Franken burger. Obör Bedeutung und Vorkommen 

der Eingeweidewürmer des Menschen; 
» Kinkelin, Schenkung von Philodryas viridissimus; 
» Schwarz, über Nectria cinnabarina. 

52. Sitzung am 28. Dezember: 

Herr Dr. G 1 ü c k , Vortrag »über den Nutzen und die systematische 
Stellung der Flechtenc (Mit Skioptiokondenmon- 
strationen) ; 

» Paalzow, Schenkung eines von Herrn Kinkelin herge- 
stellten Gipsabgusses eines fossilen Farnkrauts (Soma- 
topteris jurensis); 

» V. Schultheifs, Demonstration von Opuntia leucotricha. 

Die Protokolle wurden abwechselnd vom 2. und 8. Sekretär 
der Gesellschaft, Herrn Dr. Hartwig und Herrn Dr. Franken- 
burger geführt. 

Die Bibliothek erhielt bedeutenden Zuwachs, namentlich 
durch Ausdehnung des Tauschverkehrs mit anderen wissen- 
schaftlichen Vereinigungen ; dieselbe ist vomämlich den erfolg- 
reichen Bemühungen unseres Bibliothekars Herrn Hör mann 
zu danken; die von ihm getroffene Einrichtung, die Aus- 
leihung von Büchern sowie deren Rückgabe an den Sitzungs- 
abenden der Gesellschaft zu bethätigen, hat sich sehr bewährt 

Digitized by VjOOQIC 



21 

und eine wesentlich gesteigerte Benützung der Bibliothek zur 
Folge gehabt; leider wird die übersichtliche Aufstellung der- 
selben durch Raummangel erschwert. 

Die Sammlungen mehrten siclr in mannigfacher Weise 
teils durch Neuanschaffungen, vornehmlich aber durch zahl- 
reiche Schenkungen. Zu ganz besonderem Dank ist die 6e- 
sellschaft Herrn Kinkelin verpflichtet, der wieder viele und 
wertvolle Beiträge zurReptiliensammlungin trefflich präparierten 
Exemplaren uns übergab. Sodann ist eine ansehnliche Mehrung 
der anthropologischen Sammlungen zu verzeichnen durch die 
bei den Ausgrabungen in der Beckerslohe gemachten Funde» 
wobei die Herren Wunder sen. und jun. grofse Opfer an Zeit 
und Mühe brachten. 

Zu beklagen ist, dafs die unzureichenden finanziellen 
Mittel weder die so wünschenswerte Ausfüllung von Lücken 
in den Sammlungen, noch die Beschaffung der absolut not- 
wendigen Räumlichkeiten für übersichtliche Aufstellung der 
vorhandenen wertvollen Gegenstände ermöglichen, ein Mifsstand, 
der nicht mehr länger so fortbestehen kann, wenn nicht 
die Interessen der Gesellschaft ganz namhaft geschädigt 
werden sollen. Die Vorstandschafb sieht sich gezwungen, nun- 
mehr mit allem Ernst auf Mittel und Wege zu sinnen, um die 
zur Weiterführung der wissenschaftlichen Aufgaben der Ge- 
sellschaft unumgänglich nötigen Gelder zu erhalten. Wenn 
sie dabei allerdings auch auf eine künftige Unterstützung aus 
Staatsmitteln, sowie auf etwaige Erhöhung des von der Stadt 
gewährten Beitrags zu hoffen wagt, so rechnet sie — und 
gewifs nicht mit Unrecht — auf die Opferwilligkeit und Liberalität 
sowohl ihrer Mitglieder, als auch weiterer Kreise. 

Die Sammlungen erfreuten sich übrigens trotz ihrer so 
wenig zweckentsprechenden Aufteilung im letzten Jahr eines 
sehr erfreulichen, gegen früher wesentlich gesteigerten Besuchs 
von Seiten hiesiger Schulen. 

Für die auch im letzten Jahr gewährte Unterstützung 
aus städtischen und Kreismitteln spricht die Gesellschaft den 
ergebensten Dank aus. 

Eine weitere Dankespflicht hat die Gesellschaft gegenüber 
all denen, die durch Rückgabe von Schuldscheinen und finanzielle 
Zuwendungen, sowie durch Geschenke ihr Interesse an dem 

Digitized by VjOOQ IC 



22 

Werk, das wir treiben, an den Tag gelegt. — So danken wir 
Herrn Karl Sachs eine Gabe von 100 Mk. zum Archäopteryx, 
einem ungenannten Mitglied SOMk., sowie Herrn Veit Schult- 
heifs 2 lebende Pflanzen (Stapelien), deren Verlosung 27 Mk. 
eintrug. Die übrigen Geschenke sind an anderer Stelle ver- 
zeichnet. 

Endlich haben auch im verflossenen Jahr die Redaktion 
des »Fränkischen Kurier«, des »General-Anzeiger« und der 
»Nordbayerischen Zeitung« die Protokolle unserer Sitzungen 
in ihre Spalten aufgenommen. 



Es wurden heuer 4 zahlreich besuchte Ausflüge unter 
Führung des Konservators unternommen, 2 Nachmittagsausflüge 
und 2 auf den ganzen Tag sich erstreckende: 

Der erste, einNachraittagsspaziergang, ging von Schoppers- 
hof zur Herrnhütte und Schafhof, wobei mehrere parasitäre 
Pilze gesammelt und die* gewaltigen Veränderungen, die 
namentlich das Hirtentäschchen: Gapsella Bursa pastoris durch 
die Besiedelung von Gystopus candidus erleidet, demonstriert 
wurden. Im Walde zwischen Schafhof und Ziegelstein wurden 
die dünenähnlichen Anhäufungen diluvialen Sandes begangen, 
auch einiges floristische Material gesammelt und sodann iu 
Ziegelstein ein kurzer Halt gemacht. Hinter Ziegelstein ergab 
der Waldrand eine Oberaus grofse Form von Myosotis versicolor 
und viele parasitäre Pilzvorkoramnisse, tiefer im Walde konnten 
sich dann alle Teilnehmer an der Farbenpracht der eben in 
Blüte stehenden blauen Schwertlilie: Iris sibirica erfreuen. Auf 
den sandigen Strichen jenseits der Versumpfungen ergaben 
sich kolossal reichblütige Preiselbeersträucher : Vaccinium Vitis 
Idaea in Menge. Alsdann wurde auf dem Ziegelsteiner Keller 
ausgeruht und dann der Heimweg angetreten. 

Der zweite Ausflug wurde trotz Morgengewitter «bei sehr 
zahlreicher Beteiligung durch die Bahnfahrt Nürnberg-Bahnhof 
Schnaittach eröCTnet. Zwischen da und Rollhofen konnte ein 
Arischer sehr instruktiver Aufschlufs besichtigt werden, der 
den unteren Lias und darunter im sehr schönen weifsen abbau- 



Digitized by VjOOQ IC 



28 

wQrdif^n Sieine die Stufe des rbaetisohen Eeupers zeigt. 
Jenseits Rollhofen wurde die grofse diluviale Jurascbottergrube 
lange besucht und wurden nicht nur einige Ammonitenabdracke 
und Belemniten, sondern auch Pecten personatus, die Leit- 
muschel des mittleren Doggers in RollstQckein gefunden. Kurz 
vor Kersbach fand sich die seltene Potentilla Fragariastrum 
im Fruchtzustand, während in Eersbach, woselbst etwas gerastet 
wurde, auch die Nichtbotaniker durch die Farbenpracht der 
eben aufblühenden Kosen, namentlich der punioea und der 
cinnamomea erfireut wurden. Der Weg zog sich nun unterm 
Glatzenstein hin in den duftigen Waldschlag. Hier erfreute 
die Juraflora: Aklei, Waldmeister und anderes; ein abgestürzter 
grofser Ealkblock zeigte sich voll Rhynchonella lacunosa und 
gleich darauf konnte Herr Wunder Reste menschlicher 
Thätigkeit aus prähistorischer Zeit in Form einer lange sich 
hinziehenden künstlichen Abböschung demonstrieren. Kurz 
vor Verlassen des Waldes wurden die Wanderer durch die 
zierlichen eben offenen weifsen Blüten der Monesis grandiflora 
(Pjrola uniflora) entzückt und nach Ersteigung des Plateaus 
erfreute sich das Auge der Teilnehmer an dem Panorama über 
die zackigen Höhen des Hersbrucker Jura, welches prächtige 
Bild im Süden mit der fernen Burgruine Poppberg bei Alfeld 
abschlofs. Auf dem Plateau stellten sich rasch die charak- 
teristischen Bürger der lehmigen Überdeckung der Juraplateaus 
ein und bald darauf stand man an dem hochberühmten Gräber- 
feld der Beckerslobe. Nachdem auch hier Herr Wunder die 
nötigen Erläuterungen gegeben hatte, setzte man nordwärts- 
den Marsch über das Juraplateau nicht ohne floristische Er- 
gebnisse fort, um bei Moosbrunn über den quellenreichen 
Ornatenthon in den Dogger herabzusteigen. Hier fand sich die 
bisher im Gebiete nur einmal konstatierte bläulichblätterige Abart 
der Sanguisorba minor, eine mit Bombinator versehene Pfütze 
am Aufstieg verschaffte auch ,der Zoologie ihr Recht, während 
am Rande des Plateaus liegende grofse Kalksteine herrliche 
Exemplare von Ammoniten und Schwämmen zeigten, nur waren 
dieselben zu grofs, um mitgenommen zu werden. Auf der kurz- 
grasigen Heide präsentierte sich alsdann der mächtige Dolomit- 
stock des Hohenstein, geschmückt mit den Resten des hohen- 
staufischen Burgstalls, eine imposante Erscheinung; die rund- 
lichen Vertiefungen allda bezeichnete Herr Wunder als höchst 
wahrscheinlich prähistorische Trichtergruben. Dann senkt sich 

Digitized by VjOOQIC 



24 

der Weg zum forellenreichen krystallklaren Sittenbach herab, 
nachdem man 8ich jenseits an den epheubedeckten Felsen 
erfreut hatte, war bald Steinsittenbach und die Quelle des 
Sittenbaches erreicht, woselbst in malerischer Felsbildung der 
Dolomit bis auf die Thalsohle herabgeht. Ein einfaches aber 
gutes Mittagessen im öasthaus zu Hohenstein ergab zugleich 
die nötige Ausruhepause und ein inzwischen niedergehendes 
Gewitter störte den fröhlichen Sinn der Teilnehmer nicht, da 
es just zur rechten Zeit, nämlich da man hübsch im Trocknen 
safs, sich eingestellt hatte. Dann wurde die Felsenburg be- 
stiegen, das am senkrechten Fels sich anpressende Setnpervivum 
soboliferum, Erysimum odoratum, und eine selbst von Zimmeter 
noch nicht definitiv festgestellte Potentilla aus der collina- 
argen tea- Gruppe ergaben sich als ihren angestammten Wohnort 
fest einhaltend. Dann genofs man die prächtige Rundsicht 
über tiefeingeschnittene Thäler, zackige Höhen, ehrwürdige 
Ruinen und Schlösser, wie Wildenfels, Hartenstein, Lichteneek 
und Popperg; auch die schöngelegenen Eapellen: wie die 
Pinzigkapelle bei Auerbach, Sankt Anna bei Sulzbach, Maria- 
hilf bei Amberg beleben das weite Bild, das vom Fichtel- 
gebirge über den bayerischen Wald bis zum Nagelberg bei 
Treuchtlingen und Hesseiberg bei Wassertrüdingen, also fast 
über halb Bayern sich erstreckt. Der weitere Marsch ergab 
eine schöne Hieraciumform, bei Treuf konnten an den in 
reichster Blüte stehenden Trugdolden des Wasserholders 
Viburnum Opulus die engen Beziehungen zwischen Tier- und 
Pflanzenwelt demonstriert werden, während gleich darauf wieder 
die zahlreich blühende Zimmtrose an die Beziehungen zwischen 
Geschichte und Flora mächtig erinnerte. Ein schönes Waldthal 
nahm alsdann die Wanderer auf, nahe dessen Ausgang liegt 
die Griesmühle, bekanntlich so tief gelegen, dafs nach der 
Sage nur einmal im Jahr, an dem Tag, wo die Sonne am ' 
höchsten stehet, also an Johanni, der Sonnenstrahl den 
Mittagstisch des Müllers bes.cheint. Dort wurde die Cochlearia 
pyrenaica betrachtet und gleich darauf 2 weitere Standorte des 
zarten doppelblättrigen Milzblättchens konstatiert, sodafs die • 
geographische Verbreitung dieses seltenen Quell- und Fels- 
bewohners wesentliche Ergänzung erfuhr. Der weitere Marsch 
im Pegnitzthal bei Artelshofen war reich an landschaftlichen 
Bildern und war somit der Tag voll von schönen Eindrücken 
für alle Teilnehmer. 

Digitized by VjOOQ IC 



25 

Die dritte Exkursion, auch eine Tagspartie, war veranlafst 
durch die Mär, es komme bei Loderbach das bislang in Franken 
nicht bekannte Garum Bulbocastanum vor; die Nachricht war 
dadurch entstanden, dafs daselbst die Schulkinder die Knollen 
einer ümbellifere im Frühjahr aus dem Boden zögen und ver- 
speisten. Herr Landrat Frauenknecht in Loderbach hatte 
in liebenswürdiger Weise seine Unterstützung zur Aufklärung 
dieser floristisch interessanten Frage zugesagt, und schon 
zwischen Neumarkt und Loderbach schlofs sich den zahlreichen 
Teilnehmern Fräulein Frauen knecht als liebenswürdige 
FOhrerin an. Ein Weiher nahe Blomenhof zeigte sich mit den 
zarten rosa Blümchen der Elodea canadensis, des nordamerika- 
nischen Einwanderers besetzt. Hinter Loderbach wurde Aspidiura 
Thelypteris beobachtet, die sonstigen Bürger dieser sumpfigen 
Striche konnten aber nicht aufgesucht werden, denn die vor- 
hergehenden Regentage machten die Erlenschläge unzugänglich. 

Herr Eckert als Amateurphotograph nahm das lieblich 
am Jurasteilrand gelegene Eircbdorf auf, dann ging es zum 
Brennpunkt der heute zu erledigenden Frage. Die fragliche 
ümbellifere ergab sich nun aber als das an ähnlichen Orten 
Qberall häufige Ghaerophyllum bulbosum, das ja allerdings 
einen knolligen Stengelgrund besitzt, und damit war diese 
Frage erledigt. In Loderbach ward Mittagsrast gehalten, und 
nach derselben erwarb auf Rechnung der freiwilligen Kasse, 
genannt Archaeopterix, Herr Hör mann eine Anzahl Kuh- 
sohellenbögen beim Dorfhirten, beziehungnehmend auf Rankes 
jCtogst erschienene Arbeit über diesen früher wohl noch nicht 
beachteten Gegenstand. 

In der Neumarkter Juraprovinz erzeugen die zahlreichen 
Überdeckungen diluvialen Flugsandes merkwürdige Bilder, 
vergleiche Flora von Nürnberg, allgem. Teil. Abhandlungen 
9. Bd. pg. 101 und 102. 

Gleich nach dem Abmarsch von Loderbach konnte in 
diesem Sinne die sandliebende kleine Com posite Arnoseris pusilla 
konstatiert werden, dann richtete sich der Marsch gen Labers- 
ricbt auf den Wolfstein zu, dessen mächtiger Bergfried und 
stattliche Schlorsmauern von steiler Höhe herabgrübten. Nach 
Ersteigung der Höhe erfreaten überall die vielen Formen 
wilder Rosen. Herr Eckert vereinigte durch photographische 
Aufnahme die Teilnehmer inmitten der stattlichen Mauerreste 

Digitized by VjOOQIC 



der ehrwürdigen WolfsteiDer Burg, in deren Gemäuer die 
zuckerweifsen Aragonitsteine zu besichtigen nicht unterlassen 
wurde. Auch hier ergab die Rundschau vom hohen Wartturm 
ein sonnigklares Bild der lieblichen Landschaft vom alten 
Musensitz Altdorf über die hohe Bergkirche Habsberg hinüber 
ins Sulzthal und über Neumarkt ins Landl mit der von 
2 Kirchen geschmückten Höhe der Sulzbürg. Der Marsch auf 
dem Plateau südwärts ergab die schöne Schopf traubenhyacinte, 
Muscari comosum und an zahlreichen Stellen durchschritt man 
im weitern die diluvialen Sandüberdeckungen, die hier die 
höchsten Stellen des Jurasteilrandes überlagern. Landschaft- 
liche schöne Ausblicke ins Neumarkter Vorland verkürzten den 
Weg zur lieblich gelegenen Wallfahrtskirche Mai*iahilf, wo 
unter den mächtigen Bäumen an aussichtsreicher Stelle eine 
erquickende Rast gehalten wurde. Der schöne Tag neigte sich 
bereits zur Rüste, als man den Abmarsch nach Neumarkt 
antrat, woselbst im Hotel Egner am Bahnhof willkommene 
Atzung den wieder von der Witterung überaus begünstigten 
Ausflug beschlofs. 

Die vierte Excursion flej schon in den Spätherbst und 
trotzdem war auch sie von der Witterung mit einem herrlichen 
sonnigen Nachmittag beglückt. Der Marsch vom Reichelsdorfer 
Bahnhof durch den Wald ergab floristisch noch einiges, indem 
an Scrophularia aquatica die Staminodien demonstriert werden 
kopnten. Bald darauf gelangte man an frisch ausgeworfene 
Kieshaufen diluvialen Materiales. Die Suche nach der Provenienz 
dieser diluvialen Rollsteine war sehr vom Glück begünstigt. 
Einige Ammonitenabdrücke und ein solcher von Rhynchonella 
lacunosa und viele Scyphien gaben deutliche Anhaltspunkte in 
dieser Hinsicht, während auch verkieselte Hölzer nicht fehlten. 

Angesichts des ehemaligen Frauenklosters Pillenreut 
wurde die Lage des für die alte Reichsstadt rühmlichsten Schlacht- 
feldes, dann die Grenzen des einstigen weit ausgedehnten 
Königsweibers erwähnt. Im Klösterlein ward Rast gehalten auf 
hochhistoriscbem Boden, dann wurden die einstige Befestigung 
des Klosters und die geringen architektonischen Reste besichtigt, 
von da zog sich der Marsch an zahlreichen mit der Wolfs- 
bohne: Lupinus luteus bestandenen Feldern vorbei nach Korn- 
burg. Hier besichtigte man die befestigte Kirche, das Egloff- 
steinische und Rieterische Schlofs und zog sich dann die 

Digitized by VjOOQ IC 



27 

Excursion auf das alleiastehende Eircblein Allerbeiligeo bin. 
Bei eintreteoder Dunkelheit ergab nacb Überscbreitung der 
Scbwarzach die Müble am rauschenden Flufswebr, die Fenster 
alle hell erleuchtet, ein reizendes landschaftliches Bild, dann 
ging der Marsch nacb Schwabach, woselbst ein sehr frugales 
Abendessen diesen ebenfalls noch lieblichen Spätberbstspazier- 
gang bescblofs. 



n. BibUotheksbericht für 1898. 

Ankauf und Schenkungen vermehrten die Bibliothek 
um HS neue Zugänge mit i2i Bänden. Am Jahresschlufs 
waren 3673 Katalog-Nummern vorhanden. Es befinden sich 
darunter umfangreiche Geschenke seitens der Universitäts- 
bibliothek üpsala, de THerbier Boissier in Genf, der Herren 
A. Schwarz und Dr. L. Koch sen. Ebenso umfassen sie die 
Widmungen neuer VeröBfentlichungen, welche der Gesellschaft 
im Laufe des Jahres zugeeignet wurden von den Herren: 
Dr. Gordon -Habana, Friedr. Hess, Charles Janet-Paris, 
Prof. Dr. Klunzinger, Friedr. Knapp, Dr. Eug. Ober- 
hummer, Dr. R. A. Philippi-Santiago, Prof. Dr. J. Rackl, 
Prof. Dr. Job. Ranke, Theod. Schübe, Prof. Dr. Em. Selenka, 
Prof. Dr. Friedr. Wagner, Dr. Fr. Weber, sowie vom Stadt- 
magistrat Nürnberg und vom Konservatorium der prähistorischen 
Sammlungen des Staates in München. 

Schriften austausch führte der Bibliothek 660 Ein- 
sendungen zu, welche von 156 Tauschgesellschaften ausgingen. 
In dankenswerter Weise entsprach eine Anzahl von Gesell- 
schaften der Bitte um Nachlieferung ihrer uns fehlenden 
Publikationen, wofür wir den gleichen Dienst zu leisten bestrebt 
waren. Doch sind Band 2, 3, 5 und 6 unserer Abhandlungen 
vergriffen; ein an die hiesigen Gesellschaftsmitglieder im 
Interesse des Schriftenaustausches gerichtetes Ersuchen um 
Überlassung älterer Jahrgänge unserer »Abhandlungen« blieb 
leider ohne Erfolg. 

Eine Revision unserer Tauschliste auf Grund des Zeit- 
sehriftenkataloges im XII. Band der Annalen des k. k. naturh. 
Hofinuseums in Wien ergab, dafs einige darin verzeichnete 
Gesellschaften nicht mehr existieren, andere zwar Veröffent- 
lichungen herausgeben, aber unsere Einsendungen nicht er- 

Digitized by VjOOQ IC 



28 

widern. Es sind insgesamt 23 Gesellschaften. Wir unterlassen 
einstweilen die Einsendungen an dieselben, doch wäre zu 
wünschen, dafs die Beziehungen wieder angeknüpft würden. 

Von 7 Gesellschaften erfolgten Neueinsendungen mit der 
Bitte um Gegenleistung, der wir bereitwillig nachkamen. Wir 
waren auch unsrerseits bestrebt, den Schriftenaustausch aus- 
zudehnen. Gegen Ende des Jahres richteten wir unter Bei- 
fügung des XI. Bandes unserer Abhandlungen an 77 Gesell- 
schaften das Ansuchen, mit uns in Schriftenaustausch zu treten. 
Davon haben bisher 9 dem Wunsch entsprochen und zum teil 
bereits Gegensendungen gemacht, besonders reichhaltig die 
Kon. Akademie van Wetenschappen in Amsterdam. Am Ende 
des Jahres 1897 standen wir mit 225 Gesellschaften im Schriften- 
austausch. 

Die Bibliothek war von 102 Entleihern in Anspruch ge- 
nommen, an welche 133 Werke ausgeliehen wurden. 

Wie im Vorjahre hat auch heuer die Gesellschaft in 
dankenswerter Weise die Mittel gewährt, eine stattliche Zahl 
von Büchern binden zu lassen. Doch ist das Bedürfnis, damit 
fortzufahren, noch immer ein dringendes. 



Verzeichnis der Körperschaften, mit denen wir im Schriftenaustausch 
stehen und der Einsendungen, die uns 1898 zugegangen sind: 

Europa. 
BeatBohes Beich. 

Altenburg — Naturforschende Gesellschaft des Osterlandes. 
Annaberg — Annaberg-Buchholzer Verein för Naturkunde. 
Ansbach — Historischer Verein für Mittelfranken. 
Augsburg — Naturwissenschaftlicher Verein für Schwaben und 

Neuburg. 
Bamberg — Gewerbeverein. 

> — Naturforschende Gesellschaft. 
Bautzen — Naturwissenschaftliche Gesellschaft »Isis«: (I.) Sitzungs- 
bericht und Abhandlungen 1896 u. 1897. 
Berlin — Botanischer Verein der Provinz Brandenburg: Verhand- 
lungen. 39. Jahrg. 1897. 
» — Deutsche geologische Gesellschaft: Zeitschrift, 49. Band, 

3. 4. Heft; 50. Band, 1. 2. Heft. 
» — Entomologischer Verein: Berliner entomolog. Zeitschrift, 

42. Band, 3. u. 4. Heft; 43. Band, 1. u. 2. Heft. 
* '— Gesellschaft naturforschender Freunde: Sitzungs-Berichte, 
Jahrg. 1897. 



Digitized by VjOOQ IC 



29 

Berlin — Kgl. preuOsisches meteorologisches Institut. Bericht 1897; 
Ergebnisse d. Beobachtimgen a. d. Stationen II. u. III. Ord. 
1897, Heft 2; Ergebn. d. Gewitter-Beob. 1895, 1896; Ver- 
handlungen d. Konferenz d. Vorstände D. M. Centralstellen, 
Berlin 1897; [Bezold], die Feier d. 50jährigen Bestehens 
des k. met. Instituts am 16. Oktober 1897. 
Bonn — Niederrheinische Gesellschaft fttr Natur- und Heilkunde: 
SiUungsber. 1897, 2. Hälfte, A-Bogen 9—10, B-Bogen 
3—5; Verhandlungen 54. Jahrg., 2. Hälfte. 
> — Naturhistorischer Verein der preufsischen Rheinlande, West- 
phalens und des Regierungsbezirks Osnabrück. 
Braunschweig — Herzogliches naturhistorisches Museum. 

» — Verein für Naturwissenschaft: Blasius, Festschrift 

zur 69. Versammlung deutsch. Naturforscher und 
Aerzte »Braunschweig i. J. 1897«. 
Bremen — Naturwissenschaftlicher Verein: Abhandlungen, 14. Bd., 
3. Heft; Beiträge z. nordwestdeutschen Volks- u. Landes- 
kunde. [Abhandlungen Bd. 15, Heft 2.) 
Breslau — Schlesische Gesellschaft für vaterländische Kultur. 
Chemnitz — Naturwissenschaftliche Gesellschaft. 
Dan zig — Naturforschende Gesellschaft. 

Darmstadt — Verein fiir Erdkunde und der grofsherzogl. geologi- 
schen Landesanstalt: Notizbl. IV. Folge 18. Heft 1897. 
Dessau — Naturhistorischer Verein für Anhalt. 
Dresden — Statistisches Bureau des kgl. Sachs. Ministeriums des 
Innern: Zeitschrift 43. Jahrg. 1897, Heft 3 u. 4; 44. Jahrg. 
Heft 1—4. 
» — Naturwissenschaftliche Gesellschaft Isis: Sitzungsber. 

und Abhandlimgen, Jahrg. 1897 Januar bis Dezember. 
Dürkheim — Pollichia. 

Düsseldorf— Naturwissenschaftlicher Verein. 
Elberfeld — Naturwissenschaftlicher Verein. 

Emden — Naturforschende Gesellschaft: 82. Jahresbericht 1896/97. 
Erfurt — Kgl. Akademie gemeinnütziger Wissenschaften: Jahrbücher, 

N. F., Heft XXIV. 
Erlangen — Physikalisch-medicinische Societät: Sitzungsberichte, 

29. Heft, 1897. 
Frankfurt a. M. — Physikalischer Verein. 

» — Senckenbergische Naturforschende Gesellschaft: 

Abhandlungen, 21. Band 1. u. 2. Heft; 24. Band 
1—3. Heft; Boettger, Katalog der Reptilien- 
sammlung, II. Teil. 
Frankfurt a. O. — Naturwissenschaftlicher Verein des Reg. -Bez. 
Frankfurt: Helios, 15. Band; Soc. Litt., Jahr- 
gang XI, Nr. 7—12; Jahrg. XU, Nr. 1—4. 
Fulda — Verein fQr Naturkunde: VIII. Bericht über die Vereins- 
jahre 1884—1898. 
Giefsen — Oberhessische Gesellschaft für Natur- und Heilkunde. 
Görlitz — Naturforschende Gesellschaft: Abhandlungen, 22. Bd. 1898. 
Göttingen — Kgl. Gesellschaft der Wissenschaften und Georg Augusts- 
Universität: Nachrichten, Mathem.-physik. Kl. 1897 
Heft 3 ; 1898 Heft 1—3. Geschäftl. Mitteilungen, 1897 
Heft 2; 1898 Heft 1. 
Greiz — Verein der Naturfreunde: Abhandlgn. u. Berichte. III. 1898. 
Guben — Niederlausitzer Geselbchaft für Anthropologie und Alter- 
tumskunde: Mitteilungen, V. Band, 1.— 7. Heft. 

Digitized by VjOOQ IC 



so 

Güstrow — Verein der Freunde der Naturgeschichte in Mecklen- 
burg: Archiv 21. u. 26. Jahr; 51. Jahr (1897), 52. Jahr 
(1898) I. Abteilung. 
Halle a. S. — Landwirtschaftliches Institut an der Universität: Be- 
richte a. d. physiol. Laboratorium, 13. Heft (1898). 
» — Kaiserlich Leopoldino-Carolinische Deutsche Akademie 

der Naturforscher: Leopoldina, Heft XXXIV. 
> — Verein für Erdkunde: Mitteilungen 1898. 

Hamburg und Hamburg-Altona — Naturwissenschaftlich. Verein: 
Verhandlungen 1897, III. Folge V. 
> — Verein für naturwissenschaftliche Unterhaltung. 

Hanau — Wetterauische Gesellschaft ftlr die gesamte Naturkunde. 
Hannover — Naturhistorische Gesellschaft: Festschrift zur Feier des 
100jährigen Bestehens; Katalog der Vogelsammlung; 
Katalog der system. Vogelsammlung ; Verzeichnis der 
vorhandenen Säugetiere; Brandes, Flora der Provinz 
Hannover. 
Heidelberg — Naturhistorisch-medizinischer Verein. 
Hof — Nordoberfränkischer Verein f. Natur-, Geschichts- und Landes- 
kunde. 
Karlsruhe — Naturwissenschaftlicher Verein. 
Kassel — Verein für Naturkunde: Abhandlgn. u. Bericht XXXXII, 

61. V.-J. 1896/97 ; XXXXHI, 62. V.-J. 1897/98. 
Kiel — Naturwissenschaftlicher Verein för Schleswig-Holstein. 
Königsberg i. Pr. — Physikalisch - Ökonom. Gesellschaft: Schriften, 

38. Jahrg., 1897. 
Krefeld — Verein für Naturkunde: III. Jahresbericht für die Jahre 

1896/97 u. 1897/98. 
Landshut — Botanischer Verein: 15. Bericht, 1896/97. 
Leipzig — Fürstl. Jablonowsky'sche Gesellschaft: Jahresbericht 1898. 
» — Kgl. sächsische Gesellschaft der Wissenschaften : Berichte 
über die Verhandl. ; math.-phys. Kl. 1897, V, VI. 50. Bd. 
1898 I— V. 
» — Naturforschende Gesellschaft. 

» — Verein für Erdkunde: Mitteilungen 1876—1880, 1892; 1897. 
Lüneburg — Naturwissenschaftlicher Verein d. Fürstentums Lüne- 
burg: Jahreshefte. XIV. 1896—1898. 
Magdeburg — Naturwissenschaftlicher Verein: Jahresbericht u. Ab- 
handlungen 1896/1898. 
Mainz — Rheinische naturforschende Gesellschaft. 
Mannheim — Verein für Naturkunde. 

Marburg — Gesellschaft zur Beförderung der gesamten Naturwissen- 
schaften: Sitzungsberichte Jahrg. 1897; Schriften, XIII. Bd. 
2. Abteilung. 
Metz — Verein für Erdkunde: XX. Jahresbericht für das Vereins- 
jahr 1897-1898. 
München — Kgl. Bayer. Akademie der Wissenschaften: Sitzungs- 
berichte der mathem.-phys. Kl., 1897, Heft III; 1898 
Heft 1— III. 
» — Bayer. Botanische Gesellschaft. 
» — Geographische Gesellschaft. 
Münster — Westphälischer Provinzial verein für Wissenschaft u. Kunst : 

25. Jahresbericht tür 1896/97. 
Neifse — Philomathie: Bericht XIX, 1874/77; XXV, 1888/90; XXVI, 
1890/92; XXVII, 1892/94; XXVIII, 1894'96. 

Digitized by VjOOQ IC 



31 

Nürnberg — Ärztlicher Verein: Sitzungsberichte. Sep.-Abdruck a. 
d. Münchn. Med. W. Jahrg. 1897. 

— Germanisches Nationalmuseum : Anzeiger Jahrg. 1897. 
Mitteilungen Jahrg. 1897; Hampc, Katalog der Ge- 
webesammlung, I. Teil. 

— Medicinische Gesellschaft u. Polyklinik: XIX. Sitzungs- 
bericht für 1897; Sitzungsberichte 1897. 

— Verein för Geschichte der Stadt Nürnberg: Jahres- 
bericht über das 20. Vereinsjahr 1897; Mitteilungen 
12. Heft, 2. Abt. 1898. 

— Verein för öffentliche Gesundheitspflege. 

— Verein Merkur. 
Offen b ach — Verein für Naturkunde. 

Osnabrück — Naturwissenschaftlicher Verein: Zwölfter Jahresbericht. 

Für das Jahr 1897. 
Passau — Naturhistorischer Verein: Siebenzehnter Bericht für die 

Jahre 1896—1897. 
Regens bürg — Naturwissenschaftl. Verein: Berichte. VI. Heft 1896-97. 
Reichenbach — Voigtländ. Verein für allgemeine u. spez. Landes- 
kunde. 
Reutlingen — Naturwissenschaftlicher Verein. 
Schneeberg — Wissenschaftlicher Verein. 
Schweinfurt — Naturwissenschaftlicher Verein. 
Stuttgart ~ Verein für vaterländische Naturkunde in Württemberg: 

Jahreshefte, 54. Jahrg. 
Wernigerode — Naturwissenschaftlicher Verein des Harzes. 
Wiesbaden — Nassauischer Verein für Naturkunde: Jahrbücher, 

Jahrgang 51. 
Würzburg — Physikalisch-medicinische Gesellschaft: Sitzungsbericht, 

Jahrgang 1897, No. 1—9. 
> — Polytechnischer Zentralverein für Unterfranken und 

Aschaffenburg : Gemeinnützige Wochenschrift, 48. Jahrg. 
Z erbst — Naturwissenschaftlicher Verein. 
Zweibrucken — Naturhistorischer Verein. 
Zwickau — Verein für Naturkunde: Jahresbericht, Jahrgang 1897. 

Österreich-Üngani. 

Aufsig a. E. — Naturwissenschaftlicher Verein. 
Baden bei Wien — Gesellschaft zur Verbreitung naturwissenschaft- 
licher Kenntnisse. 
Brunn— K. k. mährische Landwirtschaftsgesellschaft: Central-Blatt, 
77. Jahrg. 1897. 
> — Naturforschender Verein : Verhandlungen, XXXVI. Bd., 1897 ; 
XVI. Bericht der meteorologischen Commission 1896. 
Budapest — K. M. Termdszettudomänyi Tärsulat (K. U. naturwissen- 
schaftliche Gesellschaft): Francs, Craspedomonadinäk. 
S^. (ungar. u. deutsch). Kohaut, Magyar. szitakötöf61^i. 
4®. (ung.). Kurländer, Erdmagnet. Messungen in Ungarn. 
4 ® (ung. u. deutsch). Röna, a l^gnyomäs Magyarorsz. 8®. 
(ung.). Szädeczky, ZempMni szigethegys^g geolögiäja. 4®. 
(ung.). Aquila, Zeitschrift für Ornithologie, Band II, III, 
IV. 4^. (ung. u. deutsch). Mathem. u. naturwissenschaft- 
liche Berichte aus Ungarn. Band VIII. S^. (deutsch). 
» — Rovartani Lapok (entomolog. Monatsschr.) V. K^tet 1898. 

Digitized by VjOOQIC 



82 

Graz — K. k. Gartenbau - Gesellschaft in Steiermark: Mitteilungen, 
23. Jahrg. 1897. 
» — Naturwissenschaftlicher Verein für Steiermark : Mitteilungen, 

Jahrg. 1897. , (D. g. R. 34. Heft.) 
> — Verein dek* Arzte in Steiermark : Mitteilungen, 34. Jahrg., 1897. 
Hermannstadt — Sicbenbürgischer Karpathenverein : Jahrbuch, 
XVIII. Jahrg. 1898 u. »Beilage«. 
> — Siebenbürgischer Verein f. Naturwissenschaften: 

Verhandlungen und Mitteilungen, XL VII. Band. 
Jahrg. 1897. 
Hermann&tadt — Verein f. siebenbürgische Landeskunde: Archiv, 
N. F. XXVIII. Bd., 1.-3. Heft; Jahresber. 1897/98. 
HoHc — K. k. Fachschule für Bildhauer und Steinmetze. 
Innsbruck — Ferdinandeum für Tirol und Vorarlberg: Zeitschrift, 
3. Folge, 42. Heft. 
» — Naturwissenschaftlich-mediz. Verein. 

Klagenfurt — Naturhistorisches Landesmuseum ftir Kämthen: Fest- 
schrift z. 50 jährigen Bestehen des Kärnther Naturh. 
Landesmuseums. 
Klausenburg (Kolozsvärt) — Siebenbürgischer Museumverein : Sitz- 
ungsbericht d. med.-naturw. Sektion. XXn. Jahrg., 
1897, 19. Band. 
Laibach — Museal verein für Krain. 
Linz — Museum Francisco-Carolinum : 56. Jahresber. nebst 50. Lief. 

der Beiträge z. Landesk. v. vjsterreich o. E. 
Prag — K. Böhmische Gesellschaft der Wissenschaften: SiUungs- 
berichte 1897, I. II; Jahresber. 1897. 
» — Deutscher naturwissensch.-medicinischer Verein für Böhmen 
»Lotos« : Sitzungsberichte 1896 N. F. XVI. (44.) Bd. ; 1897 
N. F. XVII. (45.) Bd. 
Pre«sburg (Pozsony) — Verein für Heil- und Naturkunde: Verhand- 
lungen, Jahrgang 1894—1896. N. F. 10. Heft. 
Reichenberg — Verein der Naturfreunde: Mitteilungen 29. Jahrg. 
Salzburg — Städtisches Museum Carolino-Augusteum: Jahresb. 1896. 
Triest — Societä adriatica di scienze naturali. 
Wien — Entomologischer Verein: 8. Jahresbericht 1897. 

» — K. k. Gartenbaugesellschaft: Wiener illustr. Gartenzeitung 

1898, Heft 1—12. 
» — K. k. geographische Gesellschaft: Mitteilungen 1897, XL. Bd. 

(d. n. F. XXX.) 
» — K. k. geologische Reichsanstalt : Verhandlungen, Jahrg. 1897, 

Heft 14—18; 1898 Heft 1-13. 
» — K. k. zoologisch-botanische Gesellschaft: Verhandlgn., Jahr- 
gang 1897, XLVII. Band. 
» — Naturhistorisches Hofmuseum: Annalen, Bd. XII, Nr. 1—4. 
» — Natur wissenschaftl. Verein an der Universität. 
» — Verein zur Verbreitung naturwissenschaftlicher Kenntnisse: 
Schriften, 38. Bd., 1898. 



Soliweis. 

Basel — Naturforschende Gesellschaft: Verhandlgn., Bd. XL Heft 3; 

Bd. XII, Heft 1. 
Bern — Naturforschende Gesellschaft. 
[ » ] — Schweizerische Naturforschende Gesellschaft. 



Digitized by VjOOQ IC 



88 

Char— Naturforschende Gesellschaft Graubflndens: Jahresbericht N. F. 
XLI. Bd., Vereinsjahr 1897/98; Dr. P. Lorenz: die Fische d. 
Kant. Graub&nden. 
Frauen feld — Thurgauische naturforschende Gesellschaft. 
St. Gallen — Naturwissenschaftliche Gesellschaft: Bericht 1875/6, 

1881/2, 1882/3, 1883/4, 1895—96. 
Solothurn — Naturforschende Gesellschaft. 

Zürich — Naturforschende Gesellschaft: Vierteljahrsschrift, 42. Jahr- 
gang 1897 3. u. 4. Heft; 48. Jahrgang 1898 1.— 3. Heft. 

Balgiea. 

Antwerpen — Acad^mie Royale d' Archäologie de Belgique: Bulletin 

5e S^rie des Annales 1898 I— HI. 
Bruxelles — Soci^t^ beige de Microscopie. 

» — Sociöt^ Royale malacologique de Belgique: Procfes- 

Verbaux, Tome XXIV, 1896 — Tome XXVII, 1898; 
Annales Tome XXVin 1893 — XXXI, Fascic. 1, 1896. 
» — Soci^t^ Royale Linn^enne. 

Frftnkreidk. 

Cherbourg — Soci^6 Nationale des Sciences naturelles et math6- 
matique : M^moires. Tome XXX (3nje S^rie, Tome X.) 

drossbritamden. 

Dublin — Royal Irish Academy. 

Glasgow — Natural History Society: Transactions (N. S.), Vol. V, 
Part n 1897—98. 

Holland. 

Amsterdam — Genootschap Natura Artis magistra. 

» — Koninklijke Akademie van Wetenschappen : Ver- 

handelingen, Afd. Natuurkunde 1« Sectie Deel I— III, 
V, VI; 2e Sectie, Deel I— V; VI, No. 1. Zittings- 
verslagen Deel I~VI. 
Haarlem — Mus^e Teyler: Archives, S^r. II, Vol. V, 4« partie.; 

Vol. VI, le et 2e partie. 
Leiden — Nederlandsche Dierkundige Vereeniging : Tijdschrift 
2<le Serie, Deel V, Aflevering 2-4; Deel VI, Afl. 1. 
» — Sammlungen des Geologischen Reichsmuseums: Serie I. 

Beiträge zur Geologie Ostasiens u. Australiens, Nr. 24 a 
Bd. V, Heft 5. 

ItaUen. 
Brescia — Ateneo: Commentari 1897. 

Catania — Accademia Gioenia di Scienze Naturali : Bullettino, 

N. S. 1898, Fase. L-LV; Atti 1897 Vol. X; 1898 Vol. XI. 

Firenze — Bibliotheca Nationale Centrale: Bolletino d. Public. Ital. 

Nr. 288—311. Indici 1897. 

» — R. Istitttto di Studi Superiori, Pratici e di Perfezionamento : 

Pubblicazioni : Chiarugi, Sviluppo dei nervi encef n. 

mam; Inverardi, Rendic. d.lstituto ostetrico; Luciani, 

II cerveletto ; Oddi e Rossi, Vie äff. del midollo spinale ; 

Ristori^ Cheloniani fossili; Rossi, Struttura d.'ovid. del 

Geotriton fuse ; Rossi, Studio Sülle Uova deglio^nfibi. j 

Digitized by VnQOQlC 



34 

Firenze — Societä Entomologica Italiana: Bulletino anno XXIX, 

Trim. I~IV ; Indice vol. XXVI. 
Modena — Societä dei naturalisti: Atti, S. 3, Vol. XV, anno XXX, 

F. 1 u. 2; Vol. XVI, anno XXXI Fase. 1 u. 2. 
Padova — Societä Vencto-Trentina di Scienze Naturali: Bullettino. 

Anno 1898, Tomo VI, Nr. 3. 
Pisa — Societä Toscana di Scienze Naturali: Atti, Proc. verb. Vol. X. 

S. 243-292 ; Vol. XI, S. 1—56. 
Roma — R. Accademia dei Lincei: Atti, S. V., Rendiconti, Vol. VIP. 
Rendiconto dell' adunanza solenne dei 12. Giugno 1897. 
» — Biblioteca nazionale centrale Vittorio Emanuele. 
Torino — Accademia Reale delle Scienze: Atti, Vol. XXXIII, 1» 

bis 15», Dr. Rizzo, Osserv. meteorol. 1897. 
Venezia — Reale Istituto-Veneto di Scienze, Lettere ed Arti: 

Memorie Vol. XXVI, Nr. 1, 2. 
Verona — Accademia d'Agricoltura, Scienze, Lettere, Arti e Com- 
mercip: Memorie, Vol. LXXIII. Serie in, Fase. I. u. IL 

Luxemburg. 

Luxemburg — Sociötö botanique de Grand-duch^ de Luxembourg: 
Recueil des M^moires et des Travaux No. XIII, 
1890—96. 
> — Fauna, Verein Luxemburger Naturfreunde: Mitteilgn. 

aus den Vereinssitzungen, 7. Jahrg., 1897. 

Bamftnien. 

Bucuresci — Museulü de Geologia §i de Paleontologia: Anuarulü pe 
Anulu 1895; Gr. Stefanescu, Harta Geolog. Gen. a 
Romaniei Blatt CI, CII, CHI, CIV. 

Bnssland. 

Dorpat — Naturforscher-Gesellschaft bei der Universität: Sitzungs- 
berichte, XI. Bd., 3 H. 
Heisingfors — Societas pro Fauna et Flora Fennica : Acta, Vol. XIII, 

1897, XIV 1897—98. Meddelanden 23. Haftet 1898. 
Kiew — Naturforscher-Gesellschaft der Universität : Sapiski Tom XIV 

Wjep. 2; Tom XV Wjep. 1, 2. 
Mi tau — Kurländische Gesellschaft f Literatur und Kunst: Sitzungs- 
berichte und Jahresber. d. Kurland. Prov. Museums 1897. 
Moskau — Soci^t^ Imperiale des Naturalistes : Bulletin, Annöe 1897. 
Riga — Naturforscher- Verein : Korrespondenzblatt XL und XLI. 
St. Petersburg — Hortus petropolitanus : Acta Tomus XIV, Fase. 11. 
» — Imperatorskaja Akademiia Nauk : Iswjestija Seria V, 

Tom VII, 2—5; Tom VIII, 1—4. 

Schweden und Norwegen, 

Bergen — Museum: Aarbog for 1897; Sars, Crustaeea of Norway, 

Vol. n. Part. IX— XII. 
Christiania — Kgl. Norske Frederiks Universitet: Program 1897, 
2aet Semester. 
> — Editorial Committee of Den Norske Nordhavs-Ex- 

pedition 1876—1878. 
Göteborg — Kungl. Vetenskaps — och Vitterhetssamhället: Hand- 
lingar 4de följden, l»ta haftet. ^ ^ 

Digitized by VjOOQ IC 



88 

Stavanger — Museum: Aarsberetning for 1897. 
Stockholm — Kongliga Svenska Vetenskaps Akademien: Öfversigt 
af Förhandlingar 1897, 54. Ergingen; Bihang 23. 
Bandet, Afdelning I—IV; Handlingar, 29. Bandet, 
30. Bandet. 
> — Soci^t^entomologique: EntomologiskTidskrift, 4rg. 18, 

Haft 1—4, 1897. 
Tromsö — Museum: Aarsberetning for 189Ö, 1896; Aarshefter 19, 1896. 
Upsala — Kongliga Universitets Bibliotek: Bulletin Vol. III. Part 2, 
1897, Nr. 6; 16 verschiedene Schriften s. Zugänge zur 
Bibliothek Nr. 3604—3619. 

Amerika. 

ArgeatiiiieB. 

Buenos Aires — Museo Nacional: Comunicaciones Tomo I, No. 1, 2. 
Cordoba — Academia Nacional de Ciencias de la Republica Argentina. 
La PI ata — Bureau g^n^ral de Statistique: Anuario estadistico. 
Ado 1896. 

Brasiliea. 

Rio de Janeiro — Museu Nacional: Revista, Vol. I. 

BriÜsoh Amerika. 

Halifax (Nova Scotia): Nova Scotian Institute of Natural Science: 

Proceedings and Transactions, Session of 18%/97, Vol. DC, 

Part 3. 

Toronto — Canadian Institute: Transactions No. 10, 1898 (Vol. V, 

Part 2). Supplement to No. 9, Vol. V, Part 1 ; Proceedings, 

N. S., Vol. I, Part 4-6. 

Chfle. 

Santiago — Deutscher wissenschaftlicher Verein. 

» — Soci^tö Scientifique du Chili : Actes : 7me Ann^e, Tome 

Vn 20-4« livr. 
» — Universidad. 
» — Museo National. 

Costa Bioa. 
San Jos€ — Museo Nacional: Director J. F. Ferraz, Informe de 1897 
ä 1898. 

Mezioo. 
Mexico — Instituto Geolögico de Mexico: Boletin Nr. 10. 

Montevideo — Museo Nacional: Anales, Tomo H, Fase. VIII; 
Tomo ra, Fase. DC. 

Yereiniflrte Staaten. 

Albany (N.-Y.) — State Museum of Natural History. 

> - üniversity of de State of N.-Y. ogtizedbyGgOglc 



86 

Boston (Mass.) — American Academy öf Arts and Sciences: Procee- 

dings N. S. Vol. XXXII, Nr. 10—17; Vol. XXXÜI Nr. 1 

bis 27, Vol. XXXIV Nr. 1. 

» — Society of Natural History: Proccedings Vol. XXVIII 

Nr. 1—12; Memoires Vol. V, Nr. 3. 

Buffalo (N.-Y.) — Society of Natural Sciences: Bulletin Vol. V, 

Nr. 5; Vol. VI, Nr. 1. 
Cambridge (Mass.) — Museum of comp. Zoology at Harvard College: 
Annual Report 1897/98; Bulletin Vol. XXXI, No. 6—7. 
Vol. XXXn, No. 1-8. Vol. XXVra (Geol. Scr., Vol. HI), 
No. 4. 5. Memoirs Vol. XXm, Nr. 1. 
Chicago (111.) — Academy of Sciences. 

Colorado Springs (Colo.) — Colorado College: Studies. Vol. VI. 
Davenport ^owa) — Academy of Natural Sciences. 
Madison (Wisc.) — Wisconsin Academy of Sciences. Arts and Lettres: 

Transactions Vol. XI. 1896—97. 
Meriden (Conn.) — Scientific Association: Proceedings and Trans- 
actions, Vol. VIII, 1897—1898. 
Milwaukee — Natural History Society of Wisconsin. 
Minneapolis (Minn.) — Geological and Natural History Survcy of 
Minnesota. 
» — Minnesota Academy of Natural Sciences. 
New-Haven (Conn.) — Academy of Arts and Sciences. 
New-York (N.-Y) — Academy of Sciences, late Lyceum of Natur. 
History: Annais Vol. IX, Nr. 6—12, Index; Vol. XI, 
Part I, n. Transactions Vol. XVI, 1897/98. 
» — American Museum of Natural History: Bulletin Vol. XI., 

Part 1. 
» — Microscopical Society : Journal, Vol. XIII, Nr. 4, Vol. XIV, 
No. 1. 
Palo Alto (California) — Leland Stanford Junior University: Con- 
tribution to Biology XFV, XVI. Annais of Botany, Vol. XII, 
No. XLVn. 
Philadelphia (Pennsylv.) — Academy of Natural Sciences: Procce- 
dings, 1897 Part ü, III; 1898 Part I. 
» — American Philosophical Society: Proceedings Vol. VI, 
Nr. 58; IX, 68, 71, 72; X, 75—80; XXXV, 153; 
XXXVI. 155—157. 
> — Wagner Free Institute of Science: Transactions 
Vol. V, 1898. 
Rochester (N.-Y.) — Academy of Science. 
Salem (Mass.) — Essex Institute : Vol. XXVI, No. 4—12; XXVH, 1—12; 

XXVIII. 1—6; XXIX, 1-6. 
St. Louis (Miss.) — Academy of Science. 

» — Missouri botanical Garden : Ann. Report 1890 ; 4. Report 
1893 — 9. Report 1898. 
San Francisco (Cal.) — California Academy of Sciences: Occasional 
Papers V. Denburgh, the Reptiles of the Pacif. Coast 
and gr. Basin. 
St. Paul (Minn.) — Geological and Natural flistory Survey. 
Topeka (Ark.) — Kansas Academy of Science: Transactions, Vol. XV, 

1895—96. 
Trenton (N.-Y.) — Natural History Society. 
Tufts College (Mass) — Studies No. 5. r^^^^T^ 

Digitized by VjOOQ IC 



87 

Washington — U. S. Department of Agriculture: Bulletin No. 9, 
10, 11, 50 ; Yearbook 1897 ; Report of the Secretary 
of Agriculture 1898. 

» — U. S. Geological Survey: Seventeenth Annual 

Report I, n. 

» — Smithsonian Institution: 

— Good, George Brown, the Smithsonian Institution. 
Contributions to Knowledge: Vol. 29, No. 1126. 
Miscellaneous Collectioos: No. 1084, 1087, 1090, 
1093, 1125. 

— Bureau of American Ethnology: 16*1» Annual 
Report 1894—95. 

— U. S. National Museum : Annual Report of the 
Board of Regents. 1895. Bulletin: Part L, No. 39. 
Proceedings: Vol. XIX. 



Die Jahresberichte und Abhandlungen der Naturhistorischen 
Gesellschaft werden aufserdem an folgende Adressen gesandt: 
München — Kgl. Hof- und Staatsbibliothek. 
Nürnberg — Stadtmagistrat. 
StadtbibKothek. 

> Gymnasialbibliothek. 

> Kgl. Bayer. Gewerbemuseum. 



Digitized by VjOOQ IC 



88 



nL Bericht über den Zuwachs zu den Sammlungen. 




Gegenstand 


Fundort 


Schenker 




la« Anthropologe« 






44 


Menschliche Knochen vom Asyl- 








neabau zu 


Nürnberg 
Beckerslohwald 


Magistrat 

J. Wunder und 


218— 


Enochenfiinde, Bronzen, Urnen, 


224 


ümenscherben, hierunter selbst 


bei Kirchsitten- 


anthropolog. 




gemalte, etc 


bach. 


Sektion. 


150 


Römisches Ornament auf einem 


Köfsnachb.Strau- 


V. Grundherr, 




Marmorplattenfragment. . . . 


bing 


Major. 


204 


Schellenbogen, gemalt, für Kühe 


Grofsreuth bei 








Nürnberg 


Seel. 


239 


6 Schellenbögen, gemalt, für Kühe 


Loderbach bei 








Neumarkt 


angekauft. 


240 


Peitschenstiel mit gemalten und 


Grofsreuth bei 






eingelegten Verzierungen. . . 


Nürnberg 


Seel. 




Ib. Ethnographie. 






97 


Geschnitzte KokosnuTsschale . . 


Neuguinea 


Seel. 


190 


Waffen 


r 


Seel. 


124 


Muschelverziertes Armband. . . 


Seel. 


177 


Pfeife 


Türkei 


Frh V Löffelholz. 






Regensburg. 




2. Zoologie* 1 






a. Säugetiere. i 




122 


Affenfell I — 


P. Gramer & Co. 


99 


Plecotus auritus. Langohrige | 






Fledermaus | Erlangen 


Lindinger. 


189- 


Fell vom Collinsky-Feuermarder, 






212 


und anderes Tierfell 


Rufsland 


P. Gramer & Co. 


56-58 


Kopf, Wirbel und Schwanzflosse 








vom Delphin 


— 


Dr. Barabo. 




b. Vögel. 






286 


Motacilla flava, gelbe Bach- 


Veilhof b. Nürn- 






stelze 


berg 


Rogg. 


80 


Sericulus mellinus, Prinzpirol . . 


Queensland 


KinkeUn. 


130 


Callopsittacus Novae Hollandiae. | Neuholland 


Frau Schnerr. 


148 


Astur nisus, $ alt und 4 ganz | 






junge Vögel 


Hofstettenb.Roth 


Meisenbach. 



Digitized by VjOOQ IC 



39 



2: 

I 



Gegenstand 



Fundort 



112 Gallas domesticas, mifsgestaltetes 

I Hühnerei 

79.821 Actitis hypoleucos, Strandläufer, 

: 3 Stück 

238 j Rallu8 aquaticos, Wasaer-Ralle . 

78.81 Gallinula chloropns, grünfüfsiges 

Wasserhuhn, 2 Stuck .... 

I c Amphibien. 
20 Emys europaea, Sumpfschildkröte 
32 1 Crocodilus porosus, Leistenkro- 
kodil, jung 

117 Alligator mississippiensis .... 

96 , Tupinambis nigropunctatus . . . 

6 1 Amphibolurus barbatus 

43 I Gecko verticillatus 

188 1 Ophiodes striatus 



126 I Boa constrictor 



34 
118 
149 

103 



Python reticnlatus 

Tropidonotus natrix 

„ „ cJ und 2 Gelege 



2 abgestreifte 
HÄute . . . 

7 1 „ piscator 

45 1 Bhadinaea merremi ..... 
181 Naja Haje 

60 Cyllocorus lineatus 
226,108 Lycodon aulicus, 2 Stück 

213 Zwergnatter: Galamaria tumatrana 

214 Psammodynastes pulvenüentus . 

Oligodon snblineatus 

Elaps frontalis, 2 Exemplare . . 
Elapomorphns tricolor, 2 Exempl. 
Oxyrrhopus rhombifer, 2 „ 
Leptognathus turgida, 2 „ 

Caiman latirostris 

Phryniscos nigricans 

Homalocranium schistosum . . . 

ÄO , Streptophorus atratus 



I 



Nürnberg 
Veilhofb.Nümgb. 



Europa 



Schenker 

Rudel. 

Rogg. 

« 

n 

Dt. Schubert. 



I 



Ostindien > Kinkelin. 

Verein. Staaten | Aquarien-Institut 
Nürnberg. 



I 



Australien 
Neuholland 
Ostindien 
Brasilien 

Hinterindien 
Italien 
Dutzendteich bei 
Nürnberg 



Ostindien 

Südamerika 

Egypten 

ManiUa 

n 

Sumatra 
Ostindien 
Geylon 
Parahyba 



Madagalpa 



Kinkelin. 



Dr. Barabo. 
Kinkelin. 
Aquarien-Institut 
[Nürnberg. 
Meisenbach. 

Frl. Knapp. 
Kinkelin. 

» 
Aquarien-Institut 

Nürnberg. 
Kinkelin. 



Dr. Barabo. 



Uebersetrig. 



Digitized by VjOOQ IC 



40 






Gegenstand 



Fundort 



Schenker 



31 
26.25 

27 
191 

47 
237 

42 

70 
102 

98 

125 
24 
23 

170 

185 

186 

21 

28 

116 

83 



171 

230 

234 

187 

55 

128 

41 

71 

144 

14 

54 



113, 114 
182 
132 

131, 241 



£rythrolampra6 fissidens . . . 

Him&ntodes cenchoa 

Leptophis liocercus 

AnciBtrodon hypnale 

Hydrus platurus 

Philodryas viridissimos .... 

Dendrophis pictus 

Psammodynastes palveralentus 

Helicops leopardinus 

Erythrolamprus aesculapii vi 

venustissima 

Lachesis flävomaculata .... 

Lachesis schjegeli 

Crotalus horridus 

Chersydrus granulatus .... 



Cerberus rhynchops 

Rana tigriiia 

2 Schlangenhäute um ein Bambus- 
rohr gewickelt 

Hyla baudini D. B. 

Salamandra maculata 

Proteus anguinas, 01m 

d. Pisces, Fische. 

Scylliom canicula 

Scylliom stellare, Eatzenhai 
Eier des Eatzenhai .... 
Eier des Katzenhai .... 
Sqoalus pristis, Waffe des S&gehai 
Ostracion cubicus, Kofferfisch . 
Thymallus vulgaris, Aesche. . 
Exocoetus volitanSjfliegenderFisch 
Cyprinus barbus, Barbe . . . 
Gadus Lota, Aalmpe, Trüsche 
Acerina cernua. Barsch . . . 

e. Insekten. 
Endromia versicolor d.Q . . 

Acherontia Atropos 

Bombyx mori, Seidenspinner . 
Satornia Atlas 



Madagalpa 



Ceylon 
Indischer Ozean 
Sadamerika 
Ostindien 

Brasilien 

Südamerika 
Manila 
Honduras 
Südamerika 
Madras, brit. Ost- 
indien. 



Madagalpa 
Adelsberg.Grotte 

Mittelmeer 



Ind. Ozean 
Pegnitzb.Veflhof 

• *"^ 
Pegnitzb.Veflhof 



Uebersetzig. 



Einkelin. 



Kinkelin 



Kamerun 
Indien 



Dr. Böttger, 
Frankfurt. 



Dr. L. Koch, 
üebersetziff. 
Albert Muller. 
Dr. Fritz. 



Kinkelin. 



Frh.v. Pechmann. 
Dr. Barabo. 

Rogg. 

Dr. L. Koch. 

Rogg. 



GottUeb Schmidt. 
Keller, Kameron. 
St&dler. 



Digitized by VjOOQ IC 



41 



Ä 
» 



Gegenstand 



f. Arachnida. 
75 I Gespinnst einer Spinne .... 

I g. Crustacea. 

119 I Homarns vulgaris, Hammer . . 

232 I Cancer pagoros, Taschenkrebs 

225 I Scyllanis arctns 

95 ' Scolopendra gigantea 

I h. Mollusca. 
215,226 I Verschiedene Conchylien . . . 
111 1 Desgleichen 

I i Radiata. 

120 Echinus miliaris 



121 1 Asteropecten aurantiacus , 
111 [ Asterias sp 



121 
18 I 
8, 
9 
10 
11 
59 

184 



k. Polypi. 

Oculina sp 

Madrepora sp , 

Maeandrina isophylla? . 
Tubipora Hemprichii . . 
Haliglossa pectinata . . 

Musa sp 

Gorgonia fla bellum . . 

1. Polycistina. 
Spongilla? , 



S« Botanik« 

a. Im allffemeinen, Morpho- 
jlogie, Pflanzenbiologie etc. 
233 1 Fibrovasalstränge von der Dattel- 
palme 

200 Zwei verschiedene Landformen 

von Hottonia palustris .... 

169 Pappelholz mit eingewachsener 

Kette 

166 Blatt von Trifolium, 5teilig. . . 
33 Abnorme Frucht von Juglans regia 
196 Yerwadiflung zweier Früchte von 
Prunus domestica 



Fundort 



Afrika 



Nordsee 



Mittelmeer 
Queensland 



Nordsee. 
Mittelmeer. 

Ostindien 



Altwasser bei 
Mögeldorf 



hier gezogen 
Erlangen 

Beratzhausen 

Forchheimer 
Gegend 



Schenker 



Frau Kleemann. 

Aquarien-Institut 
Nürnberg. 
Kinkelin. 



Knapp. 
Bock. 

Aquarien-Institut 
Nürnberg. 

Bock. 

Eichner, Bombay. 



Dr. Barabo. 



Wunder, jun. 



Veit Schultheifs. 

Dr. Glück. 

Herm. Prager. 
Hübner. 
Osk. Kaupert. 

Schwarz. 

Digitized by VjOOQ IC 



42 





Gegenstand 


Fundort 


Schenker 


196 


Verwachsung zweier Früchte von 








Prunus spinosa 


Unterasbach 


Georg Schwarz. 


197 


Desgleichen von Corylus Avellana 


Göfsweinstein 


r> n 


35 


2 Früchte von Cactus Opuntia . 




Consul Dinkels- 
bühler. 


36 


Frucht von Rper nigrum. . . . 


Ostindien 


Consul Dinkels- 
bühler. 


227 


Verschiedene Früchte 


Kamerun 


KellerinKamerun 


127 


Frucht vom Brotbaum? .... 


— 


Dr. Barabo. 


168 


Frucht von Lunaria annua . . . 


cult. 


Kohn 


37 


Blütenzweig von Eucalyptus glo- 




Consul Dinkels- 




bulus 


cult. 
cult. 


bühler. 


192 


2 Stapelien 


Veit Schultheifs. 


202 


Colchicum byzantinum, vielblütig. 


Luff, Verwalter. 


15 


Fucus vesiculosus, Blasentang. . 


Nordsee 


Pfarrer Wüd. 


198 


Hexenbesen von Pinus silvestris . 


ünterweihers- 








buch. 


Schwarz. 


167 


Parasitäre Pilze 


Lichtenhof etc. 


Dr. Wagner. 


106 


desgl 


Nürnberg, Neu- 








markt, Hollfeld 


Schwarz. 


107 


desgl 


Oberbayern 


Dr. Wagner. 


53 


Pilz vom Stachelbeerstrauch . . 


Skt. Johannis 


Veit SchultheÜJB. 


105 


Pilz in der Kinde der Fohre . . 


Nürnberg 


n n 


193 


Rhytisma acerinum auf Acer pla- 








tanoides 


Schmausenbuck 
Sankt Jobst 


Adalb. Rudel. 


194 


Pilz auf Chondrilla juncea . . . 


n r 


140 


Polyporus igniarius 


Sittenbachthal 


Wunder. 


139 


» n ...... 


Hartmannshof 


Eleon. Schwarz 
in Schwabach. 


129 


Ascomycetes. Fasciculus V. . . . 


— 


Dr.Rehm,Regens- 
bürg. 


48 


Bacillus anthracis, Reincultur. . 


bot. Instit. Würz- 


Dr. Appel, Würz- 






burg. 


burg. 


49 


Bacillus Tetani, Reincultur . . . 
b. Zu den Herbarien. 


desgl. 


rt n 


203 


Aquilegia vulgaris flore albo . . 


Enzendorf 


Emma Rudel. 


90 


Verschiedene Thalamifloren. . . 


NümbergerFlora 


Schultheifs. 


92 


n n ... 


r» 'v 


Dr. Wagner. 


91 


n rt ... 


n rt 


Schwarz. 


85 


V T> ... 


n w 


Orofs. 



Digitized by VjOOQ IC 



4S 













Gegenstand 


Fundort 


Schenker 


87 


Verschiedene Thalamifloren. . . 


NürnbergerFlora 


Kränzte, Mün- 






chen. 


89 


p f» ... 


p Stöhr. 


88 


p p ... 


Bamberg 


Dr. Harz, Kulm- 
bach. 


86 


Trifolium incamatnm var. scandeos 


Nürnberg 


Dr. L. Koch. 


62 


Potentilla proctunbeus 


Schmamenback 


n w « 


2 1 Astrantia major 


Kaaerlach 


Schultheifs. 


50 


Dipsacus piloBUs 


Sendelbach 


p 


61 


Petasües albos 


Hofberg 


p 


201 


Aster sp. eingebürgert 


Gründlach 


Dr.Glück,Heidel- 
berg. 


143 


Aster bellidifloras 


Mögeldorf 


Schwarz. 


187 


Aster bmmalis 


Glaishammer 


Schwemmer. 


142 


Inola Heleniom 


Jahrsdorf 


Schultheifs. 


142 


Bidens platycephalas 


Dechsendorf 


r 


H5.t46 


Cineraria spatolaefolia, etc.« . . 


Berching 


p 


147 


Tanacetnm Balsamita 


Nürnberg, cnlt 


Schwemmer. 


68 


Hieradom Schmidtii 


Fischstein 


p 


8 


Xantbinm spinosiim ...... 


Wöhrd 


Dr. L. Koch. 


136 


Trientalis europaea 


Oberferrieden 


Emma Rudel. 


61 


Plantago arenaria 


Maxfeld 


Dr. L. Koch. 


63 


Polygonum Orientale 


Nümb., verwüd. 


Schultheifs. 


199 


Stratiotes aloides 


Forchheim 


Dr. Glück. 


77 


Ein Fascikel Phanerogamen . . 


Nümbg. Gegend 


Dr. L. Koch. 


66 


Eine Serie Gefikfscryptogamen . 


r» P 


» n P 


5 


Phanerogamen divef s 


p P 


Paalzow. 


1 


Zahlreiche Phanerogamen, auch 


Coburg, Würz- 


Dr.Appol,Würz. 




Farne 


bürg etc. 
Südwestschweiz 


bürg. 
Paalzow. 


4 


Beiches Herbar Phanerogamen . 


64^ 


Mehrere Fascikel Phanerogamen 








zum allgemeinen Hörbar . . . 


divers. 


Dr. L. Koch. 


141 


Phanerogamen zum bayerischen 




Dr. Harz, Kulm- 




Herbar 


Bayern 


hAch. 


72 


1 Fascikel Laobmoose 


Deutschland nndi Dr. L. Koch. 






Tirol 




73 


Eine Serie Lebermoose 


« p 


1» W P 


74 


y, y, Laubmoose 


Nürnberger Um- 
gegend 


TP ">* 


67 


„ „ Gefll^skryptogamen . 


Deutschland 


r t» n 


69 


Ein Fascikel Flechten 


n 


n T» p 



Digitized by VjOOQ IC 



44 



5Z5 


Gegenstand 


Fundopt 


Schenker 




4« Geologie« 

a. Palaeontologie. 






178 


Leptolepis sprattiformis .... 


Solnhofen 


Fritz Theisen. 


179 


Aptychus 


? 


n » 


16 Cydaris coronatus 


Betzenstein 


Sachs, Kommer- 


281 Ostrea pectiniformis von Litho- 




zienrat. 


domas pygmaeos angebohrt, 


Dogger b.Eschen- 


Han8Frh.v.Ebner 


Astarte. Serpula 


bach 




116 Verschiedene Yersteinemngen. . 


Lias 


Albert Müller. 


206 


RhynchmeUa laconosa, sehr grofs 


Münster b. Strau- 


Patin, Fürth. 


158 




bing 




160, 161 


Ammonites, mehrere Arten . . . 


n n n 


Schwarz. 


154,159 


Scyphien, 8 Arten, 1 Belemnites 


» t> n 


» 


154 


Ammonites, Scyphien etc 


» n r> 


Rittm. V. Grund- 
herr, Fürth. 


155 


desgleichen .... 


ry n n 


von Löffelholz, 


1 




Fürth. 


156 desgleichen .... 


7) Ti rt 


Buchner, Kitsin- 








gen. 


188 


? Orchia antiqua 


? 


Paalzow. 


288 Somatopteris jnrensis. GipsabgoTs 


— 


n 


1 b. Geognosie. 






217 Pfahlquarz 


bayerisch. Wald 
Sattelpeilnstein 
Münster b. Strau- 


Schwarz. 


227 Granit 




158 t Winzergneifs 


T» 




bing 


f> 


110 8 Gesteinsarten 


Beding 


Meieenbach. 


39 Blasensandstein 


Oberasbach 


Schwarz. 


151 Doggersandstein 


Münster b. Strau- 




[• 


bing 


7» 


52 Geode aus dem obem weifsen Jura 


Betzenstein 


Sachs, Kommer- 


165 1 Solnhofer Plattenkalk 


Willenhofen bei 


[zienrat. 




Parsberg 


Schwarz. 


168 Ereidesandttein mit Fossürest . 


Michelsneo- 








kirchen 


» 


98 


Stemberger Kuchen 


Stemberg 


Dr. L. Koc*. 


229 


Braunkohle mit Schwefelkies- 








krystallen 


Ossegg 
Marienbad 


Knapp. 
Preifs. 


108 


Basalttuff etc 


104 


1 Thonschiefer mit 5 Fossilresten. 


Dr. Heerwagen. 



Digitized by VjOOQ IC 



45 











Ä 

H 


Gegenstand 


t'undopt 


Schenker 


133 


Jurakalk mit Ammonitenabdrack 


Diluvialschotter 
bei Rollhofen 


Frl. Schultheifs. 


134 


Eisensandstein mit Pecten perso- 








natas 


n 


Adalb. Rudel 


135 


Jurakalk mit Ammonitenabdrack 


Marie Schwarz. 


138 1 Belemnites 8P 




Schwarz. 


109 


Diluviale Rollsteine mit 5 Fossil- 








resten 


Steinplatte 
Layer Wald bei 


Ammon,St. Jobst. 


76 


Gerollte Eisensandsteine .... 


Stehle, Fürth. 






Fürth 




209 


Bhynchonella lacunosa 


GeröllebeiPillen- 
reut 


Hörmann. 


211 1 Jurakalkstein mit Ammoniten- 








abdruck 


r» n r» 


Schwarz. 


210 


Schwänmie 




207 


Araucarite^, Holzstein 


Frl. Leidig. 


208 


Concentrischer Feuerstein . . . 


n n n 


n r 


176 


Tuffsteine 

5. Mineralogie. 




Frh.v. Löffelholz, 
Regensburg. 


228 


Quarz mit gediegenem Gold . . 


Californien 


Knapp. 


164 


Achatähnliche Feuersteine . . . 


Lichtenberg, 
bayer. Wald 


Schwarz. 


38 i 3 MineraUen, Quarz etc 


Bodenwöhr 


Meisenbach. 


18 


Chiastolith 


Gefrefs 
Weifsenfeis bei 


Fr. Huber. 


19 


F.klogit . ... 








Stammbach 




157 


Kalkspat 


Münster b. Strau- 


von Grundherr, 






bing 


Fürth. 


84 


Scaleno^der Kalkspat 


Grofsachsenheim 
Württemberg 


Dr. Fritz. 


123 


Verschiedene Mineralien .... 


Welau, Sachsen, 
Thüringen 


Dr. Zwanziger. 


111 b. 


desgleichen .... 





Bock. 


40,153 


Mineralien 

6. Technologie. 


Queensland 


Kinkelin. 


46 


Eine Serie MetaUgeftfse zur Dar- 


Bing'sche Metall- 






stellung des Emaillierungsver- 


warenfabrik, 






fahrens 


Marienyorstadt 

D 


gitizedbyG^OOQle 



46 



^ 

H 



Gegenstanä 

Wasserfiltrierapparat 

Kupferne Kanne 

Glaskmg 

Heizrohr 

Papyrus, nach Art der Alten 
bereitet 

Yerwaltnng der Sammlongen. 

Einrahmung von obigem Papyrus 
Pr&paratengl&ser 

desgleichen 

desgleichen 



Fiindort 



Sclienker 



172 

173 
174 
175 
100 



Berliner Fabrik i Freihr. v. Löffel- 
I holzLRegensbg. 

— ! ^ 

— i 



Sicüien 



101 
216 

228 
94 



Dr. Stfthlin. 



Schreiber. 
Rodler. 

n 

Dr. L. Koch. 



I 



Der Konservator: A. Schwarz. 



Digitized by VjOOQ IC 



47 



lY. Jahresbericht der Verwaltung 1898. 

Von den entbehrlichen Räumen des Hauses ist der zweite 
Stock des Vorderhauses und das Hinterhaus an die Nürnberger 
Frauen- Arbeitsschule vermietet, der eine Keller an einen Obst- 
bändler. 

Die Gesellschaftsräume waren vom Hebammen -Verein, dem 
Pegnischen Blumenorden, dem Stenographen-Hort, dem Verein 
iUr Gesundheitspflege und dem Apothekergremium gemietet. 

Zur jährlichen Abzahlung von 200 M, an der Hypothek 
haben sich auch in diesem Jahre eine Anzahl Herren mit Extra- 
beiträgen beteiligt; es wird hiefQr der herzlichste Dank aus- 
gesprochen. Schuldscheine wurden leider keine zurückgegeben; 
von einer Verlosung derselben mufste auch heuer abgesehen 
werden, da die Verwaltung noch einen bedeutenden ZuschuTs 
von der Hauptkasse benötigt. 



Der Vermögensstand beziffert sich wie folgt: 
a. Immobilien. 

Haus in der Schildgasse, 1. Januar 1898 J^ ^ 

Hypothek darauf 50200 — 

Abzahlung pro 1898 200 — 

sohin am Sl. Dezember 1898 Hypothenbestand 50000 — 

b. Mobiliar. 

Stand am 1. Januar 1898 16S5 75 

Ab mo Abnützung 168 57 

1472 18 

c. Schuldscheine. 

Gesamtausgabe derselben 30175 — 

Stand am 31. Dezember 1898 24600 — 

H. Sebald. 



Digitized by VjOOQ IC 



48 



V. Kassenbericht für 1898. 
a. Ober die Gesellechaftskassa. 

Einnahmen: M. 

Kassabestand 348 

Guthaben bei der Sparkassa (M. 1018.85) — 

Aufnabmsgebübren 51 

Mitgliederbeiträge 4055 

Beitrag vom Stadtmagistrat Nürnberg 500 

Beitrag vom Landrat für Mittelfranken 300 

Erlös für einen verkauften Schrank 9 

Geschenk eines ungenannt sein wollenden Gebers . 50 
Entschädigung von Professor Dr. Kämmerer für zu 

Verlust gegangene Zeitschriften 62 

Vergütung der früheren bakteriologischen Sektion 

hier, durch Herrn Dr. Goldschmidt 219 

Summa . . 5596 



86 



70 



20 



57 



SS 



Ansflraben: M. ^ 

Titel la. Einrichtung des Museums 94 — 

* Ib. Unterhaltung desselben 170 49 

. IIa. Bibliothek 755 48 

w IIb. Einrichtung derselben -. 37 — 

» II c. Druck des Kataloges . — — 

» III a. Schreibbedarf 13 44 

« Illb. Porü 132 25 

» IIIc. Inserate 100 80 

» III d. Gehalt des Vereindieners 537 59 

« nie. Feuerversicherung (1897/1902) .... — — 

* IV. Überzahlung zum Hauskonto 1435 76 

» V. Jahresbericht und Drucksachen .... 1327 83 

* Via. Zuschufs zur anthropologischen Sektion 200 — 
» VIb. • » botanischen Sektion ... 100 — 
» VIc. » » geographischen Sektion . 50 — 

* VId. » » chemischen Sektion ... 100 — 
» VII a. Fond für das 100 jährige Jubiläum. . . 100 — 
•» VII b. Abzahlung der Hypothek 200 — 

* VIII. Reservefond 109 60 

Summa . ^ 5464 19 

Digitized by LjOOQIC 



49 

Abschlnss: Jk ^ 

Summa der EinnahmeQ • . 5596 SS 

Summa der Ausgaben . . 5464 19 

Eassabestaud a. Baar . . 1S2 14 

b. 2 Sparkassabücher mit . • 1149 IS wovon 

zum Fond für das lOOjabrige Jubiläum Jk 500.— bestimmt sind. 

b. Ober die Verwaltiingskassa. 

ElnnahmeB; Jk ^ 
Extrabeitrfige der Mitglieder zur Abzahlung an der 

Hypothek 125 — 

Miets-Erträgnisse 2271 20 

Erlös für verkauftes Holz 28 — 

Beitrag zur Strafsenreinigung von Frl. Winter . . 5 — 

Oberzahlung aus der Gesellschaftskassa 14S5 76 

Summa . . S864 96 

AvsflrabeB: M ^ 

Abzahlung an der H3rpothek _ _ 

Reparaturen und Bauarbeiten 588 11 

Steuern, Wasserzinse und Holzpfandgeld 4S2 69 

Hypothek-Zinsen 1994 — 

Ökonomie und Regie • 850 16 

Summa . . S864 96 

Abschlags: Jk ^ 

Summa der Einnahmen . . . S864 96 
Summa der Ausgaben . . . S864 96 



Für die Richtigkeit : 
Iftraberg, den 31. Dezember 1898. Beruh. Lang. 

Die Richtigkeit vorstehender Aufstellung und die Über- 
einstimmung mit den vorliegenden Belegen bestätigen 

Iftraberg) den 11. Januar 1899. 

Gottfried Ammon, J. Kreutzer, Th. Erhard. 

Digitized by Vj04)QIC 



50^ 

VI. Mitgliederverzeichnis. 

(Stand vom 31. Dezember 1898.) 
Vontandsohaffc: 

Direkior: Herr Dr. phil. August Heerwagen» k. Gymn.-Prof. 
/. Sekretär: Herr Wilhelm Rudel, k. Pfarrer. 
II. Sekretär: Herr Dr. phil. Karl Hartwig, k. Gymn.-Prof. 
IJI. Sekretär: Herr Dr. Alexander Frankenburger, prakt. Arzt. 
Bibliothekar: Herr Konrad Hörmann, Lithograph. 
Coniervator: Herr Aug. Schwarz, k. Stabsveterinär im I. Chev.-Rgt. 
Sehatimeiater: Herr Georg Rhau, Fabrikbesitzer. 
ÄdmkUitrator: Herr Hans Sebald, Buchdmckereibesitzer. 
Bauteehmker: Herr Emil Hecht, Architekt und Gemeindebevoll- 
mächtigter. 

Kustoden : 

1) für die anatomische Sammlung: Herr Dr. Frankenburger; 

2) » » anthropologische Sammlung: Herr Wunder; 

3) > > botanische Sammlung und zwar: 

a. för das allgemeine Herbar: Herr Fr. Schultheifs; 

b. » » Kryptogamen-Herbar : Herr Kaulfufs; 

c. > » Nürnberger Herbar: Herr Schwarz; 

d. > > bayerische Landesherbar: Herr W. Rudel; 

4) für die chemische Sammlung und zwar: 

a. fQr die anorganisch-chemische: Herr Dr. Metzger; 

b. » » organisch-chemische: Herr Wunder; 

5) fElr die ethnographische Sammlung: HerrDr.Heerwagen; 
» mikroskopische Sammlung: Herr Dr.Goldschmidt; 

> lokal-geognostische Sammlung: Herr Schwarz; 

> mineralogische Sammlung: Herr Dr. Zwanziger; 

> paläontologische Sammlung: Herr Spandel; 
» physikalische Sammlung: f xj^,, ri, t^-«;««. 

> technologische SammluHg: 1 Herr Dr. Lessing. 
» zoologische Sammlung und zwar: 

a. fOr Säugetiere und Vögel: Herr Dr. Heerwagen; 

b. » Reptilien, Amphibien und Fische: Herr Kinkelin; 

c. > Weichtiere und Conchylien: Herr Knapp; 

d. > Insekten: Herr Dr. Manger; 
c. * Arachniden und Myriapoden: Herr Dr. Koch sen. ; 

f. » Crustaceen und niedere Tiere: Herr Kinkelin. 



6 
7) 
8) 
9) 

10 

11 

12 



A. Ehrenmitglieder. 

Sr. Kffl. Hoheit Dr. Carl Theodor, Herzog in Bayern. 
Herr Agassi z, Alexander, Professor in Cambridge. 

> Arnold, Fr., k. Oberlandesgerichtsrat in München. 
» Ballhorn, Hermann, Buchhändler in Würzburg. 

> Dr. Blasius, R., Professor in Braunschweig. 

> Dr. Blasius, W., Geh. Hofrat in Braunschweig. 

» Dr. Büchner, Ludwig, prakt. Arzt in Darmstadt. 
» Castellanos, B. S., Direktor der k. archäologischen Academle 
in Madrid. 

> Doval-Jouve, J., Ancien Inspecteur de l'Academie de Montpellier. 

Digitized by VjOOQIC 



51 

Herr E>r. Flügel , Felix, Privatgclchrtcr m Leipxig. 
> Dr. Günther, Sigmund, k. Professor an der techn. Hochschule 

in München. 
Dr. V. Hauer, Ritter, Franz, k. Hofrat in Wien. 
Dr. V. Koch, Gottlieb, Direktor des zoolog. Instituts in Darmstadt. 
Dr. Koch, Ludwig, sen., prakt. Arzt in Nürnberg. 
Lambrecht, Fr., k. holl. Hauptmann in Hannöverisch-Münden. 
Lotter, M., Waisenhansvater m Nürnberg. 
Müller, August, Kaufmann. 

Dr. Müller, Karl, Privateelehrter in Halle a. d. S. 
Dr. V. Pettenkofer, M., k. Geheimer Obermedizinalrat in 

München. 
Philippi, R. A., Professor a. d. Academie in Santjago in Chile. 
Dr. Ranke, Johannes, k. Professor in München. 
Dr. Selenka, Emil, Professor hon. an der Universität München. 
Dr. Suringar, W. F. R., Professor und Direktor des botanischen 

Gartens in Leyden. 
Dr. Virchow, R., k. Geheimer Rat und Universitäts-Professor 

in Berlin. 



B. Ordentliche Mitglieder« 



1) Herr Adolf, Georg, Kaufmann. 



2) 

3) 

4) 

5) 

6) 

7) 

8) 

9) 

10) 

11) 

12) 

13) 

14) 
15) 
16) 
17) 
18) 
19) 
20) 

21) 
22) 



25) 



Aischberg, Joseph, Hopfenhändler. 

Ammon, Gottfried, Kaufmann. 

Ammerbacher, Max, k. Postexpeditor in Fürth. 

Bach, Leo, Kaufmann. 

Bach, Siegfried, Fabrikbesitzer. 

Bäumler, Joh. Konrad, Kaufmann. 

Dr. Barabo, Adam, prakt. Ar2t. 

Barbeck, Hugo, Buchhändler und Magistratsrat. 

Barth, Tohannes, Kaufmann in Weigelshof. 

Bart he 11, Georg, Hopfenhändler. 

Dr. Bauer, Friedrich, prakt. Arzt. 

Dr. Bauer, Karl, Assistent. 

Baur, Joseph Anton, Ingenieur. 

Bauriedel, Paul, Kunstmühlbesitzer. 

Beckh, August, Apotheker. 

Dr. Beckh, August, prakt. Arzt. 

Beckh, Edwin, Fabrikbesitzer und Kommer zienrat. 

Beckh, Georg, Fabrikbesitzer. 

Dr. Beckh, Wilhelm, Oberarzt am städt. Krankenhaus und 

k. Hofrat. 
Berlin, Max. k. Oberlandesgerichtsrat. 
Dr. B er nett, Wilhelm, prakt. Arzt. 
Bernhold, Albert, Kaufmann. 
Bernstiel, Karl, Kaufmann. 



Dr. Berthold, Eugen, prakt. Arzt. 

26) Bibliothek, Königliche, in Berlin. 

27) Herr Bing, Adolf, Kaufmann. 

28) > Bing, Berthold, Kaufmann. 

29) » Bing, Heinrich, Kaufmann. 

30) > Bing, Hermann, Kaufmann. 

31) » Bing, Ignaz, Grofshändler und Kommerzienrat^Q qqq[^ 



52 



32) Herr 

33) 

34) 

35) 

36) 



39) 

40) 

41) 

42) 

43) 

44) 

45) 

46) 

47) 

48) 

49) 

50) 

51) 

52) 

53) 

54) 

55) 

56) 

57) 

58) 

59) 

60) 

61) 

62) 

63) 

64) 

65) 

66) 

67) 

68) 

69) 

70) 

71) 

72) 

73) 

74) 

75) 

76) 

77) 

78) 

79) 

80) 

81^ 

82) 

83) 

84) 

85) 

86) 

87) 



Bing, Oskar, Kaufmann. 

Birkmann, Michael, Zimmermeister. 

Birkner, Rudolf, Bankier und Konsul der chil. Republik. 

Bloch, Samuel, Bankier. 

Dr. Blöde, prakt. Arzt. 

Bock, Georg, Zahnarzt. 

Bodky, Julius, k. Reallehrer. 

Dr. Böhm, Gottfried, Assistent am bayr. Gewerbemuseum. 

Brom ig, Hans, Kaufmann. 

B r u n n e r , Martin, Kaufmann. 

Brust, Max, Kaufmann. 

Dr. Buchner, Wilhelm, prakt Arzt. 

Bückin g, Johannes, Privatier. 

Bürger, Leonhard, Architekt. 

Buz, Franz, k. Major und Regiments-Conunandeur. 

Cammerer, Fritz, k. Oberförster in Eibach. 

Carette, Georges, Kaufmann. 

Cnopf, Karl, Bankier. 

Dr. Cnopf, Rudolf, prakt. Arzt. 

Conradty, C, Fabrikbesitzer. 

Gräme r, Friedrich, Prokurist. 

Crailsheimer, Hugo, Kaufmann. 

Gramer, Fritz, Buchhändler in Würzburg. 

Gramer, Paul, Kaufmann. 

Dr. Deuerlein, Georg, prakt. Arzt. 

Dietrich, Theodor, k. Postofßzial in Schweinau. 

Dietz, Georg, Grofshändler. 

Diez, Gregor, Maurer- und Tünchermeistcr. 

Dormitzer, Louis, Kaufmann. 

Dürr, Konrad, k. Professor. 

Dr. Eberle, Joh. Fr., k. Gymnasiallehrer. 

Eckart, Ernst, Apothekenbesitzer und Magistratsrat. 

Dr. Eckart, Karl, Apotheker. 

Eckert, Hermann, Kaufmann. 

Ehrenbacher, Sigmund, Hopfenhändler. 

Eisenbach, Georg, Kaufmann. 

Dr. Elliesen, Paul, Privatier. 

Dr. Emmerich, Max, prakt. Arzt. 

Engelhardt, Adolf, k. Pfarrer. 

En giert, Hans, Kaufmann. 

Enslin, Heinrich, Kaufmann. 

Dr. Epstein, Ernst, prakt. Arzt. 

Erdmann, Friedrich, Bankier. 

Erhard, Theodor, Apothekenbesitzer. 

Erlenbach, Max, Kaufmann. 

Ertheiler, Anton, Kaufmann. 

Ertheiler, August, Kaufmann. 

Etz, Friedrich, Kaufmann. 

Fischer, Karl, Privatlehrer. 

Fleisch mann, Chemiker in Doos. 

Förderreut her, Gustav, k. Hauptmann a. D. 

Föttinger, Karl, Gasthofbesitzer. 

Forchheime r, H. S., Kaufmann. 

Dr. V. Forster, Sigm., prakt. Arzt. 

Dr. Frankenburger, Alex, prakt. Arzt. 

Frankenburger, Max, Fabrikbesitzer. ^ , 

Digitized by VjOOQ IC 



58 



SS) Herr Frauenfeld, Emil, Kaufmann. 

89) > Frauenfeld, Karl, Kaufmann. 

90) > Frauen feld, Moritz, Kaufmann. 

91) » Frauenknecht, k. Notar und Justizrat. 

92) » V. Frays, Freiherr, Philipp, Fabrikbesitzer. 

93) » Friedrich, Johann, k. Reallehrer a. D. 

94) » Fuchs, Hans, Kaufmann. 

95) » Füchtbauer, Gg., k. Rektor und Oberstudienrat. 
96^ > Funk, Stephan, Kaufmann. 

97) > Gallinger, lakob, Kaufmann und Kommerzienrat. 

98) > Gar eis, Wilhelm, k. Regierungsrat und Bezirksamtmann. 

99) » Gebhardt, Heinrich, Fabrikbesitzer. 

100) > Gebhardt, Ludwig, Kaufmann und Kommerzienrat. 

101) > Gebhardt, Wilhelm, Kaufmann. 

102) » Geifsler, Gustav, prakt. Zahnarzt. 

103) » Gern gros, Ludwig, Kaufmann und Kommerzienrat. 
104J » Gerngrofs, Wilhelm, Kaufmann. 

105) > Dr. Guilini, Ferdinand, prakt. Arzt. 

106) > Giulini, Georg, Privatier. 

107) > Glafey, Gottl., Fabrikbesitzer und Handelsrichter. 

108) > Göbel, Otto, k. Vetcrinärarzt ü. Kl. 

109) > G Öse hei, Ludwig, Privatier. 

110) » Goldmann, Kaufhiann. 

111) » Dr. Goldschmidt, Ferdinand, prakt. Arzt. 

112) » Gombrich, M., Instituts-Direktor. 

113) > Gonnermann, Karl, Fabrikbesitzer und Kommerzienrat. 

114) » Dr. Gram min g, Rechtsanwalt. 

115) » Greiner, Gustav, Kaufmann. 

116) » Dr. Grether, Fritz, Apotheker. 

117) > G^riefsbach, Otto, Kaufmann. 

118) » Grofs, Ludwig, k. Gymnasiallehrer. 

119) > v. Grundherr, Benno, Kaufmann und k. niederl. Konsul. 

120) » Gütermann, Wilhelm, Kaufmann. 

121) » Guldmann, Arthur, Kaufmann. 

122) » Gutmann, Gustav, Bankier. 

123) > Haas, Eduard, Fabrikbesitzer und Kommerzienrat. 

124) > Haas, Karl, Bankier. 

125) » Dr. Hanau, Max, Zahnarzt. 

126) » Dr. Hartwig, Karl, k. Gymnasialprofessor. 

127) > Haymann, Julius, Direktor des städt. Gaswerks. 

128) » Hecht, Emil, Architekt, Ingenieur und Gemeindebevoll- 

mächtigter. 

129) > Heerdegen, Albrecht, Kaufmann u. Armenpflegschaftsrat. 

130) > Dr. He erwägen, August, k. Gymnasialprofessor. 

131) > Heilins, Chnstian, Kaufmann. 

132) > Heim, Hermann, Kaufmann. 

133) > Heim, Karl, Kaufmann. 

134) > Held, Hermann, k. Professor. 

135) > Heller, Friedrich, Fabrikbesitzer. 

136) > Heller, Louis, Kaufmann. 

137) > Hellmuth, Joseph, Rechtsanwalt. 

138) > Hellmuth, Karl, städt. Bezirkstierarzt. 

139) > Hellmuth, Sigmund, Fabrikbesitzer in Buch. 

140) » Hering, August, Ingenieur. 

141) » Hermann, Georg, Bezirkstierarzt in München-Schwabing. 

142) > Hcrtel, Friedrich, Kaufmann. 



Digitized by VjOOQ IC 



54 



143) Herr 

144) 
146) 
146) 
147) 
148) 
149) 
150) 
151) 
152) 
153) 
154) 
155) 
156) 
157) 
158) 
159) 
160) 
161) 
162) 
163) 
164) 
165) 
166) 
167) 
168) 

169) 
170) 
171) 
172) 
173) 
174) 
175) 
176) 
177) 
178) 
179) 
180) 
181) 
182) 
183) 
184) 
185) 
186) 
187) 
188) 
189) 
190) 
191) 
192) 
193) 
194) 
195) 
196) 
197) 



Dr. Hefs, Hans, k. Reallehrcr. 

Hesseiberg er, David, Kaufmann. 

Heydolph, Georg, Buchdruckereibesitzer. 

Heydolph, Hans, Rechtsanwalt. 

Hilpert, August, Fabrikbesitzer. 

Dr. Hirsch, Jakob, Chemiker in Fürth. 

Hochstein, Karl, Veterinär. 

Hörmann, Konrad, Lithograph. 

Dr. Hofmann, Hans, Assistent am bayr. Gewerbemuseum. 

Hopf, Eduard, Kaufmann. 

Hopf, Emil, Kaufmann. 

Hopf, Hans, Kaufmann. 

Huber, Friedrich, Kaufmann. 

Hussong, Ludwig, Apotheker in Kaufbeuren. 

Jung, Heinrich, I^ufmann. 

Jungmann, Heinrich, Privatier. 

Kann, Paul, k. Telegrapheningenieur. 

Kann, Samuel, Privatier. 

Kantenseder, Johann, Schreinermeister. 

Kaulfufs, Johann, städt. Trichinenschauer. 

Kempe, Karl, Fabrikbesitzer. 

Kiefer, Andreas, k. Hauptmann und Kompagniechef. 

Kinkelin, Adolph, Apothekenverwalter. 

Dr. Kirste, Wilhelm, prakt. Arzt. 

Klein, Benedikt, Kaufmann. 

Knapp, Friedrich, Kaufmann, Magistratsrat und kgl. span. 

Konsul. 
Dr. Koch, Heinrich, prakt. Arzt. 
Dr. Koch, Karl, prakt. Arzt. 
Dr. Koppel, August Realschulassistent. 
Kohn, Emil, Kaufmann. 
Kohn, Ernst, Kaufmann. 
Kohn, Georg, Bankier. 
Krakenberger, Leopold, Kaufmann. 
Krakenberger, Max, Kaufmann. 
Kraussold, Max, k. Pfarrer und Senior. 
Kr eil, Otto, Fabrikdirektor und Gemeindebevollmächtigter. 
Krell, Otto, iun., Ingenieur. 
Krell, Rudolf, Ingenieur. 
Krefs, Johann, Grofsfleischer. 
Kreutzer, Ludwig, Fabrikbesitzer. 
Kristfeld, Jean, Uhrmacher. 
Kr om well, Karl, Kaufmann. 
Küspert, Fran2, kgl. Reallehrer. 
Kugler, Sal., Bankier. 
Kuhlo, Richard, Fabrikdirektor. 
Lambrecht, Hermann, Fabrikbesitzer. 
Dr. Landmann, Joseph, Rechtsanwalt. 
Dr. Landsberg, Ludwig, Fabrikbesitzer in Doos. 
Lang, Bernhard, Kaufmann und k. schwed. Konsul. 
Lang, Ignaz, Kaufmann. 
Lang, Leopold, Kaufmann. 
Langermann, Moritz, Kaufmann. 
Lauer, Jean, Fabrikbesitzer. 
Lauinger, Leopold, Kaufmann. 
Lehmann, Assistent a. ehem. Lab. der Industrieschule. 



Digitized by VjOOQ IC 



55 



198) Herr Lehnert, Wilhelm, Apotheker. 

199) > Leidig, Georg Friedrich, Optiker und k. Hoflieferant. 

200) > Lenz, Ernst, Erzgiefser. 

201) t Dr. Lessing, Albert, Fabrikbesitzer. 

202) > Leuchs, Georg, Kaufmann und Chemiker. 

203) » Dr. Leuchs, Kari, Chemiker. 

204) > Lex, Hans, Apotheker. 

205) > Leykauf, Georg, k. Hofstahl warenbrikant. 

206) > Dr. Limpert, L., prakt. Arzt und 2Lahnarzt. 
207J > Lindinger, Leonh., stud. rer. nat. 

208) > Lindmann, Jakob, Direktor des Gaswerks in Fürth. 

209) » Lindner, Heinrich, Kaufmann. 

210) > Lösch, Fritz, k. Postoffizial. 

211) » Dr. Löwi, Rudolf, Notariatskonzipient. 

212) > Lucas, Albert, k. Bankkommis. 

213) » Dr. Maas, Markus, prakt. Arzt. 

214) » Mandel, Karl, Kaufmann. 

215) » Dr. Manger, Karl, k. Reallehrer. 

216) > Dr. Mansbach, prakt. Arzt. 

217) » Marlier, Julius, Kaufmann und II. Vorstand des Gemeinde- 

Kollegiums. 

218) > Martin, Eugen, Rechtsanwalt. 

219) » Marx, Ceorg, Ober-Ingenieur. 

220) » Dr. Mayer, M. L., prakt. Arzt. 

221) » Mayer-Dinkel, Albert, Kaufmann. 

222) > Dr. Mehler, Heinrich, prakt. Arzt in Georgsgmünd. 

223) » Meiser, Franz, Ingenieur. 

224) > Dr. M e r k e l , Gottlieb, königl. Medizinalrat und Krankenhaus- 

Direktor. 

225) » Dr. Merkel, Wilhelm, prakt. Arzt. 

226) > Merzbacher, Joseph, Kaufmann. 

227) » Mesthaler, Jon., Fabrikbesitzer und Kommerzienrat. 

228) » Metzger, Ludwig, Kaufmann und Kommerzienrat. 

229) » Dr. Metzger, Sigmund, Fabrikbesitzer. 

230) » Michahelles, Georg, k. Hauptmann und Kompagniechef. 

231) » Dr. Mohr, Gustav, prakt. Arzt. 

232) » Dr. Morgenstern, Friedrich, Fabrikbesitzer in Fürth. 

233) > Müller, August, Kaufmann. 

234) » Müller, Jean, Kaufmann. 

235) » Münderlein, Johann, k. Pfarrer. 

236) > Dr. Müller, Wilhelm, prakt. Arzt. 

237) » Dr. Münz, Pinkus, prakt. Arzt. 

238) > Münzinger, August, Kaufmann. 

239) » Munker, Georg, k. Professor a. D. 

240) > M unzer, Julius, Kaufmann. 

241) > Narr. Adolf, Privatier. 

242) > Naue, Otto, Kaufmann. 

243) » Dr. Neuberger. Jos., prakt. Arzt. 

244) » Dr. Neuburger, S., Augenarzt. 

245) > Dr. Neukirch, Richard, Oberarzt am städt. Krankenhaut. 

246) » Neumeyer, Hans, Kaufmann. 

247) > Neumüller, Konrad, Schreinermeister. 

248) > Nister, E., Kunstanstaltsbesitzer und Kommerzienrat. 

249) > Nowack, Lorenz, Fabrikdirektor. 

250) » Obermaier, Theodor, Civilingenieur. 

251) » Offenbacher, Joseph, Kaufmann. 



Digitized by VjOOQ IC 



56 



252) Herr Omeis, Gottlieb, k. Notar und Justizrat. 

253) » Dr. Opplcr, Theodor, Chemiker. 

254) > Ottenstein, Albert, Kaufmann. 

255) > Ottenstein, Justin, Kaufmann. 

256 j » Ottenstein, Max, Kaufmann und Fabrikbesitzer. 

257) > Paalzow, Richard, Kaufmann. 

258) » Pabst, Friedrich, Fabrikbesitzer. 

259) » Pabst, Julius, Fabrikbesitzer. 

260) > Palm, Ludwig, Metallgiefsereibesitzer. 

261) » Dr. Pauschinger, Leonhard, prakt. Arzt. 

262) » Dr. Peretz, E., prakt. Zahnarzt. 

263) » Peters, Hermann, Apotheker. 

264) » Pfeiffer, Julius, Sprachlehrer. 

265) » Pil hofer, Joh., k. Bahnexpeditor. 

266) » Dr. P Öse hei, Gustav, k. Bezirksarzt in Neustadt a. A. 

267) > Popp, Adolf, Kaufmann. 

268) » Preifs, Konrad Philipp, Mechaniker. 

269) » Prell,- August, k. Ober-Bankbuchhalter. 

270) » Pretzfelder, Julius, Kaufmann. 

271) > Dr. Prior, Eugen, Direktor. 

272) > V. Puscher, Wilh., Privatier und Kommerzienrat. 

273) » Putzin, Ludwig, Fabrikbesitzer. 

274) » Raab, Karl, Fabrikbesitzer und Magistratsrat. 

275) » Ratz, Heinrich, Apotheker. 

276) » Rau, S. E., Kaufmann. 

277) » Dr. Raum, Fabrikbesitzer. 

278) » Rehlen, Fabrikbesitzer und Magistratsrat. 

279) » Reif, Jean, Brauereibesitzer. 

280) > Reif, Zacharias, Brauereibesitzer und Kommerzienrat. 

281) » Dr. Reitzenstein, Fritz, Assistent am ehem. Universitäts- 

Laboratorium in Würzburg. 

282) » Reitzenstein, Hugo, Kaufmann. » 

283) » Rettelbusch, Ernst, Architekt. 

284) * Rh au, Georg, Kaufmann und Fabrikbesitzer. 

285) > Richter, Richard, Kaufmann. 

286) > Dr. Riedel, Heinrich, Apothekenbesitzer. 

287) » Dr. Riegel, Wilhelm, prakt. Arzt. 

288) » Rieppel, A., Direktor der Maschinenbau- Aktiengesellschaft 

und Baurat. 

289) * Rockstroh, Gustav, Kaufmann. 

290) » Rodler, Karl, Apotheker. 

291) * Rogner, Konrad, Direktor des städt. Schlachthofes. 

292) » Rohn, Severin, Chemiker in Buch. 

293) » Dr. Rosen fei d, L., prakt. Arzt. 

294) » Rosen feld, Sigmund, Kaufmann. 

295) » Rudel, Georg, k. Oberst und Bezirkskommandeur. 

296) » Rudel, Wilhelm, k. Pfarrer. 

297) » Rupprecht, Friedrich, Privatier. 

298) » Dr. Rupprecht, Georg, prakt. Arzt. 

299) » Rupprecht, Wilhelm, Kaufmann. 

300) » Sachs, Karl, Kaufmann u. Kommerzienrat. 

301) * Sachs, Wilhelm, Kaufmann. 

302) » Sandner, Friedr., stud. rer. nat. 

303) » Schäfer, Jakob, k. Bezirkshauptlehrer in Fürth. 

304) » Schafft, Emil, Charkutier. 

305) > Schedel von Greifenstein, Karl, ApothekerinSchweinau. 



Digitized by VjOOQ IC 



57 



306) Herr 

307) 

308) 

309) 

310) 

311) 

312) 

313) 

314) 

315) 

316) 

317) 

318) 

319) 

320) 

321) 

322) 

323) 

324) 

325) 

326) 

327) 

328) 

329) 

330) 

331) 

332) 

333) 

334) 

335) 

336) 

337) 

338) 

339) 

340) 

341) 

342) 

343) 

344) 

345) 

346) 

347) 

348) 

349) 

350) 

351) 

352) 

353) 

354) 

356) 

356) 

357) 

358) 

359) 

360) 



Dr. Scheidemantel, Heinrich, prakt Arzt. 
Scheuermann, Ferdinand, Privatier. 
Schilffahrt, Karl, städt. Sanitätstierarzt. 
Schilling, Theodor, Grofshändler und ital. Konsul. 
Schlegel, Hans, städt. Inspektor. 
Schlegel, Hermann, Apotheker. 

Schmidmer, Chr., Fabrikbesitzer und Kommerzienrat. 
Dr. Schmidmer, E., Chemiker. 
Schmidt, August, k. Fostamtsdirektor. 
Schmidt, Eduard, Bezirkstierarzt. 
Schmidt, Rudolf, Optiker. 
Sehne bei, Ignaz, Kaufmann. 
Schönner, Georg, jun., Reifszeugfabrikant. 
Scholler, Friedrich, Hauptagent. 
Schra|{, Karl, Hofbuchhändler. 
Schreiber, Jean, Vergolder und Fabrikant. 
Dr. Seh renk, Friedrich, prakt. Arzt. 
Schröder. Theodor, k. Gymnasialprofessor. 
Dr. Schubert, Paul, prakt. Arzt. 

Dr. V. Schuh, Georg, I. Bürgermeister der Stadt Nürnberg. 
Schuh, Heinrich, Fabrikbesitzer. 
Schuh, Wilhelm, Apotheker. 
Schultheifs, Friedrich. Apotheker. 
Schultheifs, Veit, städt. Trichinenschauer. 
Schultheifs, Oskar, Rechtspraktikant. 
Schwanhäufser, Gustav, Fabrikbesitzer u. Kommerzienrat. 
Dr. Schwanhäuser, Chemiker. 
Schwarz, August, k. Stabsveterinär. 
Schwarztrauber, Jobs., Veterinär, I. Klasse. 
Schwemmer, Christian, rechtsk. Magistratsrat. 
Sebald, Hans, Buchdruckereibesitzer. 
Sebald, Kalkwerk besitzer. 
Seel. Lehrer. 

Seiler, Christoph, Ingenieur und Fabrikbesitzer. 
Dr. Seiler, Hermann, prakt. Arzt. 
Seitz, Georg, Fabrikbesitzer und Kommerzienrat. 
Sichling, Richard, Kaufmann. 

Dr. Siebenhaar, Johann, prakt. Arzt in Gräfenberg. 
Sieberth, O., Zahnarzt. 
Silbermann, Julius, Kaufmann. 
Simon, Johannes, Lehrer. 
Dr. Simon, Max, prakt. Arzt. 
Sommer, Theodor, Assistent am Gewerbemuseum. 
Spandel, Erich, Buckdruckereibesitzer. 
Speckhardt, Georg, Bäckermeister. 
Stadler, Friedrich, Zahntechniker. 
Stahl, Joh. Christ., Kaufmann. 
Staudt, Erdmann, Kaufmann. 
Dr. Steinhard, Ignatz, prakt. Arzt. 
Dr. Steinheimer, Ludwig, prakt. Arzt. 
Dr. Stich, Eduard, k. Hofrat und Oberarzt. 
Dr. Stockmeier, Hans, Vorstand am bayr. Gewerbemuseum. 
St Öhr, August, Sekretär a. polyt. Zentral verein in Würzburg. 
Dr. Straub, Adolf, Assistent an der städt. Untersuchungs- 
anstalt. 
Dr. Straufs, Julius, Oberlehrer an der städt. Handelsschule. 

Digitized by VjOOQ IC 



58 



361) Herr 

362) 

363) 

364) 

365) 

366) 

367) 

368) 

369) 

370) 

371) 

372) 

373) 

374) 

375) 

376) 

377) 

378) 

379 

380 

381 

382) 

383) 

384) 

385) 

386) 

387) 



389) 
390) 
391) 
392) 
393) 
394) 
395) 
396) 
397) 
398) 
399) 
400) 
401) 
402) 
403) 
404) 
405) 
406) 
407) 
408) 
409) 
410) 

411 
412 



Straufs» Louis, Kaufmann. 
Straus, Simon, Kaufmann. 
St raus, Willy, Kaufmann. 
Dr. Sturm, Jakob, prakt. Arzt in Mögeldorf. 
Süfs, Clemens, Apotheker. 
Tafel, Hermann, Fabrikbesitzer in St. Jobst. 
Tauber, Christ., Baumeister. 
Thurnauer, Bernhard, Fabrikbesitzer. 
T ö 1 k e , Konrad, Kunstgärtner u. Gemeindebevollmächtigter. 
Tuchmann, Franz, Kaufmann. 
Tuchmann, Friedrich, Kaufmann. 
Tuchmann, Max Joseph, Kaufmann. 
Übel, Max, Ass. a. ehem. Lab. der Industrieschule. 
Uhl, Adolf, Kaufmann. 
Ulm er, Julius, Bankier. • 

Dr. Ulrich, August, Rektor der höheren Töchterschule. 
Völker, Georg, Kaufmann. 
Voigt, Gustav, Kaufmann. 
Voit, Paul, Kaufmann. 
Voit, Robert, Kaufmann. 
Voit, Rudolf, Schneidermeister. 
Vollhard, Oskar, k. Advokat und Justizrat. 
Vollrath, Franz, Kaufmann. 
Dr. Wächter, k. Rektor in Ingolstadt. 
Dr. Wagner, Friedrich, k. Professor in Weihenstephan. 
WaydeTin, W. Fr., Kaufmann. 
Webel, Edmund. 

Dr. Weber, Cornelius, Assistent am Gewerbemuseum. 
Weigel, Karl, prakt. Arzt in Berlin. 

W e i g I e , Theodor, Apotheker u. Gemeindebevollmächtigter. 
Weil, Philipp, Kaufmann. 
Weinberger, Max, Fabrikant. 

Dr. Weinhart, Paul, Assistent an der Industrieschule. 
Weinschenk, Hermann, Kaufmann. 
Weifs, August, Apotheker und Magistratsrat. 
Weifs, Robert, Kaufmann in Chemnitz. 
Dr. Welzel, Karl, prakt. Arzt. 
Wenk, Richard, Buchhändler. 
Wertheimer, Sigmund, Kaufmann. 
Dr. Wieg mann, Assistent. 
Wieland, Peter, Privatier. 
Wieseler, Wilhelm, Kaufmann. 
W öl fei, Konrad, Metzgermeister. 
Wolf, Mathias, k. Postamtsdirektor. 
Wunder, Justin, Fabrikdirektor. 
Wunder, Ludwig, stud. rer. nat. 
Dr. Zagelmeier, Hans, Tierarzt. 
Zeltner, Johannes, Fabrikbesitzer. 
Zeltner, Johannes, jun., Kaufmann. 

V. Zenetti, Julius, Ritter, Excellenz, königl. Regierungs- 
präsident a.D. 
Zippelius, August, Kaufmann. 
Dr. Zwanziger, Georg, k. Professor a. d. Industrieschule. 



Digitized by VjOOQ IC 



59 
C. Korrespondierende Mitglieder* 

Herr Dr. Ascherson, Paul, k. Professor an der Universität Berlin. 
> Dr. Biehringer, Joachim, Privatdozent am Polytechnikum zu 
Braunschweig. 

Dr. Böttger, Oskar, Professor in Frankfurt a. M. 

Dr. Braun, Heinrich, Naturforscher und Gemeinderat in Wien. 

Dr. Buchenau, Franz, Professor in Bremen. 

Dr. Dieudonn^, Adolf, k. Stabsarzt in Würzburg. 

V. Docoupil, Wilhelm, Direktor der k. k. Fachschule in HoHc, 

Dr. Fleischmann, Albert, Universitätsprofessor in Erlangen. 

Gebhart, Oskar, Kaufmann in Markt Redwitz. 

Dr. Glück, Hugo, Privatdozent in Heidelberg. 

Goeringer, k. Oberst und Reg.-Komm. in Ingolstadt. 

Dr. Gordon y de Acosta, Akademieprofessor in Habanna. 

Hall, J., Staatsgeolog in Jowa und Paläontolog für die Staaten 
New-York, Albany etc. 

Dr. V. Heldreich, Direktor des botan. Gartens und Direktions- 
mitglied des naturhistorischen Museums zu Athen. 

Dr. Herz, Fr. J., k. Konsulent für Molkereiwesen in Memmingen. 

Dr. Holler, August, k. Bezirksarzt in Memmingen. 

Höh mann, RecUiktcur in Berlin. 

Hornung, Heinrich, k. Reallehrer in Ansbach. 

Le Jolis, Auguste, Direktor der Socidtd des sciences naturelles 
et mathdmatiques de Cherbourg. 

Dr. Issel, Arthur, Professor in Genua. 

Kleylein, Fabrikbesitzer in Gablonz. 

Dr. Klunzinger, Benjamin, k. Professor in Stuttgart. 

Kränzle, Joseph, k. Korps-Stabsveterinär a. D. in München. 

Krapfenbauer, Andreas, Apotheker in Manilla. 

Dr. Kratzmann, E., prakt. Arzt in Marienbad. 

Landauer, Robert, Apotheker in Würzburg. 

Mac CO, Eduard, Kapitän. 

Dr. Magnus, Paul, k. Professor an der Universität in Berlin. 

Dr. Mehlis, Christian, k. Gymnasiallehrer in Neustadt a. H. 

Dr. Müller, W., ordentlicher Professor an der Universität Jena. 

Dr. Peters, Karl, Reichskommissar a. D. 

Dr. Rehm, H., k. Medizinalrat in Regensburg. 

Dr. Rein seh, Paul, Privatgelehrter in Erlangen. 

Tempsky, Fr., Buchhändler in Prag. 

Teufel, Gustav, 'Ingenieur in München. 

Warnstorf, Karl, Professor in Neuruppin. 

Weidner, Gutsbesitzer in Gerasmühle. 

Weigel, Friedrich, Kaufmann in Ansbach. 

Dr. Will, Privatgelehrter in Erlangen. 

V. Wissmann, kais. Gouverneur a. D. 

Wörlcin, Gg., k. Zahlmeister a. D. in Nymphenburg. 



Digitized by VjOOQ IC 



60 



Vn, Jahresbericht der Sektion für Anthropologie, 

Ethnologie und Urgeschichte. 

Die Sektion verlor in diesem Jahre i schätzbare Mitglieder, 
Herrn Fabrikdirektor Carl BO ck und Herrn Dr. med. Bernh. Bau - 
m Uli er, dagegen sind S Herren als neue Hitglieder eingetreten, 
so dafs sich die Zahl der Hitglieder auf 87 erhöhte. Die 
Sektionssitzungen, welche stets am ersten Montag im Monat 
stattfanden, entrollten ein interessantes Bild über die im Be- 
richtsjahre wesentlich erhöhte Thätigkeit der Sektion. Aufser 
den vielfachen Referaten über einzelne Funde und Beobachtungen, 
sowie den Berichten aus der Fachlitteratur sind als gröfsere 
Unternehmungen zu erwähnen: 

1) Ausgrabung zweier Grabhügel bei Bebringersdorf. 

2) do. eines Grabhügels bei Scbwend. 

S) do. zweier Grabbügel auf dem Nonnenberg. 

4) do. von vier Grabhügeln bei Beckerslohe. 

5) Ausarbeitung von 15 Flurpläoen für die arcbaeologische 

Karte Bayerns; es wurden im Ganzen 151 Grabhügel 
bestimmt, vermessen und eingezeichnet 

Von den ausgegrabeneu, prähistorischen Hügeln lieferten 
diejenigen von Bebringersdorf und insbesondere diejenigen von 
Beckerslohe hochinteressante und wertvolle Funde, die wesent- 
lich zur Bereicherung unserer Sammlungen beitrugen. 

Für die wohlwollende Unterstützung unserer wissen- 
schaftlichen Bestrebungen sei an dieser Stelle den kgl. Forst- 
ämtern Bebringersdorf und Engeltbai und vor allem Herrn 
Stiftungsadministrator Freiherrn vonBehaim, welcher uns 
die Grabhügel kostenlos zur Ausgrabung überliefsen, der Dank 
der Sektion ausgesprochen. Zur Deckung der bedeutenden, 
aufseretatmäfsigen Kosten, welche durch diese umfangreichen 
Grabungen trotzdem erwuchsen, wurde durch die Munificenz 
eines grofsen Teiles der Sektionsmitglieder ein namhafter 
Beitrag gespendet, wofür den opferwilligen Gebern gleichfalls 
der beste Dank ausgesprocheo sei. 

Durch Schenkung wurden unserer Sammlung ferner eine 
Anzahl prähistorische, sowie einige zierliche ägyptische Ge- 
fäfse zugeführt. 

Zur Orientierung über die neuere Fachlitteratur diente, wie 
bisher, ein Lesezirkel, der von vielen Mitgliedern gerne be- 
nützt wird. 

Digitized by VjOOQ IC 



61 

Zur Erweiterung der Bibliothek wurden sowohl durch die 
Muttergesellscbaft als auch aus Mitteln der Sektion verschiedene 
fQr das Fachstudium wichtige Werke angeschafft. 

Aus den Diskussionen in den verschiedenen Sitzungen ist 
besonders zu erwähnen, dafs sich die Sektion hinsichtlich einer 
Grabungsmethode zur Erforschung der sogenannten Trichter- 
gruben einigte. 

In der Oeschäftssitzung wurden gewählt: 

Als Obmann: Herr Dr. von Forster. 

Als Schriftführer: Herr F. H. Huber. 

Als Kassier: Herr J. Veit Schultheifs. 

Der bisherige Obmann, Herr Chemiker Wunder hatte 
eine Wiederwahl abgelehnt und sprach die Sektion demselben 
für seine aufopfernde, umsichtige und schätzenswerthe Thätig- 
keit Anerkennung und herzlichsten Dank zugleich mit dem 
Wunsche aus, er möge der Sektion auch fernerhin seine wert- 
vollen Dienste ungeschmälert leihen. 

Narnberg, Dezember 1898. 

F. H. Hu her, Schriftführer. 



VnL Jahresbericht der botanischen Sektion. 

Die Sektion trat mit 26 Mitgliedern in das laufende Jahr 
ein, im Laufe desselben trat Herr Apotheker Schlegel bei, 
während Herr Professor Dr. Wagner, ein überaus treues und 
thätiges Mitglied, in Folge seiner Berufung an die landwirt- 
schaftliche Akademie Weihenstephan uns leider entrissen wurde, 
sodafs der Mitgliederstand am Schlufs des Jahres wieder 26 
beträgt. 

Die Vorstandschaft war die gleiche, wie im Vorjahre. 

Die Sektion hielt folgende Zeitschriften: Uhlworm, bo- 
tanisches Zentralblatt; Leimbach, deutsche botanische Monats- 
schrift; Kneucker, allgemeine botanische Zeitschrift; Wettstein, 
österreichische botanische Zeitschrift; ferner zirkulierten noch, 
von der Gesellschaft freundlich überlassen: Rosenthal, bio- 
logisches Zentralblatt; Prometheus; Wiener und Grazer Garten- 
zeituDg. 

Neuangeschafft wurden: Göbel, Organographie; Wettstein, 
geographisch- morphologische Pflanzensystematik; Schimper, 
Pflanzengeographie; Kittler, Flora des RegnitzgebieKs. la 

Digitized by VjOOQIC 



6ä 

Fortsetzung blieb: Asoherson, Synopsis; Potoni^, Pflanzen- 
palaeontologie. Geschenkt wurden: Ament, Frühlingsflora um 
Bamberg; mehrereNummem des General-Anzeigers mit Referaten 
von Fr. Schultbeifs und Spandel. 

Aufser S gröfseren Schenkungen der Herren Dr. Koch sr., 
Paalzow und Medizinalrat Rehm in Regensburg liefen noch 
2ahlreiche Zugange ein, welche im 3. Absatz des Berichtes 
über die Sammlungen Terzeichnet sind. 

Die Durchforschung des Florengebietes wurde namentlich 
in den bisher weniger begangenen Strichen eifrig fortgesetzt 
bezüglich der Phanerogamenflora, Herr Eaulfufs setzte seine 
bryologischen Beobachtungen, Herr Paalzow diejenigen über 
Grofzpilze fort, während an der Sammlung parasitärer Pilze, 
welche zur Zeit Herr Professor Magnus bearbeitet, sich ver- 
schiedene Mitglieder beteiligten. Herr Fr. Schultbeifs, dem 
bezüglich der Adveutivflora auch heuer das Glück günstig war, 
blieb wie bisher gewissenhafter Referent über die phaeno- 
logischen, heuer vielfach abweichenden Vorkommnisse. 

Auch mit auswärtigen Botanikern blieb die Sektion in 
regem Verkehr, namentlich mit den Herren Dr. Appel in 
Königsberg, Ascherson, Gräbner, Magnus in Berlin. 
Herr Dr. Harz in Kulmbach beteiligte sich an den pflanzen- 
geographischen Beobachtungen im nördlichen Jura. Herr 
Privatdozent Dr. Glück in Heidelberg belehrte und erfreute 
durch eine Reihe instruktiver Vorträge über die Natur der 
Flechten. 

In 19 Sitzungen wurden folgende Referate mit Demon- 
strationen geliefert: 

Buchner: Flora der Enneberger Dolomiten, zur Flora von 

Nürnberg. 
Ehrhard: Flora von Südtirol und Oberitalien, Moose vom 

Schwarzwald. 
Heerwagen: Phytelephas. 
Prell: Zur Flora der Dolomiten, Anpflanzungsversuch 

alpiner Pflanzen im Jura. 
Rodler: Frühlingsflora in Oberbayern, zur Flora von 

Nürnberg. 
Rudel «r.;Trientalis bei Oberferrieden, Geterach ofQcinarum 

bei Solenhofen. Rhytisma in verheerender Menge auf 

Amahorn Schmausenbuck. ^ l 

Digitized by VjOOQ IC 



63 

Rudel jr.: Ghondrilla juncea, ErnäbrungsstöruDg duroh 

Pilzbesetzung. 
Kinkelin: Über von Missionar Keiler in Neuguinea ge- 
sammelte Früchte; Pinus nigricans; über die bei den 
Ausgrabungen in der Beckerslobe von der anthro- 
pologischen Sektion gefundenen Pflanzenreste. 
Schlegel: Lycopodium clavatum von Heinbach. 
Fr. SchuUheife: Phaenologie. Flora von Parsberg, Beiln- 
gries, Dietfurt, Keuper- und Sandflora von Nürnberg, 
Adventivflora. 
Yeil Sehultheifs: Ornithogalum arabicum, Succulenten, 

parasitäre Pilze. 
Schioars: Über die Zugänge zum allgemeinen, bayerischen 
und Nürnberger Herbar, Formenreihe des Batrachium 
aquatile, die Fruchtbildung der ümbelliferen, Frühlings- 
flora um Vilseck Auerbach, zur Flora des Oberpflllzer 
Jura, der Straubinger Oegeud und des bayerischen 
Waldes. Verbreitungskärtchen. 
Sckwemmer: Zur Flora von Nürnberg. Heimat von Prunus 

Gerasus und avium. 
Wagner: Aufblühen von Reps und Kohlarten, Kultur- 
versuche mit Pisum arvense von Sexton, Lupinus 
polyphyllos, Sant Josö-Schildlaus. 
Schliefslich sei noch der wärmste Dank ausgesprochen 
flir die finanzielle Unterstützung, die der Sektion von der Ge- 
sellschaft gewährt wurde, sowie für das freundliche Entgegen- 
itommen der Redaktion des General-Anzeigers, das diese durch 
uoentgeltliche Aufnahme der Einladungen, zu den Sektions- 
sitzungen bekundet hat. 

A. Schwarz, W. Rudel, 

Obmann. Schriftführer. 



IX. Jahresbericht der geographischen Sektion. 

Im Jahre 1898 zählte die Sektion 29 Mitglieder. In zehn 
Monatssitzungen wurden folgende Vorträge und Referate gebracht. 
Am 20. Dezember 1897: 

Herr Enslin sprach über den 36. Band der Mitteilungen 
der k. k. geographischen Gesellschaft in Wien. 

Digitized by VjOOQ IC 



64 

Am 17. Januar 1898: 

Von Herrn Dr. Heerwagen wurde ein Manuskript des 
Herrn Ludloff auf der Wunderburg bei Erlangen mitge- 
teilt, welches eine Autobiographie und Reiseerlebnisse 
in Nord- und Süd-Amerika enthielt. 

Am 21. Februar: 

Herr Dr. Heerwagen sprach über Völtzkow's Forschungen 
auf Madagaskar, Juan de Nova und Aldabra; Herr Hör- 
mann referierte über »das Opfer der Bibel« von Lang, 
und über den »Ursprung der Magyaren« von Vamberg. 

Am 21. März: 

Herr Postmeister Schmidt sprach über »Die Insel Hainan.« 

Am 16. Mai : 

Herr Dr. Heer wagen referierte über Ratzel's »politisch- 
geographische Rückblicke«; Herr Postmeister Schmidt 
über »versunkene Schiffe im Nemi-See«; über den fran- 
zösischen Sudan und Timbuktu; über die »Beschreibung 
der totalen Sonnenfinsternis in Indien.« 

Am 20. Juni: 

Herr Dr. Heerwagen sprach über Maschonaland; Herr 
Postmeister Schmidt über »Blitzableiteranlagen am alt- 
jüdischen Tempel in Jerusalem.« 

Am 18. Juli: 

Herr Obermayer sprach über seine sechste Reise nach 
Italien, insbesondere über Rom und Pompeji. 

Am 19. September: 

Herr Dr. Heerwagen zeigte eine Sammlung von Photo- 
graphien aus Hinterindien vor. 

Am 17. Oktober. 

Herr Hör mann referierte über Brandt »aus dem Lande 
des Zopfes«; Herr Postmeister Schmidt über das »Archiv 
für Post und Telegraphie.« 

Am 21. November: 

HeiT Dr. Heerwagen sprach über Ramsay und über 
Kurs »die künstlichen Wasserstrafsen im deutschen Reich«, 
indem er gleichzeitig die grofsen Wandkarten »Deutsch- 
Ostafrika« und »der Kaiser Wilhelm -Kanal« vorzeigte. 
Herr Hörmann referierte über den geographischen und 
ethnographischen Inhalt einer Utopie von Boussenard, 
»10000 ans dans un bloc de glace.« Herr Obermayer 

Digitized by VjOOQIC 



65 

zeigte und besprach Photographien aus Italien; desgleichen 

Herr Kinkel in solche aus Palästina unter Mitteilung 

von Reiseerlebnissen im heiligen Land. 

In jeder Sitzung referierte aufserdem der Obmann tiber 
die Ansichtssendungen der einschlägigen neuen Litteratur 
seitens der Schrag'schen Hofbuchhandlung, sowie tiber den 
Inhalt der Zeit- und Tauschschriften. Herr Greiner zeigte 
von Zeit zu Zeit Neuanschaffungen aus seiner Privatbibliothek 
an alten Druckwerken vor. An Geschenken erhielt die Sektion 
von Herrn Hofbuchhändler Schräg > Hübners statistische 
Tabellen 1897« und von Herrn Enslin die Karte »Der Unter- 
Main-Ereis des Königreichs Bayern mit der Einteilung in 
Land- und Herrschaftsgerichte 1829«, wofür auch hier Dank 
ausgesprochen wird. 

Aus Sektionsmitteln wurden für dieGesellschaftsbibliotbek 
angeschafft: 

Verhandlungen der Gesellschaft für Erdkunde, Berlin. 

Zeitschrift derselben Gesellschaft. 

Deutsche Kolonialzeitung. 

Geographisches Jahrbuch, XX. Band, 2. Hälfte. 

Verhandlungen des 12. d. Geographentages Jena 1897. 

Kasette zu Lepsius geologischen Reichskarte. 

Die Geschäfte der Sektion besorgten der Unterzeichnete 
als Obmann, Herr Enslin als Kassier und Herr Hörmann 
als Schriftführer. 

Dr. Heerwagen. 



X. Jahresbericht der chemischen Sektion. 

Die chemische Sektion der naturhistorischen Gesellschaft 
zu Nürnberg hielt im Jahre 1898 neun Sitzungen ab, um vier 
weniger als im Vorjahre; der Grund für diese Verminderung 
ist darin zu suchen, dafs der Schlufs der Sitzungen des Sommer- 
semesters bereits am 26. April erfolgte und nicht, wie im Vor- 
jahre erst mit der 2. Sitzung im Juni. Bestimmend für diesen 
frühzeitigen Schlufs war die seit Jahren gemachte Erfahrung, 
dafs die Sommersitzungen stets schlecht besucht waren und 
sich nur schwer eine Tagesordnung für dieselben beschaffen liefe. 

Am 9. Januar feierte die Sektion im Hotel »Roter Hahn« 
ihr Stiftungsfest An dieser Feier beteiligten sich 24 Mitglieder 

Digitizedby Google 



66 

und 24 Gäste, und sie nahm, Dank den Bemühungen der 
Herren Apotheker Peters, Dr. Lessing, Dr. Metzger, 
Dr. Raum und Kunstmaler Raum einen äufserst gelungenen 
Verlauf. 

Ferner besichtigten 24 Mitglider der Sektion und 12 Gäste 
derselben am 27. Februar unter Führung des Herrn Apotheker 
Peters die pharmaceutischen Sammlungen des germanischen 
Museuros. 

In den neun wissenschaftlichen Sitzungen wurden von 
sieben Mitgliedern sechs Vorträge gehalten und zehn Referate 
bezw. Mitteilungen erstattet. Aufserdem fand in der ersten 
Dezembersitzung eine Debatte über die, allgemeines Interesse 
beanspruchende Frage statt : 

«Welche Vorkehrungen können zur Verhütung der durch 
die Acetylengasbeleuchtung möglichen Gefahren und Belästi- 
gungen getroffen werden.« 

An dieser Debatte beteiligten sich auf Einladung auch 
mehrere Herren, welche bezüglich der Acetylengasfrage schon 
gutachtliche Äufserungen abgegeben hatten. 

Von den 16 Vorträgen, Referaten und Mitteilungen be- 
handelten 

4 theoretische und 
12 technische Thematas. 

An denselben waren beteiligt die Herren 
Dr. Prior mit 3 Vorträgen und 1 Referat 



Dr. Stockmeier 


» 2 


. 1 . 


Prof Dr. Wagner 


* 1 Vortrag 


» — » 


Dr. Lessing 


» — » 


» 4 Referaten 


Dr. Oppler 


9 f 


» 1 Referat 


Dr. Raum 


» » 


» 2 Referaten 


Inspektor Schlegel 


a — » 


« 1 Referat. 



Der Besuch der Sitzungen war ein sehr guter, denn es 
betrug 

die höchste Theilnehmerzahl 51, im Vorjahre 41 
» geringste » 19, » » 14 

» mittlere * 30, » » 25. 

Als regelmäfsige Gäste wohnten den Sitzungen bei die 
Herrn Assistenten der staatlich subventionierten Brauerei- 
versuchsstation, sowie die Schüler des zweiten Kurses der 
chemischen Abteilung der kgl. Industrieschule. 

Digitized by VjOOQ IC 



67 

Die Tagesordnung der einzelnen Sitzungen lautete: 

25. Januar. Dr. Prior: Verschiedene analytische Hitteilungen. 
S.Februar. Dr. Wagner: Die Kalkdüngung, deren Wert und 

praktische Verwendung. 
22. Mfirz. Dr. Lessing: Über die elektrolytische Zink- 
gewinnung. 

» » Über die Acetylen- und Carbidausstellung in Berlin. 

» • Schlegel: Über fadenziehendes Brot 

26. April. Dr. Prior: Über den Ausschank des Bieres mit 

flüssiger Kohlensäure aus Syphons und Fässern. 

• » Dr. Lessing: Ergänzungen zu seinen Hitteilungen 

in der vorigen Sitzung mit Demonstrationen. 
U.Oktober. Dr. Stock meier: Über die Ursachen bei der 

Aluminiumbronzefabrikation. 
» » Derselbe: Über das Lissmann'sche Plattinierungs- 

verfahren. 
25. • Dr. Prior: Über Bierfälschungen. 
» • Derselbe: Neuerungen in der Charakteristik der 

Hefenrassen. 
» • Dr. Raum: Hineralogische Demonstrationen. 
8. NoYbr. Dr. Lessing: Die GoldschmidVschethermochemische 

Industrie. 

• » Dr. Oppler: Demonstration des Apparates *Sodor.« 
» >• Dr. Raum: Die Harmorindustrie Carrara's. 

22. » Diskussion über die Vorkehrungen zur Verhütung 
der bei der Acetylengasbeleuchtung möglichen 
Gefahren und Belästigungen. 

13. Dezbr. Dr. Stockmeier: Die Versuche zum Überziehen des 
Aluminiums mit anderen Hetallen, insbesondere das 
Wachwitz'sche Alumini um-Plattinierungs verfahren. 

Von ihren Hitgliedern verlor die Sektion im Laufe des 
Jahres 2 durch den Tod und zwar ihren Gründer und 1. Obmann 
Herrn Prof. Dr. Kämmerer, sowie Herrn Dr. BaumOller, 
Direktor der naturhistorischen Gesellschaft, ferifer 6 durch 
Aufenthalts Veränderung. Neu beigetreten sind 4 Hitglieder, 
und es hat sich dcftainach der Hitgliederstand von 43 am 
Anfang des Jahres auf 39 am Ende desselben verringert. 

Die durch den Tod des 1. Obmanns notwendige Neuwahl 
fiel auf den bisherigen 2. Obmann Herrn Dr. Stockmeier. 
Als 2. Obmann wurde Herr Dr. Prior gewählt Bezüglich 

Digitized b^OOgle 



68 

der alljährlich stattflDdeDden Neuwahl des Ausschusses wurd< 
in der Sitzuog am 11. Oktober einstimmig der Beschlufs gefafst 
dafs in der ersten Sitzung des neuen Kalenderjahres dei 
zweite Obmann an Stelle des ersten treten soll. Es hat dem 
nach fernerhin nur die Wahl eines zweiten Obmannes, voi 
2 Schriftführern und 1 Kassier stattzufinden. 

Dr. Prior. 



XI. Erster Jahresbericht der zoologischen 
Sektion. 

Die zoologische Sektion wurde^ durch die konstituierend 
Versammlung vom 13. Mai 1898 mit 14 Mitgliedern ins Lebei 
gerufen, denen sich noch 5 weitere Mitglieder anschlössen, s< 
dafs die Sektion am Schlüsse des Jahres aus 19 Mitglieder] 
bestand. 

In 7 ordentlichen Sitzungen wurden folgende Referate 
Demonstrationen und Vorträge erstattet: 

I. am 13. Mai 1898: 

Herr Dr. Heer wagen über Paradiseldac und die Hern 
Dr. Loewi gehörigen, aus Südamerika stammenden aus 

gestopften Vögel. 
Herr Paalzow über Galceola sandalina und Pleurodictyuo 

problematicum, beide aus dem Devon. 

IL am 17. Juni 1898: 

Herr Dr. Heerwagen über Geradflügler, über Rani 

fusca und über Lysidice viridis. 
Herr Kinkel in über Iguana tuberculata. 
Herr Weber demonstrierte Limenitis Sybilla, Callimorpha 

Dominula, C.v. Persona, C. v. romanovi, Arctia purpurata 
Herr Paalzow demonstrierte Ammoniten aus dem fränki 

sehen Dogger. 

III. am 22. Juli 1898: 

Herr Paalzow referierte über die Ameisenlöwen in Neu 
Guinea aus der Berliner Entomologischen Zeitschrif 
und demonstrierte Pecten pumilus aus dem Dogger 
ferner Decapoden aus dem Solnhofer Schiefer. 
Herr Hellmuth über Trigla Gunardus. 

Digitized by VjOOQ IC 



69 

IV. am \i. August 1898: 

Herr Ludwig Wunder hielt einen Vortrag Ober »Die 
Stellung des Plateosaurus Engelhardti unter den 
Reptilien der Vorzeit und der Gegenwart.« 

Herr Paalzow legte als Qesclienk des Herrn Expeditor 
Wi edder den verletzten und anormal geheilten Fufs 
eines Rehes vor, besprach dann die geologische Be- 
schaffenheit des Ortes Würgau und demonstrierte eine 
grofse Anzahl von dort herrührender Petrefacte. 

V. Am 21. Oktober 1898: 

Herr Paalzow referierte über den literarischen Einlauf. 

Herr Schwarz sprach eingehend über die geologischen 
Verhältnisse von Münster und schenkte zur Samm- 
lung eine Anzahl von dort mitgebrachter Petrefacte. 

Herr Span de 1 referierte über Spongien und demon- 
strierte Schwammnadeln. 

Herr Stadler zeigte Achrontia atropos. 

Herr Paalzow Palaeoniscus Freieslebeni. 

Herr Einkelin schenkte Psammodynastes pulverulentus. 

VI. am 18. November 1898: 

Herr Paalzow referierte über den literarischen Einlauf 

und demonstrierte Trilobiten aus den unteren Schichten 

des Übergangsgebirges. 
Herr Dr. Heer wagen sprach über Bastardierungen bei 

Fischen, VOgeln und Säugetieren und über die Fische 

Graubünden 8. 

Herr Webel demonstrierte Schmetterlinge aus seiner 
Sammlung. 

VH. am 16. Dezember 1898: 

Herr Paalzow besprach sehr eingehend eine Arbeit über 
die Ameisen, über Vespa crabro und über die Be- 
ziehungen zwischen den Ameisen und den myrme- 
cophilen Tieren, demonstrierte dann aus dem Zechstein 
von Thüringen Productus horriduß, Geinitzianus und 
latirostratus. 

Herr Einkelin demonstrierte und schenkte Philodrias 
vüidissima. 

Digitized by VjOOQ IC 



70 

Schliefslich sei Herrn Spandel der beste Dank der 
Sektion ausgesprochen Mr die unentgeltliche Lieferung der 
notwendigen Drucksachen und für die unentgeltliche Aufnahme 
der Annoncen im General-Anzeiger. 

Rieh. Paalzow, Hellmuth, 

Obmann. Schriftführer. 



Digitized by VjOOQ IC 



71 



Zugänge zur Bibliothek 

vom 1. Januar bis 31. Dezember 1898. 



Periodiea: 

Archm füfr ÄfUhropologie, 25. Band. Heft 1—4 Ttod der 
Natnrh. Gesdlsehaft angeschafft). 
3270. — ßeüräge z, Anthropologie u, ürgesehiefUe Bayerns, 12. Bd. 
Heft 1—4 (von d. anthrop. Sektion angesch.). 

— CeniralblaU f, Anthropologie, Ethnologie u, Urgeschichte, 

II. Jahrg. Heft 1—4 (t. d. anthrop. Sekt, angeseh.). 

— LmesblaU, Nr. 20— 2ft (t. d. anthrop. Sekt angeach.). 

— ZeUschriftf. Ethnologie, 28. Jahrg. Heft 1—6; 29. Jahrg. 

Heft 1— K (Ton der Naturh. GeselUch. angeseh.). 

— Globus, 78. u. 74. Bd. (v. d. Naturh. Gesellsch. angeseh.) 

— Geographische Z^lsehrift von Hettner, lY. Jahrg. 1898 

(y. d. Naturh. Gesellsch. angeseh.). 
Si57. — Geographisches Jahrbuch, XX. Bd. 1897. 2. Hälfte (von 

d. geogr. Sektion angeseh.). 
S±60. — Deutsehe Kolonialzeitung,i}i.J9ihTgAS9S, Nr.l— 21,28— 49, 

51, 52 (y. d. geogr. Sektion angeseh.). 

— Petermanns Mitteilungen, 44. Bd. 1898 (v. d. Naturh. Ge- 

sellsch. angeseh.). 

— — , Ergänzungshefte Nr. 128—126 (v. d. Naturh. Ge- 
sellsch. angeseh.). 

— ZeUschrift d. Gesellschaft /. Brdkunde zu Berlin, 82. Bd. 

1897; 88. Bd. 1898. Heft 1—4 (y. d. geogr. Sekt ang.). 

— Verhandlungen d, Gesellschaft /. Erdhunde zu Berlin, 

25. Bd. 1898 (y. d. geogr. Sekt angeseh.). 

— Prometheus, Nr. 382—884; Nr. 892—416; Nr. 486; 489 

his 441; 448; 445—480 (v. d. Naturh. Ges. ang.). 

— Naturtoissenschaftliche Rundschau von Sklarek, 13. Jahrg. 

1898; Nr. 84; 86-52 (y. d. Naturh. Ges. ang.) 

— Biologisches Centralblatt, 16. Bd. Nr. 8-5; 17. Bd. Nr. 8 

his 17; Nr. 28, 24; 18. Bd. 1898 Nr. 1-24 (y. d. Naturh. 
Ges. ang.). 

— Botanisches Centralblatt, 55. Bd ; Nr. 1 1, 12 ; Beihefte 1896 

S. I-XXXXIV; Nr. 18 u. Register z. 69. Bd.; Nr. 1 
bis 18 u. Register z. 70. Bd.; 71. Bd.; Nr. 1—10, Nr. 12 
des 78. Bds.; Nr. 1—10 des 74. Bds. (y. d. botan. 
Sekt ang.) 

Digitized by VjOOQ IC 



li 

Penodica: 

— DmUche botamisehe M(mat$$chr\ft, Ift. Jahrg. 1897, Heft 

4—12; 16.Jahrg. 1898 Heftl-5 (v. d. boton. Sekt ang.). 
8218. — Oesterr. ßoiam$che ZeH$ehrift, XLUI. Jahrg. 1893 ; XUY. 
Jahrg. 1894; XLVII. Jahrg. 1897 Nr. 5—12; XLVHI. 
Jahrg. Nr. 1—5 (t. d. hotan. Sekt ang.). 

— Allgemeine Manische ZeUechrift v. A, Kreueker: 1897 

Nr. 4-12; 1898 Nr. 1, 2, 5 (?. d. hoton. Sekt ang.). 

— Der Zoologische Garten, 39. Jahrg. 1898 Nr. 1—12 (?. d. 

zoolog. Sekt. ang.). 

— ZsUsehrift f. anorganisehe Chemie, Bd. I-XV ; Heft 1—3 

des XVL Bd8. (v. d. ehem. Sekt ang.) 

— Humboldt MowUsschrift /. d. ges, Haturwissenseh., hrsg. 

T. Dr. 0. Daunner. VI. Jahrg. 1887; VII. Jahrg. 1888; 
Vni. Jahrg. 1889; IX. Jahrg. 1890. (Geschenk.) 
3814. — Berieht über die Wüterungs- und SrankheiisverhäUmsse 
Nürnbergs^ Januar— Dezember 1898. (Geschenk der 
meteoroL Station.) 



3474. Ammt, Wilh,, Bambergs Flora im Frfihling. 80. Nr. 9— i2 de» 

UnterhaJtungsbl. d. Bamb. Tagbl. 1896. 
3490. Abbatius Baldus Angeius, de admirabili viperae natura et de 
• mirificis ejusdem facoltatibus. Hagae Gomitis MDGXL. il\ 

Index u. 186 S., einige Tafeln. 
8436. Arbeiten der D. Landwirtschi^fts- Gesellschaft, Heft 16: G. Sie- 

mssen u. Dr, Maerker, Verbrauch an Kalirohsalzen in der 

deutsch. Landwirtsch. in den Jahren 1890 u. 1894, m. Ta- 

beUen. 80. 32 S. 

3613. Amell, Dr. H. W., Lebermoosstudien im nördl. Norwegen. 

Jönköping 1892. 40. U S. 
3598. Bamberg, Festschrift z. Feier d. SOj&hr. Bestehens d. Gewerbe- 
rereins in — . 1897. 4®. 18 S. 
Bar, /. B., s. 3249, Programme. 
Bauer, s. 3236, Programme. 
3195. Baumgarten, Dr, med. P. von, und Dr. med^ F, Tangl, Jahres- 
bericht über d. Fortschritte in d. Lehre t. d. pathogenen 
Mikroorganismen, umfassend Bacterien, Pilze u. Protozoon. 
14. Jahrg. 1895. 80. XII und 784 S.; 12. Jahrg. 1896. 8». 
XII u. 896 S. 
3255. Bechstein, Dr, Joh. Matth., Forstinsektologie, m. 4 111. Kupfert. 
Gotha 1818. 8« XU u. 552 S. 
— , s. Jagdlust. 

3614. Bsngtsson, Simon, Studier öfyer Insektiarrer. I. Lund 1897. 

4«. 118 S. 4 Taf. 
3658. Bergen, Internat Fischereiausstell. 1898; Ul. Prospekt. 



Digitized by VjOOQ IC 



78 

^7. Berlin j Offizieller Haapt - Katalog der Berliner Gewerbe- Aus- 

aieUoiig 1896. 80. 256 u. 260 S. 
S478. V. Bibra, Der Kaffee a..B. Surrogate. Mttndien 1868. 80. 112 S. 
S650. BUder aus der heimatl. Yogelwelt. Eine Wandtafel, Fol. 
S599. Biichoff, Th., Atlas: 22 Tat zu d. Abhandlung d. Prof. Th. 

Bischoff flb.d. Schädel d. mensehenfthnlichen Affen. (Sitzungs- 

ber. d. k. b. Ak. d. Wissenschaft) Mflnchen 1867. gr. Fol. 
Blamu$, Prof. Dr. R., Sonderabdrücke aus »Omis«. YIU. Jahrg. 

Braunschweig. 8^. 
SS61. -, Leopold y. Schrenk. S. 632-544. 

5265. — , Omithol. Beobachtgn. a. d. Herzogt. Braunschweig. 1855 

bis 1894, m. Karte. S. 378-^476. 
316S. — , Yögel d. Herzogth. Braunschweig. S. 621—688. 

S164. — , VogeUeben a. d. d. Leuchttürmen. S. 88—138. 

326S. — , VogeUeben a. d. d. LeuchUürmen. S. 679—692. 

5266. — , Schluüifolgerungen a. d. omithol. Beobachtungen an 

deutsch. Leuchttürmen i. d. lOjähr. Zeitraum v. 1886 bis 
1894. S. 698—620. 

8267. — , Ober d. Vogelzug a. Barbados 1886 Ton Dr. G. J. Man- 

ning. S. 366—872. 

S268. — , Omis r. Malta und Gozo u. d. umliegenden Inseln. S. 189 

bis 212. 

S661 -, Braunschweig im Jahre MDGGGXGVU. Festschr. z. LXIX. 
Naturforschenrers. in Br. 80. XIV u. 684 S. 71 Abb. u. 
PL; 1 Karte. 

^8. Bode^ Joh. Eiert, Anleitung z. Kenntnis d. gestirnten Himmels. 
8. verm. Anfl., m.l6Taf. u. 1 Karte. Berlin 1806. 8<^. XVI 
u. 668 S. 40 S. Nachtrag. 

^630. Bodefimpfung für Leguminosen mit reinkulÜTierten Bacterien. 
Höchster Farbwerke. 8^ 16 S. 4 Taf. 

S451. Boieeier, Bulletin de Therbier — , Gend?e. 80. Sonderabdrücke 
aus VoL I, 2 1898. 111, 11 1896. V, 2-9 1897 ; Appendices 
zu Vol. I, Nr. 1 u. 2 1898. U, 4 1894. 111, 1 1896. V, 1 1897. 

^278. Brandenetein, Frkr. v., Getreu aufgenomm. Gebirgsgegenden und 
Höhlen um u. bey Muggendorf für Freunde d. Natur- und 
Gebirgskunde. 1. Suite, mit 6 Kupfern. Nümberg 1811. 
kl. 40. 28 S. 

^20. Bramdee, W., Flora d. Pro?. Hannoyer. 80. 544 S. 
Braun, C. F. W., s. 8242/48, 8269. Programme. 

^1 BrockmüUer, Dr. H., Beitr&ge zur Kryptogamen-Flora Mecklen- 
burgs. S. A. a. d. Archiv d. Freunde d. Nat. i. Mecklenb. 
XVIL 1868. 8». 96 S. 

S<K)1. Brogger, W. C, Die silurischen Etagen 2 u. 8 im Kristiania- 
Gebiet u. auf Eker. Kristiania 1882. gr. 8<>. IV u. 876 S. 
12 Taf. u. Profilkarten. 



Digitized by VjOOQ IC 



74 

8600. CalUano, Gustav, Prähistorische Funde in der Umgebung Ton 

Baden. 158 Text-Ili. Hersgb. y. d. G. z. Y. wiss. Kennt, in 

Baden. 1894. 8« 146 S. 
8251. Classen, C, Der mittelfir&nk. Boden. Ansbach 1871. Vortrag m. 

1 geogn. Proftl v. Mittelfranken. 8«. 10 S. 
8648. Cobres, /. P., Deliciae Gobresianae. BQchersammlg. zur Natur- 
geschichte. (Augsburg 1781.) S^ XXVIII u. 966 8. 
8472. Curies, P. F., Anleitung, die im mittl. u. nördl. Deutschland 

wild wachsenden und angebauten Pflanzen auf eine leichte 

und sichere Weise durch eigene Untersuchung zu bestimmen. 

Leipzig 1865. 8». VI und 400 S. 11. Aufl. (8. Aufl. d. 

Bearb. Ton Aug. Lüben.) 
8625. Daffner, Dr. Fr%,, Das Wachstum des Menschen. Leipzig 1897. 

80 Vi u. 180 S. 
Dalla Bosa, Dr. Alois, s. Toldt, Dr. Carl. 
8290. Dalla Torre, Dr. K. W. v., Text z. Altas d. Alpenflora, gemalt 

T. Ant Hartinger. Deutsch.- u. österr. Alpen-V. Wien 1882. 

8« 250 S. 
8214. — , Die Tolkstflml. Pflanzennamen in Tirol u. Vorarlberg nebst 

folklorist. Bemerkungen z. Flora d. Landes. Innsbruck 1895. 

8». 76 S. 

8603. Darmstadi, Die Erwerbungen f. d. Sammlungen d. Grolsh. Mus. 

zu —. 1888/9. 80. 8 S. 
Decker, Prof. G., s. 8250. Programme (2). 
8328. Deutsche zoolog. Gesellschaft, Das Tierreich: Acarina. 8. LieL 

Oribatidae (A. D. Michael). 4. Lief. Eriophyidae. (A. Nalepa). 
8210. DieudonnS, Dr. A., Schutzimpfung und Serumtherapie. (AbeFs 

medicin. Lehrbücher.) Leipzig 1895. 8®. Vorw. u. 136 S. 
8504. Dippel, Dr, Leop., Das Mikroscop u. seine Anwendung. U. umg. 

Aufl. 11. Teil, II. Abt.; m. 182 Holzschn. Braunschweig 

1898. S. 445-660 u. XVI S. 
8298. Dörfler, Botaniker-Adressbuch. Wien 1896. 4^ 
8285. Ebermeyer, Dr. E., Die Walds treufrage. München 1894. S.-A. 

80. 16 S. 

8604. Ekstrand, E, V., Lefyermossor , (Jungermaniaceae foliosae). 

Bihang tili K. Svenska Vet Akad. Handlingar Bd. 6 Nr. 1. 
80. 66 S. 

8606. Eif Strand, M., Hieracia alpina a. d. Hochgebirgsgeg. d. mittl. 

Skandinaviens. Upsala 1898. 72 S. u. 8 Tab. 8®. 
Emmerich, Dr. H., s. 8241, Programme. 
Fieischmann, Dr. W., s. 8250, Programme. 

8607. Floderus Matts, Cber d. Bildg. d. Follikelhflllen b. den Asddien. 

Inaug.Diss. Upsala 1896. 80. 97 S. 1 Taf. S. A. aus Zeitschr. 
t w. Zool. LXI, 2. 
Förderreuther, M., s. 3259 Programme. 



Digitized by VjOOQ IC 



75 

S2H. Franek, Dr. Ä. B., Lehrbach der Botanik. 2. Bd. AUgem. u. spez. 
Morphologie. Mit 417 Abbildg. Leipiig 1898. S^ 482 S. 

3287. — , Die Krankheiten der Pflanzen. 3. Bd. 2. Aufl. Die tier- 
parasitären Krankheiten d. Pflanzen m. 86 Abbild, im Text 
Breslan 1896. 80. Xu. 264 S. 

3470. Framms, Bin Ausflug nach Kiau-Tschou. Vortrag. Berlin 
1898. 80. 32 S. 

3254. Friekm, W. v,, Naturgeschichte d. i. Deutsehl. einheim. Käfer. 
IL sehr vermehrte Aufl. m. zahlr. Holzschn. Arnsberg 1872. 
8». XVI u. 344 S. 

3608. Friet, EUa$, Epicrisis Gleneris Hieraciorum (Upsala 1861). 

8«. S. 3-160. 
Fries, Hob., s. Fristedt Roh. 

3609. Fries, Th. M., Natural historien i Sverige intill Medlet af 1600 

- Talet Upsala 1894. 8«. 78 S. 
Frieditnann, Ludw,, s. 3259 Programme u. dasselbe auch in Nr. 
3047. 
3615. Fristedt, R. F., Joannis Franckenii Botanologia. Upsala 
MDCCCLXXVII. 40. 140 S. 

3610. Fristedt, Rot, och Rob. Fries, Om tTänne i Sverige hittiUs miss- 

kända arter af växtslägtet Rumex. 8®. 6 S. 
3632. FundbericMe aus Schwaben, umfassend die vorgesoh., röm. u. 

roeroving. Altertümer. Hrsgeg. y. Württemb. anthrop. Verein 

unter d. Leitung v. Prof. Dr. Sixt in Stuttgart, in. Jahrg. 

1895. 8». 72 S. 
3231. Gerstaecker, Dr. A., Der Golorado-Käfor u. sein erstes Auftreten 

i. Deutschi., mit 1 Farbendrucktaf. Gassei 1877. 8^. 84 S. 
8623. Goebel, Dr. K., Organographie der Pflanzen, insbes. der Arche- 

goniaten u. Samenpflanzen. I. Teil : Allgero. Organographie 

m. 130 Abbldgn. im Text. Jena 1898. 8«. IV u. 232 S. 
3315. Oordon, Dr. Ant. de, El Tabaco en Guba. Apuntes para su 

historia. 8^. 86 S. 
-, La ViabUidad legal j la Fisiologica. 1897. S®. 42 S. 
— , La Inspeccion mediea oficial en nuestras escuelas. 1898. 

80. 62 S. 
— , La Legislacion del Soguro de Vida ante la Medicina Forense. 

1898. 80. 42 S. 
— , Discurso leido el dia 19 de Mayo de 1897. Habana. 80. 56. 
3631. Grandhomme, Dr., Die Fabriken d. A.-G. Farbwerke yorm. Lucius 

u. Brflning zu Höchst a. M. in sanitärer u. sozialer Beziehung, 

m. 10 Lichtdruektafeln. III. Aufl. Frankfurt a. M. 1893. 40. 

90 S. 
8209. G^mbel, C. W., Geologie y. Bayern. Gassei 1894. gr. 8«. 1184 S. 
8286. — , Geognostische Beschreibung d. fränk. Alp. (Frankei^ura.) 

Kassel 1891. 



Digitized by VjOOQ IC 



76 

3454. Qümber 8 Biogrüphle u. Todesanzeige. Augsb. Abendstg. Nr. 168. 

1898. 
3589. Hau, James, Preliminary Geologie Map of New-Tork. 1 : 816800. 

1894. gr. Fol. (Zum 14. Ann. Rep. of the State Geologist, 

New-York.) 
8690. Hammer, C. F., Der Uoter-Mayn-Kreis des Kgr. Baiem m. d. 

Eintbeilung in Land- u. Herrschaflls-Gericbte. Nflrnberg 18)9. 
Hammon, Dr, Chr., s. 8260, Programme. 

3621. Hannover, 1. Katalog d. Vog^ammlung aus d. Prov. HannoYer. 

Hannover 1897. 80. 24 S. 
IL Katalog d. systemat. Vogelsanunlg. d. Pror. Mos. in 
Hannover. 1897. 80. 106 S. 

3622. — , Yerzeicbnis der im Prov.-Mus. zu Hannover vorband. Säuge- 

tiere. Hannover 1897. 8^. 30 S. 
Hartmann, Prof, Jos., a. 3250, Programme. 
Hauek, H, s. 3244, Programme. 
3642. Heerwagen, Prof. Dr., Zur Lebensgescbicbte des Nasenbären. 
S. 120 u. 121 des >Zoo). Gart.« 1898. 
Heidner, G,, s. 3250, Programme. 
Herzog, Dr, Joh, Chr., s. 3259, Programme. 
Herzogenrath^ F., s. 3250, Programme. 
3594. Hess, Friedr., Vergährnng von Saccharose durch d. Hefen von 
, Saaz, Frohberg u. Logos unter verscb. Emäbrg.-Bed. Inau- 

gural-Diss. Nürnberg 1897. S^. 30 u. 2 S. 
3626. Hinizmann, 2>. Ernst, Das Innere der Erde. Vortrag. Beil. z. 
Jahresb. d. naturw. Yer. in Magdeburg 1888. 8^ SO S. 
Höehtlen, s. 3240, Programme. 
Hoffmann, Dr, Joh. Jos. Ign,, s. 3250, Programme. 
3636. Hoffmann, Oeorg Franz, Deutschlands Flora od. botan. Taschen- 
buch; 2. Teil f. d. Jahr 1795. Grjrptogamie, 200 S., 14 TaL 
m. Beschreib., Vorher., Index. 
— , Dslbe., f. d. Jahr 1804. L Teil, 2. Abt, neue u. vermehrte 
Aufl. 308 S., 12 Taf. m. Beschr. Erlangen. 12<^. 
3253. Hoffmann j Ph , Prodromüs florae Eystettensis. Versuch einer 
syst. Charakteristik d. wildwachsd. GefftüBpflanxen um Eich- 
stätt. (Programm.) L H&lfle 1868; IL Hälfte 1869. kl. S^. 
VIII u. CXLVIII S.; 278 S. 
— , 8. auch 3237, Programme. 
3280. Holst, Awely Obersicht d. Bakteriologie f. Arste u. Studiereade; 
Obers, v. Dr. Ose. Reyher. Mit 24 HolxscbB. u. 2 Farbendr. 
Basel 1891. 80. XII u. 210 S. 
3641. Hügel, Jh. Th., Darstellg. v. Stereoskopbildem m. HOlfe ortho- 
gonaler Goordinaten. (Progr.) Neustadt 1876. 4®. 14 S. 
34 Fig. 
3633. Jagdlustj Joseph MUelU, Grilndl. Anweitg. alle Arten v. Vögehi 



Digitized by VjOOQ IC 



77 



zu fangen, einzustellen, nach dem Oeaehlecbi za unterschei- 
den, zahm zu macben, abzurichten Umgearbeitet ¥. 

Joh. Matth. Bechstein. Mit vielen Kupfern. Nürnberg u. Alt- 
dorf 1796. 8«. XIV u. 796 8. 
S646. Jamei Charles, ^des sur les fourmis, les guftpes ex les abeilles 
Note 14 du tra?ail conronn6 par Tlnstitut de France. Limoges 

1897. 8« 100 S. Note ili. Paris 1897. 8« n 8. S.-A. 
Note 16. Lille 1897. 8«. 86 8. 

8647. ^, Notice sur les tra?eauz scientifiques. 1896. 8^. 94 S. iliustr. 

Jkric%tk, Otto LuUp., s. Mflller, Sophus. 
8611. Johantmm, Ludwig, Bidragrill Kämedomen om Sreriges Ichthy- 
obdellider. 8». 118 8. u. 10 Taf. 
Judeieh, Dr,^ s. Nitsche. 
Keiler, Dr. Fr%,, s. 8159, Programme. 
8418. KUiel, Dr. Mart, Bald., Taschenbuch der Flora Deutschlands. 
NOrnb. 1887. ll». CIV u. 744 8. 
— , 8. auch 8288, Programme (6). 
KUnget^feld, Prof. Fr. Aug., s. 8250, Programme. 
8624. Kkmsikhger^ C. B., Die Lehre von d. 8chwebenwe8en d. sACsen 
Wassers, od. Untersuchungsweison u. Ergeh, d. Limnoplank- 
tologie ro. bes. RQcks. a. d. Fischerei. Gharlottenburg 1897. 
gr. 8^ 8. 119-176 d. Zeitschr. f. Fischerei. 
3651. Knapp, Friedr., Die Bergfestung Rothenberg. Nflmberg 1898. 

8«. 96 8. 12 Abb. 
8657. — , Erinnerungen an das 250-j ihr. Jubelfest d. Pegnes. Blumen- 
ordens. NOmberg 1898. 8«. 86 8. illust 
Knoblauch, Dr. Emil, s. Warming. 
S274. Köberlm, Dr. Alfred , Zur histor. GesUltung d. Landschafts- 
bildes um Bamberg. Beil. z. Jahresber. d. n. Gymnasiums. 

1898. 80. VII u. 180 S. 

8896. Koeh^ Dr. W. D. J., Taschenbuch d. deutsch, u. Schweiz. Flora. 

4. Aufl. Leipzig 1856. 80. 584 8. 
8292. Köhler' 8 nOtzliche Vogelarten u. ihre Bier. M. viel Farbdr. Gera 

1896. 80. 62 8. 
3456. KoUmialgeseüeehafi, Jahresbericht d. deutsch. — . 1895. 78 S. 

80. Mitgliederverzeichnis 1898. 
8230. Kuhn, Kaepar R, D. Käfer d. südbayer. Flachlandes. M. 1 Taf. 

Augsburg 1858. VIII u. 400 8. 
8281. Kukn, D. rauhe — , bei Neustodt a./K. 1892. 8«. 16 S. 

Kuppler, Prof C. 0., s. 8250, Programme. 
8415. Xdk^Aantfi in der Tierheilkunde. 80. i6 8. Ober Wirkungen 

des L. SO. 8 8. 
8212. Loew, Dr. E., EinAhrung i. d. BlQtenbiologie auf bist. Grund- 
lage. Mit 50 Abbild. Berlin 1895. 80. XII u. 482 S. 
8670. Lorenz, Dr. P., Die Fische d. Kantons Graubanden. 1898. 8o. 

186 8. 6 Tab. 1 Karte. DigitizedbyGoOglc 



78 

IMen, Aug.y 8. Gflries. 
Ludwig, Dr. F., 8. Sonderabdr. 
Maerker, Dr., s. Arbeiten d. D. Landwirfscbafts-Ges. 
8645. Magnus, P., Der Mehlthau auf Syringa yulgaris in Nord- Amerika. 
Mit 1 Taf. S.-Abdr. a. d. Ber. d. D. Bot. Ges. 1898. B\ 
S. 68-70. 
8628. Mayr, Eugen, Die FluCsj^rlenmoschel u. Perlenzucht in Bayern. 

1892. 80. 2 S. 
8664. Metamer, Roderich, Studien Ober d. Einflufs d. Essigsäure u. 
Milchsäure auf d. Hefen Saaz, Frohberg u. Logos in Saccha 
rose-Lösung. Inaug.-Diss. Berlin 1897. 8<^. 86 S. 
Merkelf Dr, Sigmund, s. Periodica Nr. 3814. 
Michael, Ä. D., s. Deutsche zool. Gesellschaft. 
Minsinger, Dr. Frz., s. 8250, Programme. 
8652. Moiesan, Henri, Der elektr. Ofen. Autor, d. Ausg. v. Dr. Tlu 

Zettel. 42 Abb. Berlin 1897. 8«. VIII u. 862 S. 
8485. Müller, Dr. Iwan, Die Universität Erlangen unter d. Markgrafen 

Alexander. Vortrag. 1878. 4«. 28 S. 
8656. Müller, Sophue, Nordische Altertumskunde nach Funden u. Denk* 
malern aus Dänemark u. Schleswig, gemeinfafslich dargest. 
Deutsche Ausg. v. Dr. Otto Luitpold Jiriczek. Mit Tafeln, 
250 Textillustr. u. 1 arch. Karte. StraTsburg. 8^. Lief. 1—10. 
Nalepa, Ä., s. Deutsche zoolog. Gesellschaft. 
8410. Naneen, Frid^Gf, In Nacht u. Eis. Fortsetsg. Heft 87—54. 
8627. Naturforscher u. Ärzte, Statuten d. Gesellschaft deutscher — , 

HaUe 1891. 8». 12 S. 
8447. Naturfor Seherversammlung, Tagblatt d. 66. Yersamml. D. Naturf. 
u. Ärzte in Wien. 1894. Nr. 1-7. 4«. 442 S. 
— , s. Blasius. 

8284. Neumoffr, Dr. Melch., Erdgeschichte. I. Bd. allgem. Geologie 

Leipzig u. Wien (abhanden gekommen. Bericht darüber in 
d. (xeneral- Yersamml. y. 25. Jan. 1899). IL Band. Beschrei- 
bende Geologie. 
8669. New South Wales, Mineral Map and General Statistics. Sydney 
1876. 8«. 

8285. Nitsche, Dr. H,, Die Nonne. Liparis monacha L. Ihr Leben^ 

ihr Schaden u. ihre Bekämpfung. Vorwort v. Dr. Judeich. 
S.-A. Wien 1892. 8 0. VIII u. 60 S. 
8288. Nonne, Die, auch Fichtenspanner, Fichtenbär, Rothbauch gen. 
(Liparis monacha). Auf Veranlassung d. Staatsministeriums 
hrsgeg. 2. Aufl. Mit 1 Taf. München 1891. B\ 84 S. n. 
Erklärung. 
8687. Nürnberg: Anträge, Die Errichtung eines Volksbades, die Frei- 
legung des Gewerbe-Museums-Neubaues, die Herstel- 
lung einer n. Verbindung mit der Insel Schutt u. d» 

Digitized by VjOOQ IC 



79 

Nürnberg: 

damit im Zasammeahang siehende Verleg, d. i. Kaiha- 
rinenkloster untergebrachten Anstalten betr. Stadt- 
magistr. NOrnbcrg 1895. Schm. Fol. 16 S. 8 PI. 
S588. — Nürnberger Schimpf Wörter, 16 Taf. quer 4^ col. 
S6S8. — Katalog zur Allgem. Fischereiausstellung in Nürnberg. 
1892. 8«. 48 S. 
— Meteorologische Stationy s. Rudel , Prof. und Periodica 
Nr. 3814. 

3654. — Ortepolizeiliche Vorschriften. Nürnberg 1. Juli 1898. S^. 

XX u. 252 S. 
5507. — Pegnesischer Blumenorden, Altes und neues aus d. — . 
UI. Nürnberg 1897. 8^. 820 S. 

3655. — Sammlung d. sämmtl. Lokalpolizei-Verfügungen v. 1806 

bis 1852. I. Abt: Die Lokalpolizeil. Verfüg. 8«. 494 
u. XVIII S. 
S67 . Oberhummer, Dr. Eugen, Bericht d. Central- Kommission f. wiss. 
Landeskunde v. Deutschland. S.-A. a. d. Verhandlgn. des 
XII. D. Geographentages. Berlin 1897. 8<^. 16 S. 
8685. Ochsenheimer, Ferdin., Die Schmetterlinge ▼. Europa. Bd. 1—10. 
Leipzig 1807—1885. 8<>. Von Bd. 5 an von Fr. Treitschke. 
Oeehsner, s. 8258, Programme. 
S277. O^ele, Dr. Felix v., Sonderabdrflcke : Die Medizin in Mesopo- 
tamien zur Keilschriftzeit ; (ärztl. Rundschau 1895.) 8^. 18 S. 

— Die Vorläufer der Pharaonenftrzte. (Prager Med. Woch. 
XXL 1896.) 8<>. 8S. — Vorhellenische Medizin Kleinasiens. 
(Zeitschr. t klin. Med. 80. Bd.) 8<>. 8 S. — Die Vergiftung 
durch Stierblut bei den Alten. 6 S. (Pharm. Post 1899.) 8^. 

— Sapo antimonialis in Altftgypten. 2 S.; Medicamente für 
Säuglinge in Aitägypten. 2. S.; V.— XXIV. Aufsätze über 
assyr. Ärzte u. Keilschriftmedicin. 8. u. 82 S. ; (allg. medic. 
Gentr. Zeitg. 1898 u. 1899.) S^ 

S640. Oesterreiefier's anatomischer Atlas, 8 Tafeln Stahlstiche aus —, 

1828. Folio. 
32S9. Panzer^ Gg. Wolfg. Fr., Deutschlands Insektenfauna od. entom. 

Kalender. Mit 12 z. T. kolor. Stichen. 12 unnum. Seiten. 

Dann : Georg Wolfg. Franc. Panzer! Entomologia Germanica 

exhibens insecta per Germaniam indigena. I. Elevterata .... 

cum Tabolis Aeneis. Norimberga (1795). 12 ^ 872 S. 
^S6. Peters, H., Medizinischer Aberglaube älteren u. neueren Datums. 

S.-A. 1880. 
^7. Pettenkofer, Prof. Dr. M., Ober Leuchtgas aus Holz (Vortrag). 

1850. 4«. 8. S. 
^1* PhUippi, Dr. R. Ä., Sobre el verdadero significado de la palabra 

Cordillera. Santiago 1898. it^. 10 S. 

Digitized by VjOOQ IC 



80 

8i82. Pollacky J)r. Fr. X, Flora v. DUlingen. DI. TeU der Beiträge 
zu einer Topographie v. — . 1868. 8<>. 70 S. u. 6 S. Register. 

— , 8. auch Programme, 8246. 

Preysinger, P. Ludw., b. 82K0, Programme. 

Programme, Samroclband 4^; enthält: 
8236. Bauer, Die Nonne. WOrzburg 1845. 42 S. 

8287. Hoffmann, Ph,, Der Ameisenstaat, dessen Bewohner a. 

inn. Organisation. Bamberg 1859/60. 80 S. 

8288. Schwab, Dr. K, L., Die Oestracidcn-Bremsen d. Pferde, 

Rinder u. Schafe. Mfinchon 1840. 82 S. 

8289. (f), Bedeutung d. Insekten i. d. Natur. I u. II. 3. 25—82 ; 

S. 25-86. 

8240. Uöehllen, Verzeichnis d. Icbneumoniden d. Umgeh, von 

DinkeUbfihl. 4 S. 

8241. Emmerich, Dr. H,, Z. Geologie d. Umgeg. r. Meiningen. 

1876. S. 14-28. 

8242. Braun, C, F. W., D. Tiere in den Pflanzenschiefem d. 

Geg. ▼. Bayreuth. 1860. 12 S. u. 1 Taf. 
8248. Braun, C. F. W,, Beiträge z. Urgeschichte d. Pflanzen. 

Vi. 1848/49. 10 S. u. 1 Taf. YU. 1864. 16 S. u. 
8 Taf. 

8244. Hauch, H., Wasserflora d. Umgegend ▼. Nfimberg. 1856. 

14 S. 

8245. Raupp, Ph., Ober d. Orseillieflechte d. Rhön, bekannt 

unter d. Namen Sleinflechte od. Basaltmoos. Würz- 
burg 1840. 12 S. 

8246. Pollaek, F. H., Topographie v. Dillingen. 1845. 86 S. 

8247. Simon. F., Das Leohfeld. Augsburg 1849/50. 16 S. 

8248. WaUl, Dr., Passau u. seine Umgebung, geognosi-mine- 

ralog. geschildert 1852/58. 18 S. Dassdbe, IL um- 
gearb. Ausg. 1859/60. 18 S. 

8249. (^or, J' B.), Beiträge zur Topographie von Freysing. 

(Situationskarte fehlt.) 12 S. 

8250. — , Sammelband 4^; enthält: 

Preysinger, P. Ludwig, Versuch einer ration. Erörterg. 
d. ersterenFundamentalpunkte d. Elementar-Mechanik. 
Augsburg 1857/58. 1 Taf. 24. S. 

Schnürlein, Prof. Lud. Chr., Versuch einer Leuen Ent- 
wickig. d. Grundgesetze d. Dynamik u. d. Theorie 
d. Funktionen. Hof 1846/47. 1 Taf. 88 S. 

Hoffmann, Dr. Joh. Joe. Ign., D. Grundgesetz d. Hebels 
u. d. Parallelogramm d. Kräfte. Aschaffenburg 1841/42. 
IV u. 16 S. 

Heidner, G., Über die wichtigst. Statist Kraftverhältn. 
beim Erahn. Schweinfurt 1858/54. 12 S. 



Digitized by VjOOQ IC 



81 



Programme 



Kuppler, Prcf. C. G., Ober d. Anwendg. d. Poinsot*sdien 

Gegenpaare i. d. techn. Mechanik. Nürnberg 1840/41. 

1 Taf. 12 S. 
Becher, Prof. 0., Ober die Reibung an cylindr. Zapfen. 

Augsburg 1850/51. 16 S. 
KUnger\feld, Prof. Fr. Aug., Die KonstrulLtion d. Rad- 

z&hne, überhaupt u. insbesond. d. E^olventenzähne. 

Nürnberg 1854/55. 1 Taf. SO. 
F/6itdkmafifi, Z>r. TK., DieW&rme. Memmingen 1865. 14S. 
Weger, Br. H,, Einiges über d. wicht Wärmequellen. 

Nürnberg 1859/60. 36 S. 
(T), Zur mechan. W&rmetheorie. 12 S. 
Wo{fram, Dr. C, Aug., Die Ausdehnung d. Körper durch 

d. Wärme u. d. Wasserdampfl Würzburg 1855/56. 

IV u. 44 S. 
— , Von d. Wärmemengen d. Körper. Würzburg 1858/59. 

56 S. 
Becher, Prof. G., Über Trägheit, Reaktion und Kraft. 

Augsburg 1855/56. 20 S. 
Hammon, Dr. Chr., Die Adhäsionen m. ihr. resultirend. 

Erscheinungen. Kaufbeuren 1859/60. 10 S. 
(?), Eine element. Theorie d. Gapillarersch einungen. 14S. 
Wdfs, Prcf. Dr. Ad., Die Elemente d. analyt Dioptrik. 

Nürnberg 1856/57. 32 S. 
Harimafm, Prof. Jos., Gnomonik od. Theorie u. Gonstrukt. 

d. Sonnenuhren. Passau 1868/69. 2 Taf. 26 S. 
Mineinger, Dr. Frz., Mathem. Geographie in Verbindg. 

mit popul. Himmelskunde. 1857/58. 1 Taf. 80 S. 
üerwgenrath. F., Studien a. d. physik. Chemie. Bam- 
berg 1859/60. 28 S. 
Reinseh, Paul, Die Meteorsteine. (Zwei brücken?) 1869. 

1 Taf. 22 S. 
3258. — , Sammelband 4^; enthält: 

Kittel, Dr. M. B., D. hydraulische od. Gäment-Kalk a. 

d. Umgeg. Aschafienburgs u. dessen Benutzg. 1836. 

16 S. 
— , Skisze d. geognost Verhältnisse d. Umg. Aschaffen- 

burgs. 1838/89. IV u. 40 S. 
Oechsner, Die Käfer d. Umgegd. Aschaffenburgs 1853/54. 

IV u. 48 S. 
Kittel, Dr. M. B., D. meteoroL Verhältnisse Aschaffen- 
burgs aus 36 jähr. Beobachtgn. u. deren Resultate. 

1868/69. 32 S. 
— , Verzeichnis d. offenblütigen Pflanzen d. Umg. von 

Digitized by Lj6)OQIC 



82 

Programme 

Aschaffenburg u. d. Spessarte. I. Abtlg., d. Mono- 
cofyledonen. 1870/71. 52 S. 
KüM, Dr. M, B., U. Abt, d. Dicotyledonen. 1871/72. 
S. 58—172. 
8259. — , Sammelband 4®; enthält: 

Woeekel, Dr. Lor., Die Sonne u. ihre Flecken. Nürnberg. 

1845/46. 32 S. 
Schneider, Dr. Eug., Zur Erdgeschichte, geoL Studien. 

Bamberg 1856. X u. 108 S. 

Frisehmcmn, Ludw., Yersuche e. Zusammenstellung d. 

bis jetzt bek. Tier- u. Pflanzenüberreste d. iithogr. 

Kalkschiefers in Bayern. Eichstädt 1853. II u. 46 S. 

Braun, C. Fr. W., Zur Geschichte d. Vorkommens von 

fossilem Brennstoff. Bayreuth 1838/39. S. 13—20. 

Förderreuiher, Dr. M., Der Speckstein, eine Monographie. 

12 S. 
Biederer, Dr. J. B., Beiträge z. Kenntnis d. Edelsteine. 

Freising 1859. 1 Taf. 48 S. 
Keller, Dr. Frz., Ghem. u. mineral. Mitteilgn. S. 25 — 38. 
Beinsch, Paul, D. Meteorsteine, s. auch 3250. 
Schrüfer, Dr. Theo.^ Von d. Wirkungen d. Wassers auf 

u. i. d. Erde. Bamberg 1867/68. 32 S. 
Herzog, Dr. Joh, Chr., Ober d. Mdglichk. gew. durch- 
greifender u. perman. Verändergn. i. d. Atmosphäre. 
Hof 1860/61. 16 S. 
3660. Backl, J., Die Reisen d. Venetianers Alvise da Gä da Mosto an 
d. Westküste Afrikas (1455-56). Nürnberg 1898. 8«. 88 8. 
3643. Bänke, Joh., Schädel d. bayer. Stadtbevölkerungen. 40. 88 S. 
Zur bayer. Volkskunde. I. Zwei Rauchhäuser a. Tegemsee. 
IL Mittelfränk. Ornamente, m. Tafeln. S. 47—52. S.-Abdr. 
a. d. Beitr. z. Anthr. u. Urg. Bayerns. 
2850. Batzel, Friedr., Völkerkunde. II. Bd. 2. Aufl. Leipzig 1895. 
gr. 8» X u. 780 S. 
Baupp, Ph., s. 3245, Programme. 
3282. Beefs, Dr. Max, Lehrbuch d. Botanik, mit 471 z. T. farbigen 
Fig. in Holzschn. Stuttgart 1896. 4«. X u. 454 S. 
Beinsch, Paul, s. 3259 u. 3250, Programme. 
3448. ReitzensMn, Fritz^ Ober d. Einwirk, reduzrd. Mittel auf Metall- 
Cyanide u. einige Metallsalze mit organ. Basen. Sep.-Abdr. 
a. Liobigs-Annal. d. Ghemie 282. Bd. S^. 14 8. 
Beyher, Dr. Oscar, s. Holst Axel. 
3634. Biehier, Joh. Oottfr. Ohn^., P. R. Ichthyotheologie oder Ver- 
nunft- u. schriftmäfsiger Versuch d. Menschen aus Betrach- 
tung d. Fische zur Bewunderung, Ehrfurcht u. Liebe ihres 



Digitized by VjOOQ IC 



88 

gr. erh. Schöpfers zu fahren. Mit Kupfern. Leipzig 1754. 
Vorrede, Inh.-Vens., 912 S. u. Register. 8* 
8659. Richthcfm, Ferd. Frhr. v., Schantung u. a. Eingangspforte Kiau- 
Tschou Mit 9 Licbtdr-Taf. a. 3 Karten in Mappe. Berlin 
1898. 80. XX Vm u. 8«4 S. 
S649. Rie88, Joh., Über einige fossile Ghimaeriden-Reste im Münchener 
paläontolog. Mus. S.-A. aas Palaeontographica (Zittel). Stutt- 
gart 1887. 4«. i8 S. 
Biederer, Dr, J, B., s. 8259» Programme. 
3667. Böeler, Prcf. Gottlieb Friedr., Handbuch d. prakt Astronomie 
f. Anfänger u. Liebhaber. Tübingen 1788. I. Teil m. XIII 
Kupfertaf., Vorrede, 504 S. u. Anh. II. Teil m. XXIX Kupfer- 
taf., Vorrede, 454 S. u. Anh. 
3814. Rudel, Prqf., Die Witternng Nürnbergs i. J. 1897. S^. 20 S. 
— , Beridit über d. meteorol. Station Nürnberg i. Schu^ahre 
1897/98. 8«. 8 S. 
S. auch Periodica Nr. 3314. 
Buihe, Joh. Friedr., s. Troschel, Dr. Fr. Herm. 
8673. Sehimper, Dr. Ä. F. W., Püanzengeographie auf physiolog. Grund- 
lage. Jena 1898. 8«. XVUI u. 876 S., 502 Abb, 5 Taf., 
4 Karten. 
Sehneider, Dr. JBug., s. 3259, Programme. 
* Sehnärlein, Prof. Ludw. Chr., s. 3250, Programme. 

SchrUfer, Dr. Theo., s. 3259, Programme. 
3591. Schübe, Theod., Die Verbreitung d. (xef&fspflansen in Schlesien 
nadi dem gegenw. Stande uns. Kenntnisse. Breslau 1898. 
80. 100 S. u. 1 Karte. 
3494. SchuUhäle, Friedr., Pbänolog. MitteUungen 1894, 1896. Unser 
Frühling 1898. (Einzelnummern d. General- Anzeiger.) 
Schwab, Dr. K. L., s. 3288, Programme. 
3276. Schweigger, Äug. Frid., Speeimen Florae Erlangensis. Erlangae 
doIdcccV. mit Prooemiym u. 186 S. kl. 8^. 

3671. Selenka, Prof. Dr. Emil, Atypische Placentation eines altwelt- 

lichen Schwanzaffen. Leiden 1898. 8^. 4S. S.-A. aus Ann. 
du Jardin Botan. de Buitenzorg, Supplement II, S. 85—88. 

3672. —, Blattumkehr im Ei der Affen. Leipzig 1898. 8« S.-A. 

a. d. BioL GentralbL Bd. 18. 
3288. Ser^, Dr. Ferd., Geognostische Wanderungen in Deutschland. 

I. Band. Deutschlands Landgebiet im AUgem Hannov. 

u. Leipzig 1894. 8«. XXIV u. 182 S. 
3275. Siebert, Ä., Post-, Reise- u. Notizen-Karte von Mitteleuropa. 
Nürnberg, Leuchs & Co. 
Siemesen, G,, s. Arbeiten d. D. Landwirtschafla-Gesellschaft. 
Simon, F., s. 8247, Programme. 
Sixi, G., siehe Fundberichte aus Schwaben. 



Digitized byVjOOQlC 



84 

86H5. Soldan, Carl, Die Gesammtarbeitsleistaug d. Hefen Saaz, Froh- 
berg u. Logos in Saccharofle-Dextrose- u. Mallose-Lösung. 
Inaug.-Diss. Nürnberg 1897. 8«. 86 S. 
8484. Sonderahdrücke aus »Mitt d.Thür.Bot. Ver.. 1898. 8«. Perooo- 
sporeen: Prof. Dr. F. Ludwig (Greiz). 2 S. Vorarbeiten zu 
einer Kryptogamenflora des Fürstent. Reufe &. L. L Pilze. 
10 S. u. Forte. 20 S. 
Desgl. aus »Zeitschrift für Pflanzenkrankheiten«. 8<>. Rost- u. 
Brandpilze: Über einige — Australiens. 8 S. Mykologischc 
Notizen. 
Desgl. aus d. »Forst- u. naturw. Zeitschr.« PilzfluCs der Wald- 
bäume und der Ascobulus Constantini Roll. 8 S. Alcohol- 
gährung der Eichen i. J. 1894. 2. S. 
Desgl. aus »Hedwigia«. 8^. 

Pilz, über einen neuen, algen&hnl. — (Leucocystis Criei n. 
sp.l 4 S. 
Desgl. aus Berichte d. D. bot. Ges. 1892. 8«. Pilze 12 S. 
8602. Stockmeyer, Dr., Ober Papierprüfung. 8^. 12 S. 
8658. Strafgesetzbuch f. d. Kgr. Bayern. 8«. München 1861. 
8291 . Stromer v. Reichenbach, Frhr,, Die^Geologie der deutechen Schutz- 
gebiete in Afrika. Inaug.-Dissert. m. Karten. München 1896. 
8» VIII u. 204 S. 
8612. Strömmann, Pehr Heugo, Leptocephalids in the Universily Zoo-* 
logical Museum at üpsala. Upsala 1896. 8<>. VI u. 54 S. 
5 Taf. 
8499. Sinrms, Dr. — naturhistor. Sammlung in'.Nürnberg. Verzeichnis. 

Tangl, siehe Baumgarten, Jahresbericht. 
8629. Temple, Rud,, vermeintl. Eigenheiten unserer Bäume. 8^ US. 
8616. Thäel, Hj,, Note sur quelques Holothuries des mers de la Nou- 

Teile Zemble. Upsala 1877. 4». 18 S. 2 T. 
8449. Theses pour le Doctorat en M6decine. 4^. 

Cavaiie, Alb., heureuse Intervention de Pferysipfele Bor- 
deaux, S6rie 5. Nr. 28. 1888. 72 S. 
Marangos, Äp., de'jla R^ection du Coude .... Lyon, S^rie 4 

Nr. 159. 1888. 108 S. 
Fonnegra, L., des 6pith61iomes glandulaires enkyst6s du voile 

du palais. Paris 1888. Nr. 286. 68 S. 
Guerrier, H,, Gontribution ä T^tude des fibromes duTronc . . . . 
Paris 1888 Nr. 288. 58 S. 
8427. loldt, Dr, Carl, Anatom. AUas f. Studierende u. Arzte. 6. Lief. 

Treüschke, Fr., s. Ochsenheimer. 
8256. Troschel, Dr. Fr. Herrn, u. Joh. Fr. Ridhe, Handbuch d. Zoo- 
logie. 4. Aufl. Berlin 1853. S^. 668 S. 
3617. Tullberg, Tycho, Ober die Bissus des Mytilus edulis. Upsali 
1877. 40. 10 S. 1 Taf. 

Digitized by VjOOQ IC 



85^__ 

3618. Tullberg, Tycho, Über einige Muriden tos Kamerun. Stockholm 
1893. 4^ 66 S. 4 Taf. 

3234. Ulkrieh, Äd., Der Japan. Eichenspinner. Mit 1 Lichtdrucktaf. 
(Programm.) Eichstätt 1890. 8^. S4 S. 

3605. üpiaUi, UniTersitets Arsakrift. Mathematik och Naturwetenskap. 
8«. I, 1 1865. II, 1 1870. III, 8 1870. IV, 1 1872. V, 2 
1878. VI, 1 1875. VII, 4 1876. VIII. 1 1896. IX, 1 1897. 

2667. Verhandlungen des 11 deutsch. Greograpbentages zu Jena. 1897. 
2 Abb. u. 6 Taf. Berlin 1897. 8«. LVIII u. 252 S. 

3595. Vierkandt, Dr, Ä^, Die Volksdichte im weatl. Central- Afrika. 
4 Karten. Habilit-Schrift Leipzig (1896). 8«. 110 S. 

3593. WagTter, Dr. Fr., Bericht üb. die, durch den deutsch. Hopfen- 
bau-Verein pro 1896 reranlalsten Düngungsversuche. Mit- 
teUungen d. D. Hopfenbau- Ver. Nr. 2, 1897. S. 7—18. 
— , Die Dürrfleckenkrankheit, ein neuer Feind d. Kartoffel kultur. 
40. WochenDl. d. landw. Ver. in Bayern. 1897 Nr. 8, S. 88 - 48. 
Waltl, Dr., 8. S248. Programme. 

3289. Wanmngy Dr. Eugeniu8, Lehrbuch d. ökoiog. Pflanzengeographie. 
Eine EinfQhrg. i. d. Kenntnis d. Pflanzen?ereine. Deutsche, 
V. V. durchges. u. vermehrte Ausg. v. Dr. Emil Knoblauch. 
Berlin 1886. 8». Xu. 412 S. 

3592. Weber, Fr.. Bericht üb. neue vorgeschichtl. Funde in Bayern. 
1894-96. Die Hügelgrftberaufdembayr.Lechfeld. S.-Abdr. 
aus d. Beitr. z. Anthr. o. Urg. Bayerns, XII. Bd. 1897. S. 
58-84 u. S. 87-46. 40. 
Weger, Dr. X., 8. 32Ö0, Programme. 

3279. Weichselbaum, Dr. Änt, Grundrifs d. patholog. Histologie m. 
besond. Berücksichtigung d. Untersuchungsmethodik m. 221 
z. T. färb. Ulustr. u. 8 Tafeln. Leipzig u. Wien 1892. S^. 
XII a. 498 S. 
Weiss, Prof. Dr. Ad., s. 8250, Programme. 

3468. Werner^ Eeinh , Die deutsche Flotte. Heft 7 der Flugschriften 
d. alldeutsch. Verb. München 1898. 8«. 20 S. 
Wettstein, R. v., So nder- Abdrücke : 

3215. Die gegenwftrt. Bewegung z. Regelung d. botan. Nomenclatur. 
80. 8 S. 

3216. Der Saison-Dimorphismus. Mit Taf. 8®. 12 S. 

3217. Globulariaceen-Studien. Mit Taf. 8«. 20 S. 

3218. Anagosperma (Hook) Weltst. 8 <>. 4 S. 

3219. Beitrag z. Flora d. Orients (Pisidien u. Pamphilien). Mit 
8 Taf. 80. 52 S. 

8227. Ober bemerkenswerte neue Ergebn. d. Pflanzengeographie. 

(Vortrag.) Wien 1895 kl. 8«. 22 S. 
3228. Nolanceae, Solanaceae, Scrophulariaceae. Mit viel. Abbildgn. 

gr. 80. 108 S. 

Digitized by VjOOQIC 



86 

WettsteiHy R. v., Sonderabdrficke : 
SS20. Ober Sesleria coenüea L. 8. 8* S. 

3221. Zur Morphologie d. Staminodien v. Paroassia palustris. Mit 

1 Taf. 8«. 8 S. 
8222. Untersuchungeo Aber die Sektion »Labamum« d Gattung 

Gytisus. Mit 1 Taf. 8^ 22 S. 
8228. Untersuchungen Ober »Nigritella angustifolia Rieh.« Mit 1 

Taf. 8«. 14 8. 
3224. Flora d. Balkanhalbinsel. (Vortrag.) 40. 4 S. 

8228. Studien üb. d. Gattungen Gephalanthera, Epipaetis u. Limo- 

dorum. Mit 1 Tat 8<». 14 S. 
8226. Untersuchungen flb. Pflanzen d. österr.-ungar. Monarchie. 

I. Die Arten d. Gattungen Gentiana a. d. Section >£ndo- 
tricha« Fröl. Mit 1 Taf. 8«. 86 S. 
8689. — , GrundzAge d. geogr.-morpholog. Methode d. Pflanzensyste- 
matik. Jena 1898. 4*. 64 S. 7 Karten. 
— , s. auch Periodica, österr. botan. Zeitschrift 
3666. Widenmann^ J. J., Die Umgebungen von Nflmberg. Bin Taschen- 
buch f. Lustwandler. 1828. 120. VIII u. 282 S. 
Woeckd, Dr. Lor., s. 3259, Programme. 
Wolfram, Dr. C. Aug., s. 3250, Programme. 
Zettely Dr. Th., s. Moissan. 

8282. Ziegler, Ä., Mechanische u. kosmische Physik 1862. S^. 66 S. 

8283. Zittel, Karl Ä. r., Grundzflge d. Palaeontologie. MOnchen o. 

Leipzig. 

8619. Zoologische Studien, Festschrift, Wilh. LiUjeborg zum 80. Ge- 
burtstag gewidmet yon schwedischen Zoologen. Upsala 1896. 
40. XU u. 860 S. 18 Taf. 

8488. Zürn, Dr. F. A., Die thierischen Parasiten auf u. in d. Körper 
unserer Haussäugetiere. Weimar 1872. 8^ XIV u. 288 S., 
4 Taf. 



Digitized by VjOOQ IC 



• 1 



i 



Digitized by VjOOQ IC 



Digitized by VjOOQ IC 






Jahresbericht 



der 



Naturbistorischen Gesellschaft 



zu 



Nürnberg 



für 



1899. 



->->^<- 



Nür nber g 
1900. 



D i g i t i zcd by VjQOj^l ^ 

rd ' ^ 



Digitized by VjOOQ IC 

U. E. Sebald, Nürnberg. 



Jahresbericht 

der 

Naturhistorischen Gesellschaft 

für 1809. 



Die Gesellschaft trat mit einem Bestand von 410 Mitgliedern 
in das abgelaufene Jahr ein; während desselben traten 12 ordent- 
liche Mitglieder und 1 aufserordentliches ein, dagegen schieden 
18 Mitglieder aus, hievon 10 in Folge von Domicilveränderung, 8 aber 
in Folge Todesfalls, nämlich die Herren Fritz Cammerer, kgl. 
Oberförster in Eibach; Gottlieb Glafey, Fabrikbesitzer; Heinrich 
Jungmann, Privatier; Dr. Albert Lessing, Fabrikbesitzer; Joseph 
Offenbacher, Kaufmann; Ludwig Palm, Metallgiefsereibesitzer; 
Christian Schwemmer, rechtsk. Magistratsrat und August Weifs, 
Apotheker. Am Schlufs des Jahres zählte die Gesellschaft 405 
Mitglieder. 

Von unseren korrespondierenden Mitgliedern, in deren Zahl 
drei Herren neu aufgenommen wurden, nämüch Herr Dr. Appel, 
Beamter an der botan. Sektion des kaiserl. Gesimdheitsamts in 
Berlin; Herr Ernst Ben da, Kaufmann in Adelaide imd Herr Dr. Kurt 
Harz, Reallehrer in Kulmbach, verloren wir durch Todesfall Herrn 
Karl Ho mann, Redakteur in Berlin imd Herrn Georg Wo r lein, 
kgl. Zahlmeister a. D. in Nymphenburg; der letztere war viele Jahre 
lang ein fleifsiger Mitarbeiter unserer botanischen Sektion imd hat 
sich durch Herausgabe einer Flora der oberbayrischen Hochebene 
verdient gemacht. Aber auch in den Kreis unserer Ehrenmitglieder 
hat der Tod schmerzHche Lücken gerissen, indem Herr Dr. Ludwig 
Büchner, prakt. Arzt in Darmstadt, Herr Dr. Ritter Franz v. 
Hauer, Hofrat in Wien und Herr Dr. Karl Mülle^j^^Tjr^ivatgelehrt^ 
in Halle a. S. aus dem Lefa^n schieden. ^ 

1* 



Allen Dahingeschiedenen wird die Gesellschaft ein treues und 
dankbares Andenken bewahren. 

In der Vorstandschaft ergab sich zu Anfang des Jahres insofern 
eine Änderung, als unser langjähriger, um unser Kassawesen hoch- 
verdienter Schatzmeister Herr Bernhard Lang, Kaufmann und 
schwedischer Konsul, in Rücksicht auf seine Gesundheit und auf 
die gesteigerte Arbeitslast in seinem Berufe sich zu der entschiedenen 
Erklärung veranlafst sah,. die Annahme einer etwaigen Wiederwahl 
ablehnen zu müssen. Unter dankbarer Anerkennung seiner vielen 
Verdienste um die Gesellschaft, deren Interesse er mit Rat und 
That zu fördern allezeit bereit war, wurde zu seinem Nachfolger 
Herr Georg Rhau, Fabrikbesitzer gewählt. Im Laufe des Sommers 
sahen sich dann sowohl der II. als auch der III. Sekretär Herr Dr. Karl 
Hartwig, Gymnasialprofessor und Herr Dr. Alexander Franken- 
burger, prakt. Arzt in Folge angegriffener Gesundheit genötigt, um 
Enthebung von ihrem Amte nachzusuchen. An ihre Stelle wurden, 
imter dem Ausdruck des aufrichtigsten Dankes für die erspriefshchen 
Dienste, die beide Herren der Gesellschaft geleistet, als II. Sekretär 
Herr Dr. Franz Küspert, Reallehrer und als III. Sekretär Herr 
Hermann Eckert, Kaufmann, gewählt. 

An dieser Stelle hat die Vorstandschaft über eine wichtige 
Änderung in der Organisation der Gesellschaft zu berichten, eine 
Änderung, welche nach wiederholten eingehenden Beratungen, sowohl 
in der Vorstandschaft und den Sektionen, als auch in zwei aufser- 
ordentlichen General-Versammlungen zum Abschlufs gebracht wurde. 
Es wurde nämUch auf Anregung der anthropologischen Sektion, deren 
Anträgen sich die chemische angeschlossen hatte, der Beschlufs 
gefafet, solchen Personen, welche nur an einer Sektion thätigen 
Anteil nehmen wollen, die Möglichkeit zu gewähren, unserer Ge- 
sellschaft als aufserordentliche Mitgheder beizutreten; andererseits 
wurde aber auch, um die Früchte der wissenschafthchen Arbeiten 
in den einzelnen Sektionen der Muttergesellschaft in erhöhtem Mafse 
zukommen zu lassen, den Sektionen zur Pflicht gemacht, nach 
einem festgesetzten Turnus Vorträge in den Mittwochssitzungen ab- 
zuhalten. Die in Folge obiger Beschlüsse nötig gewordene Ände- 
rung unserer Statuten, sowie der Sektionsordnung erhielt die gericht- 
liche Bestätigung imter dem 10. Oktober 1899. Möge diese Neuenmg, 
die einem lebhaft geäufserten Wunsche zahlreicher Mitglieder Rechnung 
♦ragt, von allen Sektionen gutgeheifsen und von der grofsen Mehrheit 
er in der betr. Generalversammlung anwesenden Mitglieder zum 



Beschlufs erhoben wurde, in ihren Folgen sich förderlich erweisen 
für die wissenschaftlichen Bestrebiingen unserer Gesellschaft. Zu 
den bisherigen Sektionen trat kurz vor Jahresschlufs eine neue — 
die technologische — hinzu. 

Der Besuch der Sammlungen war, namenthch von Seiten der 
verschiedenen Schulen und Lehranstalten, ein recht lebhafter. Der- 
selbe würde sich noch bedeutend steigern, wenn es unsere Mittel 
erlaubten, die Sammlungen in einer ihrem Umfang und ihrem Werte 
entsprechenden, übersichtlichen Weise aufzustellen. 

Dem speziellen Nachweis über die Thätigkeit in den wöchent- 
lichen Gesellschaftssitzungen sei hier der Ausdruck des ergebensten 
Dankes vorausgeschickt, den wir allen denen schulden, welche einer- 
seits durch Vorträge, Referate und Demonstrationen, andrerseits durch 
Bereicherung unserer Sammlungen und durch Geldspenden ihr warmes 
Interesse für die Gesellschaft bethätigten. Das Nähere hierüber 
bringt der Bericht über die Mittwochs-Sitzungen und der Schenkungs- 
bericht. Hier seien nur diejenigen Herren dankbar erwähnt, welche 
von auswärts kafnen und durch gröfsere Vorträge uns erfreuten, 
nämlich Herr Universitätsprofessor Dr. Fleisch mann in Erlangen, 
der über das Eileben der Wirbeltiere sprach; Herr Universitäts- 
professor Dr. Günther in München, der eine interessante Schilderung 
Sibiriens und der sibirischen Pacificbahn brachte ; Herr Dr. Glück, 
Assistent an der Universität Heidelberg, der über Süfswasseralgen 
referierte und Herr Apotheker Würsching, Bürgermeister in 
Velburg, der über seine interessanten Höhlenfunde Bericht erstattete. 
Aber auch einem hiesigen Mitgliede, Herrn Apotheker Erhard, sei 
hier die dankbare Anerkennung ausgesprochen für die 3 umfassenden 
Vorträge, die er über die Droguen Amerikas, Indiens und Chinas, 
sowie über die Handelswege nach Indien und China seit den ältesten 
Zeiten bis auf unsere Tage hielt. Unter den Gönnern, die unsere 
Bibliothek und unser naturhistorisches Museum mit Gaben be- 
dachten, nennen wir hier den verehrUchen Stadtmagistrat, der 
uns die wertvolle Festschrift zur Feier der Einweihung des neuen 
Krankenhauses, sowie die Festschrift zur Hans Sachs-Feier übergab; 
die Hinterbliebenen unseres langjährigen treuen Mitgliedes, Herrn 
RechtsratSchwemmer, die uns den botanischen Teil seiner Bibliothek 
und sein Herbar überwiesen; Herrn Apothekenverwalter Kinkelin, 
•der seinem gewohnten löblichen Brauche getreu auch im verflossenen 
Jahre unserer Sammlung eine stattliche Anzahl von Reptilien zu- 
geführt hat; für seine Opferwilligkeit schulden wir ihm um^iS 



6 

gröfseren Dank, als er diese Tiere eigenhändig in mustergiltiger 
Weise präpariert hat. Ebenso erwuchs unserer Sammlung eine 
wertvolle Bereicherung durch die bei den Ausgrabungen prähistorischer 
Grabhügel gewonnenen Fundstücke; bei diesen Grabungen erwarben 
sich wieder die Herren Wunder sr. und jr. durch ihren unermüd- 
Uchen Eifer und ihre grofse Sachkenntnis besonderes Verdienst, 
Ein imgenannt sein wollendes Mitglied, das seine Freigebigkeit schon 
wiederholt in erfreuUchster Weise bethätigt hat, ermöglichte uns die 
Erwerbung einer alten mit mancherlei Schaltieren völlig inkrustierten 
Amphora, eines prächtigen Schaustücks für unser Museum. Herr 
V. Schultheifs hat wieder eine Anzahl hübscher Topfpflanzen^ 
Herr Hub er aber eine interessante alte Spottfigur eines französischen 
Soldaten des vorigen Jahrhunderts zum Besten unserer Sammelbüchse 
»Archaeopteryx« gespendet; die Verlosung dieser Geschenke lieferte 
erkleckliche Beträge. Endlich hat eine Anzahl von MitgHedern auf 
unseren Appell an die Opferwilligkeit der Gesellschaft gröfsere oder 
kleinere Geldbeiträge geschenkt, die zur Tilgung unseres Defizits 
verwendet wurden; auch wurde ein Schuldschein zurückgegeben; für 
all diese Gaben danken wir bestens. Der freundlichen Einladung 
des Herrn Birkmann zur Besichtigung seines Gewächshauses, das 
eine Zierde unserer Stadt ist, wurde mit Dank Folge geleistet. 

Wir schHefsen diesen allgemeinen Bericht mit dem ehr- 
erbietigsten Dank für die auch im verflossenen Jahre gewährte 
Unterstützung aus städtischen und Kreismittebi ; desgleichen rühmen 
wir die BereitwiUigkeit, mit der die Redaktionen des Fränkischen 
Kuriers, des General-Anzeigers und der Nordbayrischen Zeitung den 
Protokollen unserer Sitzungen ihre Spalten öffneten. 

Verzeichnis der in den Sitzungen des Jahres 1899 gehaltenen Vorträge, 
Referate und Demonstrationen. 

1. Sitzung am 4. Januar: 
Herr Kinkelin, Schenkung zweier Präparate: Dromia vulgaris; 
Wollkrabbe aus dem Mittelmeere und Ophiura laevis, 
Schlangenstern ; 

> Schwarz, Vorlage von Christian Schwarz, Raupenkalender 1791; 

> Paalzow, Referat über zwei Arbeiten von Jalet, insbesondere 

über »Rapports des animaux myrmecophiles avec les fourmis«; 
» Schwarz, über die Fortpflanzungsorgane der Phanerogamen 
unter Vorlage und Schenkung der von ihm verfafsten »Gift-, 
Heil- und Nährpflanzen, Bilder aus der heimischen Pflanzen- 
welt*: Digitizedby ^OOg. 



Herr Veit Schultheifs, Vorlage eines Werkes von Suringar über 
Melokakieen. 

2. Sitzung am 11. Januar: 

Herr Schwarz, Demonstration von Blättern, Blüten und Früchten 
von Calycanthus praecox, übergeben von Herrn Rechtsrat 
Schwemmer; 

> Kinkelin, Schenkung einer Natter, Lycodon aulicus, von 

Manila, und von Früchten des Guttapercha-Baumes; 

> Paalzow, Demonstration einiger von Herrn Rodler geschenkten 

Mineralien ; 

* Schwarz, über Bandwürmer und über Ascaris marginata, 

einen Spulwurm des Hundes, unter Vorzeigung einiger 
Präparate. 

3. Sitzung am 18. Januar: 

Herr Dr. Heerwagen, Vorlage zweier Geschenke, einer Monographie 
von Hugo Graf von Waldersdorf »Römerbauten an dem 
Königsberg bei Regensburg«, geschenkt von Herrn Freih. 
V. Loeffelholz in Regensburg, und einer Anzahl von Karten 
aus dem Hohmann'schen Atlas, geschenkt von Herrn Buch- 
bindermeister Praeg; 

> Erhard, über tropische fetthaltige Samen unter Vorlage der- 

selben; 

* A. Schmidt, über Palmin und Margarine als Speisefett; 

> Rudel, über Arachidöl; 

* K i n k e 1 i n , Schenkung eines indischen Domschwanzes, Uromastix 

hardwickei ; 
» Veit Schultheifs, Vorlage eines Stnmkes von Aloe nigricans; 

> Schwarz, über die Konfiguration der Schichtanlage bei 

Hohenstadt. 

4. Sitzung am 1. Februar: 

Herr Obermayer, Vortrag über seinen Besuch in Pompeji und die 
Besteigung des Vesuv unter Vorlage von Photographieen; 

» Dr. Heerwagen, Vorlage eines Kopfskelets von Phoenicopterus 
ruber, präpariert von Realgymnasiast Heuner; 

» Kinkelin, Demonstration einiger Anschaffungen für die 
Sammlung (Carcinus maenas); 

» Schwarz, Vorlage von Geschenken für die BibUothek von 
Herrn Medizinalrat Holler in Memmingen, Hulmr und 
Schwarztrauber. ° 9' '^^^ ^^ L^OOglC 



8 

5. Sitznng am 8. Februar: 

Herr Dr. Heerwagen, Vorlage von >SpandeI, Foraminiferen des 
deutschen Zechsteins« als Geschenk vom Verfasser; 

» Dr. Frankenburger, über den derzeitigen Stand der 
Forschungen über Ätiologie der Malaria und über Amöben; 

» Schwarz, Demonstration von Cladonia coccifera von Dutzend- 
teich; 

> Kinkelin, Schenkung von Lycodon aulicus var. capucina aus 

Manila; 
» Schwarz, Demonstration von Jurakorallen aus der Gegend 
von Blaubeuren und zweier seltener Liasammoniten. 

6. Sitzung am 15. Februar: 

Herr Dr. Frankenburger, Referat über Malariaplasmodien unter 
Vorzeigung mikroskopischer Präparate; 

> L Otter, Übergabe einiger Geschenke zur Bibliothek; 

» Hub er, über Montinit und Schenkung eines auf Elfenbein 
gemalten Porträts eines Gründers der Gesellschaft, Oster- 
hausen; 

» Kinkelin, Demonstration und Schenkung von Tropidonotus 
striatus aus Ceylon; 

» V. Schultheifs zeigt eine blühende Echeveria pubescens, die 
echte Meerzwiebel (Scilla maritima) und die fälschUch 
sogenannte Meerzwiebel (Ornithogaliun arabicum); 

» Schwarz, Vortrag über die FamiUe der Pirolaceen unter 
Vorzeigung zahlreicher Pflanzen und Verbreitungskarten. 

7. Sitzung am 22. Februar: 

Herr Schwarz, Demonstration für die Sammlung erworbener 
Präparate: Serpula contortuphcata und Psammechinus 
miUaris; 

» Dr. Heerwagen, Vorlage eines Kukukseis und eines Granat- 
krystalls von der Granatwand bei Gurgel, geschenkt von 
Herrn Prof. Dr. Blümke; 

» Rudel, Vorlage einiger Bände der Veröffentlichungen des 
Landesmuseums von Bosnien und Herzegowina; 

» Schwarz, über morphologische Differenzen und Keimungs- 
unterschiede der Monokotylen und Dikotylen; 

» V. Schultheifs, Vorlage eines Pilzes, Polyporus ribesiarum; 

> Schwarz, Demonstration von Nectia cinnabarina und eines 

verwandten Pilzes; C^r^r^f^]r> 

Digitized by V^OOQIC 



9 

Herr Wieseler, Vorzeigung von Handarbeiten und Photographien 
aus Tsingtau (Kiautschou), mitgebracht von Herrn Dr. Haake. 

8. Sitzung am 1. März: 

Herr Dr. Heerwagen, Referat über Fumefs »Bilder aus Bomeo« 
in den Proeeedings der Amer. Philos. Society zu Philadelphia; 
» Staedler, Vorlage einer Zusammenstellung durch ihre Gröfse 
ausgezeichneter Insekten; 

> Huber, Schenkung einiger Schriften für die Bibliothek; 

> Kinkel in, über die arzneiliche Verwendung des Scincus 
officinaUs in früherer Zeit und Schenkung eines Präparats; 

> Paalzow, über einige für die Sammlung angekaufte niedere 

Tiere. 

9. Sitzimg am 8. März: 

Herr En giert, Vortrag über rauchfreie Verbrennung unter Vor- 
führung eines Modells; 
» Rudolf Schmidt, Schenkung einiger Vogelschädel; 

> Paalzow, Schenkung einer Zusammenstellung von Planorbis. 

muhiformis, deren Entwicklung darstellend; 

> Schwarz, über die geologischen Verhältnisse der Umgebung 

von Erlangen unter Vorlage einiger Leitfossilien. 

10. Sitzung am 15. März: 

Herr Professor Dr. Fleischmann-Erlangen, Vortrag über das 
Eileben in der Wirbeltierwelt mit Skiopticondemonstrationen ; 
» Dr. Heer wagen, Vorlage eines Flamingobalges, geschenkt von 
Herrn Paul Zopfy; 

> Kinkelin, Demonstration und Schenkung von Ancistrodon 

hypnale aus Ceylon; 
>. Schwarz, Vorlage einer Vespertiüo murinus und eines 
Simipfvogels, beide von Veilhof bei Skt. Jobst und ge- 
schenkt durch Herrn Braumeister Rogg. 

> Staedler, Vorzeigung einer Sammlung herrlicher Schmetter- 

lingsarten. 

11.. Sitzung am 21. März: 
Herr Professor Dr. Günther-München, Vortrag über Sibirien und 
die sibirische Pazifikbahn; 
» Kinkel in, Schenkung einer Natter von Mindanao, Psammody- 
nastes pulverulentus. 

12. Sitzung am 29. März: 
Herr Dr. Heerwagen, Vorlage einer Schenkung der Frau Hof- 
ratswitwe Dietz, einer Anzahl von W^erken für die Bibliothek^ 1^ 



10 

Herr Kinkelin, Schenkung einer Baumnatter, Dendrophis pictus 
von Luzon; 
» Webel, über die verschiedenen Oberwinterungsstadien der 
Makrolepidopteren unter Vorlage einer Sammlung von 
Raupen imd Puppen. 

13. Sitzung am 5. April: 

Herr Dr. Frankenburger, Demonstration eines ungewöhnlich grofsen 

Ascaris lumbricoides ; 
» V. Schultheifs, Referat über Schuhmann, Monographie der 

Cacteen; 
» Schwarz, über Opuntia Missouriensis auf Schlofs Abenberg 

bei Roth, und über Darmsteine unter Vorlage eines solchen 

vom Pferd. 

14. Sitzung vom 12. April; 

Herr A. Schmidt, Vortrag über >Deutsche Ansiedelungen in 

Paraguay« ; 
» Kinkelin, Demonstration eines Gesteinsstückes mit Granaten 

von Bodenmais; 
» V. Schultheifs, Vorzeigung von Opuntia Missouriensis. 

15. Sitzung vom 19. April: 

Herr Wunder jun., Vortrag über die Ausgrabungen bei Labersricht 
und Behringersdorf und Demonstration der Funde; 

» Dr. Heerwagen, Vorlage einiger Geschenke für BibUothek 
• und Sammlung; 

» Seel, Demonstration verschiedener Früchte aus Neuguinea; 

» V. Schultheifs, Vorlage einer herrlich blühenden Amaryllis 
vittata hybrida; 

» K i n k e l i n , Demonstrationen einer grofsen Anzahl von Mineralien 
von Bodenmais; 

» Schwarz, Demonstration von Corydalis solida mit Peronospora 
corydahs aus dem Erlanger Schlofsgarten, eines Leber- 
mooses, Fegatella conica vom Dutzendteich und zweier 
Pflanzengallen, Schenkung mehrerer Bücher zur Bibliothek. 

16. Sitzung am 26. April: 

Herr Schwarz, Vorlage getrockneter Pflanzen aus der Gegend von 
Rom, geschenkt von Herrn Spandel; 
» Kinkel in, über Haltung des Chamäleons in der Gefangen- 
schaft und Schenkung von Männchen, Weibchen und Eiern 
von Chamäleon vulgaris; DigitizedbyL^OOg. 



11 

Herr V. Schultheifs, Demonstration von Mammillaria multiceps nnd 
Epiphyllum Russellianum Gaertneri; 

> Schwarz, über Galinsogaea parvifolia und deren Einwanderung 

bei uns und Vorlage einer Anzahl von Geschenken für die 
Bibliothek. 

17. Sitzung am 3. Mai: 

Herr Huber, über Telegraphie ohne Draht bei den Indianern und 
Vorlage von Photographieen , holländische Volkstypen dar- 
stellend ; 

> Dr. Heerwagen, Vorlage eines Spulwurms, Heteracis reflexa, 

in einem Hühnerei, dann mehrerer Stücke von Mansfelder 
Kupferschiefer, geschenkt von Herrn Kirsch; 

> Hörmann, Vorlage wertvoller neuer Tauschschriften; 

» Schwarz, Demonstration von Ixodes, Vorlage mehrerer von 
Herrn Dr. v. Oefele in Neuenahr verfafster und geschenkter 
Abhandlungen aus dem Gebiet der Geschichte der vor- 
christlichen Medizin und Arzneikunde, einer Sendung von 
Frühlingspflanzen aus der Gegend von Schweinfurt und 
über die geologische BeschafTenheit des Main- und Tauber- 
thaies; 

» Kinkelin, Demonstration getrockneter, von ihm aus Palästina 
mitgebrachter Pflanzen; 

> V. Schultheifs, Vorzeigung einer blühenden Aloe glauca 

humihs und Gasteria hngua var. nigrescens. 

18. Sitzung am 10. Mai: 

Herr Seel, Vorlage ethnographischer Gegenstände aus Neuguinea; 
» Schwarz, Demonstration eingegangener Geschenke; 
» Kinkelin, über die von Herrn Seel geschenkten Früchte aus 
Neuguinea und über Kikakumenaja-Harz ; 

* V. Schultheifs, Demonstration von Gasteria lingua und 

Varietäten ; 
» Schwarz, über Myosotis-Arten und deren Unterschiede; 

* Kinkelin, über Fritillaria meleagris bei Höfen; 

» Schwarz, über Verbreitung und Verwendung des Burgsand- 
steins. 

19. Sitzung am 17. Mai. 

Herr Webel, Demonstration einer Reihe von Föhrenschädlingen und 
Schenkimg einer Biologie von Lasiocampa pini r^/-^p 
Sammlung; ^'^^ ^ ö 



12 

Herr Hub er, Vorführung von Landschaflsbildern aus Holland mit 
dem Skioptikon; 

» Kinkel in, über die Kreuzotter (Vipera berus) mit Bezug auf 
einen jüngst hier vorgekommenen Vergiftungsfall; 

> V. Schultheifs, Demonstration von Mammillaria gracilis und 
Echeveria globosa; 

» Schwarz, über Beiträge zum Lokalherbar und Vorlage ver- 
schiedener Bücher und Abbildungen. 

20. Sitzung am 24. Mai: 

Herr Dr. Heerwagen, Vorlage, von Rhinolophus hipposideros aus 
der Bismarckshöhle bei Rinnenbrunn und eines Cocons von 
Agroeca Hnotina; 

derselbe, Referat über Hugh Marmillan >ein Streiflicht auf 
die Flora Palästinas« in den Transactions of the Natural 
History Society of Glasgow; 

» Kinkelin, Schenkung von Uromastix hardwickei und über die 
Haltung der Domschwänze, Schenkung einiger Mineralien; 

» A. Schmidt, Schenkung eines prächtigen Homsteins; 

» V. Schultheifs, Demonstration einiger Pflanzen; 

» Schwarz, Vorzeigung von Abbildungen aus der Zeit des 
Baues der Ostbahnlinie und über die geologische Beschaffen- 
heit der betr. Gegend ; über Poa bulbosa var. vivipara vom 
Spitalhof. 

21. Sitzung am 31. Mai: 

Herr Dr. Heerwagen, Vorlage einiger durch Herrn Prediger Scholl 

übergebener Geschenke; 
» Kinkelin, Schenkung von Lacerta muralis mit Eiern nebst 

biologischen Mitteihmgen; 
» V. Schultheifs demonstriert Mesembrianthemum deltoideum, 

Mammillaria Boccasana und Sedum fruticosum, forma cristata 

mit ausgebildeter Verbänderung; 
» Schwarz, über das Vorkommen von Crataegus monogyna 

var. splendens an den Rednitzabhängen bei Roth; 
» Schwarz, Vorführung einer Reihe von Abbildungen vom 

Rothenberg mit geologischen Mitteilungen. 

22. Sitzung am 7. Juni: 

Herr Schwarz, Demonstration einiger Pflanzen vom Fufs des 
Burgsteins, eingesendet von Herrn Gebhard-Redwitz, sowie 
einer Reihe von Pflanzen aus der Gegend von Artelshofen, 
gesammelt von Herrn Gynmasiast Dittmar; .GoOglc 



13 

Herr A. Schmidt, Vorzeigung einiger Naturalien; 

> Paalzow und Kinkelin, Demonstration einer Reihe von Ge- 
steinen und Mineralien; 

> Schwarz, Bericht über den letzten GeselLschaftsausflug und 
seine floristische Ausbeute; 

> V. Schultheifs, Schenkung von Echeveria globosa und 
Gasteria globosa zur Versteigerung für den Archäopteryx. 

23. Sitzung am 14. Juni: 
Herr Dr. Heerwagen, Vorlage von Calla palustris; 

> Betzold, Demonstration einer grofsen Reihe ethnographischer 
Gegenstände aus Westafrika; 

> Kinkelin, Demonstration dreier lebender Molche, Triton 
marmoratus aus Spanien; 

> Paalzow, Vorzeigung von Cykadeenresten aus Wolfehöhe 
bei Schnaittach. 

24. Sitzung am 28. Juni: 
Herr Rudel, Vorlage eines Feuersalamanders, geschenkt von Frau 

Stieber. 

25. Sitzung am 5. JuU: 
Herr Kinkelin, Schenkung von Calotes versicolor, einer Agame; 

Vorlage einiger früheren Geschenke im präparierten Zu- 
stande; 

* Rudel, Vorlage eines reich mit Pilzen besetzten Föhren- 
stammes, geschenkt von Herrn Lehrer ZippeUus in Reichen- 
schwand ; 

' • Hörmann, Bibliographische Mitteilungen aus dem Jahres- 

, bericht des Smithsonian-Instituts und die Versendungen der 

\ Publikationen ; 

* * V. Schultheifs, Demonstration und Schenkvmg eines blühenden 

Sedum dasyphyllum. 

26. Sitzung am 12. Juh: 

Herr Schwarz, über Mifsbildung durch Insektenstich an Salix rubra; 

' V. Schultheifs, Vorlage von Phalaris arundinacea var. picta, 

Mammillaria Caput Medusae und Mammillaria Heyderi mega- 

cantha, sämtlich blühend; 

» Rhau, Demonstration eines stachellosen Rosenzweiges aus 

Italien und einer Cobitis-Art; 

* Greiner, Vorlage der »Nürnberger Hesperiden« und Schenkunff 

. eines älteren anatomischen Werkes; DigtizedbyLnOOgTe 



14 

Herr Schwarz, Demonstration einer grofsen Anzahl von Pflanzen 
von der Halbinsel Krim, vom Kaukasus und der armenischen 
Hochebene, gesammelt von Herrn Bauriedel. 

27. Sitzung am 19. Juh: 

Herr Kinkelin, Demonstration einer lebenden Rautenschlange, 
Morelia argus, aus Queensland; 
» Dr. Heerwagen, Vorlage einer reichhaltigen Serie von 
australischen Goldstufen und der Cocons eines australischen 
Nachtfalters, Geschenk des Herrn E. Benda in Adelaide; 

> Schwarztrauber, Demonstration einer verschieden gefärbten 

Kornblume, von einem hiesigen Gärtner gezüchtet; 

> Schwarz, Bericht über den letzten Gesellschaftsausflug nach 

Rofsstall, über das Vorkommen von Lathyrus hirsutus, 
HeHanthemum vulgare und Reseda lutea; 

> V. Schultheifs führt vor Jasione montana vom Centralfriedhof 

und einen Fruchtstand von Amaryllis vittata hybrida; 

28. Sitzung am 26. Juh: 

Herr Dr. Heerwagen, Vorlage dreier Goldstufen, geschenkt von 
Herrn Gabriel Benda; 

> Kinkelin demonstriert ein junges, lebendes Exemplar von 

Otus vulgaris; 

> Paalzow ein solches von Melolontha fullo. 

29. Sitzung am 2. August: 

Herr Kinkel in, Demonstration eines lebenden Exemplars von 
Iguana tuberculata; 

» Dr. Heerwagen, Übergabe von Moränen^Gesteinen und Furchen- 
steinen aus dem Stamberger See, geschenkt von Herrn 
Freih. v. Löffelholz; 

» Hörmann, Vorlage eines von Cossus ligniperda durchbohrten 
Bimbaumstamms , geschenkt von Herrn Kupferschmied 
Buchner; 

» V. Schultheifs demonstriert Euphorbia caput medusae, forma 
commeUni und Euphorbia globosa. 

30. Sitzung am 9. August: 

Herr Dr. Heerwagen, Vorlage eines prächtigen Exemplars von 
Lacerta ocellata, geschenkt von Herrn Pelzwarenhändler 
Schröder und zweier lebender Exemplare, Männchen und 
Weibchen, von Gtenosaura acanthura (schwarzer Leguan), 
von Herrn KinkeUn zur Besichtigung eingesendet; _ 



16 

Herr V. Schultheifs, Demonstration einer Verbänderung von 

Asparagus offieinalis, geschenkt von Herrn Hutzier; 

> Schwarz, Beschreibung der Gegend um Auerbach i. Oberpf. 

in botanischer und geologischer Hinsicht unter Vorlagen 

von Gesteinsproben aus dem Auerbacher Bergwerk u. s. w. 

31. Sitzung am 16. August: 

Herr Schwarz, Vorlage botanischer Schriften, dann des wertvollen 
Vermächtnisses des verstorbenen verdienstvollen MitgUedes 
der botanischen Sektion, des Herrn Rechtsrats Schwemmer, 
bestehend in dem von ihm gesammelten Herbar und seiner 
an wertvollen Werken reichen botanischen Fachbibliothek; 

> V. Schultheifs zeigt Gasteria acinacifoUa, dann Blüten von 

Cereus peruvianus und Curculigo; 
» Schwarz, Vortrag »Botanische Streifzüge durch das Spalter 
Land« ; 

* Paalzow, Vorlage von Gryphäen aus seiner Sammlung; 

> Hör mann, Schenkung einer Anzahl chinesischer Schuhe für 

die ethnographische Sammlung durch das hiesige Gewerbe- 
museum. 

32. Sitzung am 23. August: 

Herr Dr. Heerwagen, Vorlage einer im jonischen Meer aufgefischten 
alten, von Vertretern der Meeresfauna dicht überwachsenen 
Amphora, Schenkung eines Gönners und Mitgliedes der 
Gesellschaft ; 

> Paalzow, Referat über verschiedene zoologische Abhand- 

lungen und Bericht über einen Ausflug an den Hetzlaser 
Berg unter Vorlage zahlreicher Fossilien aus dem Dogger; 
» Kinkel in, Demonstration zweier lebender Eidechsen, Agama 
palUda, aus Ägypten und eines jungen Iltis (Putorius 
foetidus) von Schnaittach; 

* Dr. Heerwagen, Referat über die zoologischen Ergebnisse 

der Drygalski'schen Expedition nach Grönland; 
» Schwarz, über Elymus arenarius, bei Bernlohe zur Be- 
festigung des Flugsandes angepflanzt. 

33. Sitzung am 30. August: 

Herr Schwarz, Demonstration einer Verbändenmg bei Euphorbia 
cyparissias, eingeschickt von Herrn Zach in Rupprecht- 
stegen ; 
» V. Schultheifs legt vor Chlorophyllum Sternbergianum im 
blühenden Zustand. oigtizedbyLiOOgk 



16 

34. Sitzung am 6. September: 

Herr Dr. Heerwagen, Vorlage einiger für die Sammlung erworbener 
Tiere; 

> Rudel, Referat über zwei Werke über Istrien und Dalmatien; 
» Schwarz, Ober die Verbreitung von Centaurea paniculata 

und verwandter Arten; 
» Paalzow, Vorlage einiger von Herrn Seel im Süfs wasserkalk 

bei Öttingen gefundener Petrefakten; 
» V. Schultheifs legt vor Aloe nigricans; 

> Wunder jr., über die Entstehung von Aragonit und Kalkspath; 
» Schwarz, über den geologischen Horizont der östlichen Zu- 
flüsse der Rednitz tmter Vorlage bildlicher Darstellungen. 

35. Sitzung am 13. September: 

Herr Wunder sen., Vortrag über die Ausgrabungen bei Hammer 
und bei Weifsenbrunn ; 

» Dr. Heerwagen, Vorlage einiger Photographien prähistori- 
scher Skulpturen aus Ungarn, eingeschickt von Herrn 
Hutzelmaier; 

» Rodler, Vorlage eines Zapfens einer Araucaria, geschenkt 
von Herrn Friedrich Barbeck; 

» Schwarz, Demonstration eines mit ausländischen Flechten 
bewachsenen Rindenstückes von Quercus suber, von 
Ockererde aus Auerbach, Einschlüssen von Früchten in 
Damarharz aus Bomeo und Java und einer Doppelfrucht 
von Prunus Padus; 

» V. Schultheifs, Vorlage von Cunninghamia sinensis; 

» Schwarz, Demonstration von Gallinula porzana, Geschenk 
des Herrn Werkmeisters Georg Mayer in Schnigling und 
verschiedener Pflanzen aus den Dolomiten, gesammelt von 
Herrn Lehrer Seel; 

» Wunder jun. , Schenkung neuer Funde von Plateosaurus 
Engelhardti. 

36. Sitzung am 20. September: 

Herr Dr. Heerwagen, Demonstration eines seltenen Bernsteinein- 
schlusses ; 

» V. Schultheifs, Vorzeigung von Aloe arborescens, Euphorbia 
globosa und Gasteria acinacifoiia; 

» Wunder jun., Referat über die Haut^-c^gr^^W^irbeltiere mit 
Skioptikon-Demonstrationen ; ^ 



17 _ 

Herr Schwarz, Vorlage von Ammonites costatos aus der Gegend 
von Neuhof. 

37. Sitzung am 27. September: 

Herr August Schmidt, Referat über die Wasserkatastrophe in Mar- 
quartstein unter Vorlage von Karten und Abbildungen; 

> Wunder jun., Bericht über neue Grabungen bei Labersricht 

und Demonstration der Funde ; 

> V. Schultheifs zeigt vor Aloe vulgaris; 

» Dr. Heerwagen, Vorlage einer Schenkung des Herrn 
Dr. Koch sen. für die Bibhothek und einer Reihe amerika- 
nischer Tauschschriften. 

38. Sitzung am 4. Oktober: 

Herr Dr. Heerwagen, Demonstration eines Einsiedlerkrebses, ge- 
schenkt von Herrn Magistratsrat Rehlen; 
» V. Schultheifs zeigt vor eine blühende Opuntia polyantha; 

* Dr. Glück, Mitteilungen über Lycopodiaceen ; 

* Schwarz, über das Vorkommen von Lycopodiaceen auf dem 

Haidenberg bei Schwabach und Demonstration der Früchte 
von Liriodendron tuüpifera. 
39 Sitzung am 11. Oktober: 
Herr Schwarz, Bericht über einen Gesellschaftsausflug nach dem 
Haidenberg und dabei gemachte botanische Funde, dann 
über die Tintenfleckenkrankheit an Ahornblättem ; 

> V. Schultheifs legt vor Stapeha variegata und einen Rosetten- 

kürbis. 

40. Sitzung am 18. Oktober: 

Herr Kinkelin, Demonstration imd Schenkung eines schwarzen 
Leguans (Ctenosaura acanthinura) aus Mexico; 

» V. Schultheifs, Vorlage von Mamillaria polythele; 

» Schwarz, Vorlage einiger Pflanzen aus der Tölke'schen 
Kunstgärtnerei; 

» Kinkel in übergiebt Brauneisenstein-Geoden , Geschenk des 
Herrn Lehrer Hertlein in Leimburg. 

41. Sitzung am 25. Oktober: 

Herr Dr. Heerwagen, Übergabe eines Mikroskops, geschenkt durch 
Herrn Hofbuchhändler Konsul Schräg, sowie einiger Ge- 
steine und MineraUen aus den Alpen, Geschenk dos Herrn 
General Göringer; 
» Hoermann, Vortrag: >Neue ethnologische Forschungen über 

das Totem«; Digitlzedby CnOOQ Ic 

2 



18 

Herr V. Schullheifs schenkt Echeveria globosa zur Versteigerung; 
» Dr. Küspert, über die Entstehung von Pilzringen; 

> Kinkelin, Schenkung einer jungen austrahschen Wildkatze aus 

Queensland und Demonstration der Eierpflanze, Solanum 
ovigerum ; 
» Schwarz, Vorlage abnormer Enteneier und eines Darmsteins, 
gebildet aus den Trichomen von der Samenhaut des Hafers; 

> Seel, Demonstration zweier pflanzUcher Abnormitäten; 

4:2. Sitzung am 1. November: 
Herr Hermann Schlegel, Bericht über Bohrversuche auf Steinsalz 
bei Burgbernheim; 
» Dr. Stadlinger, über Entstehung der Salzlagerstätten; 
» Seel zeigt versteinertes Holz vom Hundsbühl bei Heroldsberg; 

> Kinkelin, Demonstration und Schenkung von Agama inermis 

aus Nordägypten und Eumeces quinquelineatus aus den 
Vereinigten Staaten; 

> Dr. Heerwagen, Vorlage von fruchttragenden Zweigen des 

Erdbeerbaums Arbutus proliferus; 
» V. Schultheifs, Demonstration eines Cereus Macdonaldi. 

43. Sitzung am 8. November: 

Herr Dr. Neuburger, Vortrag >über den Gesichtssinn niederer Tiere«; 
» Dr. Heerwagen, Vorlage von Rubin imd Saphir in Basalt 

vom Siebengebirg, Geschenk des Herrn Magistratsrat Kehlen ; 
» Paalzow demonstriert Phylloceras heterophyllum aus dem 

Lias e von Berg bei Neumarkt i. 0., selbstgefertigte kolorierte 

Abbildungen von Pilzen und ein Exemplar von Agaricus 

phalloides; 

> V. Schultheifs demonstriert Aloe abessynica. 

44. Sitzung am 15. November: 

Herr Dr. Stadlinger, Vortrag über > Diamantfelder in Südafrika«; 
» Dr. Heerwagen, Übergabe einiger Geschenke. 
* Hub er, Schenkungeines ^Helminthochorton«, einer Sammlung 
getrockneter Algen; 

> Greiner, Vorlage von Steinsalz von der Aumühle bei Burg- 

bernheim ; 
» Dr. Küspert, Referat »über die Entwicklung der Schleimpilze« 
unter Vorlage mikroskpischer Präparate; 

> Hub er, über Verwendung der sog. springenden Bohnen zu 

Reklamezwecken; oigitized by GoOglc 



19 

Herr Kinkel in, Demonstration und Schenkung von Calotes versi- 
color und Lacerta viridis; 

> V. Schultheifs zeigt Agave americana und rigida; 

> August Schmidt, über die Zusammensetzung des mensch- 

lichen Körpers. 

45. Sitzung am 22. November: 

Herr Erhard, Vortrag »Geschichte der Handelswege nach Indien«; 

» Dr. Heerwagen, Vorlage einer Reihe von Schädeln, Geschenk 

des Herrn Dr. Will in Erlangen imd einer reichhaltigen 

Sammlung exotischer Vögel und Eier, Geschenk des Herrn 

Ernst Benda, Kaufmann in Adelaide; 

> V. Schultheifs legt vor Solanum pseudocapsicum, eine 

spätblühende Stapelia picta und eine blühende Crassula 
gracilis ; 

> Kinkel in, Vorlage einer Rautenschlange (Moreha argus) aus 

Queensland, gesammelt von Herrn Zeeh; ' 
» Dr. Stadlinger, Demonstration von porphyrischem Granit aus 
der Umgegend von Markt Redwitz. 

46. Sitzung am 29. November: 

Herr Dr. Koeppel, Vortrag: >Die Mikrofauna tmserer stehenden 
Gewässer«; 
» Kinkelin, Demonstration von Gymnodactylus geccoides; 

> V. Schultheifs zeigt Opuntia lanigera und übergibt zur Ver- 

steigerung Echeveria globosa; 

> Dr. Heer wagen, Vorlage eines Stückes Cedernholz, an dem 

sich Lehm mit Wespenlarven befindet, aus Tennessee. 

47. Sitzung am 6. Dezember: 

Herr Dr. Küspert, Vortrag »die Metallverbindungen des Acetylens« 
mit Experimenten; 

> Hans Schlegel, Vortrag Ȇber den dermahgen Stand der 

Acetylenfrage« unter Vorlage von Zeichnungen und einer 
reichen Brennerkollektion von der Firma J.Stadelmann&Co.; 

> Wirsching, Bericht über Grabungen in Tropfsteinhöhlen bei 

Velburg unter Vorlage der Funde; 

> Kinkelin, Demonstration eines lebenden jungen Tupinambis 

tegulxin aus Brasilien; 
» Schultheifs schenkt Aloe nigricans zur Versteigerung. 

48. Sitzung am 13. Dezember: 

Herr Erhard, Vortrag über »Indische Droguen imd Gewürze«; j 
» Dr. Heerwagen, Vorlage des literarischen Einlaufs; o 

2* 



20 

Herr Schwarz, Vorlage eines Ammoniten aus dem weifsen Jura, 
Geschenk des Herrn Avril; 

> Schwarz, Demonstration eines Nierensteins vom Rind, Ge- 

schenk des Herrn Lehrer Riedner. 

49. Sitzung am 20. Dezember: 

Herr Schwarz, Schenkung eines Werkes für die Bibliothek; 
» Dr. Heerwagen, Referat über die Vogelfauna des böhmischen 
Mittelgebirges; 

> Schwarz, über Nützlichkeit und Schädlichkeit der Schleier- 

eule; 
» Kinkelin, Schenkung von Uromastix hardwickei; 

50. Sitzung am 27. Dezember: 

Herr Dr. Glück, Vortrag »Unsere Süfswasseralgenflora« mitSkioptikon- 
demonstrationen. 



Ausfläge. 

Die 1. Excursion des heurigen Jahres, ein Tagesausflug, fand 
Sonntag den 4. Juni statt Sie hatte den Jura als Ziel und 
zwar das Sittenbachthal, weil dasselbe bekanntlich sehr regelmäfsig 
die Schichtenfolge der jurassischen Lagen zeigt, während schon im 
benachbarten nahezu parallelem Eschenbach-Rupprechtstegener Teil 
des Pegnitzthales vielfache Abweichungen vom Bilde der regelmäfsigen 
und ungestörten Ablagerung, als da sind wellenförmige Erhebungen, 
namentlich bei Artelshofen und Verwerfungen bei Rupprechtstegen 
zu Tage treten. 22 Teilnehmer, darunter auch unser korrespon- 
dierendes Mitglied Herr üniversitätsprofessor Dr. Fleischmann von 
Erlangen, verliefsen die Bahn in der Station Schnaittach, um anfangs 
über diluviale Sandüberdeckung gegen Speickern zu marschieren. 
Während selbstredend auf dem Sande die Föhre ihr Recht be- 
hauptete, ergab sich an einem gegen das Thal des Schnaittachbaches 
abfallendem baumlosen Hang eine wenn auch beschränkte Stelle 
unüberdeckten Zanclodonlettens ; das sofortige zahlreiche Auftreten 
von Lathyrus montanus an dieser Stelle war daher von Interesse, 
weil es so prompt die Abhängigkeit des Florenbildes von der 
geognostischen Unterlage bezeugte. Als man gegenüber Speickern 
die Lokalbahn überschreitend den Wald verliefs, erfreute in im- 
posanter Nähe mit duftigem Blaugrün der Wälder der zackige Steil- 
rand des Jurazuges vom alten Rotenberg über die Festungsruine 



21 

Rotenberg zum Felseneck des Glatzensteines und zum Hansgörgei- 
berg, und diesem vorgelagert der DoggerhQgel, »die Röd«, unser 
nächstes Ziel. Die' Böschungen hinter Speichern , rhaetischer Keuper, 
zeigten noch eine ächte Sandpflanze: Teesdalia nudicauiis, dann 
ergab am Wege ein kleiner Aufschlufs rostfarbigen harten Gesteins 
den Horizont des Bucklandisandsteines, Lias a, während gleich 
darauf der graue schwere Lfehmboden bezeugte, dafs die mittlere 
Hauptlage des Lias Qherschritten wurde. AUroählig wird die Steigung 
eine steilere, weshalb es gar nicht unwillkommen war, dafs eine 
waldlose Stelle zu kurzer Rast einlud durch einen herrlichen Rück- 
blick auf den Moritzberg und die Laufer Gegend, aus dessen tiefem 
Grün der Nadelwälder die zwei Kirchthurmdächer von Neunkirchen 
hervorlugen, während nach rechts der Blick über die vorgeschobenen 
Simonshofen-Tauchersreuter Liasrücken hinüberschweift zum Grafen- 
berger Jura. Hier war es nun, wo der Boden rostbraun sich förbt, 
Heidekraut, Besenginster und Föhre stellen sich als sichere Deuter des 
Eisensandsteins des mittleren Doggers ein, und dieser Pflanzenge- 
nossenschaft gesellte der Scharfblick einer Teilnehmerin, des Fräulein 
Emma Rudel, noch ein seltenes, aber diesen Horizont bevorzugendes 
zierliches Pflänzchen hinzu: das Dreifaltigkeitsblümchen, Trientalis 
enropaea. Als der Höhenzug der Röd, von der rostroten Farbe 
des Personatensandsteines sehr richtig so benannt, erreicht war, 
wurde Auge und Geruchsorgan der Wanderer durch Mengen blühender 
Maiglöckchen erfreut, dann zieht sich der Weg ober Leutzenberg 
mit prächtigem Fernblick nach Süden in die parallel abgelagerten 
Schichten des Werkkalkes hinauf. Eine mit Haselnufsstauden 
bestockte Kuppe, ein sogenannter Knock, auf dem sonnigen Jura- 
plateau, geschmückt mit der stattlichen Anemone silvestris, lud zu 
kurzer Rast ein, und diese Gelegenheit liefs sich Herr Leidig nicht 
entgehen, die ganze Reisegesellschaft photographisch aufzunehmen. 
Beim Abstieg zu dem bereits wieder im Dogger gelegenen Dorf 
Oberkrummbach waren noch einige bessere Repräsentanten der 
Joraflora, namentlich der Frauenschuh, Cypripedium Calceolus, 
konstatiert worden, dann erfreute das aus dem Ornatenton herab- 
stürzende Bächlein frischesten Quellwassers gar sehr und diese 
Erfrischung war nicht überflüssig, mufste ja doch trotz bereits 
etwas heifs gewordener Tageszeit hinter Oberkrummbach nochmal 
das Juraplateau erstiegen und überquert werden. Auf diesem Wege 
fand zuerst Herr Kinkel in die stattlichste unserer heimischen 
Orchideen, Orchis purpurea = fusca Jacquin, welche sich daniie 
später noch einmal einstellte; auf dem Plateau fanden sich gute 



Handstücke corallenähnlicher fossiler Scyphien und kurze Zeit 
darauf wurde die Aussieht frei gegen den Hohenstein zum Spiegel- 
berg und in die Hersbrucker Berge, davor das tiefeingeschnittene 
Thal des Sittenbachs voll frischgruner Wiesen, darin das warme 
Rot der Ziegeldächer der Ortschaften Dietershofen und Kirchen- 
sittenbach, ein freundlich < friedlich -sonniges Landschaftsbild. In 
Kirchensittenbach ward Mittag gemacht, dann das alte Tetzelsche 
Schlofs und sowohl die riesigen Linden am Keller, als am Schlofe- 
berg das Birkenumpflanzte Volckamer-Denkmal aufgesucht, von 
welchem aus ein entzückender Fernblick das Sittenbachthal hinauf 
zur Burg Hohenstein selbst den hartgesottensten Stubengelehrten 
•das Herz aufthaut zur Freude an den Landschaftsbildern unseres 
lieblichen Jurazuges. Der Rückweg zog sich dann in Richtung 
Kersbach an dem hochberühmten Gräberfeld der Beckerslohe vorbei 
und da es noch bald am Tage war, wurde beschlossen auch dem 
Glatzenstein noch einen Besuch abzustatten. Kurze Rast auf den 
zerklüfteten Dolomitfelsen liefs auch hier die Aussicht geniefsen 
zum Rotenberg und in die Lauf- und Gräfenberger Gegend, dann 
wurde der Rückmarsch über Weissenbach angetreten, in Speickern 
Rast und Abendtisch gemacht und dann bei anbrechender Dunkel- 
heit unter fröhlichem Gesang zum Ausgangspunkt, den Schnaittacher 
Bahnhof, zurückmarschiert. 

Sonntag den 18. Juni fand Nachmittags der 2. Ausflug 
statt. Er war ganz anderer Gegend gewidmet, nämlich der Burg- 
sandsteinklamm bei Gsteinach. Zunächst ward aber vom Feuchter 
Bahnhof der Waldweg längs des zur Kanalspeisung dienenden 
Gauchsbaches benützt, um an das ehemals Schlüsselfelderische 
Schlofs Gugelhammer zu gelangen. Nachdem man in den tiefen 
Gauchsbachgraben hinabgestiegen war und die hübsche Partie des 
Schlosses und die Stelle besucht hatte, wo einst die Sankt Wolfgang- 
Kapelle stund, nach welcher heute noch die nahe Ortschaft Röten- 
bach bei Sankt Wolfgang ihren Namen führt, gelangte man ins 
Thal der Schwarzach bei der Rotwiesenmühle. Zwischen da und 
der Kanalbrücke wurde Geranium sanguineum als auffallender Fund 
und neues Standortergebnis konstatiert, dann ging der Marsch 
unter der hohen Brücke hindurch, auf der der Kanal die Schwarzach 
überschreitet und auf dem dortigen schattigen Keller ward Rast 
gehalten. Der weitere Marsch setzte sich mit Benützung der Kanal- 
brücke auf das südliche Schwarzachufer fort, und bald erfreuten 
sich die sehr zahlreichen Ausflugsteilnehmer aS Hen mit Lebermoos 



23 

und Milzblatt bedeckten saftiggrun^ nassen Sandsteinwftnden. Zwei 
floristische Funde sind hier auch zu erwähnen : Orchis militaris und 
Convallaria verticillata; auch die 2 Felsenaltanen mit ihrem herr- 
lichen Blick ins schmale Thal des Schwarzachdurchbruches wurden 
besucht und dann auf etwas kritischer Holzbrücke der Übergang 
zur tief in der Schlucht gelegenen Ortschaft Gsteinach bewerkstelligt. 
Hier war inzwischen Herr Pfarrer Rudel eingetroffen, wodurch die 
Teilnehmerzahl auf 27 stieg. Der kurze Rückweg zog sich nach 
Feucht behufs Benützung eines praktischen Vorortszuges. 

Gewissermafsen als Abschied für das nach Nördlingen ver- 
setzte und beförderte treue Mitglied Herrn Schul theifs und dessen 
Fräulein Schwester fand am 16. Juli der 3. Ausflug bei sehr 
warmer Witterung nach Rosstall statt. Im Steinbruch daselbst 
konnte den 23. Teilnehmern das inf Keuper einzige Vorkommen 
von Lathyrus hirsutus als konstant vorgestellt werden, in Rosstall 
selbst wurde die Stelle des unglückseligen Felsabsturzes nahe dem 
Schlofs gezeigt, dann die hochhistorischen Lagerplätze aus dem 
Hunnenkrieg: der Matzen- und der Ungarn-Berg. Nach stattgehabter 
Rast besichtigte man die uralte Kirche, stieg zur Krypta hinunter 
und zum Turm hinauf und besuchte dann die hübsche Waldlokalität 
an den sieben Quellen. Am Weg dahin kamen 2 pflanzenbiologische 
Vorkommnisse zur Demonstration: Aristolochia Clematitis, eben 
schön in Blüte, gab Veranlassung zum Thema über Besuche der 
Insekten auf den Pflanzen behufs deren Blütenstaubübertragnng; 
die hackigen Früchte der Medicago minima zeigten ebenfalls Be- 
ziehungen zwischen Tier und Pflanze, hier speziell die Vorrichtungen 
der Pflanzen zur Verbreitung durch Tiertransport mittels hackiger 
Früchte. Der Heimweg ward wieder mit der Bahn vom Bahnhof 
Rosstall aus angetreten. 

Sonntag Nachmittag des 8. Oktober fand der letzte 
Gesamtausflug des heurigen Jahres statt, das Ziel desselben war 
der isolierte Höhenzug des Haidenberges südlich Schwabach. War 
schon die Zahl der Teilnehmer bei der Abfahrt von Nürnberg keine 
kleine, unter welcher wir auch unser korrespondierendes Mitglied 
Herrn Privatdozent Dr. Glück von Heidelberg begrüfsen konnten, 
so vermehrte sich dieselbe sogar noch auf der Bahnfahrt, denn in 
Reichelsdorf stiefs Herr Wunder mit Sohn zu uns und in 
Schwabach schlössen sich noch 2 eingeladene Gäste an, sodafs in 
Rednilzhembach 26 Teilnahmer den Bahnzug verliefsen. Gleich 
nach dem Aussteigen erfreute der Ausblick in den Eisöldener Jura, 



24: 

welchem dort auf vorgeschobener kegelförmiger Doggerhöhe die 
stattliche Burgruine Stauf eine charakteristische Silouette verleiht 
Bei der Ortschaft Untermainbaeh wurden einige Exemplare von 
Lupinus luteus auf das Vorhandensein und die GröCse der Wurzel- 
knöUchen untersucht. In diesem sandig-trockenem Strich von 
Schwabach über Roth nach Hilpoltstein sieht man ja bekannter 
Masen die hochgelben Lupinenfelder überaus häufig, für den Be- 
schauer ein schöner Anblick, aber kein gutes Zeichen für die 
Ertragsfahigkeit einer solchen Gegend, denn die Wolfsbohne, Lupinus, 
baut man ja nur zur Gründüngung, und in guten Gegenden, wo 
auch viel Dünger der Landwirtschaft zur Verfügung steht, braucht 
man keine Lupinen bauen. Durch einen symbiotischen Vorgang 
mit entsprechenden Pilzen sammelt die Lupine Stickstoff an, und 
sind es gerade die Wurzelknö^chen, wo dieser symbiotische Prozefs 
hauptsächlich sich abspielt. Der Vergleich der Wurzelknöllchen 
vom blaublühendem Lupinus angustifolius mit dem ebenerwähnten 
luteus, der gleich hinter Walpersdorf vorgenommen wurde, fiel nicht 
zu Gunsten des L. luteus aus. L. angustifolius zeigte hier viel 
zahlreichere und viel gröfsere Wurzelknöllchen. Nachdem bei 
Tennenlohe die Strafse gekreuzt war, fanden sich im Kiefern walde 
gegen üngenthal zu eine grofee Anzahl von Grofspilzen: Steinpilz, 
Kuhpilz, Habichtspilze und andere und so wurde unter anregender 
Besprechung gar bald der versteckt gelegene Weiler Üngenthal, der 
wohl richtiger nach den benachbarten Weihern und Versumpfungen 
ünkenthal geschrieben werden sollte, erreicht. An einem dieser 
Weiher konstatierte Herr Dr. Glück die Heleocharis acicularis, von 
den anderen floristischen Schönheiten der im grünmoosigen Fichten- 
wald sich hinaufziehenden Schlucht konnte freilich, der vorge- 
schrittenen Jahreszeit halber, nichts mehr demonstriert werden. 
Auf der Höhe stund in Menge Potentilla procumbens und dieses 
erst vor wenigen Jahren konstatierte und, wie sich auch diesmal 
wieder ergab, konstante Vorkommen schliefst die Annahme einer 
Einschleppung mit Torfstreu aus Norddeutschland ganz bestimmt 
aus. Der nun nach Osten umbiegende Marsch gab gute Aussicht 
südwärts gegen Abenberg, wie nordwärts nach Schwabach, das 
Zusammenklingen der Namen Haidenberg mit dem der Ortschaft 
Götzenreut am Südfufs und dem des hinteren Bergflügels, der Ofen- 
platte, besser Opferplatte benannt ist, im Zusammenhalt mit der 
isolierten Lage des wald bedeckten Höhenzuges wurde in anthro- 
lologischer-geschichtlicher Beziehung besprochen, dann kam der 
bstieg über buschwaldbedeckten Zanclodonletten nach Kühdorf. 



Beim Verlassen des Waldes zeichnete sich scharf am Abendhimmel 
die malerische Kontour der Burg Abenberg ab, ein acht Albrecht 
Dörer'sches Landschaftsbild. Nach einer Rast in Kühdorf wurde 
der Nachtmarsch angetreten über Obermainbach nach Schwabach, 
meist unter fröhlichem Singsang des jungen Volkes, und die in 
Schwabach im Gasthaus zur Rose ausbrechende fröhliche Stimmung 
bewies, dafs der etwas lange Marsch vielleicht an die Beine der 
Teilnehmer eine Anforderung gestellt hatte, aber dennoch nicht im 
Stande war, dem guten Humor nur einiges anhaben zu können. 

Der Besuch des Haidenberges hat der Anregungen gar viele 
gegeben, denn nur wenige Tage darauf, gerade nach der Kriegs- 
erklärung des tapferen Burenvolkes gegen das übermächtige England, 
wanderte wieder eine wenn auch kleinere Zahl zum fichtenbedeckten 
Waldberg, um Material zu sammeln, über die daselbst forstmäfsig 
angepflanzten fremdländischen Coniferen, während anthropologisch- 
ethnographische Beziehungen, die Frage über Bildschmuck der 
alten Schellenbögen und die Sagen vom mitternächtigen Reiter ohne 
Kopf andere Teilnehmer des Herbstausfluges noch bis in den Winter 
hinein in die abgelegene Ortschaft Kühdorf führten, einst der Sitz 
eines danach benannten Geschlechtes »Kühdorfiorum«, von deren 
Stammschlofs freilich jetzt kaum mehr die Stätte zu eruiren ist. 

A. S. 



Digitized by VjOOQ IC 



26 



BibUotheksbericht für 1899. 

Der Bestand der Bibliothek wurde durch Schenkungen und 
durch die Anschaffungen der Sektionen um 260 Nummern 
mit insgesammt 329 Bänden vermehrt. Ende 1899 waren 3907 
Nummern vorhanden. Von gröfseren Geschenken sind besonders 
erwähnenswert die reichen Zuwendungen aus dem Nachlafs der 
Herren Hofrat Dr. Diez, Bezirkstierarzt Konr. Schwarz und 
Rechtsrat Schwemm er. 

Unser korrespondirendes MitgUed Herr Dr. Hugo Glück ehrte 
die Gesellschaft durch Dedicienmg seiner Habilitationsschrift »Ent- 
wurf zu einer vergleichenden Morphologie der Flechten« ; die gleiche 
Ehrung der Überweisung ihrer Publikationen erwiesen der Gesellschaft 
die Herren Dr. Otto Appel, Prof. Dr. Rud. Blasius, Prof. Hans 
Crammer, Dr. Adolf Dieudonnö, Prof. Dr. A. Fleischmann, 
Dr. Gordon, Th. v. Heldreich, Charles Janet, Prof. Arturo 
Issel, Prof. C. B. Klunzinger, Prof. Dr. Paul Magnus, Dr. F. W. 
Neger, Dr. Herm. Poeverlein, Dr. P. Reinecke, Stabsveterinär 
Aug. Schwarz, Prof. C. Warns^orf. Der Stadtmagistrat Nürnberg, 
der bayer. Volkssehullehrervein und der Bezirksverein deutscher 
Ingenieure überreichten ihre Festschriften. 

Im Schriftenaustausch liefen 687 Sendungen ein. Nach^ 
lieferungen fehlender Abhandlungen wurden mehrfach von uns 
erbeten und, so weit möghch, gerne gegeben. Die gleiche Bitte 
richteten wir an verschiedene Gesellschaften, die derselben in 
dankenswerter Weise entsprachen. Im Laufe des Jahres wurde 
abermals eine gröfsere Zahl von Gesellschaften eingeladen, mit uns 
in Schriftenaustausch zu treten; die Gesamtzahl dieser seit dem 
Vorjahr von uns ergangenen Einladungen ist 102. Antworten sind 
bisher von 40 Gesellschaften eingetroffen, von denen 23 zustimmend 
lauteten und Gegensendungen ankündigten. Besonders reiche Sendungen 
erhielten wir von der Geological Society in London, dem American 
Museum of Natural History in New York, dem Bosnisch-Hereego- 
winischen Landesmuseum in Sarajewo und der Feuille des jeunes 
Naturalistes in Paris. Aufserdem wurde die Naturhistorische Ge- 
sellschaft von weiteren 8 Gesellschaften und Vereinen zum Tausch- 
verkehr aufgefordert. Wir sind nunmehr mit 255 Gesellschaften im 
Schriftenaustausch. Der rege Verkehr machte sich auch in der 
gesteigerten Geschäftskorrespondenz der Bibliothek bemerkbar. 



27 

Die im Interesse des Tauschverkehrs dauernd an die MitgHeder 
unserer Gesellschaft gerichtete Bitte um Überlassung älterer Jahr- 
gänge der »Abhandlungen« ist nicht ohne Erfolg geblieben; bei 
der fortdauernden Nachfrage wären weitere solche Schenkungen 
sehr willkommen. 

Ausgeliehen wurden 149 Werke an 101 Entleiher. 



VeneichniB der Körperschaften, mit denen wir im Schriftenaustausch 
stehen und der Einsendungen, die uns 1899 zugegangen sind: 

Europa. 
Deutsches Reich. 

Altenburg — Naturforschende Gesellschaft des Osterlandes: Mit- 
theilungen. N. F. 8. Band (1898). 
Annaberg — Annaberg-Buchholzer Verein für Naturkunde : X. Bericht. 

29. bis 30. Geschäftsj. (1894-98.) 
Ansbach — Historischer Verein für Mittelfranken : Sechsundvierzigster 

Jahresber. 
Augsburg — Naturwissenschaftlicher Verein für Schwaben und Neu- 
burg: 33. Bericht. 1898. 
Bamberg — Gewerbeverein: Jahresber. f. d. Jahr 1898. 

» — Naturforschende Gesellschaft. 
Bautzen — Naturwissenschaftliche Gesellschaft »Isis«. 
Berlin — Botanischer Verein der Provinz Brandenburg: Verhand- 
lungen. 40. Jahrg. 1898. 
» — Deutsche geologische Gesellschaft: Zeitschrift, 49. Band, 

1. 2. Heft; 60. Band, 3. 4. Heft; 51. Band, 1. 2. Heft. 
> — Entomologischer Verein: Berliner entomolog. Zeitschrift, 
43. Band, 3. u. 4. Heft; 44. Band, 1. bis 4. Heft. 
Gesellschaft naturforschender Freunde : Sitzungs-Berichte, 

{ahrg. 1898. 
Cgi. preufsisches meteorologisches Institut: Bericht 1898; 
Ergebnisse d. Beobachtungen a. d. Stationen II. u. III. Ord. 
1894, Heft III; 1898, Heft I, II. Hellmann, Regenkarte d. 
Prov. Schlesien. 
Bonn — Niederrheinische Gesellschaft für Natur- und Heilkunde: 
Sitzungsber. 1898; 1899 I.Hälfte; Verhandlungen 56. Jhrg., 
1. Hälfte. 
» — Naturhistorischer Verein der preufsischen Rheinlande, West- 
phalens und des Regierungsbezirks Osnabrück: Verhand- 
lungen 55. Jahrg. 
Braunschweig — Herzogliches naturhistorisches Museum. 

> — Verein für Naturwissenschaft: 11. Jahresber. f. d. 

Ver.- Jahre 1897/98 u. 1898/99. 
Bremen — Naturwissenschaftlicher Verein: Abhandlungen, XVI. Bd., 

1. 2. Heft. 
Brcs lau — Schlesische Gesellschaft für vateriändische Kultur : 75. Jahres- 
bericht 1897. Ergänzungsheft, Litteratur d. Landes- ie 
Volkskunde d. Pr. Schlesien, Heft 6. ^ 



-E 



28 

Chemnitz — Naturwissenschaftliche Gesellschaft 

Dan zig — Naturforschende Gesellschaft: Schriften. N. F. Neunten 

Bandes 3. u. 4. Heft. 
Darmstadt — Verein für Erdkunde und der grofsherzogl. geologischen 

Landesanstalt: Notizbl. IV. Folge 19. Heft 1898. 
Dessau — Naturhistorischer Verein für Anhalt. 
Dresden — Statistisches Bureau des kgl. Sachs. Ministeriums des 
Innern: Zeitschrift 45. Jahrg. Heft 14; Beilage, 1899. 
> — Naturwissenschaftliche Gesellschaft Isis: Sitzungsber. 

und Abhandlungen, Jahrg. 1898 Januar bis Dezember. 
Dürkheim — Pollichia: Mitteilungen LVI. Jahrg. 1898 Nr. 12. 
Düsseldorf — Naturwissenschaftlicher Verein. 
E 1 b e r f e 1 d — Naturwissenschaftlicher Verein : Jahresberichte . Neuntes 

Heft. 
Emden — Naturforschende Gesellschaft: Kleine Schriften. XIX. 
Erfurt — Kgl. Akademie gemeinnütziger Wissenschaften : Jahrbücher, 

N. F., Heft XXV. 
Erlangen — Physikalisch-medicinische Societät: Sitzungsberichte, 

30. Heft, 1898. 
Frankfurt a. M. — Physikalischer Verein: Jahresber. f. d. Rechnungs- 
jahr 1897—1898; Dr. W. König, Goethes optische 
Studien. 
» — Senckenbergische Naturforschende Gesellschaft: 

Abhandlungen, 21. Band 3. u. 4. Heft mit Titel; 
Bericht. 1898. 
Frankfurt a. O. — Naturwissenschaftlicher Verein des Reg.-Bez. 
Frankfurt: Helios, 16. Band; Soc. Litt., Jahr- 
gang XII, Nr. 5—12. 
Fulda — Verein für Naturkunde. 
Giefsen — Oberhessische Gesellschaft für Natur- und Heilkunde: 

Zweiunddreifsißster Bericht. 1897—1898—1899. 
Görlitz — Naturforschende Gesellschaft. 

Göttingen — Kgl. Gesellschaft der Wissenschaften und Georg Augusts- 
Universität: Nachrichten, Mathem.-physik. Kl. 1898 
Heft '4; 1899 Heft 1, 2; Geschäftl. Mitteilungen, 1898 
Heft 2; 1899 Heft 1. 
Greiz — Verein der Naturfreunde. 

Guben — Niederlausitzer Gesellschaft für Anthropologie und Alter- 
tumskunde: Mitteilungen, V. Band, 8. (Schluß-) Heft, Sach- 
Register. Bd. VI, 1. Heft. 
Güstrow — Verein der Freunde der Naturgeschichte in Mecklen- 
burg: Archiv 52. Jahr (1898) II. Abteilung; 53. Jahr (1899) 
I. Abtlg. 
Halle a. S. — Landwirtschaftliches Institut an der Universität: Be- 
richte a. d. physiol. Labaratorium, 13. Heft (1898). 
» — Kaiserlich Leopoldino-Carolinische Deutsche Akademie 

der Naturforscher: Leopoldina, Heft XXXV. 
» — Verein far Erdkynde: Mitteilungen 1899. 

Hamburg und Hamburg -Altona — Naturwissenschaftlich, Verein: 
Verhandlungen 1898, III. Folge VI. 
» — Verein für naturwissenschaftliche Unterhaltung: Ver- 

handlungen 1883 - 1885, VI. Bd. 
Hanau — Wetterauische Gesellschaft für die gesamte Naturkunde: 

Bericht. 1895-1899 DigitizedbyGoOQlc 

Hannover — Naturhistorische Gesellschaft. o 



29 

Heidelberg — Naturhistorisch-medizinischer Verein : Verhandlungen. 

N. F. Sechster Bd. 1. (1898), 2. (1899) Heft. 
Hof — Nordoberfränkischer Verein f. Natur-, Geschichts- und Landes- 
kunde. 
Karlsruhe — Naturwissenschaftlicher Verein. 
Kassel — Verein für Naturkunde. 
Kiel — Naturwissenschaftl. Verein ffilr Schleswig-Holstein: Schriften. 

Band XI, zweites Heft 1898. 
Königsberg i. Pr. — Physikalisch-ökonom- Gesellschaft: Schriften, 
39. Jahrg., 1898. 
> — Preufsischer Botanischer Verein: Flora von 

Ost- u. Westpreufsen. I. Hälfte (Bogen 1—25) ; 
Jahresbericht 1891/92—1897/98. 
Krefeld — Verein für Naturkunde. 
Lan'dshut — Botanischer Verein. 

Leipzig — Fürstl. Jablonowsky'sche Gesellschaft: Jahresbericht 1898. 

» — Kgl. sächsische Gesellschaft der Wissenschaften : Berichte 

über die Verhandl. ; math.-phys. Kl. Titel z. 50. Bd. 1898 : 

51. Bd. Jahrg. 1899. Heft I-V. 

» — Naturforschende Gesellschaft: Sitzungsberichte. 24. u. 

25. Jhrg. 1897/1898. 

» — Verein fiir Erdkunde: Mitteilungen 1898; wissenschaftl. 
Veröffentl.: Dr. Ose. Baumann, d. Insel Pemba. 
Lüneburg — Naturwissenschaftl. Verein d. Fürstentums Lüneburg. 
Magdeburg — Naturwissenschaftlicher Verein. 
Mainz — Rheinische naturforschende Gesellschaft. 

» — Römisch-Germanisches Centralmuseum : Bericht über die 
Vermehrung der Sammlungen des Vereins zur Erforschung 
der rheinischen Geschichte und Altertümer i. J. 1893/94 
bis 1897/98. 
Mannheim — Verein fiir Naturkunde. 

Marburg — Gesellschaft zur Beförderung der gesamten Naturwissen- 
schaften. 
Metz — Verein fiir Erdkunde: XXI. Jahresbericht fQr das Vereins- 
jahr 1898—99. 
Müikchen — Kgl. Bayer. Akademie der Wissenschaften: Sitzungs- 
berichte der mathem.-phys. Kl., 1898 Heft IV, 1899 
Heft I, n. 

— Bayer. Botanische Gesellschaft: Berichte Bd. VI. 1899. 
» — Geographische Gesellschaft : Jahresbericht f. 1896 u. 1897. 
» — Ornithologischer Verein: Jahresbericht f. 1897 u. 1898. 

Müi\ster — WestphälischerProvinzialverein für Wissenschaft u. Kunst: 

26. Jahresbericht fiir 1897/98. 
Neifse — Philomathie: Bericht XXIX, 1896—1898. 

Nürnberg — Ärztlicher Verein: Sitzungs-Protokolle. Sep.-Abdnick 
a. d. Münchn. Med. W. Jahrg. 1898. 
• — Germanisches Nationalmuseum: Anzeiger Jahrg. 1898. 

Mitteilungen Jahrg. 1898 ; Katalog der Glasgemälde aus 
älterer Zeit, IL Aufl. 

— Medicinische Gesellschaft u. Poliklinik: XX. Sitzungs- 
Bericht fiir 1898: Sitzungsberichte 1898. 

» — Verein für Geschichte der Stadt Nürnberg. 

» — Verein för öffentliche Gesundheitspflege. 

^ » — Verein Merkur. C^r\r\n]p> 

Offenbach - Verein fiir Naturkunde. Digitizedby^OOgie 



30 

Osnabrück — Naturwissenschaftlicher Verein: Dreizehnter Jahres- 
bericht. Für das Jahr X898. 

Pas sau — Naturhistorischer Verein. 

Regensburg — Kgl. Botanische Gesellschalt: Denkschriften I. Bd. 
A und B; Sechster Bd; VII. Bd. Neue Folge. 
I. Bd.; Katalog d. Bibliothek, I. u. II. Teil. 
— Naturwissenschaftlicher Verein: Berichte. VI. Heft 
1896-97. 

Reichenbach — Voigtländ. Verein für allgemeine u. spez. Landes- 
kunde. 

Reutlingen — Naturwissenschaftlicher Verein. 

Schneeberg — Wissenschaftlicher Verein: Mitteilungen. 4. Heft. 

Schweinfurt — Naturwissenschaftlicher Verein. 

Stuttgart -^ Verein für vaterländische Naturkunde in Württemberg: 

iahreshefte, 55. Jahrg. 
üringischer Botanischer Verein: Mitteilungen. Neue 
Folge. I. Heft, bis XII. Heft. 
Wernigerode — Naturwissenschaftlicher Verein des Harzes. 
Wiesbaden — Nassauischer Verein für Naturkunde: Jahrbücher, 

Jahrgang 52. 
Würzburg — Physikalisch-medicinische Gesellschaft: Sitzungsbericht. 
Jahrgang 1898. 
> — Polytechnischer Zentralverein für Unterfranken und 
Aschaffenburg : Gemeinnützige Wochenschrift, 49. Jahr- 
gang 1899. 
Zerbst — Naturwissenschaftlicher Verein : Bericht von 1892 bis 1898. 
Zweibrücken — Naturhistorischer Verein. 
Zwickau — Verein für Naturkunde: Jahresbericht, Jahrgang 1898. 

Österreich-Üngrani. 

Agram — Hrvatsko Narovoslovno DruStvo. 
Aufs ig a. E. — Naturwissenschaftlicher Verein. 
Baden bei Wien — Gesellschaft zur Verbreitung naturwissenschaft- 
licher Kenntnisse. 
Brunn — Club für Naturkunde (Sektion d. Brünner Lehrervereines): 
Erster Bericht f d. Jahre 1896—1898. 
» — K. K. mährische Landwirtschaftsgesellschaft: Central Blatt, 

78. Jahrg. 1898. 
» — Naturforschender Verein. 
Budapest — K. M. Termöszettudomänyi Tärsulat (K. U. naturwissen- 
schaftliche Gesellschaft). 
» — Rovartani Lapok (entomolog Monatsschr.) VI. Kötet 1899. 
Graz — K. k. Gartenbau-Gesellschaft in Steiermark: Mitteilungen, 
24. Jahrgang. 1899. 
> — Naturwissenschaftlicher Verein für Steiermark: Mitteilungen, 

Jahrg. 1898. (D. g. R. 35. Heft.) 
» — Verein der Ärzte in Steiermark : Mitteilungen, 35. Jahrg., 1898. 
Hermannstadt — Siebenbürgischer Karpathenverein : Jahrbuch, 
» XIX. Jahrg. 1899 u. >Beilage« 

— Siebenbürgischer Verein f. Naturwissenschaften : 
Verhandlungen und Mitteilungen, XLVDI. Band. 
Jahrg. 1898. 
> — Verein f. siebenbürgische Landeskunde: Archiv, 

N. F. 29. Bd., 1. Heft. ^ j 

Ho Tic — K. k. Fachschule für Bildhauer und SteinmetieiOOgie 



31 

Innsbruck — Ferdinandeum fiir Tirol und Vorarlberg: Zeitschrift, 
3. Folge, 43. Heft. 
» — Naturwissenschaftlich-medizinischer Verein: Berichte. 

XXIV. Jahrg. 1897/98 und 1898/99. 
Klagenfurt — Naturhistorisches Landesmuseum für Kämthen: Jahr- 
buch. 25. Heft; Seeland, Diagramme d. magnet. u. 
meteorol. Beobachtgn. 1898. 
Klausenburg ~ (Kolozsvärt) — Siebenbürgischer Museum verein. 
Laibach — Museal verein för Krain. 
Linz — Museum Francisco-Carolinum : 57. Jahresber. nebst 51. Lief. 

der Beiträge z. Landesk. v. Österreich o. £. 
Prag — K. Böhmische Gesellschaft der Wissenschaften: Sitzungs- 
berichte 1888, I; Jahresber. 1898. 
» — Deutscher naturwissensch.-medicinischer Verein für Böhmen 
»Lotos«. 
Pressburg (Pozsony) — Verein für Heil- und Naturkunde: Verhand- 
lungen, Jahrgang 1897—1898, N. F. X. Heft. 
Reichenberg — Verein der Naturfreimde : Mitteilungen 30. Jahrg. 

zugleich Festschrift z. F. d. ÖOjähr. Best. 
Salzburg — Städtisches Museum Carolino-Augusteum. 
Sarajevo — Bosnisch - Her cegovinisches Landesmuseum: Wissen- 
schaftliche Mittheilungen aus Bosnien u. d. Hercegovina, 
Erster bis Fünfter Band; Walter, Beitrag z. Kenntnis 
der Erzlagerstätten. 
Triest — Societä adriatica di scienze naturali. 
Wien — Entomologischer Verein: 9. Jahresbericht 1898. 

— K. Akademie der Wissenschaften : Sitzungsberichte. Mathemat.- 
naturw. Cl. CVTI. Band. 1.— 5. Heft. 

— K. k. Gartenbaugesellschaft: Wiener illustr. Gartenzeitung 
1899, Heft 1—12. 

— K. k. geographische Gesellschaft : Mitteilungen 1898, XLL Bd. 
(d. n. F. XXXI). 

— K. k. geologische Reichsanstalt: Verhandlungen, Jahrg. 1898, 
No. 14—18; 1899 Nr. 1-10. 

— K. k. zoologisch-botanische Gesellschaft: Verhandlgn., Jahr- 
gang 1898, XLVin. Band. 

— Naturhistorisches Hofmuseum: Annalen, Bd. XIII Nr. 1. 

— Naturwissensehaftl. Verein an der Universität. 

— Verein zur Verbreitung naturwissenschaftlicher Kenntnisse : 
Schriften, XXXDC. Bd., 1898/99. 



Sohweis. 

Basel — Naturforschende Gesellschaft. 
Bern — Naturforschende Gesellschaft. 
[»1 — Schweizerische Naturforschende Gesellschaft: Verhandlungen. 
80. Jahresversammlung 1897; 81. Jahresversammlung 1898. 
Chur — Naturforschende Gesellschaft Graubündens: Jahresbericht N. F. 
XLn.Bd., Vereinsjahr 1898/99; mit Anhang: Campelli Topogr. 
Raetica. Pag. 1—80. 
Frauen feld — Thurgauische naturforschende Gesellschaft : Mitteilungen. 

Dreizehntes Heft. 
St. Gallen — Naturwissenschaftliche Gesellschaft: Bericht 1896—97. 
So lothur n — Naturforschende Gesellschaft: XII. Bericht über di« 
Thätigkcit. Winter 1897/98, 1898/99. JUgi^ 



32 

Zürich — Naturforschende Gesellschalt: Vierteljahrsschrift, 43. Jahrg. 
1898, 4. Heft; 44. lahrg. 1899, 1. u. 2. Heft. 

> — Bibliothek der Schweizerischen Botanischen Gesellschaft: 

Berichte Heft VUI, Heft IX. 

Belgien« 

Anvers — Acad^mie Royale d' Archäologie de Belgique: Bulletin 

5« S^rie des Annales IV— VU. 
Bruxelles — Soci^t^ beige de Microscopie. 

> — Soci^t^ Royale malacologique de Belgique: Annales 

Tome XXXII A. 1897 ; Tome XXXIV A. 1899 ; M^moircs 
S. 1—16, PI. I u. II; Bulletins S. I— XCVI; Proc^- 
Verbaux des S^ances S. LXXIII— C. 
» — Soci^t^ Royale Linn^enne. 

Frankreiolu 

Cherbourg — Soci^t^ Nationale des Sciences naturelles et mathö- 

matique. 
Paris — Bibliothfeque de la Feuille des JeunesNaturalistes: LaFeuille, 
Ile S^rie, lie bis 20e Ann^e Tome 1—10; Ille S^rie, 21© bis 
29« Ann^e No. 241—350; Cataloques. 
> — Soci^t6 d' Anthropologie de Paris : Bulletins, Tome neuvi^me 
(IVe S6ne) 1898 Fase. 6; Tome dixi^me (TVe Serie) 1899. 
Fase. I. 

ChroMbriUnnien. 

Dublin — Royal Irish Academy. 

Glasgow — Natural History Society. 

London — Geological Society: The Quarterly Journal No. 185, 
2. Febr. 1895 Vol. XLVU, Part 1 bis No. 216, 1. Nov. 
1898 Vol. LIV, Part 4 ; No. 200a, 200b General Index to 
the fifty Vol. ; Charter and Bye-Laws of the Geol. Soc. ; 
Catalogue of the Library 1881; A classified Index to 
the Transactions, Proceedings and Quarterly Joum, 
2. Edit.; List of the Geolog. Soc. 1897/1898. Geological 
Literature added to the Geol. Soc. 1894, 1895—97. 

Manchester — Geographica! Society: The Journal. Vol. XTV 
No. 7—12; Vol. XV No. 1-9. 

Holland. 

Amsterdam — Genootschopp Natura Artis magistra. 

» — Koninklijke Akademie van Wetenschappen : Ver- 

handelingen, Afd. Natuurkunde le Sectie Deel VI 
No.6/7; 2e Sectie, Deel VI, No. 2/8. Zittingsverslagen 
Jahr 1899 Deel VI. 
Haarlem — Mus^e Teyler: Archives, S^r. n, Vol.-VI, 3e et 4© partie. 
Leiden — Nederlandsche Dierkundige Vereeniging: Tijdschnft 2^« 
Serie, Deel VI, Afl. 2. 

> — Sammlungen des Geologischen Reichsmuseums: Serie I. 



Beiträge zur Geologie Ostasiens und Australiens. Wr. 24 



Bd. V, Heft 6; Bd. VI Heft I. oigitizedt 



33 

IttUM. 

Brescia — Atcneo: Commentari 1898. 

Catania — Accademia Gioenia di Scienze Naturali: Buliettino, 

N. S. 1898, Fase. LVI bis LVni. 
Firenze — Bibliotheca Nationale Centrale: Bolletino d. Public. Ital. 
Nr. 312—335. Indici 1898. 
» — R. Istituto di Studi Superiori, Pratici e di Perfezionamento. 
» ~ Societli Entomologica Italiana: Bulletino Anno trentesimo 
Trim. I-IV. 
Modena — Societä dei naturalisti: Atti 1898 S. 3 Vol. XVI Anno 

XXXI Fase. m. 
Padova — Soeietä Veneto-Trentina di Scienze Naturali: Buliettino. 
Anno 1899, Tomo VI, Nr. 4; Atti, Anno 1898, Serie II, 
Vol. ni, Fase. U. 
Pavia — Orto botanico, Istituto botanico dell' Universitä di Pavia: 

Atti 1892 IL Serie, Vol. secondo. 
Pisa — Societä Toscana di Scienze Naturali : Atti, Proc. verb. Vol. XI, 

S. 57-167; Vol. XVI. 
Roma — R. Accademia dei Lincei: Atti, S. V. Rendiconti. Vol. VIII«. 

» — Biblioteca nazionale centrale Vittorio Emanuele. 
Torino — Accademia Reale delle Scienze: Atti, Vol.XXXTV, 1898/99, 

1& bis 15 ft , Dr. Rizzo, Osserv. meteorol. 1898. 
Venezia — Reale Istituto- Veneto di Scienze, Lettere ed Arti: 

Memoric Vol. XXV, Nr. 4-7. 
Verona — Accademia d'Agrieoltura, Scienze, Lettere, Arti e Com- 
mercio: Memorie Vol. LXXTV Serie HI Fase. I. u. II. 



Luxemburg — Soci^^ botanique de Grand-duch^ de Luxembourg. 
» — Fauna, Verein Luxemburger Naturfreunde. 



BnmiBien. 

Bacuresci — Museulü de Geologü si de Paleontologia : Anuarulü pe 
Anulu 1896. 



BisiUmd. 

Dorpat — Naturforscher-Geselbchaft bei der Universität: Sitzungs- 
berichte Xn. Band 1898, 1. Heft. 
Helsingfors — Societas pro Fauna et Flora Fennica. 
Kiew — Naturforscher-Gesellschaft der Universität. 
Mi tan — Kurländische Gesellschaft f. Literatur und Kunst: Sitzungs- 
berichte und Jahresber. d. Kurland. Prov. Museums 1898. 
Moskau — Soci^t^ Imperiale des Naturalist es : Bulletin, Annde 1898; 
Nouveaux M^moires Tome XV Livr. 7; Tome XVI 
Livr. 1, 2. 
Riga — Naturforscher Verein. 
St. Petersburg — Hortus petropolitanus. 

» — ImperatorskajaAkademijaNauk: Iswjestija Seria Vi 

Tom Vm, 5; Tom IX. 1 5, Tom X, 1 4. *^8^^ 



34 

Schweden und Vorwegren. 

Bergen — Museum: Aarbog for 1898, 1899 Iste hefte; Sars, Report 
on Norweg. Marine Investigations 1895 — 1897. Sars, 
Crustacea of Norway Vol. II. Part. XIÜ, IVX. 
Christiania — Kgl. Norske Frederiks Universitet. 

» — Editorial Committee of Den Norske Nordhavs-Ex- 

pedition 1876 — 1878, Professor H. Mohn, Det Meteoro- 
logiske Institut. 
Göteborg — Kongl. Vetenskaps och Vitterhets-Samhället. 
Stavanger — Museum: Aarsberetning for 1898, 9<ie Aargang. 
Stockholm — Kongliga Svenska Vetenskaps Akademien: Öfversigt 
af Förhandlingar 1897, 55. Ergangen; Bihang 24. Bandet, 
Afdelning I — IV; Handlingar, 31. Bandet. 
» — Entomologiska Föreningen: Entomologisk Tidskrift, 

arg. 19, Haft. 1-4, 1898. 
Tromsö — Museum: Aarshefter 20, 1897. 

Upsala — Kongliga Universitets Bibliotek: Bulletin Vol. IV. Part 1, 
1898, Nr. 7. 

Afrika. 

Ägypten. 

Le Caire — Institut figyptien: Mdmoires, Tome III Fase. VI -IX; 
Bulletin, 3e Serie, Ann^e 1897 Fase. 6—8, Annde 1898 
Fase. 9 No. 1 u. 2. 

Amerika. 

Argentinien. 

Buenos Aires — Museo Nacional : Comunicaciones Tomo I, No. 3, 4; 

Anales Tomo VI (Ser. 2a, T. III). 
Cordoba — Academia Nacional deCiencias de la Republica Argentina. 
La PI ata — Bureau g^n^ral de Statistique. 

Brasilien. 

Parä — Museu Paraense de Historia Natural e Ethnographia : Boletim 

Vol. n No. 4. 
Rio de Janeiro — Museu Nacional. 

Britisch Amerika. 

Halifax (Nova Scotia): Nova Scotian Institute of Natural Science: 

Proceedirigs and Transactions, Session of 1897/98, Vol. IX, 

Part. 4. 

Ottawa — Geological Survey of Canada: Macoun Catalogue of Canadian 

Plauts, Part I— VI; Annual Report (New Series) Vol. IX. 1896. 

Toronto — Canadian Institute: Transactions Vol. I, Part 1; Pro- 

ceedings. Vol. III, Fase. 2 u. 3; Vol. IV Fase. 1; Vol. V 

Fase. 1 u. 2; Vol. VI Fase. 1 u. 2; Vol. VII Fase. 1 

u. 2; New Series Vol. I Part. 1-3; Vol. H, Part 1 

(No. 7), Part. 2 (No. 8). 

Chile. 

Santiago — Deutscher wissenschaftlicher Verein: Verhandlungen, 
Band III, Heft 5, 6. oigitizedb, 



36 

Santiago — Socidtö Scientifique du Chili: Actes 7n»« Ann^e, Tome 
VII 5e livr. 
» — Universidad. 

> — Museo Nacional. 

Cofta Riea. 

San Jos6 — Museo Nacional: Director J. F. Ferraz, Informe de 1898 
ä 1899. 

Mezieo. 

Mexico — Instituto Geolögico de Mexico: Boletin Nr. 11. 

ürnguy. 

Montevideo — Museo Nacional: Anales, Tomo 11, Fase. XI. 

YeroiBigte StMien. 

Albany (N. Y.) — State Museum of Natural History: 49. Annual 
Report 1895 Vol. I; 50. Annual Report 1896 Vol. I. 
* — University of de State of N.-Y.: Forty-ninth Ann. Rep. 1895 
Vol. 2. 
Boston (Mass.) — American Academy of Arts and Sciences: Procee- 
dings N. S. Vol. XXXIV Nr. 2-23. 
> — - Society of Natural History: Proceedings Vol. XXVIII 
Nr. 13-16; Memoires Vol. V, Nr. 4 u. 5. 
Buffalo (N.-Y.) — Society of Natural Sciences. 
Cambridge (Mass.) — Museum of comp. Zoology at Harvard College : 
Annual Report 1898/99; Bulletin Vol. XXXII No. 9, 10, 
Vol. XXXV No. 1, 2, 7. 
» — Peabody Museum ofArchaeologjy and Ethnology: Archaeo- 
logical and Ethnological Papers Vol. I, No. 1—6. 
Chicago (III.) — Academy of Sciences: Fortieth Ann. Rep. 1897; 

Bulletin No. n. 
Colorado Springs (Colo.) — Colorado College: Studies, Vol. Vn. 
Davenport (Jowa) — Academy of Natural Sciences. 
Madison (Wisc.) — Wisconsin Academy of Sciences, Arts and Letters. 
> — Wisconsin Geological and Natural History Survey: Bulletin 
No. 1 Econom. Series No. 1; No. 2 scientif. Series No. 1. 
Meriden (Conn.) — Scientific Association. 
Milwaukee — Natural History Society of Wiseonsin. 

> — Public Museum: 16. Annual Report. 1898. 

Minneapolis (Minn.) — Geological and Natural History Survey of 
Minnesota. 
» — Minnesota Academy of Natural Sciences. 
Ncw-Haven (Conn.) — Academy of Arts and Sciences: Transactions. 

Vol. X, Part I 1899; Titel zu Vol. IV 1877—1882. 
New-York (N.-Y.) — Academy of Sciences, late Lyceum of Natur. 
History: Annais Vol. X 1898 Nos l— 12; Vol. XI Part. III; 
Vol. Xn Part I; Transactions Vol. XVI, pp. V to VIH. 

* — American Geographical Society: Bulletin 1898 Vol. XXX 

No. 1—6; 1899 Vol. XXXI No. 1-4. 

* — American Museum of Natural History: Bulletin(3^^o^^ 

1892 bis Vol. X 1898; Annual Report 1898. ^ 

3* 



36 

New-York ~ Microscopical Society: Mitteilung, dafs die Veröffent- 
lichungen suspendiert sind. 
» — Torrey Botanical Club, Columbia University: Bulletin 
Vol. 25 No. 12. 
Palo Alto (California) — Leland Stanford Junior University: Con- 

tribution to Biology XVII. 
Philadelphia (Pennsylv.) — Academy of Natural Sciences: Procee- 
dings 1898 Part II, III; 1899 Part. I. 
» — AmericanPhilosophicalSociety:Proceedings XXXVI, 158. 

» — Commercial Museum: The Philadelphia Museum; 

Wiederlein, the Republic of Guatemala ; the State of 
Nicaragua; Wool and other Fibers in the Technic. 
Laboratories; The Worlds Commerce and the U. S. 
Share of it. 
» — Wagner Free Institute of Science. 

Rochester (N.-Y.) — Academie of Science. 
Salem (Mass.) - Essex Institute: Vol. XX VIR, 7— 12; XXIX. 7—12; 

XXX, 1-6. 
St. Louis (Miss.) — Academy of Science: Transactions Vol. VII, 
17-20; Vol. VIII, 1-12; Vol. IX, 1-5, 7. 
> — Missouri botanical Garden. Tenth Annual Report (1898). 
San Francisco (Cal.) — California Academy of Sciences. 
St. Paul (Minn.) — Geological and Natural History Survey. 
Topeka (Ark.) - Kansas Academy of Science: Transactions, Vol. XVI, 

thirtieth and thirty first Ann. Meetings (1897—1898). 
Trenton (N.-Y.) Natural History Society. 
Tufts College (Mass). 

Washington — U.S.Department of Agriculture : Bulletin No. 14, 16, 

Yearbook 1898. 

» — U. S. Geological Survey: Eighteenth Annual Report 

1896-97, Part I, II, HI, IV. V, V continued; Nineteenth 

Annual Report 1897 98. Part. I, IV, VI, VI continued. 

> — Smithsonian Institution: Annual Report to July 1896; 

to Juli 1897. 

Contributions to Knowledge. 

Miscellaneous Collections: No. 1170, first Supple- 
ment; Register und Titel zu Band XXXIX. 
» — Bureau of American Ethnology. 

> — U. S. National Museum : Annual Report of the Board 

of Regents ending June 1896. Bulletin: Part L, 
No. 39. Proceedings: Vol. XX. 

Asien. 

Japan. 

Tokyo — Anthropological Society: The Journal Vol. XIV Nr. 153 
bis 162; Vol. XV No. 163. 

> — Deutsche Gesellschaft fQr Natur- und Völkerkunde Ost- 
asiens: Mitteilungen. Band VII, Theil 2. 

» — Premiere fecole Sup6rieure (Societas ZoologicaTokionensis) : 
Annotationes Zoologicae Japonenses, Vol. V^/MXJTbIV; 
Vol. II Pars l -IV; Vol. III Pars I. DigitizedbyVjOOgIL 



37 

HiederliBdiioli ladiea« 

Batavia — Koninklijke Natuurkundige Vereeniging in Nedcrlandsch- 
Indie: Natuurkundig TijdscHrift, Deel LVIII. 

Australien. 

YiotorU. 

Melbourne — Royal Society of Victoria: Proceedings Vol. X (N.S.) 
Part I, n. 



Die Jahresberichte und Abhandlungen der Naturhistorbchen 
Geseilschaft werden aufserdem an folgende Adressen gesandt: 
München — Kgl. Hof- und Staatsbibliothek. 
Nürnberg — Stadtmagistrat. 

» Stadtbibliothek. 

» Gymnasial bibliothek. 

> Kgl. Bayer. Gewerbemuseum. 



Digitized by VjOOQ IC 



38 



lU. Bericht über den Zuwachs zu den Sammlungen. 





Gegenstand 


Fundort 


Schenker 




la. Anthropologe« 






63 


Bronze-Schmuck und Gebrauchs- 


Labersricht bei 


Anthropologische 




gegenstände, Fiebeln .... 


Neumarkt, Obpf. 


Sektion,Wunder 


130— 


Nadeln, Bronzering, Urnen (von 




senior n. junior. 


133 


H. Wunder und Eckert rekon- 
struiert), ürnenscherben, Eisen- 
gegenstände, Knochen^ Pflanzen- 








samenreste . * 


do. 


do. 


64,65 


Urnen und sonstige Grabfunde . 


Behringersdorf 


do. 


122,123 


Urnen und Anderes 


Hanuner bei 








Mögeldorf 


do. 


124. 


Urnen und Bronzefunde .... 


Weifsenbrunner 








Höhe b. Altdorf 


do. 




Ib. Ethnogrraphie. 






112,113 


2 Paar verzierter Frauenschuhe. 


China 


Bayerisches Ge- 


114-117 


4 Paar verzierter Männerschuhe 

2. Zoologie. 

a. Säugetiere. 


do. 


werbemuseum. 


50 


Vespertilio murinus , gemeine 


Veühof b. Nürn- 






Fledermaus 


berg 
Binnenbrunn frk. 


Roffff. 


89 


Rhinolophus hipposideros, kleine 


'^•^OO 




Hufeisennase 


Jura 


Heuner. 


66 


Talpa europaea, Maulwurf, weifs- 


Gostenhof bei 






gelbe Varietät 


Nürnberg 


Frank. 


201 


Felis sp., junge australische Wild- 








katze 


Queensland 
Afrika 


Kinkelin. 


95,96 


Elephas, Elefantenzähne .... 


SchoU. 


97 


Hippopotamus, Nilpferdzähne . . 
b. Aves, Vögel. 


Afrika 


do. 


172 


Picus viridis, Grünspecht. . . . 


Mögeldorf 


Rogg. 


41 


Cuculus canorus, Kuckuck, Ei . 




Dr. Blümke. 


67 


Tetrao tetrix, Birkhenne .... 


Brunnau b. Both 


Meisenbach. 


120 


Porzana marmorata, punktiertes 




Mayer, Schnieg- 




Rohrhuün 


Schniegling 


Ung. 


49 


Rallus aquaticus, Wasserralle. . 


Pegnitzufer bei 




56 


Phoenicopterus ruber, Flamingo. 


Veühof ^ _ 

Digitized 


\&SSi,' 



39 






Gegenstand 



eine Serie Vogelbalge 
eine Serie Vogeleier . 



c. Reptilien. 

Lacerta ocellata, Perleidechse . 
Lacerta maralis mit Eiern . . . 
Lacerta viridis, Smaragdeidechse 
14-16 1 Chamaeleon vulgaris, cJ 5 u. Eier 
137 j Ctenosauraacanthinora, schwarzer 

»,9iJ ^^^"^ 

d)7 üromastix hardwickei,3Exemplare 

Enmeces qninquelineatus .... 

Calotes versicolor, 2 Exemplare. 

Agama inermis 

Gymnodactylus geccoides .... 

Scicnus officinalis 

Ancistrodon hypnale " . 

Tropidonotus stolatus. Natter. . 
Vipera bems, Kreuzotter .... 



Dendrophis pictus, Baomschlange 
Morelia argus, Rautenschlange . 
Psanunodynastes pulverulentus . 

Lycodon aulicus 

Lycodon aulicus var. capncina . 
Crotalns sp., eine Klapper . . . 
Salamandra maculata . t . . . 

d. Fische. 
Cobitis foBsilis, Wetterfisch. . . 

e. Insekten. 
Sammlung der deutschen Geo- 

metriden 

Sammlung ausgeblasener Raupen 

f. Spinnentiere. 
Chelifer cancroides, Bücher- 
skorpion 



Fundort 



Australien 



Schenker 



ßenda, Adelaide. 



Willy Schröder. 



Tirol. 


Kinkelin. 


Tirol. 


» 


Ägypten. 


n 


Mexiko. 


f) 


Ostindien. 


ry 


Verein. Staaten 




Nord-Ajn. 


n 


Ostindien. 


n 


Nordägypten. 


r» 


Griechenland. 


n 


Ägypten. 


» 


Ceylon. 


r» 


Ceylon. 


n 


Lorenzer Wald 




bei Mögeldorf. 


» 


Luzon. 


, 


Queensland. 


Zeeh^Queensland 


Mindanao. 


Kinkelin. 


Manila. 


» 


Manila. 


r» 


Kamerun. 


Scholl. 



Kersbach b. Lauf. Frau Stieber 



Schniegling. 



Deutschland. 



Nürnberg. 



Rhau. 



Kaulfufs. 



CigitizedbyVnOO^lC 

1 lleinr. Walther. 



40 



h 


Gegenstand 


Fundort 


Sehenker 


90 


Agroeca linotina, Goccon der- 








selben 


Muggendorf. 
Hund, Nürnberg. 


Heerwagen. 


85 


Ixodes ricinus, Zecke 


A. Schwarz. 




g. Krebse. 






134 


Pagurus Bernhardinus, Einsiedler- 








krebs 


Europ. Küsten 


Rehlen. 


23 


Dromia vulgaris, Wollkrabbe . . 


Mittelmeer, Cette 


KinkeUn. 


37 


Carcinus maenas, Krabbe. . . . 


französisches 








Mittelmeer 


angekauft. 




h. Würmer. 






39 


Serpula contortnplicata 


französisches 








Mittelmeer 


angekauft. 


1 


Ascaris marginata, Spulwurm . . 


Hund, Nürnberg 


A. Schwarz. 


83 


Heteracis inflexa 


Hühnerei, „ 


Heerwagen. 


2 


Taenia cucumerina 

i. Mollusken. 


Hundf „ 


A. Schwarz. 


47 


Sepia officinalis, Rückenschulp . 


französ. Mittel- 








meerküste 


angekauft. 


46 


Einige Muscheln 


II 


n 


119 


Amphora m. Muscheln, Schwämmen 








und Serpula dicht bedeckt . . 


jonisches Meer 


Prof. Schröder 




k. Echinodermata. 






40 


Psammechinus miliaris 


französ. Mittel- 








meerküste 


angekauft. 


24 


Ophiura laevis 


Mittelmeer 


Kinkelin. 




1. Polypen. 




169 


Homkoralle 


französ. Mittel- 


Rödelmeier. 




m. Schwämme. 




48 


Spongia, verschied. Seeschwämme 


meerküste 


angekauft. 


119 


Spongia, Schwämme 

n. Anatomie. 


jonisches Meer 


Prof. Schröder. 


167 


Eine Serie Säugetierschädel . . 


divers. 


Dr.WiU,£rl«agen 


25 


Phoenicopterus, ein Flamingo- 




R. Schmidt 




Schädel 


— Digitized b) 


51 


Zwei Vogelßchädel 


— 



41 



^ 1 Gegenstand 

w ■ 


Fundort 


Sehenker 




0. Biologie. 






88 


Abnorm kleines Ei vom Kanarien- 








vogel 


hier gezogen 


Schmidt, August. 


154 


Abnormes und kleines Entenei . 


n 


Dasch. 


80 


Lasiocampa pini, Entwickelang 








desselben 


Franken 


Webel. 


190 


Gänge des Cossus in einem Birn- 






baomast 


Nürnberg 


Buchner. 


185 


Cocons Ton Entometa ignobilis, 








einem Nachtfalter 


Australien 


Benda, Adelaide. 




p. Pathologie. 






149 


Darmstein 


Pferd, hier 


Fein. 


171 


Nierenstein 


Rind 


Riedner. 




8. Botanik. 






a. zum Nürnberger Lokal- 








herbar. 






71 


Aquilegia vulgaris, Tar: flore albo, 


Vorra, Artels- 






Tar: stellata. 


hofen 


Dittmar. 


70 


Lunaria rediriya 


Vorra 


Dittmar. 


187 


Lathynis hirsotns, Helianthemom, 








Beseda Luteola 


RofsstaU 


A. Schwarz. 


145 


Papilionaceen, Rosa- und Rubus- 








formen 


Nürnberger 








Florengebiet 


n 


150 


Rosa, ferschiedene Spezies . . . 


Forchheim 


Simon. 


210 


Rosa cinnamomea, flore pleno 


Schwarzachthal 


Fr. Schultheifs. 


153 


Rosaceen und anderes 


Erlangen 


Glück, Heidelbg. 


60 


VJDca minor. 


Molzberg 
advent. .Forsthof 


Rodler. 


68 


Anchosa italica und ochroleuca . 


Fr. Schultheifs. 


74 


Roragineen 


Nürnberger 
Florengebiet 








» 


79 


(^nscuta-Arten, Boragineae . . . 


n 


A. Schwarz. 


78 


Ptümonaria mollisima 


Fischstein 


Schwemmer. 


82 


^laneen und Scrophulariaceen . 


Nürnberger 








Florengebiet 


Fr. Schultheifs. 


^lOrchia milltaiiB 


Schwarzach- 


Emma RüdelJ^ 


ona 


l)-l i A'.'tt.^ 


klamm 



42 



148 
151 

144 

146 
152 
22 
147 
148 



194 



135 

21 

72 

12 

184 

182 

169 

13 

214 

142 

186 

87 



125 

76 

77 

178 

140 

141 



Gegenstand 

b. zum bayorischen Landes- 

herbar 
Bosa-Formen 



Rosa- und Cirsinm- Arten, -Formen, 

Bastarde 

Papilionaceen, Cotoneaster etc. . 

Cirsiom-Formen 

Uieraciam Schmidtii 

Cirsium heteropbyllom 

Cirsiom-Bastarde 



Fundort 



Rothenburg 
Treuchtlingen, 
Donau 

Bayern 
Nördlicher Jura 

n 

Staffelberg 
Lichtenfels 
Mainthal 



c. zum allgemeinen Herbar. 

Herbar des 4^ Rechtsr. Schwemmer Tirol, Italien etc. 

d. frische Pflanzen, 

Früchte etc. 

Frucht vom Tulpenbaum, Lirio- 

dendron 

Calycanthus praecox 

Baumwolle, Gosypium herbaceum 
Eucaljrptus globulus, Blüten 
Rosa, dornenlose Sorte aus Italien 

Sedum dasyphyllum 

Escheveria globosa 

Mesembryanthemum grandiflorum 
Orchideen u. anderePhanerogamen 

Aster alpinus 

Centaurea Cyanus, verschiedene 

Farbensorten 

Trientalis, Chamaebuxus, Pingui- 

cula, frisch 



Quercus Suber, Korkeiche, Rinde 

Quercus Teysmanni 

Quercus javanica 

Calla palustris 

Crocus speciosus 

Colchicum autumnale var. byzan- 
tinum 



Schenker 

Simon. 

Kränzte, Munchn. 

A. Schwarz. 
Harz, Kulmbach. 

n 
n 

Kaulfufs. 

n 

Frau Gaechter. 
A. Schwarz. 



hier gezogen 

kult. Oberitalien I Schwemmer 

kult. Pompeji 

kult. Italien 

kult. Schniegling 

kult. hier 



Pompeji 

Plech, Fischstein 

kult. hier 



Fichtelgebirg 



Java 

n 

Lorenzer Wald 
kult. hier 

Digitized b/ 



E. Spandel. 

Rhau. 

Veit Schultheifs. 



E. Spandel. 

Zeidler. 

Tölke. 

Schwär ztrauber. 

Gebhardt, Markt 
Redwitz. 
Tölke. 
Kinkelin. 

n 

Dittmar. 
Tölke. 

Google 



43 



125 


Gegenstand 


Fundort 


Schenker 


86 


Mnscari botryoides, Tnlipa sil- 








Testris etc., frisch 


Schweinfurt 


Prell. 


206 


Aloe nigricans 


kultiv. hier 
Mexiko 


Veit Schultheifs. 


173 


Bromelia pingnis, Same 


Seel. 


174 


Hevea elastica, Same 


Neuguinea 


j» 


175 


Coula edulis, Same 


Kamerun 


1) 


176 


Terminalia Chebula, Same . . . 


Ostindien 


» 


17 


Tefillea cordifolia, Same .... 


— 


n 


18 


Mucuma spec, Same 


— 


n 


19 


Areca spec, Same 


Südamerika 


» 


20 


Balsamocarpon brevifolium, Same 


Chile 


ff 


73 


Eatada scandens, Fracht .... 


— 


ff 


35 


Isonandra Gutta, Guttapercha- 








bäum, Frucht 


Sumatra 


Kinkelin. 


107 


Verschiedene unter Damarharz 








gemengte Früchte 


Batavia u.Borneo 


Dasch. 


177 


Poa bulbosa var. vivipara . . . 


Umgegend von 








Nürnberg 


Heuner. 


183 


Phalaris arundinacea var. picta, 








in Blüte 


kult. hier 
Bernloh, ein- 


Veit Schultheifs. 


196 


Elymus arenarius mit Frucht . . 




* 




gebürgert 


Bhau. 


75 


Pinus Pinaster, Zapfen 


kult. Erlangen 


Kinkelin. 


11 


Pinus Pinaster, Zapfen 


lUlien 


E. Spandel. 


126 


Araucaria spec, mächtiger Frucht- 








zapfen 


Brasilien 
botan. Garten 


Fr. Barbeck. 


211 


Azolla filliculoides 








Erlangen 


Sayferth, Erlang. 


8 


Fegatella conica 


Lorenzer Wald 


A. Schwarz. 


155 


Algensammlung (Helmintochorton) 


divers. 


Frau Martins, 
Ansbach. 


197 


Lepioda procera, Parasolpilz . • 


Schwabach 


A. Sehwarz. 


198 


Agaricus phalloides 




ff 


212 


Armillaria melleaYahl., Hallimasch 
e. Phytopathologie. 


Hallerwiese 


Kinkelin. 


202 


Boletus piperatus mit Verwachsung 


Kraftshof 


Seel. 


43 


Polyporus Bibesiarum auf 






44 


Stachelbeere 


Skt. Johannis 
Gostenhof 


Veit Schultheifs. 


Nectria cynabarina 


A. Schwarz. r 
Zippelius, Rei- 
chenschwand. 


181 ; Föhrenstamm mit Pilzen .... 


Reichenschwand 


1 







44 



I 



216 
136 

101 
128 

118 

191 



127 

84 

129 

212 
62 
54 

170 

33 
27-33 

62 



9 
138 
192 

6 

6 

62 

189 



Gegenstand 



Peronospora Gorydalidis and an- 
dere parasitäre Pilze .... 

Melampsora Pirolae Schroet . . 

Rhytisma acerinum aof Acer 
platanoides 

Bosa centifolia mit Abnormität . 

Prunus Padus, Verwachsung von 
2 Früchten 

Verbänderung von Euphorbia 
Cyparissias 

Verbänderung vom Spargel, 
Asparagus off. 

4* Geologie. 

a. Palaeontologie. 
Plateosaurus Engelhardi .... 

Palaeoniscus Freyenslebenii. . . 

Ammonites costatus 

Gryphaea arcuata 

Pecten personatus 

Trigonia costata 

Ammonites 

Ammonites, mehrere Spezies . . 
Beiche Kollekt. fossiler Schwämme 

Planorbis multiformis, Formen- 
reihe 

b. Geognosie. 

Porphyr 

Geode aus dem Amaltheenthon . 

Röthel in Dogger 

Basalt 

Basalttuff 

Süfswasserthon mit Petrefakten . 
Moränengestein und Furchensteine 



Fundort 



Schenker 



Erlangen etc. 
Plech 

Bothenburg 
kult. Weidenbach 

Bofsstall 

Bupprechtstegen 

Skt. Johannis 



A. Schwarz. 
Zeidler. 

Bodler. 

Pfautsch, Wei- 
denbach. 
A. Schwarz. 

Zäh, Bupprecht- 
stegen 
Hutzier. 



Zanclodonletten, 




Lauf 


Wunder junior. 


Kupferschiefer, 




Mannsfeld 


Kirsch. 


Lias, Neuhof bei 




Eschenau 


Schwemmer. 


Lias, Bamsberg 


A. Schwarz. 


Dogger, Spardorf 


n 


1» 
weifser Jura, 


n 


Franken 


Avril. 


Jura, Blaubeuern 


Model. 


weifser Jura, 




Blaubeuern 


n 


Steinheim 


Paalzow. 


Sarnthal, Bozen 


Prof. Schröder. 


Leinburg 


Hertlein, Leinbg 


Ligenz 


Gg. Schwarz. 


Podhom, Marien- 




bad 


Bodler. 


Peifsenberg 


Schmidt. 


Starnberger See 


Frkv.LöffelhoU. 



45 



^ 
^ 



Gegenstand 



Fundort 



94 

193 

8 



196 
156 
203 



Hornstein aus dem Dilavinm 

Torf 

Sprudelstein 



5. Mineralogie. 

Aragonit 

Marmor 

Rabin in Basalt .... 

Andalosit 

Kaolinerde 



42 Granatkrystall . 



92 
111 
121 

110 
104 
188 
105 
200 



108 
109 



199 
103 
56 

100 



Magnetit . . . 
Brauneisenerz 
Ocker. ... 



Spatheisenstein 

Kupfererze 

Goldstufen 

Diverse andere Mineralien 
Diverse Mineralien . . . 
Steinsammlong 



6. TeehDolofie« 

2 violette Einschlüsse in Copal . 
Gelblicher Einschlofs in Copal . 

7. TerwaltiBg. 

Ein Mikroskop 

Pri^ratengl&ser 

K&sten f&r mikroskopische Prä 
parate 

Zigarrenkistchen für Zettelkata 
löge 



Nürnberg 

Ligenz. 

Karlsbad. 



SpiefSiOberfrank. 

Specia 

Siebengebirge 

Bodenraais 

Zettlitz beiKarls- 
bad 

Granatwand, 
Gurgl 

Bodenmais 

Auerbach 

Espanmühle, 
Ligenz 

Auerbach 

Australien 

» 
Neusüdwales 
Alpen 
divers. 



Brasilien 



Schenker 



Schmidt, August. 
Gg. Schwarz. 
Rodler. 



Gg. Schwarz. 
Grofs. 
Rehlen. 
Kinkelin. 

Rodler. 

Prof. Blümke. 
Kinkelin. 
A. Schwarz. 

Gg. Schwarz. 
A. Schwarz. 
Benda, Adelaide. 



GeneralGOringer. 
Schwemmer. 



Dasch. 



Schräg. 
Rodler. 

Prof. Fleisch- 
mann. 

Hefa, Zigarren- 
handlung. 



Der Konservator: Ä^ Schwan 



46 



IV. Jahresbericht der Verwaltung 1899. 

Von den entbehrlichen Räumen des Hauses ist der zweite 
Stock des Vorderhauses und das Hinterhaus an die Nürnberger 
Frauen-Arbeitsschule vermietet, der eine Keller an einen Obsthändler. 

Die Gesellschaflsräume waren von dem Pegnesischen Blumen- 
orden, dem Stenographen-Hort, dem Verein für Gesundheitspflege 
und dem Apothekergremium gemietet. 

Es wurden zwei Schuldscheine zurückgegeben. Zur jährlichen 
Abzahlung von Mk. 200. — an der Hypothek haben auch in diesem 
Jahre eine Anzahl Herren Extrabeiträge geleistet. 

Für alle Geschenke und freiwilligen Beiträge wird der herzlichste 
Dank ausgesprochen. 

Da die Verwaltung noch ünmer einen grofsen Zuschufs aus 
der Gesellschaftskasse benötigt, kann eine Verlosung der Schuld- 
scheine noch nicht vorgenommen werden. 



Der Vermögensstand beziffert sich wie folgt: 
a. Immobilien. 

Haus in der Schildgasse, 1. Januar 1899 M. ^ 

Hypothek darauf 50000 — 

Abzahlung pro 1899 200 — 

sohin am 31. Januar 1899 Hypothekenbestand , . 48800 — 

b. Mobiliar. 

Stand am 1. Januar 1899 1472 18 

Ab lOO/o Abnützung 163 57 

1308 61 

c. Schuldscheine. 

Gesamtausgabe derselben 30175 — 

Stand am 31. Dezember 1899 . . 24500 — 

H. Sebald. 



Digitized by VjOOQ IC 



47 



V. Kassenbericht für 1809. 

a. Ober die Gesellschaftskassa. 

Einnahmeii: M 4 

Kassabestand 132 14 

Guthaben bei der Sparkassa (^ 1149.13) — — 

Aufnahmsgebuhren .... 41 60 

Milgliederbeiträge 3957 70 

Beitrag vom Stadtmagistrat Nürnberg 500 — 

Beitrag vom Landrat für Mittelfranken 300 — 

Freiwillige Beiträge von Mitgliedern 250 — 

Summa . . 5181 44 

Ausgaben: Jk J^ 

Titel la. Einrichtung des Museums 26 — 

Ib. Unterhaltung desselben 326 05 

Ha. Bibliothek 388 21 

üb. Einrichtung derselben — — 

II c. Druck des Kataloges — — 

lUa. Schreibbedarf 2 10 

nib. Porti 166 40 

fflc. Inserate 101 50 

III d. Gehalt des Vereinsdieners 530 93 

Ille. Feuerversicherung (1897/1902) — — 

IV. Überzahlung zum Hauskonto 948 96 

V. Jahresbericht und Drucksachen 853 90 

Via. Zuschufs zur anthropologischen Sektion . . 150 — 

VIb. » > botanischen Sektion 70 — 

VIc. > » geographischen Sektion ... 50 — 

VId. > > chemischen Sektion 80 — 

VIe. » > zoologischen Sektion 60 — 

VUa. Fond für das 100 jährige Jubiläum .... 100 — 

Vnb. Abzahlung der Hypothek 200 — 

VIU. Reservefond 72 14 

Summa . . 4126 19 

Abschlags: Jk ^ 

Summa der Einnahmen .... 5181 44 

Summa der Ausgaben . . . . 4126 19 

Kassabestand a. Bar 1055 25 



b. 2 Sparkassabücher mit. . . 1283 31 wo 
zum Fond für das 100jährige Jubiläum ,ü (MX) . — °B'es1i 



tininu smdi 



48 

b. Ober die Verwaltungskassa. 

Einnahmen: Jk ^ 

Extrabeilräge der Mitglieder zur Abzahlung an der 

Hypothek 123 — 

Miets-Erträgnisse 2407 10 

Erlös für verkauftes Holz 16 — 

Eintrittsgelder 3 50 

Erlös für Vereinszeichen — 50 

Überzahlung aus der Gesellschaftskassa 948 96 

Summa . . 3499 06 

Aasgaben: Jk ^ 

Reparaturen und Bauarbeiten 115 14 

Steuern, Wasserzinse und Holzpfandgeld 387 94 

Hypothek-Zinsen . 1985 98 

Ökonomie und Regie 1010 — 

Summa . . 3499 06 

Abschlnsg: M ^ 

Summa der Einnahmen .... 3499 06 
Summa der Ausgaben . , . . 3499 06 



Für die Richtigkeit: 
Nftrnberg, den 31. Dezember 1899. 



Georg Rhau. 



Die Richtigkeit vorstehender Aufstellung und die Überein- 
stimmung mit den vorHegenden Belegen bestätigen 

Nttrnbergy den 9. Januar 1900. 

Carl Mandel, Hermann Schlegel, Kinkelin. 



Digitized by VjOOQ IC 



49 
VI. Mitgliederverzeichnis. 

Vontandschalt: 

Direktor: Herr Dr. August Heerwagen, k. Gymn.-Prof. 
/. Sekretär: Herr Wilhelm Rudel, k. Pfarrer. 
IL Sekretär: Herr Dr. Karl Hartwig, k. Gymn.-Prof. Vom 8. Nov. 

ab Herr Dr. Franz Küspert, k. Reallehrer. 
IK Sekretär: Herr Dr. Alexander Frankenburger, prakt. Arrt. 
Vom 8. November ab Herr Her m. Eckert, Kaufmann. 
IHbUoihekar: Herr Konrad Hörmann, Lithograph. 
Conservaiar: Herr Aug. Schwarz, k. Stabsveterinär. 
Sehaiimmier: Herr Georg Rhau, Fabrikbesitzer. 
Admmstrator: Herr Hans Sebald, Buchdruckereibesitzer. 
Bmteckniker: Herr Emil Hecht, Architekt und Gemeindebevoll- 
raächtigter. 

KoBtoden: 

1) för die anatomische Sammlung: Herr Dr. Frankenburger; 

2) > » anthropologische Sammlung: Herr Wunder; 

3) > > botanische Sammlung und zwar: 

a. für das allgemeine Herbar: Herr Fr. Schultheifs; 

b. » > Kryptogamen-Herbar : Herr Kaulfufs; 

c. > » Nürnberger Herbar: Herr Schwarz; 

d. > » bayerische Landesherbar: Herr W. Rudel; 

4) för die chemische Sammlung und zwar: 

a. für die anorganisch-chemische : Herr Dr. Metzger; 

b. » > organisch-chemische: Herr Wunder ; 

5) für die ethnographische Sammlung: Herr Th. Obermayer; 



6) 
7) 
8) 
9) 
10) 

11) 
12) 



mikroskopische Sammlung: Herr Dr. Goldschmidt; 

> lokaUgeognostische Sammlung: Herr Schwarz; 
» mineralogische Sammlung: Herr Dr. Zwanziger; 

> paläontologische Sammlung: Herr Spandel; 

> physikalische Sammlung: 1 - 7. „aranf 
* technologische Sammlung: / ^' ^^' vacani, 
» zoologische Sammlung und zwar: 

a. für Säugetiere und Vögel: Herr Dr. Heerwagen; 

b. » Reptilien, Amphibien und Fische:. Herr Kinkelin; 

c. » Weichtiere und Conchylien: Herr Knapp; 

d. * Insekten: z. Zt. vacant; 

e. » Arachniden und Myriapoden: Herr Dr. Koch sen.; 

f. » Crustaceen tmd niedere Tiere: Herr Kinkelin. 



A. Ehrenmitglieder. 

Sr. Kgl. Hoheit Dr. Carl Theodor, Herzog in Bayern. 
Herr Agassiz, Alexander, Professor in Cambridge. 
» Arnold, Fr., k. Oberlandesgerichtsrat in München. 

• Ball hörn, Hermann, Buchhändler in Würzburg. 

• Dr. Blas i US, R., Professor in Braunschweig. 

• Dr. Blasius, W., Geh. Hofrat in Braunschweig. 

• Doval-Jouve,T., Ancien Inspecteur de 1' Academie de Montpellier. 

• Dr. Flügel, Felix, Privatgelehrter in Leipzig. [^ 
» Dr. Günther, Sigmund, k. Professor an der tcchn. Hochschule 

in München. 



50 



Herr Dr. v. Koch, Gottlieb, Direktor des zoolog. Instituts in Darmstadt. 
Dr. Koch, Ludwig, sen., prakt. Arzt in Nürnberg. 
Lambrecht, Fr., k. holl. Hauptmann in Hannöverisch-Münden. 
Lotter, M., Waisenhausvater in Nürnberg. 
Müller, August, Kaufmann. 
Dr. V. Pettenkofer, M., k. Geheimer Obermedizinalrat in 

München. 
Philippi, R. A., Professor a. d. Academie in Santjago in Chile. 
Dr. von Ranke, Johannes, k. Professor in München. 
Dr. Selenka, Emil, Professor hon. an der Universität München. 
Dr. Surr in gar, W. F.R., Professor und Direktor des botanischen 

Gartens in Leyden. 
Dr. Virchow, R., k. Geh. Rat u. Universitäts-Professor in Berlin. 



B. Korrespondierende Mitglieder. 

Herr Dr. Appel, Otto, Beamter am Reichsgesundheitsamt in Berlin. 

Dr. Ascherson, Paul, Professor an der Universität Berlin. 

Benda, Emest, Kaufmann in Adelaide. 

Dr. Biehringer, Joachim, Professor am Polytechnikum zu 
Braunschweig. 

Dr. Böttger, Oskar, Professor in Frankfurt a. M. 

Braun, Heinrich, Naturforscher und Gemeinderat in Wien. 

Dr. Buchenau, Franz, Professor in Bremen. 

Dr. Dieudonn€, Adolf, k. Stabsarzt und Privatdozent in Würzburg. 

V. Docoupil, Wilhelm, Direktor der k. k. Fachschule in HoKc. 

Dr. Fleischmann, Albert, Professor an der Universität in 
Erlangen. 

Gebhart, Oskar, Kaufmann in Markt Redwitz. 

Dr. Glück, Hugo, Privatdozent in Heidelberg. 

Goeringer, k. Generalmajor in Metz. 

Dr. Gordon y de Acosta, Akademieprofessor in Habanna. 

Hall, J., Staatsgeolog in Jowa und Paläontolog für die Staaten 
New- York, Albany etc. 

Dr. V. Heldreich, Direktor des botan. Gartens und Direktions- 
mitglied des naturhistorischen Museums zu Athen. 

Dr. Herz, Fr. J., Konsulent fiir Molkerei wesen in Neupasing- 
München. 

Dr. Holler, August, k. Medizinalrat in Memmingen. 

Hornung, Heinrich, k. Reallehrer in Ansbach. 

Dr. Hartz, Kurt, Reallehrer in Kulmbach. 

Le Jolis, Auguste, Direktor der Soci€t€ des sciences naturelles 
et math^matiques de Cherbourg. 

Dr. Issel, Arthur, Professor in Genua. 

Kleylein, Fabrikbesitzer in Gablonz. 

Dr. Klunzinger, Benjamin, k. Professor in Stuttgart. 

Kränzle, Joseph, k. Korps-Stabsveterinär a. D. in München. 

Krapfenbauer, Andreas, Apotheker in Manilla. 

Dr. Kratzmann, E., prakt. Arzt in Marienbad. 

Landauer, Robert, Apotheker in Würzburg. 

Mac CO, Eduard, Kapitän. 

Dr. Magnus, Paul, k. Professor an der Universität in Berl}^. 

Dr. Mehlis, Christian, k. Gymnasiallehrer in Neustadt a. H. 

Dr. Müller, W., ordentlicher Professor an der Universität Jena. 

Dr. Peters, Karl, Reichskommissar a. D. 



61 



Herr 



Dr. Rehm, H., k. Medizinalrat in Regensburg. 

Dr. Rein seh, Paul, Privatgelehrter in Erlangen. 

Tempsky, Fr., Buchhändler in Prag. 

Teufel, Gustav, Ingenieur in München. 

Warnstorf, Karl, rrofessor in Neuruppin. 

Weidner, Gutsbesitzer in Gerasmühle. 

Weigel, Friedrich, Kaufmann in Ansbach. 

Dr. Will, Privatgelehrter in Erlangen. 

V. Wissmann, kais. Gouverneur a. D. 

Wo r lein, Gg., k. 2^Imeister a. D. in Nymphenburg. 



G. Ordentliche Mitglieder. 

1) Herr Adolf, Georg, Kaufmann. 

2) > Aischberg, Joseph, Hopfenhändler. 

3) > Ammon, Gottfried, Kaufmann. 

4) 9 Ammerbacher, Max, Postofficial in Fürth. 

5) » Dr. Baal fs, Hans, Veterinär. 

6) » Bach, Leo, Fabrikbesitzer. 

7) * Bach, Siegfried, Fabrikbesitzer. 

8) > Bäumler, Joh. Konrad, Kaufmann. 

9) » Dr. Barabo, Adam, prakt. Arzt. 

10) • Barbeck, Hugo, Buchhändler und Magistratsrat. 
11} > Barth, Johannes, Kaufmann in Weigelshof. 

Barthell, Georg, Hopfenhändler. 

Dr. Bauer, Friedrich, prakt. Arzt. 

Dr. V. Bauer, Karl, Assistent. 

Baur, Joseph Anton, Ingenieur. 

Bauriedel, Paul, Kunstmühlbesitzer. 

Beckh, August, Privatier. 

Dr. Beckh, August, prakt. Arzt. 

Beckh, Edwin, Fabrikbesitzer und Kommerzienrat. 

Beckh, Georg, Fabrikbesitzer. 

Dr. Beckh, Wilhelm, Hofrat und Oberarzt am städt. 
Krankenhaus. 

Berlin, Max, k. Oberlandesgerichtsrat. 

Dr. Bernett, Wilhelm, prakt. Arzt. 

Bern hold. Albert, Kaufmann. 
25J » Bernstiel, Charles, Kaufmann. 

26) . Dr. Berthold, Eugen, prakt. Arzt. 

27) Bibliothek, Königliche, in Berlin. 
2S) Herr Bing, Adolf, ICaufmann. 

29) > Bing, Berthold, Kaufmann. 

30| » Bing, Heinrich, Kaufmann. 

31) > Bing, Hermann, Kaufmann. 

32) * Bing, Ignaz, Fabrikbesitzer und Kommerzienrat. 

33) > Bing, Oskar, Kaufmann. 

34) > Birkmann, Michael, Zimmermeister. 

35| > Birkner, Rudolf, Bankier und Konsul der chil. Republik. 

36) » Bloch, Samuel, Privatier. 

37) t Dr. B 1 ö d e 1 , Georg, prakt. Arzt. 

38) » Dr. Blümcke, Adolf, k. Professor. 

39) . Bock, Georg, Zahnarzt DigitizedbyGoOQlc 

40) » Bodky, Julius, k. Reallehrer. o 

41) * Dr. Böhm, Gottfried, Chemiker in Stein. 



18 

16) 
17) 
18) 

m 

20) 
21) 

22) 



43) 
44) 



52 



42) Herr Brom ig, Hans, Kaufmann. 

Brunner, Martin, Kaufmann. 

Brust, Max, Kaufmann und Kommerzienrat. 

Dr. Bu ebner, Wilhelm, prakt. Arzt. 

Bücking, Johannes, Privatier. 

Bürger, Leonhard, Architekt. 

Buz, Franz, k. Oberst und Brigade-Commandeur. 

Carette, Georges, Kaufmann. 

Cnopf, Karl, Bankier und Magistratsrat. 

Dr. Cnopf, Rudolf, prakt. Arzt. 

Conradty, C, Fabrikbesitzer. 

Crämer, Friedrich, Prokurist. 

Crailsheimer, Hugo, Kaufmann. 

Cramer, Fritz, Buchhändler in Würzburg. 

Cramer, Paul, Kaufmann. 

Dr. Deuerlein. Georg, prakt. Arzt. 

Dietrich, Theodor, k. Bahnverwalter in Schweinau. 

Dietz, Georg, Kaufmann und Handelsrichter. 

Diez, Gregor, Maurer- und Tünchermeister. 

Dormitzer, Louis, Kaufmann. 

Dürr, Konrad, k. Professor an der Industrieschule. 

Dr. Eberle, Joh. Fr., k. Gymnasiallehrer. 

Eckart, Ernst, Apothekenbesitzer und Magistratsrat. 

Dr. Eckart, Karl, Apotheker. 

Eckert, Hermann, Kaufmann. 

Ehrenbacher, Sigmund, Kaufmann. 

Eisenbach, Georg, Kaufmann. 

Dr. Elliesen, Paul, Privatier. 

Dr. Emmerich, Max, prakt. Arzt. 

Engelhardt, Adolf, k. Pfarrer. 

Englert, Hans, Kaufmann. 

Enslin, Heinrich, Kaufmann. 

Dr. Epstein, Ernst, prakt. Arzt. 

Er d mann, Friedrich, Bankier. 

Erhard, Theodor, Apothekenbesitzer. 

Erlenbach, Max, Kaufmann. 

Ertheiler, Anton, Kaufmann. 

Er th eiler, August, Kaufmann. 

Etz, Friedrich, Kaufmann. 

Fischer, Karl, Privatlehrer. 

Fleischmann, Chemiker in Doos. 

Föttinger, Karl, Gasthofbesitzer. 

Forchheimer, H. S., Kaufmann. 

Dr. v. Forster, Sigm., prakt. Arzt, 

Dr. Frankenburger, Alex., prakt. Arzt. 

Frankenburger, Max, Fabrikbesitzer. 

Frauen feld, Emil, Kaufmann. 

Frauenfeld, Karl, Kaufmann. 

Frauen feld, Moritz, Kaufmann. 

Frauenknecht, Gustav, k. Notar und Justizrat. 

V. Frays, Freiherr, Philipp, Fabrikbesitzer. 

Friedrich, Johann, k. Reallehrer a. D. 

Fuchs, Hans, Kaufmann. ^ _ 

Füchtbauer, Gg., k. Rektor und OberstudienratLnOOQlC 

Funk, Stephan, Kaufmann. ^ 

G allinger, Jakob, Kaufmann und Kommerzienrat. 

Gar eis, Wilhelm, k. Regierungsrat und Bezirksamtmann. 



63 



99) Herr 
100) 
101) 
102) 
103) 
104) 
105) 
106) 
107) 
108) 
109) 
110) 
111) 
112) 
113) 
114) 
115) 
116) 
117) 
118) 
119) 
120) 
121) 
122) 
123) 
124) 
125) 
126) 
127) 
128) 
129) 
130) 
131) 
132) 
133) 
134) 
135) 
136) 
137) 
138) 
139) 
140) 
141) 
142) 
143) 
144) 
145) 
146) 
147) 
148) 
149) 
150) 
151) 
152) 
153) 
154) 



Gebhardt, Heinrich, Fabrikbesitzer. 

Gebhardt, Ludwig, Kaufmann und Kommerzienrat. 

Gebhardt, Wilhelm, Kaufmann. 

Dr. Geifsler, Gustav, prakt. Zahnarzt. 

Gerngros, Ludwig, Kaufmann und Kommerzienrat. 

Gern gros, Wilhelm, Kaufmann und Kommerzienrat. 

Dr. Giulini, Ferdinand, prakt. Arzt. 

Glafey, Gottl., Fabrikbesitzer und Handelsrichter. 

Göbel, Otto, k. Veterinärarzt. 

Göschel, Ludwig, Privatier, 

Gold mann, Max, Kaufmann. 

Dr. Goldschmidt, Ferdinand, prakt. Arzt. 

Gom brich, M., Instituts-Direktor. 

Gonnermann, Karl, Fabrikbesitzer und Kommerzienrat. 

Dr. Gramming, Kari, Rechtsanwalt. 

Greiner, Gustav, Kaufmann. 

Dr. Grether, Fritz, Apotheker. 

Griesbach, Otto, Kaufmann. 

Grofs, Ludwig, k. Gymnasiallehrer. 

V. Grundherr, Benno, Kaufmann und k. niederi. Konsul. 

Gütermann, Wilhelm, Kaufmann. 

Guldmann, Arthur, Kaufmann. 

Gut mann, Gustav, Bankier. 

Gut mann, Moritz, Kaufmann. 

Haas, Eduard, Fabrikbesitzer und Kommerzienrat. 

Haas, Karl, Bankier. 

Dr. Hanau, Max, Zahnarzt. 

Dr. Hartwig, Karl, k. Gymnasialprofessor. 

Haymann, Julius, Direktor des städt. Gaswerks. 

Hecht, Emil, Architekt und Gemeindebevollmächtigter. 

Heerdegen, Albrecht, Kaufmann und Handelsrichter. 

Dr. Heerwagen, August, k. Gymnasialprofessor. 

Heiling, Christian, Kaufmann. 

Heim, Hermann, Kaufmann. 

Heim, Karl, Kaufmann. 

Held, Hermann, k. Professor an der Kreisrealschule. 

Heller, Friedrich, Fabrikbesitzer. 

Heller, Louis, Kaulmann. 

Hellmuth, Joseph, Rechtsanwalt und Justizrat. 

Hellmuth, Karl, städt. Bezirkstierarzt. 

Hellmuth, Sigmund, Magistratsrat. 

Hering, August, Ingenieur. 

Hertel, Friedrich, Kaufmann. 

Dr. Hefs, Hans, k. Reallehrer. 

Hesselberger, David, Kaufmann. 

Heydolph, Georg, Buchdruckereibesitzer. 

Heidolph, Hans, Rechtsanwalt. 

Hilpert, August, Fabrikbesitzer. 

Dr. Hirsch, Jakob, Fabrikbesitzer in Fürth. 

Hochstein, Karl, k. Veterinär. 

Hör mann, Konrad, Lithograph. 

Dr. Hofmann, Hans, Inspektor am bayr. Gewerbemuseum. 

Hopf, Eduard, Kaufmann. r^^^r^T^ 

Hopf, Emil, Kaufmann. Digitized by V^OOglC 

Hopf, Hans, Kaufmann. 

Huber, Friedrich, Kaufmann. 



-,l :- tr-..fU« 



54 



f 



198) 
199) 
200) 
201) 
202) 
203) 
204) 
205) 
206) 
207) 
208) 
^09) 
10^ 



Jung, Heinrich, Kaufmann, 
'ungmann, Heinrich, Privatier, 
"ann, Paul, k. Telegrapheningenieur. 
Kann, Samuel, Privatier. 
Kantenseder, Johann, Schreinermeister. 
KauHufs, Johann, städt. Trichinenschauer. 
Kempe, Karl, Fabrikdirektor. 

Kiefer, Andreas, k. Hauptmann und Kompagniechef. 
Kinkelin, Adolph, Apothekenverwalter. 
Dr. Kirste, Wilhelm, prakt. Arzt. 
Klein, Benedikt, Kaufmann. ' 

Dr. Klenker, Otto, Fabrikbesitzer in Doos. 
Knapp, Friedr., Kaufm., Magistratsrat u. kgl. span. Konsul. 
Dr. Koch, Heinrich, prakt. Arzt. 
Dr. Koch, Karl, prakt. Arzt. 
Dr. Koppel, August, Realschulassistent. 
Kohn, Emil, Bankier und Handelsrichter. 
Koh», Ernst, Bankier. 
Kohn, Georg, Bankier. 
Krakenberger, Leopold, Kaufmann. 
Krakenb erger, Max, Kaufmann. 
Kraus so Id, Max, k. Pfarrer' und Senior. 
Kr eil, Otto, Fabrikdirektor und Gemeindebevollmächtigter. 
Kr eil, Otto, jun., Ingenieur. 
Kr eil, Rudolt, Oberingenieur. 
Krefs, Johann, Grofsifeischer. 
Kreutzer, Ludwig, Fabrikbesitzer. 
Kristfeld, Jean, Uhrmacher. 
Kr om well, Karl, Kaufmann. 
Dr. Küspert, Franz, kgl. Reallehrer. 
Kugler, Sal., Direktor. 
Kunlo, Richard, Generaldirektor. 

Lambrecht, Hermann, Fabrikbesitzer u. kgl. span. Konsul. 
Dr. Landmann, Joseph, Rechtsanwalt. 
Dr. Landsberg, Ludwig, Fabrikbesitzer in Doos. 
Lang, Bernhard, Kaufmann und k. schwed. Konsul. 
Lang, Ignaz, Kaufmann. 
Lang, Leopold, Kaufmann. 
Langermann, Moritz, Kaufmann. 
Lauer, Jean, Fabrikbesitzer und Magistratsrat. 
Lauinger, Leopold, Kaufmann. 

Lehmann, Alfred, Assistent am ehem. Labor, der Industrie- 
schule. 
Dr. Lehnert, Wilhelm, Apotheker. 
Leidig, Georg Friedrich, Optiker und k. Hoflieferant. 
Lenz, Ernst, Erzgiefser. 
Dr. Lessing, Albert, Fabrikbesitzer. 
Leuchs, Georg, Chemiker und kgl. Hoflieferant. 
Dr. Leuchs, Karl, Chemiker. 
Lex, Hans, Apotheker. 
Leykauf, Georg, k. Hofstahlwarenfabrikant. 
Dr. Limpert, L., prakt. Arzt und Zahnarzt. 
Lindinger, Leonh., stud. rer. nat. in Erlangen. r 
Lind mann, Jakob, Direktor des Gaswerks in Fürth, ^^ 
Lindner, Heinrich, Kaufmann. ^ 

Lösch, Friedrich, k. Postkassier. 



55 



212) 
213) 
214) 
215) 
216) 

217) 

218) 

219) 

220) 

221) 

222) 

223) 

224) 

225) 

226) 

227) 

228) 

229) 

230) 

231) 

232) 

233) 

234) 

235) 

236] 

237 

238^ 

239] 

240 

241 

242^ 

243) 

244) 

245) 

246) 

247) 

248) 

249) 

250) 

251) 

252) 

253) 

254) 

255) 

256] 

257 

258 

259 

260 

2611 

262) 

263) 

264) 

265) 



Herr Dr. Maas, Markus, prakt. Arzt. 
Mandel, Karl, Kaufmann. 
Dr. Manger, Karl, k. Reallehrer. 
Dr. Mansbach, Sigmund, prakt. Arzt. 
Marlier, Julius, Kaufmann und II. Vorstand des Gemeinde- 
Kollegiums. 
Martin, Eugen, Rechtsanwalt und Justizrat. 
Marx, Georg, Ober-Ingenieur. 
Dr. Mayer, M. L., prjSct. Arzt. 
May er- Dinkel, Albert, Kaufmann. 
Dr. Mehler, Heinrich, prakt. Arzt in Georgensgmünd. 
Meiser, Franz, Ingenieur. 

Dr. Merkel, Gottl., k. Medizinalrat u. Krankenhaus-Direktor. 
Dr. Merkel, Wilhelm, prakt. Arzt und k. Hofrat. 
Merzbacher, Joseph, Kaufmann. 
Mes thaler, Jon., Fabrikbesitzer und Kommerzienrat. 
Metzger, Ludwig, Kaufmann und Kommerzienrat. 
Dr. Metzger, Sigmund, Fabrikbesitzer und k. Hoflieferant. 
Dr. Meyer, Chemiker und Fabrikbesitzer in Leyh. 
Michahelles, Georg, k. Hauptmann und Kompagniechef. 
Miedefer, Kaufmann. 
Dr. Mohr, Gustav, prakt. Arzt. 

Dr. Morgenstern, Friedrich, Fabrikbesitzer in Fürth. 
Mühlberger, Karl, Gymnasialzeichenlehrer in Ansbach. 
Müller, August, Kaufmann. 
Müller, Jean, Kaufmann. 
Dr. Müller, Wilhelm, prakt. Arzt. 
Münderlein, Johann, k. Pfarrer. 
Dr. Münz, Pinkus, prakt. Arzt. 
Münzinger, August, Kaufmann. 
Munker, Georg, k. Professor a. D. 
M unzer, Julius, Kaufmann. 
Narr, Adolf, Gutsbesitzer. 
Naue, Otto, Kaufmann. 
Dr. Neuberger, Jos., prakt. Arzt. 
Dr. Neuburger, S., Augenarzt. 

Dr. Neukirch, Richard, Oberarzt am städt. Krankenhaus. 
Neumeyer, Hans, Direktor. 
Neu m Uli er, Konrad, Schreinermeister. 
Nister, £., Kunstanstaltsbesitzer und Kommerzienrat. 
Nowack, J-orenz, Fabrikdirektor. 
Obermaier, Theodor, Kaufmann. 
Offenbacher, Joseph, Kauünann. 
Omeis, Gottlieb, k. Notar und Justizrat. 
Dr. Gtppler, Theodor, Beauftragter der chemischen Berufs- 

genossenschaft. 
Ottenstein, Albert, Kaufmann. 
Ottenstein, Justin, Kaufmann und Kommerzienrat. 
Ottenstein, Max, Kaufmann. 
Paalzow, Richard, Kaufmann. 
Pabst, Friedrich, Fabrikbesitzer. 
P a b 8 1 , Julius, Fabrikbesitzer. 
Palm, Ludwig, Metallgiefsereibesitzer. 
Dr. Pauschinger, Leonhard, prakt. Arzt. 
Dr. Peretz, E., prakt. Zahnarzt. 
Peters, Hermann, Apotheker. 



zedby Google 



A ^^».U^U^m 



\XT^iAt%*%yxr%f^U K Xr4<keHrkrf 



56 



267) Herr 

268) 

269) 

270) 

271) 

272) 

273) 

274) 

275) 

276) 

277) 

278) 

279) 

280) 

281) 

282) 

283) 

284) 

285) 

286) 

287; 

288 

289 

290 

291; 

292) 
293) 
294) 
295) 
296) 
297) 
298) 
299) 
300) 
301) 
302) 
303) 
304) 
305) 
306) 
307) 
308) 
309) 
310) 
311) 
312) 
313) 
314) 
315) 
316) 
317) 
318) 
319) 
320) 
321^ 
322) 



Pfeiffer, Julius, Sprachlehrer. 

Pilhofer, Joh., k. Bahnexpeditor. 

Dr. Pose hei, Gustav, k. Bezirksarzt in Neustadt a. A. 

Popp, Adolf, Kaufmann. 

Preifs, Konrad Philipp, Mechaniker. 

Prell, August, k. Ober-Bankbuchhalter. 

Pretzfelder, Julius, Kaufmann. 

Dr. Prior, Eugen, k. Professor und Direktor. 

V. Puscher, Wilh., Privatier und Kommerzienrat. 

Putz in, Ludwig, Fabrikbesitzer. 

Raab, Karl, Fabrikbesitzer und Magistratsrat. 

Ratz, Heinrich, Apotheker. 

Rau, S. E., Kaufmann. 

Dr. Raum, Wilhelm, Fabrikbesitzer. 

Rehlen, Wilhelm, Fabrikbesitzer und Magistratsrat. 

Reif, Jean, Brauereibesitzer und Kommerzienrat. 

Reif, Zacharias, Brauereibesitzer und Kommerzienrat. 

Dr. Reitzenstein, Fritz, Privatdozent in Würzburg. 

Reizenstein, Hugo, Kaufmann. 

Rettelbusch, Ernst, Architekt. 

Rhau, Georg, Fabrikbesitzer. 

Richter, Richard, Kaufmann. 

Dr. Riedel, Heinrich, Apothekenbesitzer. 

Dr. Riegel, Wilhelm, prakt. Arzt. 

Rieppel, A., Direktor der Maschinenbau-Aktiengesellschaft 

und k. Baurat. 
Rockstroh, Gustav, Kaufmann. 
Rodler, Karl, Apothekenbesitzer. 
Rogner, Konrad, Direktor des städt. Schlachthofes. 
Rohn, Severin, Direktor in Buch. 
Dr. Rosenfeld, L., prakt. Arzt. 
Rosenfeld, Sigmund, Kaufmann. 
Rudel, Georg, k. Oberst und Bezirkskommandeur. 
Rudel, Wilhelm, k. Pfarrer. 
Rupprecht, Friedrich, Privatier. 
Dr. Rupprecht, Georg, prakt. Arzt. 
Rupprecht, Wilhelm, Kaufmann. 
Sachs, Karl, Kaufmann und Kommerzienrat. 
Sachs, Wilhelm, Kaufmann. 
Sandner, Friedr., stud. rer. nat. in Erlangen. 
Schäfer, Jakob, k. Bezirkshauptlehrer in Fürth. 
Schafft, Emil, Charkutier. 

Schedel von Greifenstein, Karl, Apotheker in Schweinau. 
Dr. Scheidemantel, Heinrich, prakt. Arzt und k. Hofrat. 
Scheuermann, Ferdinand, Privatier. 
Schilling, Theodor, Grofshändler und ital. Konsul. 
Schlegel, Hans, städt. Inspektor. 
Schlegel, Hermann, Apotheker. 

Schmidmer, Chr., Fabrikbesitzer und Kommerzienrat. 
Dr. Schmidmer, E., Fabrikbesitzer. 
Schmidt, August, k. Postamtsdirektor. 
Schmidt, Eduard, k. Bezirkstierarzt. 
Schmidt, Rudolf, Optiker. 

Schmiede 1, Theodor, FabrikbesitzeroPzR^f^OOQlC 
Sehne bei, Ignaz, Kaufmann. ^ 

Schneider, Peter, k. Veterinärarzt. 
Schönner, Georg, jun., Reifs zcußfabrikant. 



57 



323) Herr 

324) 

325) 

326) 

327) 

328) 

329) 

330) 

331) 

332) 

333) 

334) 

335) 

336) 

337) 

338) 

339) 

340) 

341) 

342) 

343) 

344) 

345) 

346) 

347) 

348) 

349) 

350) 

351) 

352) 

353) 

354) 

355) 

356) 

357) 

358) 

359) 

360) 

361) 

362) 

363) 

364) 
365) 
366) 

367) 
368) 
369) 
370) 
371) 
372) 
373) 
374) 
375) 
376) 



Scholler, Friedrich, Hauptagent. 

Schräg, Karl, Hofbachhändler und k. k. östcrr. Konsul. 

Schreiber, Jean, Vergolder und Fabrikant. 

Dr. Seh renk, Friedrich, prakt. Arzt. 

Schröder, Theodor, k. Gymnasialprofessor. 

Dr. Schubert, Paul, prakt. Arzt u. Gemeindebevollmächt. 

Dr. V. Schuh, Georg, I. Bürgermeister der Stadt Nürnberg. 

Schuh, Heinrich, Fabrikbesitzer. 

Schuh, Wilhelm, Apotheker. 

Schultheifs, Friedrich, Apotheker. 

Schultheifs, Veit, städt. Trichinenschauer. 

Schultheifs, Oskar, k. Postofüzial in Nördlingen. 

Schwanhäufser, Gustav, Fabrikbesitzer u. Kommerzienrat. 

Dr. Schwanhäufser, Eduard, Chemiker. 

Schwarz, August, k. Stabsveterinär. 

Schwarztrauber, Johs., k. Veterinär. 

Schwemmer, Christian, rechtsk. Magistratsrat. 

Sebald, Hans, Buchdruckereibesitzer. 

Sebald, Carl, Kalkwerkbesitzer. 

Seel, W., Lehrer in Grofsreuth. 

Seiler, Christoph, Ingenieur und Fabrikbesitzer. 

Dr. Seiler, Hermann, prakt. Arzt. 

Seitz, Georg, Fabrikbesitzer und Kommerzienrat. 

Sichling, Richard, Kaufmann. 

Dr. Siebenhaar, Johann, prakt. Arzt in Gräfenberg. 

Siebentritt, Friedrich, Magazinsverwalter. 

Sieberth, O., Zahnarzt. 

Silbermann, Julius, Kaufmann. 

Simon, Johannes, Lehrer. 

Dr. Simon, May, prakt. Arzt. 

Sommer, Theodor, Chemiker in Fürth. 

Spandel, Erich, Buchdruckereibesitzer. 

Speckhardt, Georg, Bäckermeister. 

Dr. Spoerl, prakt. Arzt in Neumarkt i. O. 

Stadler, Friedrich, Zahntechniker. 

Stahl, Joh. Christ., Kaufmann. 

Stau dt, Erdmann, Fabrikbesitzer und k. Hoflieferant. 

Dr. Steinhard, Ignaz, prakt. Arzt. 

Dr. Steinheimer, Ludwig, prakt. Arzt. 

Dr. Stich, Eduard, Oberarzt und k. Hofrat. 

Dr. Stockmeier, Hans, Vorstand der chemischen Ab- 
teilung des bayer. Gewerbemuseums. 

Stöhr, August, Sekretär a. polyt. Zentral verein in Würzburg. 

von SWansky, Lorenz, Bureaubeamter. 

Dr. Straub, Adolf, I.Assistent an der städt. Untersuchungs- 
anstalt. 

Straus, Simon, Kaufmann. 

Dr. Straufs, Julius, Oberlehrer an der städt. Handelsschule. 

St r aufs, Louis, Kaufmann. 

Straufs, Willy, Kaufmann. 

Dr. Sturm, Jakob, prakt. Arzt in Mögeldorf. 

Süfs, Clemens, Apotheker. 

Tafel, Hermann, Fabrikbesitzer in St. Jobst. C^r\r^n]o 

Tauber, Christ, Baumeister. Digitizedby^^OO^lC 

Thurnauer, Bernhard, Fabrikbesitzer. 

Tölke, Konrad, Kunstgärtner u. Gemeindebevollmächtigter. 



V«.,f«*««« 



58 



378^ Herr Tuchmann, Friedrich, Kaufmann. 

379) » Tuchmann, Max Joseph, Kaufmann. 

380) • Übel, Max, Ass. a. ehem. Lab. der Industrieschule. 

381) » Uhl, Adolf, Kaufmann. 

382) » ülmer, Julius, Direktor der Nürnberger Bank. 

383) » Dr. Ullrich, August, Rektor der höheren Töchterschule 

und k. Schulinspektor. 

Völker, Georg, Kaufmann. 

Voigt, Gustav, Kaufmann. 

Voit, Paul, Kaufmann. 

Voit, Robert, Kaufmann. 

Voit, Rudolf, Schneidermeister. 

VoUhardt, Oskar, k, Advokat und Justizrat. 

Vollrath, Franz, Kaufmann. 

Dr. Wagner, Friedrich, k. Professor in Weihenstephan. 

Waydelin, W. Fr., Kaufmann. 

Webel, Edmund, Fabrikant. 

Dr. Weber, Cornelius, Chemiker am bayer. Gewerbemuseum. 

Dr. Weigel, Karl, prakt. Arzt in Berlin. 

Weigle, Theodor, Apotheker u. Gemeindebevollmächtigter. 

Weil, Philipp, Kaufmann. 

Weinberg er, Max, Fabrikant. 

Weinschenk, Hermann, Kaufmann. 

Weifs, August, Apotheker und Magistratsrat. 

Weifs, Robert, Kaufmann in Chemnitz. 

Dr. Welzel, Karl, prakt. Arzt. 

Wenck, Richard, Buchhändler. 

Wertheimer, Sigmund, Kaufmann. 

Dr. Wiegmann, Dietrich, I. Assistent der Brauereiversuchs- 
station. 

W i e 1 a n d , Peter, Privatier. 

Wieseler, Wilhelm, Kaufmann. 

Wölfel, Konrad, Grofsfleischermeister. 

Wolf, Mathias, k. Postamtsdirektor. 

Wunder, Justin, Chemiker und Fabrikbesitzer. 

Wunder, Ludwig, geprüfter Lehramtskandidat. 

Dr. Zagelmeier, Hans, städt. Sanitätstierarzt. 

Zelt n er, Johannes, Kaufmann und Kommerzienrat. 

Zeltner, Johannes, jun., Kaufmann. 

V. Zenetti, Julius, Ritter, Excellenz, königl. Regierungs- 
präsident a. D. 

Zippelius, August, Kaufmann. 

Dr. Zwanziger, Georg, k. Professor a. d. Industrieschule. 



D. Anrserordentliche Hitglieder. 

1) Herr Dr. Stadlinger, Hermann. 



Digitized by VjOOQ IC 



59 



Vn. Jahresbericht der Sektion für Anthropologie, 
Ethnologie und Urgeschichte. 1899. 

Die Zahl der lulitgiieder belief sich in diesem Jahre auf 35. 
Die Sitzungen, welche wie bisher am ersten Montag eines jeden Monats 
stattfanden, waren gut besucht. Die Thätigkeit der Sektion war 
im Berichtsjahr eine äufserst rege. Aufser zahlreichen Referaten 
und Demonstrationen seien an dieser Stelle vor allen die umfang- 
reichen Ausgrabungen prähistorischer Grabstätten er- 
wähnt, welche fast durchwegs sehr wertvolle und interessante 
Funde lieferten, so dab die dafür aufgewandte MQhe und die nicht 
unerheblichen Kosten reich belohnt wurden. 

Die Grabungen fanden statt: 
1) Am 21.— 23. März. Bei Labersricht (Oberpfalz). 

Nordöstlich der Stadt Neumarkt, in der Nähe des Dörfchens 
Labersricht, zwischen der Friedlmühle und der Bodenmühle, 
liegt im Wiesengrunde eine Gruppe von 8 Grabhügeln. 
Hügel I und II sind von Bäumen bestanden, V, VI und VII 
sind schon in früheren Jahren geöffnet worden und befinden 
sich die dabei gemachten Funde in der Sammlung des 
Germanischen Museums. Hügel III, IV und VIII sind noch 
unberührt Die Grabung galt dem Hügel III. Derselbe hat 
15,8 m Durchmesser und 1,4 m Höhe. Er wurde von der 
Besitzerin jährlich zweimal überackert und hat dadurch einen 
beträchtlichen Teil seiner ursprünglichen Höhe verloren. Bei 
der Abgrabung, welche nach Cohausen vorgenommen wurde, 
zeigte es sich, dafs die untere Hälfte des Hügels aus Steinen, 
die obere aus reinem Sand aufgebaut war. Der Hügel war 
in seiner ganzen Ausdehnung von zwei übereinander gelagerten, 
scharf getrennten homogenen Brandschichten durchzogen. Im 
Verlauf der Grabung wurden aufser Knochenresten (calciniert) 
folgende bedeutende Funde gemacht: 1 Bronzering mit 2 
spiralförmig gekrümmten Fufsansätzen , 10 Urnen, darunter 
ein sehr seltenes Exemplar mit 2 Ösen und einem Deckel, in 
dessen Mitte sich eine Öffnung befindet, 1 Radnadel, Bronze- 
drahtspiralen, 1 Eisenmesser, Feuersteinsplitter und verkohlte 
Früchte (Eicheln). 

Die Funde der unteren Brandschicht gehöM^lMzweifelhaft^ 
der Bronzezeit, die der oberen der Hallstattzeit an. 



60 



2) Am 30. März. Grabung am Hirschberg bei Behringersdorf. 

Der Hügel war regelmäfsig rund, von 9 m Durchmesser und 
V2 m Höhe , aus kleineren und gröfseren Sandsteinen und 
Erde aufgebaut. Bei durchschnittlich 3 m Entfernung von 
der Mitte kam in der Tiefe von 0,9 m eine Brandschicht zum 
Vorschein, die sich durch den ganzen Hügel hindurch zog. 
An Funden wurden gefördert: 

3 Bronzringe, 1 Paukenfibel, 1 Eisenmesser, 1 Armbrust- 
fibel, aufserdem Urnenscherben und calcinierte Knochen. Die 
mächtige Brandschicht und das Fehlen von Knochen ohne 
Feuerspuren läfst auf eine Feuerbestattung schliefsen. Die 
Bronzeringe sind Spiralen, einer der Ringe hat rautenförmigen 
Querschnitt, der andere ist von Bronzedraht 'mit ovalem Quer- 
schnitt, ohne Ornament; der dritte ist schraubenförmig orna- 
mentiert, wobei die Schraube immer einen Gang überspringt 
Der Hügel gehört der Hallstattzeit an. 

Herrn Forstmeister Kadner, der die Güte hatte, den Hügel 
der Sektion zur Ausgrabung zu überweisen, sei an dieser 
Stelle der beste Dank hiefür ausgesprochen. 

3) Am 24. August. Grabung bei Hammer. 

Auf Anregung des Herrn Dr. Naue veranstaltete die Sektion 
eine gründliche Durchsuchung des Ackers, auf welchem sich 
vor etwa zehn Jahren das in unseren Sammlungen befindliche, 
schöne Bronzeschwert durch einen Zufall gefunden hatte. 
Von einem vorbeiziehenden Rainweg aus wurde der Acker 
in einer 7 m breiten Front angegraben. Durch das ganze 
umgearbeitete Gebiet zog sich eine kontinuirliche Brandschicht, 
welche sich wahrscheinlich durch den ganzen Acker erstreckt. 
Der Sand über der Brandschicht war vom Feuer gerötet und 
diese etwa 5 m im Durchmesser haltende Stelle ergab calcinierte 
Knochenreste, eine Radnadel, ein Bronzemesser und ziemlich 
viele, leider nicht zusammensetzbare Topfscherben. 

Die Radnadel ist 23 cm lang, das Rad hat 5 cm Durch- 
messer und besteht aus zwei Kreisen, deren äufserer in eine 
Öse von dreieckigem Lumen endigt. Die Nadel ist 3 mm 
dick, von aufserordentlich schöner Form und Arbeit Das 
Messer ist zweischneidig, mit fast parallelen, erst an der 
Spitze zusammenlaufenden Schneiden, mit erhabener Mittel- 
rippe. Die Klinge ist 9 cm lang, der Griff 8,7 cm. Der 
Griff, mit der Klinge in einem Stück gegossen, ist durch- 



61 



brochen gearbeitet, von seltener Form. — Radnadel und Messer 
lagen 4 m von- einander entfernt, die Mitte zwischen beiden 
ist noch etwa 12 m von der Fundstelle jenes Bronzeschwertes 
entfernt. 

4) Am 26. August. Grabung im Waldteil Vogelherd bei 

Weifsenbrunn. 

Nachdem von der aus drei kleinen Hügeln bestehenden 
Nekropole Hügel I bereits im August 1897 von der Gesell- 
schaft abgegraben worden war und aufser Topfscherben, be- 
statteten (d. h. nicht calcinierten) Knochen und einem kleinen 
Bronzearmring keine für die Feststellung seines Alters ver- 
wendbaren Funde ergeben hatte, wurden am genannten Tag 
die beiden übrigen Hügel abgegraben. Beide Hügel waren 
ganz niedrig aus Jurakalkplatten aufgeschichtet, welche durch 
wenig lockeren Humus lose verbunden waren. 

Hügel n war rund, von 7 m Durchmesser und 0,5 m Höhe. 
Er ergab nur Reste bestatteter Knochen und wenige Scherb- 
chen aus sandfreiem Thon. 

Hügel III war rund, halte 13 m Durchmesser und an- 
scheinend 1,2 m Höhe. Schon am Umfang fanden sich be- 
stattete Knochen; im Ganzen konnten die Reste von fünf 
bestatteten Leichen festgestellt werden. Kohlen oder Brand- 
spuren fehlten vollständig. Bei einer Leiche befand sich ein 
Bronzedrahtring von 3^/j cm Durchmesser mit schleifenartig 
umgebogenen Enden, bei einer benachbarten Leiche ein Bronze- 
dolch; derselbe ist zweischneidig, mit Mittelgrat, spitzzulaufend; 
das andere Ende der 12 cm langen, nur aus einer Klinge 
bestehenden Waffe ist flach abgeschnitten und hat keine 
Nietlöcher; da dasselbe zugeschärft ist, war er jedenfalls in 
einen hölzernen Griff eingekeilt. Wir haben es hier wahr- 
scheinlich mit einer der ältesten Dolchformen zu thun. 

5) Am 30. und 31. August. Ausgrabung des Grabhügels VIII 

bei Labersricht. 

Der Hügel hatte 13 m Durchmesser und 1,2 m Höhe und 
war aus lehmigem Sand errichtet, mit stellenweise eingelagerten 
Nestern von Dolomitsteinen Durch den ganzen Hügel zogen 
sich zwei scharf getrennte Brandschichten in 0,50 
und 1,00 m Tiefe unter der Oberfläche. Die untere Brand-r 
schichte enthielt vier beslaltete Leichen mit folgenden, der 
Bronzezeit angehörigen Funden: 



62 



1. neben einer Leiche, am Umfang des Hügels, eine Bronze- 
nadel mit massivem, darch Striche ornamentiertem Kopf, 
20 cm lang; 

2. bei einer 2Vs m von der Mitte entfernten Leiche zwei 
Nadeln von 20 cm Länge mit ösenartig umgebogenem, 
verbreitertem Ende; 

3. nahe der Mitte: zwei Radnadeln mit einfachem Kreis und 
endständiger Öse, ältere Form; daneben Schulterblatt und 
Schlüsselbein ; an den Unterarmen derselben Leiche je zwei 
massive, breite, nicht geschlossene Armbänder mit schönen 
Strichornamenten, aus Bronze. In der Nähe ein mit zwei 
Schnurhenkeln versehenes Gefäfs aus sandfreiem Thon, 
mit steilem Hals; 

4. bei einer 4 m von der Mitte entfernten Leiche: ein kleiner 
Bronzedrahtarmring, 32 getriebene Bronzezierbuckeln mit 
je zwei Schnurlöchern, zwei kleine Bernsteinringlein von 
2 und 3 mm Durchmesser. In der Nähe eine schön 
ornamentierte, leider nicht ganz restaurierbare Schale mit 
Fufs, aus sandfreiem Thon. 

Die Leichen der unteren Brandschichte waren durchweg be- 
stattet, nicht verbrannt 

Die obere Brandschichte enthielt folgende, der Hallstattzeit 
angehörigen Funde: 

1. ganz am Umfang eine grofse, graphitierte Urne mit calcinierten 
Knochenresten; in der Nähe vermoderte Eicheln (vgl. 
Hügel UI); 

2. nahe der Mitte: neun grofse, ovale Bronzehohlringe mit 
ineinander gesteckten Enden; mit Strichen, Punkten und 
Kreisen sehr schön ornamentiert. In der Nähe graphitierte 
Scherben ; 

3. eine eiserne Gürtelschnalle mit anhängender Bronzespur; 
ein kleines Bronzeknöpfchen ; zwei tonnenförmige Bernstein- 
perlen, durchbohrt, IVs cm lang. 

Die Leichen der oberen Brandschicht waren, soweit erkennbar, 
verbrannt worden. 

Die bei den Grabungen geförderten Funde wurden der Sammlung 
der Naturhistorischen Gesellschaft einverleibt, welche dadurch eine 
wertvolle Bereicherung erfuhr. 

Seitens der Sektion wurde bei der Muttergesellschaft der 
Antrag gestellt, auch Nichtmitglieder der Naturhistorischen Gellschaft 



63 



als aufserordentliche Mitglieder einer Sektion zuzulassen. 
Die Generalversammlung vom 21. Juni beschloüs, dem Antrag statt- 
zugeben und die Statuten der Gesellschaft in diesem Sinne abzu- 
ändern. Die Sektion erhofft dadurch, das Interesse für die prä- 
historische Forschung in weitere Kreise zu tragen und neue that- 
kräftige Mitarbeiter der »Wissenschaft des Spatenst zuzuführen. 

Den Herren Wunder sr. und jr., welche auch heuer wieder 
den gröfsten Teil der Ausgrabungen, mit anerkennenswertem Eifer 
and Geschick leiteten, die Fundberichte in ausführlichster und 
instruktiver Weise ausarbeiteten und die Vermessungen einer Reihe 
Ton Grabhügeln vornahmen, sei an dieser Stelle der wärmste Dank 
der Sektion ausgesprochen. 

Der Lesezirkel, welcher die Sektionsmitglieder stets über die 
neuesten Forschungen und die Fachlitteratur orientiert, wurdB auch 
in diesem Jahre vielfach und gerne benützt 
In der Geschäflssitzung wurden gewählt: 
Als Obmann: Herr Dr. von Forster, 
Als Schriftführer: Herr F. H. Hub er, 
Ab Kassier: Herr Veit Schultheifs. 
Nürnberg, Dezember 1899. 

F. H. Huber, 
Schriftführer. 



Vm Jahresbericht der botanischen Sektion 
pro 1899. 

Die Zahl der Mitglieder betrug bei Beginn des Jahres 26 ; im 
Laufe desselben trat Herr Dr. Fr. Küsperl, k. Reallehrer, in 
dieselbe ein^ während 1 Mitglied, Herr Rechtsrat Schwemmer, ihr 
durch den Tod entrissen wurde. In dem Verstorbenen verliert die 
Sektion eines ihrer treuesten und verdienstvollsten Mitgliedes; er 
gehörte derselben seit ihrer Gründung an und bewahrte bis zuletzt 
das gleiche warme Interesse an ihren Bestrebungen, so da£s er sich 
weder durch sein hohes Alter, noch durch jeweilige Unbill der 
Witterung vom regelmäCsigen Besuch der Sitzungen abhalten liefs. Ic 
Am Schluls des Jahres zählt die Sektion 26 Mitglieder. ^ 



64 



Die Vorstandschaft blieb dieselbe wie im Vorjahr. Die Sektion 
hielt folgende Zeitschriften: 

Uhlworm, bot. Zentralblatt; Leimbach, deutsche bot. Monats- 
schrift; Kneucker, aligem. bot. Zeitschrift; Wettstein, österr. bot. 
Zeitschrift; aufser diesen zirkulierten noch Rosenthal, biolog. Zentral- 
blatt; Prometheus; Wiener und Grazer Gartenzeitung. Neu an- 
geschafft wurden: Schuhmann, Kakteen; Strafsburger, Reduktions- 
teilung, Spindelbildung etc.; Bruckmann, Prothallien der Lycopodi- 
aceen; Sendtner, Vegetationsverhältnisse von Südbayern; Potoni^, 
Morpholog. Herkunft der Blätter; Schleichert: Pflanzenphysiolog, 
Versuche im Winter; Beiblatt zu Kneuckers bot Zeitschrift; in 
Fortsetzung blieb: Ascherson und Gräbner, Synopsis der mittel- 
europäischen Flora; Potoni6, Pflanzenpaläontologie kam zum Ab- 
schlufs. Geschenkt wurden: Von Herrn Stabsveterinär Schwarz: 
Heil-, Gift- nnd Nutzpflanzen für Mittelschulen; Dr. Appel, Referat 
über Herstellung von Kindermilch; ferner eine Serie Sonderabdrucke 
von Referaten des f ^roL Dr. Knuth (Kiel), Blütenbiologie und 
Phänologie betr.; Prof. Dr. Magnus, Referat über einen Mehlthau- 
pilz auf Caragana arborescens; Spandel, Mehrere Nummern des 
General-Anzeigers mit phänolog. Berichten des Herrn Schultheifs; 
Pfarrer Rudel, Fiori e Paoletti, flora analitica dltalia, Bd. 1. An 
dieser Stelle darf nicht unerwähnt bleiben, dafs die Schwester des 
verstorbenen Mitglieds, Herrn Rechtsrat Schwemm er, Frau Fabrik- 
besitzerswitwe Gechter, den gesamten Nachlafs ihres Bruders, 
soweit er botanischen Inhalts ist, der Gesellschaft überliefs; derselbe 
besteht aus einem Herbar und einer grofsen Anzahl gröfserer und 
kleinerer Werke, darunter das umfangreiche illustrierte Werk von 
Schlechtenthal und Hallier. In Folge zahlreicher Zuwendungen 
wurde das Lokalherbar der Nürnberger Flora vom Obmann einer 
Umarbeitung unterzogen, wodurch sich der Umfang desselben auf 
das 4 — 5 fache vermehrt hat. Auch zum bayr. Landesherbar wie 
zum allgemeinen Herbar sind viele Zugänge zu verzeichnen. 

Verschiedene Mitglieder setzten die Sammlung parasitärer 
Pilze eifrig fort; dieselben werden von Herrn Prof. Dr. Magnus 
in Berlin zur Zeit bearbeitet. Auch den Grofspilzen wurde erhöhte 
Aufmerksamkeit zugewendet, wozu namentlich die beiden Spätherbst- 
exkursionen auf den Heidenberg hei Schwabach Anlafs gaben. Be- 
züglich der Lokalflora wurden wieder Gebiete, die bisher wenig durch- 
gearbeitet waren, aufgesucht, so die Gegend von Allersberg und 
Freysladl, sowie dieUmgebung von Spalt, welch letzfere sich besonders 



65 



dankbar erwies. Die Beobachtong der Ruderal- und Adventivfiora ergab 
wieder interessante Funde, so insbesondere das Auftreten von 
Solanum rostratum an mehreren Plätzen. Die ph&nologischen Daten 
worden wie bisher von Herrn Fr. Schultheifs gewissenhaft 
registriert Erireuhcher Weise fand auch die allgemeine Botanik 
Berücksichtigung durch mehrere Referate und Demonstrationen seitens 
des Herrn Dr. Küspert 

Von der Flora von Nürnberg und Erlangen hat der Verfasser 
die Calycifloren zum Abschluls gebracht In den allgemeinen 
Gesellschaftssitzungen wurden mehrfach Vorträge botan. Inhalts 
gebracht, so von Herrn Privatdozent Dr. Glück in Heidelberg über 
Sü&wasseralgen und über die Prothallien der Lycopodiaceen; von 
Herrn Erhard über pflanzliche Droguen aus Amerika und Indien; 
TOD Herrn Dr.Küspert über Schleimpilze ; von Herrn Schwarz über 
die Flora von Georgensgemünd, Spalt und Pleinfeld. Die Anwesen- 
heit des Herrn Dr. Glück veranlafste zwei Exkursionen in die Um- 
gebung des Dutzendteichs und Valznerweihers; aufserdem beteiligten 
sich an den Vereinsausflügen die Mitglieder der Sektion in stattlicher 
Anzahl. 

Der Verkehr mit auswärtigen Botanikern war in diesem Jahr 
besonders lebhaft; so erfreuten uns die Herren Dr. Appel von 
Berlin und Privatdoc. Dr. Glück von Heidelberg durch persönlichen 
Besuch und interessante Referate, während im brieflichen Verkehr 
nicht nur die früheren Beziehungen fortgesetzt, sondern auch neue 
angeknüpft wurden, z. B. mit Herrn Lycealprofessor Dr. Fischer 
in Bamberg und mit dem thüringischen botanischen Verein; der 
Tauschverkehr mit botanischen Gesellschaften hat sich weiter 
gemehrt. 

In den 18 Sitzungen wurden folgende Referate geliefert: 
Herr Dr. Appel: Ober Phleum Böhmeri v. ciliata und blepharodes 
Ascherson; über Nectria cinnabarina; über die Aufgabe der 
botan. Abteilung des kaiserl. Gesundheitsamts in Berlin. 

» Dr. Buch n er: Botanische Wanderungen in den Dolomiten; 
über Calycanthus floridus und occidentalis, Cananga odorata 
und Himnanthus praecox; über Rhododendron ferrugineum 
hier in Blüte; über Pelorienbildung bei hier kultivierten 
Exemplaren von Digitalis purpurea; über Abies Douglasi im 
Stadtpark. 

» Erhard: Ober die Flora von Südtyrol; übg^''^^^' 
Alchemilla. 



66 

Herr Dr. Heerwagen: Ober Colchicum byzantinum, als gärtnerische 
Zierpflanze ; Demonstration eines Fruchtstandes von Helianthas 
annuus von riesiger Gröüse und eines Exemplars von Euphorbia 
Lathyris. 

» Grofs: Ober Potentilla norvegica und Abies Douglasi (Herm- 
hütte) ; über Dianthus atrorubens von Sodenberg bei Hammel- 
burg; Demonstration von Fruchtständen von Cedrus Libani, 
Pinus maritima und Culteri (Riviera). 

» Kaulfufs: Ober adventiv aufgetretene Kochia scoparia; 

über die Gattung Blechnum und deren mannigfaltige Varietäten; 

über Equisetum silvaticum v. polystachium (Erlenstegen); über 

verschiedene Laubmoose, Timmia bavarica, aufgefunden von 

Herrn Schwanz. 
» Kinkel in: Ober Fritillaria Meleagris; über Früchte und 

Pflanzen aus Palästina und Griechenland; über Armillaria 

mellea, Halimasch, von der Hallerwiese. 
» Dr. Küspert: Ober Schleimpilze und über Kernteilung mit 

Zeichnungen und mikroskopischen Demonstrationen. 

» Paalzow: Ober die Flora des Zechsteins bei Pöfsneck und 
Gera, sowie der Trias bei St. Cassian. 

» Prell: Ober die Flora des Contrin und der Marmolata. 

> Rodler: Ober die Flora von Karlsbad und Marienbad, sowie 
des Keilberg im Erzgebirg; über die Ruderalflora Nürnbergs; 
über die Flora des oberpfölzer Jura; über Orobanche ramosa 
auf Meerrettig bei Baiersdorf; über Rhytisma acerinum; über 
die Flora von Südtyrol; über Aster spec? (Mögeldorf); 
Demonstration eines Fruchtstandes von Araucaria brasUiensis, 
Geschenk von Herrn Fr. Barbeck. 

» Rudel: Ober Ceterach offincinarum in die Mauern eines Burg- 
gärtchens verpflanzt und dort gut gedeihend; über 2 ausländische 
im Schloüsgarten von Abenberg verwilderte Alyssum-Arten. 

> Fr. SchuUheifs: Ober die Flora von Nürnberg; über 
Vaccinium intermedium; Alsine viscosa, neu für hier (Red- 
nitzthal); Nasturtium amphibium, silvaticum und anceps 
(Stein); über eine Aster-Species zu Gebersdorf; über Phänologie. 

» V. SchuUheifs: Demonstration verschiedener Sukkulenten 
und Rosettenkübis; über Scilla maritima und^ Ornithogalum 
arabicum; über parasitäre Pilze. oigitizedbyLjC ^ 



67 



Herr Schwarz: Ober die Flora von Plech und Auerbach, der 
unteren Aisch, des Bamberger und des Hersbrucker Jura, 
von Georgensgmund, Spalt und Pleinfeld; über Monotropa 
hypopitys in karminroter Varietät; Elymus arenarius, an- 
gepflanzt und verwildert bei Bemlohe; über die Gattung 
Calamagrostis mit Skioptikon-Demonstrationen; über Anchusa 
ochroleuca; Batrachium aquatile in seinen verschiedenen 
Formen; Pirola media (Plech) ; Vicia villosa und glabrescens, 
letztere als selbständige Species; über parasitäre Pilze; über 
am Heidenberge bei Schwabach kultivierte ausländische 
Coniferen (Abies Douglasi); über Azolla filiculoides, bei 
Baiersdorf aufgetreten; über Agaricus phalloides (Kontumaz- 
garten); Vorlage einer groüsen Anzahl pflanzengeographischer 
Verbreitungskärtchen; über den jeweiligen literarischen Einlauf. 
> Schwemmer: Über Calycanthus praecox, Strelizia Reginae 
Amaliae und Gossypium herbaceum aus Pompeji. 
Schliefslich spricht die Sektion der Gesellschaft für die ge- 
währte finanzielle Unterstützung, der Redaktion des General-Anzeigers 
aber für die unentgeltliche Aufnahme der Einladungen zu den 
Sitzungen den ergebensten Dank aus. 

W. Rudel. 



IX. Jahresbericht der Geographischen Sektion. 

Die Anzahl der Mitglieder betrug am Anfang des Jahres 29 ; 
leider verlor die Sektion durch den Tod des Herrn Dr. A. Lessing 
ein treues Mitglied, so dafs sie am Ende des Jahres 28 Mitglieder 
zählte. Die Sektion trat stets am dritten Montag im Monat zu- 
sammen und hielt 11 Sitzungen ab, welche teils durch Vorträge, 
teils durch Referate aus der Fachliteratur und Diskussionen aus- 
gefüllt wurden. 

Die Tagesordnung der einzelnen Sitzungen war folgende: 
19. Dezember: Dr. Heerwagen: Referat über »Der Ursprung der 

afrikanischen Kulturen« nach Frobenius. 
16. Januar: Postamtsdirektor Schmidt: Referat aus Jung »Seelen- 
leben der Buschmänner Australiens«, sowie aus Ose. Low 
»Die Mohavewüste«. 
Hörmann: über »Englische Kolonialverwaltung« aus Hibbe- 
Schleiden. 



68 



20. Februar: Diskussion über die Frage, ob auüserordentliche Mit- 
glieder in die Sektionen aufgenommen werden können. 
Kinkel in: über seinen Besuch zweier Gräber in der libischen 
Wüste. 
20. März: Obermayer: über »Die Entdeckung von Amerika durch 
die Nordgermanen« aus der Islendingabök. 
Schmidt: über »Der Raiserkanal in China«, sowie »Ent- 
deckung des Naphtas« aus Archiv für Post und Telegraphie. 
17. April: Kinkelin: Verlesung einer grofsen Zahl Ansichtskarten 
aus Australien, sowie Vorzeigung von Photographien und 
Bildern. 
Schmidt: Referat über »Bewässerung Südafrikas« und »Be- 
grüdsungsformen der Wahehe.« 

15. Mai: Obermayer: über seine letzte italienische Reise unter 

gleichzeitiger Vorlage einer Anzahl Photographien. 
Enslin: Vorlage von Bildern der Goldküste und Madeira. 
Schmidt: über »Die Insel Sakhalin und die Gefangenen auf 

derselben« , sowie über »Geographische Ursachen von 

Spaniens Niedergang«. 

19. Juni: Paetzold als Gast: Vortrag über seinen Aufenthalt in 

Togo und der Goldküste unter gleichzeitiger Vorlage von 
Gebrauchsgegenständen und Photographien. 
Schmidt: Referat aus der Kolonialzeitung über »Handels- 
schwierigkeiten mit den Engländern in Togo«. 

17. Juli: Obermayer: über »Wie man in Italien reist«. Es wird 

beschlossen, im kommenden Monat keine Sitzung abzuhalten. 

18. September: Diskussion über die Hochwasserberichte in den 

Alpen. 

16. Oktober: Obermayer: Vorlage eines Briefes aus Bombay, der 

die Thätigkeit einer Missionarin während der Pestzeit 
behandelt. 
Diskussion über die Feldzugsberichte in Südafrika. 

20. November: Schmidt: Referat aus dem Archiv für Post und 

Telegraphie über »Das Eisenbahnnetz der Erde«, »das 
Pferd in China«, sowie »Neue Pläne zur Bewässerung von 
Ägypten«. 

Für die Gesellschaftsbibliothek wurden auch heuer wieder 
aus Sektionsmitteln beschafft: 

Verhandlungen der Gesellschaft für Erdkunde, Berlin, Ic 
Zeitschrift derselben Gesellschaft, ^ 



69 



Deutsche Kolonialzeitang, 
Geographisches Jahrbuch XXI. Band. 
Ferner erfuhr sie Erweiterung durch Anschaffung des neuen 
Andreeschen Handatlas, sowie durch Schenkung von »Hübners 
Statistischen Tabellen« durch Herrn Hofbuchhändler Schräg. 

In der Geschäftssitzung lehnte der bisherige Obmann der 
Sektion Herr Professor Dr. Heerwagen, sowie der seitherige 
Schriftführer Herr Hör mann eine Wiederwahl ab und wurden 
daher gewählt: 

als Obmann: Herr Postamtsdirektor A. Schmidt, 
» Kassier: Herr Heinrich Enslin, 
» Schriftführer: Herr Th. Obermayer. 
Nürnberg, Dezember 1899. 

Th. Obermayer. 



X. Bericht aber die Thätigkeit der chemischen 

Sektion. 

Im Jahre 1899 wurden seitens der Sektion 11 ordentliche 
und eine auTserordentliche Sitzung veranstaltet. Die letztere be- 
schäftigte sich ausschliefslich mit der Formulierung und Begründung 
des an die Muttergesellschaft zu richtenden Antrags, die Aufnahme 
Ton auDserordentlichen Mitgliedern betreffend. 

Der Zahl von 12 Sitzungen in diesem Jahre steht die von 9 
im vergangenen gegenüber. 

Das Stiftungsfest fand am 18. Februar 1899 im Saale des 
Hotel ^ Roter Hahn« statt und zwar waren 32 Mitglieder und Gäste 
erschienen, um sich an den zahlreichen humoristischen Vorträgen, 
sowie an der mitteb Skioptikons bewerkstelligten Vorführung kolo- 
rierter Photographien von italienischen Städten und Landschaften 
zu erfreuen. Um letzteren Punkt des Programms machten sich die 
Herrn Dr. Metzger und Kunstmaler Raum verdient. Eine Festschrift, 
herausgegeben von der aus den Herrn Apotheker Peters, Dr. 
Lessing und Dr. Metzger bestehenden Vergnügungskommission 
sorgte für das Andenken an den gelungenen Abend. C^nc\o]c> 

Die Gesamtsumme der in den elf Sitzungen gebrsüchlen vor- 
trage, Referate und Demonstrationen betrug 21 und verteilte sich 



70 



auf 15 Referenten; von den Themen waren 11 wissenschaftlichen 
und 10 technischen Inhalts. 

Der Besuch der Sitzungen ist gegen das Vorjahr bedeutend 
zurückgegangen : 

1898 1899 

Höchste Mitgliederzahl 51 31 

Niedrigste » 19 14 

Mittlere » 30 19 

Als regelmäfsige Gäste wohnten den Sitzungen bei die Herren 
Assistenten der staatlich subventionierten Brauereiversuchsstation, 
sowie die Schüler des zweiten Kurses der chemischen Abteilung 
der kgl. Industrieschule. 

Die Tagesordnung der einzelnen Sitzungsabende gestaltete 
sich wie folgt: 
10. Januar: Dr. Metzger: Ein neues Denaturierungsmittel. 

» » » Neuerung in der Schnellessigfabrikation. 

» » » Ober Karbide. 

» » Dr. Raum: Demonstration von Kupfermineralien. 

24. Januar: Dr. Syr^e: Über den Konkurrenzkampf der Saccharo- 

myceten. 
* » Dr. Straub: Demonstration von Carborundum und 

daraus hergestellten Gegenständen. 
28. Februar: Dr. Landsberg: Künstliche Darstellung von Indigo. 
14. März: Dr. Drev erhoff: Über Sarcina im Haushalt der Natur. 
» » Dr. Prior: Das Vorkommen der Sarcina im Bier. 
» » » » Demonstration elektrischer Heizapparate. 

25. April: Inspektor Schlegel: Indikatoren in der Alkalimetrie. 

» » » »Die Weinfrage im Sinne des 

Weingesetzes von 1892. 

9. Mai: Dr. Stockmeier: Die Fortschritte der chemischen 

Metallbearbeitung und verwandter Zweige im Jahre 1898. 

» » Dr. Lessing: Demonstration von Carborundumkrystallen. 

10. Oktob.: Dr. Guggenheimer: Über die neueren Theorien in 

der Elektrolyse. 
24. » Dr. Metzger: Über die neuen Ramsay'schen Elemente. 
» > Dr. Stadlinger: Goldvorkommen in Transvaal. 
14. Nov.: Inspektor Schlegel: Über den jetzigen^ Stand ^ der 

Acctylenfrage. ° 9' '^^^ ^^ L^OO^le 

» » Dr. Küspert: Metallverbindungen des Acetylens. 



71 



28. Nov.: Apotheker Schlegel: Steinsalzvorkommen und Bohr- 

versuche in Burgbernheim. 
13. Dezbr.r Fabrikbes. Sc hmidel: Atom und Molekulargravitationen 
I. Teil. 
Am 12. Juli verlor die Sektion durch den Tod Herrn Dr. 
Lessing; des weiteren sind 3 Mitglieder wegen Aufenthaltsver- 
änderung ausgetreten. 

Diesem Verlust steht ein Zugang von 4 Mitgliedern gegenüber, 
so dafs der gegenwärtige Stand der Mitgliederzahl wie zu Anfang 
39 beträgt. 

Der I. Obmann : 

Inspektor H. Schlegel. 



XL Zweiter Jahresbericht der zoologischen 
Sektion 1899. 

Die Mitgliederzahl der Sektion erfuhr im Laufe des Berichts- 
jahres einen Zuwachs von 2 weiteren Mitgliedern, so dafs deren 
Stand nunmehr 21 beträgt 

In 9 ordentlichen Sitzungen wurden folgende Referate, De- 
monstrationen und Vorträge erstattet: 

I. am 6. Januar 1899: 

Herr Spandel demonstrierte Xerophilen, die er auf dem Wege 
von Neiikirchen über Schnaittach nach dem Rothenberg in 
diluvialem Sande gefunden hat, nämlich Xerophila candidula 
und candicans, sowie Xerophila ericetorum aus dem Dogger 
auf dem Rothenberg, femer Pomatias septemspiralis und 
Tachea sylvatica, beide vom Vierwaldstätter-See. 
> Paalzow besprach die geographische Verbreitung des Elens 
nach einer Arbeit von Greve, ferner einen Aufsatz über die 
Seeschlange und eine Abhandlung über den Ameisenfang der 
Galgenspinne. 

II. am 17. Februar 1899 : 

Herr Paalzow besprach eine Arbeit von Hennicke über »Star- 
bildung durch Abschiefsen einer Stange, resp. Sprosse vom 
Gehörn eines Rehbockes«, ferner eine Arbeit von Köhler über 
»Reineke Fuchs in Fabel und Volksglauben der Ostasiaten«, 
und demonstrierte sodann Korallen aus dem oberen weifse»^ 
Jura. 



72 



Herr Dr. Heer wagen referierte über eine Arbeit von Keller: 
»Zur Ornithologie der Somaliländer.« 

UI. am 14. April 1899: 
Herr Wunder jun. hielt einen Vortrag über »Entwickelung und 
Funktion des Darmkanales« unter Vorführung von Projektions- 
bildern. 

» Paalzow demonstrierte Phylloceras heterophyllum aus der 
Posidonienschichte. 

» Kinkelin demonstrierte 3 Exemplare von Chamäleon vulgaris. 

IV. am 19. Mai 1899: 

Herr Paalzow demonstrierte Trigonien aus dem Zechstein, der 
Trias, dem Dogger und der Kreide und besprach die Arbeit 
Reinck^ »Über das Wesen der Organisation.« 
» Dr. Heerwagen demonstrierte einen Cocon von Agröca 
linotina. 

V. am 16. Juni 1899: 

Herr Paalzow besprach eine Arbeit von Leog über »Das Leben 
der Frösche unter dem Wasser« und erläuterte sodann die 
tertiären Ablagerungen des sogen. Wiener Beckens unter 
Demonstration einer groben Anzahl von Fossilien aus diesen 
Schichten. 

» Webel zeigte Schmuckkäfer aus Brasilien und eine Kreuzotter. 

» Paalzow zeigte Helix arbustorum, eine Schnecke aus dem 
Kalktuff bei Würgau und referierte über eine Arbeit von 
Karl Sajo über die San Jos^-Schildlaus. 

VL am 15. September 1899: 
Herr Wunder jun. hielt einen Vortrag über »Die Entwickelung 

des Blutkreislaufes bei den Wirbeltieren.« 
» Paalzow demonstrierte Harpoceratiten, Phylloceratiten und 

Belemniten. 
» Dr. Heerwagen zeigte ein Stück Bernstein mit sehr schönem 

Käfereinschlufs. 

Vn. am 20. Oktober 1899: 
Herr Paalzow besprach eine Abhandlung aus der Zeitschrift 
Prometheus über die 17 jährige Cikade und demonstrierte eine 
gröfsere Anzahl von Fossilien. 

» Kinkelin zeigte eine als Geschenk für die Sammlung be- 
stimmte junge Wildkatze aus Bundaberg in Queensland und 
berichtete über seinen Besuch des Aquariums in Neapel. 



73 



Vm. am 17. November 1899: 
Herr Dr. Heerwagen demonstrierte die als Geschenk des Herrn 

Benda in Australien übersandten farbenprächtigen Vögel 

nebst Eiern. 
> Kaulfufs zeigte Schmetterlinge und Raupen aus seiner 

Sammlung. 
» Paalzow berichtete über die Entwickelung der Paläontologie 

nach dem Werke von Zittel. 

IX. am 15. Dezember 1899 : 
Herr Paalzow besprach eine Arbeit aus dem Prometheus über 
das noch lebende Riesenfaultier und verliest eine französische 
Arbeit über Echiniden unter Demonstration von Präparaten 
aus seiner Sammlung. 

Für die Bibliothek der Sektion wurde angekauft: Zittel, 
Geschichte der Geologie und Paläontologie. 

Als Beitrag erhielt die Sektion 60 Mark aus den Mitteln der 
sehr verehrlichen naturhistorischen Gesellschaft, wofür an dieser 
Steile der beste Dank ausgesprochen wird; desgleichen schuldet 
auch heuer wieder die Sektion Herrn Spandel ihren Dank für die 
unentgeltliche Aufnahme der Annoncen im General-Anzeiger. 

Rieh. Paalzow Karl Hellmuth 

Obmann. Schriftführer. 



Digitized by VjOOQ IC 



74 



Zugänge zur Bibliothek 

vom 1. Januar bis 81. Dezember 1899. 



Psnodiea: 

— Arehk) für ÄtUhropologie, 26. Band. Heft I, IL (von der 

Naturh. Gesellschaft angeschafft). 
3270. — Beiträge z. Anthropologie u. Urgescfüehte Bayerns, 12. Bd., 
III. n. lY. Heft (von d. anthrop. Sektion angesch.). 

— Ceniralblatt /. Anthropologie, Ethnologie «. Urgeschichte 

(von d. anthrop. Sekt, angesch.). 

— Limesblatt (v. d. anthrop. Sekt, angesch.). 

— Zeitschrift f. Ethnologie, 80. Jahrg. 1898, Heft VI; 31. 

Jahrg. 1899, Heft I. (v. d. Naturh. Gesellsch. angesch.) 

— Globus, 75. u. 76. Bd. (v. d. Natorhist. Gesellsch. angesch.) 

— Nachrichten Ober deutsche AUertum^unde, 9. Jahrg. 1898, 

Heft 6; 10. Jahrg. 1899, Heft 1. (v. d. anthrop. Sekt 
angesch.) 

— Geographische Zeitsehrift von Hettner, V. Jahrg. 1899 (v. 

d. Naturh. GeseUsch. angesch.). 
3257. ~ Geographisches Jahrbuch , XXI. Bd. 1898 (v. d. geogr. 

Sektion angesch.). 
3260. — Deutsche Kolonialzeitung, 16. Jahrg. 1899, Nr. 1—24, 

27—43 (v. d. geogr. Sektion angesch.). 

— Petermanns Mitteilungen, 45. Bd. 1899, 1— IX. (▼. d. Naturh. 

Gesellsch. angesch.). 

— — , Erg&nzungshefte Nr. 127—130 (v. d. Naturh. Ge- 
sellsch. angesch.). 

— Zeitschrift d. Gesellschaft f Erdkfmde zu Berlin, 33. Bd. 

1898. Heft 5, 6; 34. Bd. 1899. Heft 1-3. (v. d. geogr. 
Sektion angesch.) 

— Verhandlungen d. Gesellschaft f. Erdkunde zu Berlin, 

26. Bd. 1899 Nr. 1-6. (v. d. geogr. Sekt angesch.) 

— Prometheus, Nr. 481—532. (v. d. Naturhistor. Gesellsch. 

angesch.) 

— NaturwissenschfrfiUche Rundechau von Sklarek, XIV . Jahrg. 

1899 (v. d. Naturh. Gesellsch. angesch.) 

— Biologisches CentralblaU, XIX. Bd. 1899, Nr. 1—24 (▼. 

d. Naturh. Gesellsch. angesch.). 

— Botanisches Centralblatt, 76. Bd.; 77. Bd.; 78. Bd. Nr. 

1—11 (v. d. botan. Sektion angesch.) 

— Deutsche botan. Monatsschrift, 16. Jahrg. 1898 Heft 6—12 ; 

17. Jahrg. 1899 Heft 1—3 (▼. d. botan. Sekt ang.). 



75 



Pmodiea: 
3213. Oesierr. botan. ZeUmihrift, XLVIU. Jahrg. 1898, Nr. 6—12 ; 

XLIX. Jahrg. 1899 Nr. 1—4. (v. d. hotan. Sektion 
angesch.) 

— ÄUgemeine boianitche ZeiUekrifi v. Ä. Kneucker, 1898 

Nr. 6—12; 1899 Nr. 1—4. (v. d. hotan. Sekt, ang.) 

— Der Zoologisehe Garten, XL. Jahrg. 1898 Nr. 1—12 (v. 

d. zoolog. Sekt, angesch.). 

— ZeUeehrift /. anorgan. Chemie, Heft 4—6 des Xyi.Bd8.; 

XVII. Bd.; XVIII. Bd.; Heft 1 d. XIX. Bds.; (v. d. 
ehem. Sekt, angesch.) 
3314. - Bericht über die WiUertmge- und KrankheilsverhäUnisee 
Nürnbergs, Januar— Oktoher 1899. (Geschenk der 
meteorol. Station.) 



Abromeii, J., s. Königsberg, Prenfs. Botan. Ver. 

3850. Ahles, Dr,, AUgem. verbreitete efsbare und sehädl. Pilze m. einig, 
mikrosk. Zergliederungen a. erläuternd. Text, z. Gebr. in 
Schule u. Haus. II. Teil von: Unsere wichtigeren Gift- 
gewächse, kl. fol. 14 S. u. XXX färb. Taf. 1876. Efslingen. 

3818. Ammon, Karl Wilh., J. B. Yon Sind's sicher u. geschwind hei- 
lender Pferde Arzt oder gründlicher Unterricht über die 
Erkenntnifs, Ursachen u. Heilung der Krankheiten der Pferde. 
Völlig umgearb. Mit Anmerkgn. u. Zusätzen v. Seyfert v. 
Tennecker. Frankfurt a.M. 1820. 8. Aufl. 8®. XIV u. 848 S. 

3692. Andres^ 8 allgem, Handatlas in 126 Haupt- u. 137 Nebenkarten 
nebst vollst. Namenverzeichn. 4. völlig neubearb., stark 
verm. Aufl. Hrsg. v. A. Scobel, ausg. v. Velhagen u. Glasing. 
Bielefeld u. Leipzig 1899. Fol. 

3823. Anthropologische Wandtafeln 6 Stück: Skelett u. Muskelmann, 
aufgez., in Mappe, gr. Fol. 

8706. Appei, Dr. Otto, Über Phyto- u. Zoomorphosen (Pflanzengallen). 
S.-A. a. d Schriften d. Phys.-Okon. Ges. Königsb. Jahrg. 
XXXIX. Mit 1 Taf. 1899. 4». 68 S. 

3716. — , u. Dr, Max Buchner, Über Abwasserreinigung S.-A. a. d. 
Ztschr. f. Gewässerkunde 1899. S. 82—99. 8«. 

3864. Auerswald, B.^ Botanische Unterhaltungen z. Verständnis der 
heimatl. Flora. Mit 60 Taf. u. 432 Text-Abb. 2. umg. u. 
V. Aufl. Leipzig 1863. 8». VIII u. 416 S. 

38€6. Behrens, Dr. WUh. Jul., Methodisches Lehrbuch d. Allgem. 

Botanik f. höhere Lehranstalten. II. durchg. Aufl. Mit 4 {^ 
Tabellen u. 408 Abb. Braunschweig 1882. 8. XIV u. 348 S. 



76 

3718. Behrens, Wüh. Jul,, Lehrbach d. AUg. Botanik. 6. dnrchges. 
Aufl. m. 4 anal. Tab. u. zahlr. Orig.-Abb. in 411 Fig. Braun- 
schweig 1899. S^. YlII u. 352 S. 

3767. Beneke, M. D,, Friedr, Wüh,, Der phosphorsaore Kalk in phy- 
siologischer and therapeatischer Beziehang. Ein Beitrag 
z. physiol. Heilkande. Göttingen 1860. S^. 88 S. and 1 
lith. Tafel. 
Berlepech, H. Ä., s. Kabsch, Dr. Wilh. 

3751. Be%old, Albert v., Das chemische Skelett der Wirbeltiere. Ein 
physiolog.-chem. Yersach. S.-A. a. d. Zeitschr. f. wissensch. 
Zoologie. IX. Bd. 8*. S. 240-269. 

3851. Biichoff, Dr. 0. W., Allgemeine Übersicht d. Organisation der 

phanerog. u. kryptog. Pflanzen. U. Abth. Kryptogamen- 
Kunde mit 1711 Abb. aaf 30 Taf. (in Mappe). Leipzig 1860. 
4«. Hierzu 16 S. Text 

3852. Bieehoff, Gotil. WWk, Die kryptogamischen Gewächse m. bes. 

Berücks. d. Flora Deatschlands u. d. Schweiz. Lief. I a. II, 

mit 8 Kapfem a. 5 lithograph. Tafeln. 4®. X o. 182 S. 

Nürnberg 1828. 
3885. Blanekenhom, Dr. Max, Taschen-Liederbach f. sangesfrohe o. 

wanderlustige Naturforscher u. Naturfreunde. Erlangen 1896. 

12». XII u. 180 S. 
3708. Blankenburg a. H. 1896, Protokolle d. Gen.-Yersanmilg. d. Ge- 

samtvereins der deutsch. Geschichts- und Altertumsvereine. 

BerUn 1897 m. Abb. 8» 144 S. 

3904. BUmus, Prof. Dr. Hud., 8 Sonder-Abdrücke : aus „Omis" VIII.Bd. : 

Der Tannenheher in Deutschland; S. 223-252; omitholog. 
Leuchtthurm-Beobachtgn. a. d. Str. v. Gibraltar. S. 339—342. 
— Aus d. XI. Jahresber. d. Ver. f. Naturw. zu Braunschweig: 
Naturhistor. Skizzen aus Spanien u. Südfrankreich, kl. 8*. 
S. 212—222; über neuere Nistkästen, ebenda XIL Jahersb. 
S. 127—136. — Aus d. Omith. Monatsschr. d. D. Ver. i. 
Schutze der Vogelw.: Weifslicher Edelfasan, sogen. Türk 
Fasan. XXL Jhrg. 1896 S. 266/7; Heinr. Gätke. XXOL 
S. 49-56; Job. Ernst. Wilh. Pietsch. XXIII. S. 96-101; 
Eine neue Einwanderg. d. Steppenhuhns? XXIV. S. 158,'9. 

3905. — , Hygien. Studien aus Spanien. Vortrag 1898. S.-A. aus d. 

Monatsbl. f. öffentl. Gesundheitspflege Nr. 3-5. 8«. 20 S. 

3906. — , Festrede bei d. Einweihung des Brehm-Schlegel-Denkmals 

zu Altenburg am 30. Sept. 1894. S.-A. a. Nr. 6 1895 d. Z. 
f. Omith. u. prakt. Geflügelz.; Stettin. 8<>. Zweimal 12 S. 

3907. — , 5. Jahresber. (1886) d. Comitös f. omithol. Beobachtungs- 

stationen in Österr.-Üngam. Supplement zu „Omis" Jahrg. 
1888. Wien. 8<>. XII u. 346 S.; desgl. 6. Jahresber. 
(1887) .... Wien 1890. „Ornis** 1889-90 XH u. 470 S. 



77 

3800. BlekteU, Joh., Practisches Heilverfahren bei den gewöhnlichsten 
innerlichen ELrankheiten d Pferdes. III. Aufl. Wien 1843. 
8«. XIV u. 374 S. 

3760. Bhmmbaeh, Joh. Friedr., Handbuch der Naturgeschichte. XI. 
rechtm&fsige Aufl. Mit 2 Taf. Göttingen 1826. 8^ XII a. 
668 S. 

3820. ßoek, Dr. Äug, Karl, Beschreibung d. 6. Nervenpaares n. s. 
Verbindungen m. a. Nerven, vorzügl. m. d. Gangliensysteme. 
Mit 3 Eupfertaf. Meissen 1817. Fol. XII u. 90 S. 
— , Nachtrag dazu 1821, Taf. IV u. V. 16 S. Text. 

3738. Etm-Reymimd, Emil du, Über die Grenzen des Natnrerkennens. 
Ein Vortrag in der II. Offentl. Sitzg. d. 45. Versammig. D. 
Naturforscher und Ärzte zu Leipzig am 4. Aug. 1872. 8®. 
40 S. 

3876. BorkhauseHy Moriz Balthasar, Naturgeschichte der Europäischen 
Schmetterlinge nach systemat. Ordnung. Frankfurt. 8®. 
I. Tagschmetterlinge. Mit 1 ausgem. Kupfertafel. 1788. 
XXXVI u. 288 S. II. Theü. Sphinxe (Schwärmer). (VIII) 
u. 240 S. 1789. III. Theil. Phalänen (erste Horde, Spinner) 
(XII) u. 476 S. 1790. IV. Theil. Phalänen (zweite Horde, 
Eulen). XVI u. 810 S. 1792. V. Theü. Phalänen, dritte 
Horde, Spanner. 672 S. 1794. 

3756. Brormer, Fr. Jos., Vier Perlen d. bayer. Hochlandes. Ober- 
ammergau, Partenkirchen— Garmisch, Mittenwald, Walchen- 
see. Skizzierte Natur- u. Lebensbilder a. d. Bergen zw. 
Isar und Ammer. Touristen u. Alpenfreunden gewidmet. 
Leipzig 1890. 8». 82 S. u. 9 Taf. 

3884. Bruchmann, ISrof, Dr, Ä, Über die Prothallien u. d. Keimpflanzen 
mehrerer europ. Lycopodien u. zwar über d. v. L. clavatum, 
L. annotinum, L. complanatum u. L. Selago. Mit 7 lithogr. 
Taf. Gotha 1898. gr. 8« 120 S. 

3735. Büehmanny Oeorg, Geflügelte Worte. Der Citatenschatz d. D. 
Volks. 6. verb. u. verm. Aufl. Berlin 1871. 8^ 284 S. 
Büchner, Dr. Max, s. Appell Dr. Otto. 
Bürhner, B'of, H., s. Leisering, Dr. A. G. T. 

3780. Burmeisier, H., Geschichte der Schöpfung. Eine Darstellung 
des Entwicklungsganges d. Erde u. ihrer Bewohner. Leipzig 
1843. 8«. IV u. 488 S. 

3830. Busch, Ä., Der Kartoffelbau. Anleitg. z. Anbau u. z. Kultur 
d. Kartoffel n. Beschreibg. d. neuesten u. wichtigst. Sorten. 
Mit 23 lUustr. Danzig 1874. 8^. 78 S. 

3B58. Caßsdt, Friedr., Excursions-Flora für das Südöstl. Deutschland, j 
Ein Taschenbuch z. Bestimmen d. in d. nördl. Kalkalpen, iS?R^^ 
Donau-Hochebene, d. scbwäb. u. fränk. Jura u. d. bayer. 



78 

Walde vorkommenden Phanerogamen oder Samenpflanzen. 
Augsburg 1878. 8«. XLVIU u. 374 S. 

3834. CandoUe, Älph. de, Regeln d. botanischen Nomenclatur angen. 
V. d. intemat. botan. Eongrefs zu Paris, im Aug. 1867; nebst 
Einleitg. u. Gommentar. Basel u. Genf 1868. S^, 70 S. 

3836. — , Der Ursprung der Culturpfianzen , übers, v. Dr. Edmund 
Goeze. Leipzig 1884. kl. B®. X u. 590 S. LXIY. Band 
d. intern, wiss. Biblioth. 
Canesirmi, Praf, (?., s. Deutsche Zool. Gesell 

3788. Carhbad, Marienbad, Franzensbad und ihre Umgebung vom 
naturhlstor. u. medicinisch-geschichtlichen Standpunkte; mit 
einer geognostischen Karte und 4 Portraits. 8®. 340 S. 
1862. 

3791. Carus, Dr. Carl Gustav, Psyche. Zur Entwicklungsgeschichte 
der Seele. Mit dem Bilde des Verfassers. Pforzheim 1846. 
8«. VIII und 496 S. 

3903. CfMmberlam*s, Haust, Stew,, Grundlagen d. geistigen o. mate- 
riellen Kultur der Gegenwart 2 Besprechgn. v. Prof. Dr. 
^ A. Drew (S.-A. a. d. „Gegenwart" 1899 Nr. 32) u. Prof. 
Dr. Hueppe (S.-A. a. d. „Bohemia" 1899 Nr. 104). MOnchen 
1899. 8« 16 S. 

3698. Chesnut, V. K., Thirty poisonous Plauts of the U. S. Washington, 
Dep. of Agriculture 1898. Farmers BuUetin Nr. 85. 8^. 
M. 24 Abb. 32 S. 

3694. Chicago, Weltausstellung 1893, Japan, General View of Commerce 
and Industry in the Empire of Japan. (Dep. of Agri- 
culture and Commerce). Tokyo 1893. 8<>. 492 S. 

3691. — , Wakamiya, Outlines of the History of Telegraphs in Japan. 
Tokyo 1892. 8^. Vin u. 68 S. 

3693. Claus, Carl, DOngungstafel in graph. Darstellg. Nürnberg 1867. 
Folio. 

3702. Cohausen, Äug. v.. Die Befestigungsweisen d. Vorzeit u. d. 
Mittelalters. Auf s. Wunsch hrsg. v. Max Jahns. Wies- 
baden 1898. gr. 8®. 1 Lichtdruck, XL VI u. 340 S. Mit 
einem Atlas, gr. 8«. 6 S. u. 57 Taf. 

3771. Co«a, ÄemÄard t?on. Die Geologie der Gegenwart 3. umgearb. 
Aufl. Mit d. Porträt d. Verf. Leipzig 1872. 8« XII u. 
456 S. 

3719. CrammeTj Prof, Hans, Eishöhlen- u. Windröhren-Studien. Mit 
5 Taf. S.-A. a. d. Abb. d. k. k. Geogr. Ges. Wien I, 
1899. gr. 80. S. 19^76. 

3328. Deutsehe Zoologische Gesellschaft, Das Tierreich. 5. Lief. 
Protozoa. Alphonse Labb^ Sporozoa. 6. Lief. Crustacea. 
Copepoda I. Gymnoplea, bearb. v. Dr. W. Giesbrecht u. Dr. 



L 



79 

0. Schmefl. 1898. 7. Lief. Acarina. Demodicidae u. Sar- 
coptidae v. Prof. G. Canestrini u. Prof. P. Kramer. 8. Lief. 
Arachnoidea. Scorpiones a. Pedipalpi v. Prof. K. Krae- 
pelin. 1899. 
3734. Dießkau, Chr. Joh. Fr. v., Naturgeschichte der Nachtigall. Mit 

Kupfern. Römhüd 1779. kl. 8®. 208 S. 
3883. DieudonnS, Adolf, Die Pest in Bomhay. Ein Rück- und Aas- 
blick S.-A. aas Westerm. Monatsh. LXXXY. Jahr 1899. 
gr. 8^ 8. 496-601. 
3901. DUimar, Franz, 400 Aasflüge in d. ümgebg. v. Nürnberg n. 
Fürth, femer in d. Pegnitzthal, in d. Altdorfer Gegend, in 
d. Bednitz- a. Altmühlgebiet a. in d. Fr&nk. Schweiz. Mit 
4 G.-St.-Karten u. 1 Karte d. Fr&nk. Schweiz. 3. vermehrte 
a. verbess. Aofl. Nürnberg 1899. kl. 8* 112 a. VUI 8. 
3862. Dodd'Pori, Br. Arnold, Illustriertes Pflanzenleben. Gemein- 
▼erständl. Osiginalabhandl. ü. d. interessant, u. wichtigsten 
Fragen d. Pflanzenkunde. Mit 10 Taf. Extra-Beilagen. 122 
Text- Abb. Zürich 1883. 8«. XVI a. 474 S. 
3781. DöUinger, /. von, König Maximilian 11. und die Wissenschaft. 
Rede, gehalten in der Festsitzung der k. Akademie der 
Wissenschaften zu München am 30. M&rz 1864. 8®. 48 S. 
3766. Dolomüm, NordwesUiehe. im Mafse 1:60,000. Topograph. 
Detailkarten. YII. K. u. k. milit&r.-geogr. Institut in Wien. 
Gefalzt in 8^ 
Eiehhom, ^r., s. Nürnberg 3900, Bericht etc. 
3^' BUenberger, Dr. W., Lehrbuch d. allg. Therapie d. Hauss&uge- 
tiere. unter Mitwirkung v. Prof. Dr. Schütz in Berlin u. 
Prof. Dr. Siedamgrotzky in Dresden. 1. Teil. Berlin 1884. 
8« Xn u. 346 S. 
^^' Ellerbroek,Ign.Jo8. J>ie HoU&nd. Rindviehzucht u.Milchwirthschaft. 
Mit 71 Text-Abb. Braunschweig 1853. 8». VI u. 127 S. 
nEneyelopaediaBrUanniea^, someFamous Contributors to the — , 
and a few of the Important Articles they have written. Mit 
Portr&ts. 8». 24 S. 
^'^' „England*^, Mitteilungen aus dem Reisebuche eines deutschen 
Naturforschers. 8» XVI u. 476 S. Basel 1842. 
Engler, Carl, s. Stohmann, F. 
Ennemoter, Dr. Joseph, Anleitung zur Mesmerischen Praxis. 

Stuttgart u. Tübingen 1852. 8». VI u. 514 S. 
Flmchmann, Dr, A., D. Entwickig. d. Zoologie im 19. Jhrhdt. 
S.-A. aus d. Beil. z. Allg. Ztg. No. 169 u. 170. 1890 München. 
8«. 24 S. 
i,Plora'^ oder allgem. botan. Zeitung, hrsg. v. d. k. bayer. botan. 
Gesellschaft in Regensburg. 1876. XXXIV (g. R. LIX.) Jahrg.^ 
14 Taf. 682 S. 8«. 



8700. 



3740. 
3722 

3871. 



80 

3732. Flouretis, P,, Das mensclüiche Leben in seiner Dauer von mehr 

als hundert Jahren. Uebersetzg. Leipzig 1855. 8®. 64 S. 
3773. Flügel, Dr., Volksmedizin and Aberglaube im Frankenwalde. 

Nach lOj&hr. Beobachtg. dargest Manchen 1863. 8®. YIII 

n. 82 S. 
3832. Focke, Dr. W. 0., Über die Begriffe Species u. Varietas im 

Pflanzenreiche. Jena 1875. 8®. 65 S. 
3680. Friedberger, Fran%, Lehrbuch der spec. Pathologie o. Therapie 

d. Haustiere f. Tierärzte, Ärzte u. Studierende y. Franz 

Friedberger u. Dr. med. Engen Fröhner. 2 B&nde. 8®. 

Stuttgart 1886 X u. 640 S.; 1887 VH! u. 696 S. 
Fröhner, Dr. med. Eugen, s. Friedberger, Franz. 
3713. GaerMngen, Frhr. HUler v., S.-A. aus Thera Band 1, Th. v. 

Heldreich, Die Flora der Insel Thera. Berlin 1899. Illustr. 

40. 20 S. 

3855. Garcke, Dr. August, Flora von Nord- u. Mittel-Deutschland. 

Zum Gebrauche auf Excurs., in Schulen u. beim Selbstunterr. 
7. verb. Aufl. Berlin 1865. 8». 108 u. 516 S. 

3856. - , Flora von Deutschland. Zum Gebrauche auf Excurs., in 

Schulen u. beim Selbstunterr. 16. neubearb. Aufl. Berlin 

1890. 8». 100 u. 570 pag.. 
3798. Qe8et% betreffend die Abwehr und Unterdrückung von Vieh- 
seuchen vom 23. Juni 1880. Berlin 1881. kl. Q^. 40 S. 
3806. Gegner, Conrad, De Piscibus et Aquatilibus Omnibus Libelli III. 

Nout. 1606. 12». 280 S. 
Giefebrechl, Dr, W., s. Deutsche Zool. Gesell. 
3684. Glück, Dr. Hugo, Entwurf zu einer vergleichdn. Morphologie d. 

Flechten-Spermogonien. Habilitationsschrift. Mit 2 Doppel taf. 

u. 50 Textfig. Heidelberg 1899. 8». VI S. u. S. 81—216 

ans: Verhandlgn. d. Naturh.-medizin. Ver. zu Heidelberg. 

N. F. VI. Bd. 
3623. Goebel, Dr. K., Organographie d. Pflanzen, insbes. d. Arche- 

goniaden u. Samenpflanzen. IL Teil. Spec. Organographie. 

I.Heft Bryophyten. m. 128 Abb. im Text. Jena 1898. 8«. 

S. 238—386 u. S. IX— XIL 
Goe%e, Dr. Edmund, s. Candolle Alph. de. 
3315 t Gordon y de Äcoaia, Dr., Indicaciones Terapeuticas de la 

Musica. Habana 1899. 8^. 64 S. 
u. — , La Tuberculosis en la Habana desde el Punto de Vista 

social y economico. 1899. 8®. 32 S. 
V. — , Gonsideraciones sobre la voz humana. S.-A. aus „Revista 

de Medicina y Cirujia de la Habana". 1899. 8«. 40 S. 
w. Declaremos en Cuba i Guerra a la Tuberculosis! 1899. S^. 32 S. 
3731. Götz, Joh. Kasp., Ffarrer zu Äbaberg, Der Vogelherd oder 

vollständiger Unterricht in der Kunst, verschiedene Arten 



81 

von VOgeln auf dem Heerde zu fangen. Mit einem Kapfer. 

Nördlingen. kl d®. 86 S. 
3846. Qremliy Ä., Ezcnrsionsflora für die Schweiz. VI. yerm. q. verb. 

Auflage. Aarau 1889. S\ XXIV u. 510 S. 
3813. Griem, Br. Chr., Der homöopathische Haos-Thierarzt Prakt. 

Anweisg. f. Landwirthe u. Yiehbesitzer übhpt. a. Krankheiten 

n. äofserl. Yerletzongen d. Pferde, d. Rindviehes, d. Schafe, 

Ziegen, Schweine und Honde auf bomOop. Wege schnell q. 

gründl. zu heilen. Qaedlinborg q. Leipzig 1861. 8®. lY 

Q. 194 S. 
3759. Qfube, A. W,, q. Alfred Koeh, Lindau— Bregenz nebst n&herer 

n. weit, ümgebg. Landschaftliches q. Geschichtliches. 4. Anfl. 

Mit Karten n. Panoramen von A. Kinkelin n. A. Walten- 

beiger. Lindau 1886. kl. 8» Vin u. 172 S. 
3703. Orübel, V., Statistisches Orts-Lexikon d. Kgr. Bayern. Ein 

Handbuch für Amts- u. Gerichts-, dann Post-, Telegraphen- 

n. Eisenbahn-Verkehr. 8. verb. u. verm. Aufl. Ansbach 1896. 

8« 48 u. 830 S. 
Qümbel, W., s. Sendtner, Otto. 

3728. Hager, Dr. Hermann, Das Mikroskop u. seine Anwendung. Ein 

Leitfaden bei mikrosk. Untersuchungen. Mit 100 Text-Abb. 

Berlin 1866. Q^, 74 S. 
HaUier, Br. Ernst, s. Schlechtendal. 
3737. Harleii, Dr. A. v,, Die elementaren Funktionen der kreatOr- 

liehen Seele. Psychologisches Fragment aus d. Nachlafs d. 

UniT.-Prof. u. Akad. Dr. Emil Harlefs. Manchen 1862. 8®. 

IV u. 106 S. 
Harimann, H. Jf^ s. Leisering, Dr. A. G. T. 
^^^ Horlwig, Theodor, Handbuch für Reisende durch Südbayem, 

Tyrol, Vorarlberg, Salzburg und das Salzkammergut. Nebst 

Bundreise um den Bodensee und Reiserouten nach Mailand 

und Venedig. lü. g&nzl. neu bearb. Auflage. Mit 5 Stahlst. 

u. 1 Karte. München 1842. 8®. Vm u. 888 S. 

Heidreieh, Th, v^ s. Gaertringen, Frhr. Hiller t. 
Hemmer, Dr, Morüs, Hygienische Studien. 8 Vorträge. München 

1875. 8». 48 S. 
3'^' Hi^e, Joh, Chriet,, Der Vogelfang nach seinen versch. Arten 

prakt. n. d. Erfahrg. beschr. nebst Anleitg. z. Jagd d. Feder- 

wildprets. Mit Kupfern. Nürnberg, I. Teil, 1798. VUI u. 

608 S. 8«. n. Teil 1806. XVI u. 606 S. 
^1- Hüdebrand, Dr. Friedr., Die Farben d. Blüthen in ihrer jetzigen 

Variation u. früheren Entwicklung. Leipzig 1879. S^. I|^ 

u. 84 S. ^ 

Hireekt, Karl, s. Schumann, Prof Dr. Karl. 



8755. 



82 

8753. Hoeven, /., van der, Ergebnisse der Natarforschung f. d. Leben. 
BerUn 1848. 8« VI u. 121 S. 

2177. HoffmanUy Gg. Franz, Deutschlands Flora od. botan. Taschen- 
buch. Zweiter Teil f. d. Jahr 1796. Cryptogamie. Erlangen. 
12<>. Mit 14 kolorierten Taf., Vorbericht, 200 S. Text, Index 
Q. Appendix. — Dasselbe, Duplikat, aber mit nichtkolo- 
rierten Tafeln. 
— , dasselbe, für das Jahr 1804. Erster Theil. II. Abtheüiing. 
14. bis 23. Klasse. Neue u. verm. Aufl. Mit 12 nichtkolor. 
Taf., Vorbericht, 308 S. Text u. 24 S. Verlagsverz. 

3801. Hoffmann, K. Fr. Yollr., Deutschland u. s. Bewohner. Ein 
Handbuch d. Vaterlandskunde f. a. Stände. Stuttgart 1836. 
8« I. Band XVI u. 712 S., 3 Karten. H. Bd. XVI u. 
518 S. III. Bd. XII u. 596 S. IV. Bd. IV u. 264 S. 

3892. Hofmann, Og., Zeitungsnotiz über die Ausgrabung eines Grab- 
hügels bei Hagenhausen (Altdorf). Frank. Kurier No. 634 
V. 11. Dez. 1899. 

3863. Hofmeister, Wüh., Die Lehre v. d. Pflanzenzelle. Mit 58 Holzsch. 
Leipzig 1867. 8». XII u. 404 S. 

3682. Holler, Dr. A., Die Moosflora v. Memmingen u. d. benachbarten 
Oberschwaben. Memmingen 1898. S.-A. a. d. 33. Ber. d. 
Naturw. V. f Schwab, u. Neub. in Augsburg. 8^ S. 131—204. 

3679. Hamann, Joh. BapU, 19 alte Landkarten in Kupferstich. Hongariae 
Persien Portugall Piemont Westphalen Venedig Pfaltz 
Mähren Nieder Sachsen Dännemarck Mayland Ober-Sachsen 
Venetia Teutschland Brandenburg Holland Burgund Rass- 
land Alsatia Württemberg Heilig Land. In Folio. 

3714. Ho$e, Gustav, D. Weltgesetz. Eine kurzgefafste Abhdlg. d. 
ges. Seins, a. streng wiss. Grundlagen bearb. f. Jederm, 
Dortmund 1899. 8«. 32 S. 
Homsehuch, Dr. Fr., s. Nees von Esenbeck. 

2252. Hübner, Otto, geogr.-statist. Tabellen aller Länder d. Erde. 
Ausg. 1899. V. Prof. Fr. v. Juraschek. Quer 8». 96 S. 

3787. Htifeland, Dr. Chr. Wüh., Die Kunst, das menschliche Leben 
zu yerlängern. I. Teil. Neue verm. Aufl. Jena 1802. 
kl. 8» XVI u. 204 S. 
Humboldt, Alex., s. Kletke, H. 
— . s. LOwenberg, J. 

3360 e. Issel, Arturo, Morfologia e genesi del Mar Rosso. Saggio di 
Paleogeografia. S.-A. a. d. Atti del Terzo Congresso €teo- 
grafico Italiano. Firenze 1898. Mit 1 Taf.. 1899. 8^ 18 S. 

3887. Janet, Charles, Sur les Nerfs de TAntenne et les Organes 
chordotonaux chez les Fourmis. S.-A, a. d. Comptes-r. h. 
des Seances de l'Ac. d. Sc., T. 118^p.^'^814. Paris 1894. 
40. 4 S. 



83 

Jenizseh, Ä., s. Königsberg, Preofs. Bot. Ver. 

Jura$chek, Fr. v., s. Hühner, Otto. 
3874. Kabseh, Dr. WUh., Das Pflanzenleben d. Erde. Eine Pflanzen- 
geograpbie f. Laien q. Naturforscher. Mit Vorwort v. H. A. 
Berlepsch. Mit 59 Text-Holzschn. II. Ausg. Hannover 1870. 
S\ XVI u. 642 S. 

Kannegiefaer, K. L., s. Oersted H. Chr. 
3687. Küt^ Th., Bakteriolog. u. Pathologisch-Histiolog. Übgn. f. Tier- 
ärzte Q. Studierende d. Tierheilkunde. Eine Anleitg. z. 
Erlemg. d. Anfangsgründe d. Bakterienkunde u. Mikroskop. 
Untersuch, n. Vorträgen eines Utägigen Kurses. M. Abb. 
Wien 1889. 8«. VHI u. 328 8. 
3710. KUiler, Ch., Flora d. Regnitzgebietes. Zum Gebrauch auf £x- 
cursionen, in Schulen u. z. Selbstunterrichte. Nnbg. 1896. 
3792. Klein, Hermann J., An den Nordpol. Schilderung d. arktischen 
Gegenden u. d. Nordpolfahrten v. d. &lt. Zeiten b. z. Gegen- 
wart Illustr. Kreuznach. S^, 135 S. 
3768. KMke, H., Alexander von Humboldt's Reisen in die Äquinoctial- 
Gegenden Amerikas. II. Band. Berlin 1858. 8®. VIII u. 
368 S. 
3699. Kkm%fnger, Prcf. Dr. C. B., Theodor Eimer. Ein Lebens- 
abrifs m. Darstellg. d. Eimer'schen Lehren nach ihrer Ent- 
wicklung. S.-A. a. Jahresh. d. V. f. Vaterl. Naturk. i W. 
Stuttgart 1899. 8». 22 S. 

KUififel, K., s. Schwab, G. 
^28. Knauer, Friedr. K,, Unsere Kenntnisse v. d. Entstehung u. d. 
Baue des Chlorophyll's u. dessen Rolle im Pflanzenleben. 
Wien 1875. 8». (IV) u. 52 S. 

Knoeh, Äug, Wilh,, Beiträge zur Insektengeschichte (3 Abteil, 
in 1 Band) mit 18 kolor. Kupfern. Leipzig 1781. Q^. 98, 
192 u. 138 S. 

Knuth, Dr. Paul^ Sonder-Abdrücke : 22 versch. aus d. Botan. 
Centralblatt, 1 aus Kneucker's bot. Z., 1 aus „Humboldt*". 8®. 

— , Blumen u. Insekten auf d. Halligen (overgedrukt uit het 
„bot. Jahrbuch" 1894). Gent 1894. S». [32] S. 

— , Blütenbiolog. Beobachtgn. 5 S.-A. aus der Dodoneae, Gent, 
overgedrukt aus d. bot. Jahrbuch. 8^. 

— , 4 Sonder-Abdrücke aus „Die Heimat". 8®. 

— , 4 dsgl. aus d. Schriften d. Naturw.-Ver. f. Schleswig-Hol- 
stein. 8<>. 

Koeh, Alfred, s. Grube, A. W. 

Kömgeberg, Preufs. Botan.-Verein, Hora v. Ost- u. Westpreufsen. 
I. Samenpflanzen od. Phanerogamen. Bearb. y. J. Abromeit Ic 
unter Mitw. v. A. Jentzsch u. G. Vogel. I. Hälfte. Berlin 
1898. 8». X u. 400 S. 



8786. 



3897. 



3701. 



84 

3812. KärbeTy Franz, Belehrungen über die f. Menschen n. Tiere 

höchst gefährl. Folgen d. Ansteckung durch die ansteckenden 

Krankheiten der Haosthiere, nebst Angabe der geeigneten 

Mittel Q. Wege z. Yermeidg. ders. Leipzig 1874. S^. 150 S. 

KraepeUn, Prof. K., s. Deutsche Zool. Gesellsch. 

Kramer, Prof, P., s. Deutsche Zool. Gesellsch. 

3747. Kritik des Qottesbegriffs in den gegenwärtigen Weltansichten. 
II. unver&nd. Aufl. Nördlingen 1866. 8». 95 S. 

3816. Kühn, Dr. Otto Bernhard, Orfila's Allgemeine Toxikologie oder 
Abhandlung von den Giften des Mineral-, Pflanzen- und 
Thierreichs in physiol., patholog. u. gerichtl.-med. Hinsicht 
Leipzig 1830. I. Band. 8«. XXII u. 621 S. 

3843. Kummer, Paul, Der Führer in die Mooskunde. Anleitung zum 
leichten und sicheren Bestimmen d. deutschen Moose. Mit 
78 Fig. auf 4 lith. Tafeln. Berlin 1873. 8«. (VI) u. 120 S. 

3841. — , Der Führer in die Flechtenkunde. Anleit. z. leichten u. 

sicheren Bestimmen der deutschen Flechten. Mit 14 an- 
gefügten Naturflechten u. 22 lith. Fig. auf 3 Taf. Berlin 
1874. 8». (VI) u. 116 S. 

3842. — , Der Führer in die Laubmoose u. d. GefUfscryptogamen. 

Mit 83 Figuren auf 7 Uth. Tafeln. BerUn 1876. 8«. (Vm) 
u. 142 8. 

3840. — , Der Führer in die Pilzkunde. Anleit z. method., leichten 
u. sicheren Bestimmen d. in Deutschland vorkomm. Fibse, 
m. Ausnahme d. mikroskopischen. II. völlig umgearb. Aufl. 
Band I. Mit 46 lith. Abbild, auf 4 Taf. Zerbst 1882. 
8». (IV) u. 188 S. Band H. Die mikroskop. Pilze. Mit 
130 Hth. Abb. auf 4 Taf. Zerbst 1884. (VI) u. 146 8. 

3879. KOeter, H. C, Omitholog. Atlas d. aufsereurop. Vögel (Fort- 
setzg. V. Dr. C. W. Hahn's Werk), 17. Heft Bucconidae I. 
8 Tafeln. Nürnberg 1841. 8«. 
Labbä, Alphome, s. Deutsche Zoolog. Ges. 

3739. Lang, Wilhelm, David Friedrich Straufs. Eine Charakteristik. 
Leipzig 1874. 8«. 60 S. 
Langethal, Dr. L. E,, s. Schlechtendal. 

3686. Leisering, Dr. A. G. T., D. Fufs d. Pferdes in Rucks, a. Bau, 
Verrichtgn. u. Hufbeschlag. Gemeinfafsl. in Wort u. Bild 
dargestellt von Dr. — u. H. M. Hartmann. 5. Aufl. in 
ihrem 2. d. Hufbeschlag betr. T. umg. v. A. Lunkwitz. Mit 
169 Holzschn. v. Prof. H. Bürkner. Dresden 1882. 8«. 
X u. 320 S. 
Zattz, Dr. Harald 0,, s. Rose, A. 

3804. Leo, Jf. Rudolf, Die Krankheiten des Hundes nebst einer Anleit. 
z. Aufzucht u. Pflege, bearb. a. Grd. ei. 17 j. Erfahr. Mit 
2 Origzeichn. v. Friedr. Specht. Leipzig 1878. 8®. 48 8. 



3860. LeimiBy Dr, Joh., Analytischer Leitfaden f. d. ersten, wissen- 
schaftlichen Unterricht in der Naturgeschichte. I. Heft 
Zoologie. 7. Y. a. v. Aufl. Mit 643 Abb. Hannover 1877. 
8». XII u. 220 S. 

3783. Leupoldi, Br. Joh. Mich,^ Geschichte der Gesundheit und der 
Krankheiten. Erlangen 1842. 8®. XYI a. 158 S. 

3902. Leyhf Friedr. Ä., Handbuch d. Anatomie d. Hansthiere. Mit 
bes. Beröcks. d. Pferdes. Z. Gebr. bei Yorlesgn. n. zu eign. 
Belehrg. 2. yerm. u. yerb. Aufl. Mit Holzsch. Stattgart 
1859. 8«. XVin u. 724 S. 

3750. Liebig, Br. JiiatuSj Die organische Chemie in ihrer Anwendung 
auf Physiologie und Pathologie. Braunschweig 1842. 8®. 
XVI u. 342 S. 

3779. Liebig, Juetua von, Über das Studium der Naturwissenschaften. 
Eröfl&iungsrede zu seinen Vorlesungen über Experimental- 
Chemie. München 1852. 8®. 24 S. 
Limpricht, K. Gustav, s. Rabenhorst, Dr. L. 

3772. Loewenberg, J., Alexander v. Humboldt's Reisen in Amerika 
und Asien. Eine Darstell, s. wichtigsten Forschgn. 8®- 
Berlin 1843. IL Aufl. Mit Kupfern u. Karten. I. Band. 
X u. 328 S. n. Band. X u. 412 S. 

3810. London, R. Medical and Ghirurgical Society, Medico-chirurg. 

Transactions. (83. Bd.) 2. Series, 15. Bd. 1850. XL u. 

360 8. 8». 
S807. Dr. Xorens'sche Schutz-Impfung gegen den Rotlauf der Schweine. 

Berlin 1898. 8«. 8 S. 
3845. Lormaer, Br. Quai,, Botanisches Ezcursionsbuch f. d. deutsch- 

österr. Länder u. d. angrenzende Gebiet. 5. Aufl. Durchges. 

u. ergänzt v. Dr. Friedr. Wilh. Lorinser. Wien 1883. kl. S^. 

CXVI u. 566 S. 
3727. Lösch, Br. Carl, Vergleichung der Wirkungen des Schwefel- 

äthers und des Chloroforms. In.-Diss. d. medic. Facultät 

in Erlangen. 1848. kl. 8^ 19 S. 
3679. LoUer, Tob. Conr., Hungariae. Venedig. 2 alte Karten. Folio. 
Luerfsen, Br. Chr., s. Rabenhorst, Dr. L. 

3811. Lünemann, 0. H., Imm. Joh. Gerh. Schellers lateinisch-deutsches 

und deutsch-lateinisches Handlexikon. Wien-Prag 1806. 8®. 

Erster oder lateinisch-deutscher Teil I. Abtheilnng. XXXII 

u. 824 8. n. Abteil. 825—1728 S. 
LunhwU», Ä., s. Leisering, Dr. A. G. T. 
Magnus, P., Sonder-Abdrücke 8®: aus d. Ber. d. D. Botan. 

GeseUsch. Jahrg. 1898 8. 331—334; Jahrg. 1899 S. 112—120, 

8. 145—151, S. 178—184. — aus d. Abhandl. d. Botan. Ver.[^ 

d. Prov. Brandenburg 1899 S. 166—168. — a. d. Hedwigia 

1899 8. (241)— (242). 



86 

3778. Martin, Dr. Antelm, Qeschichtliche Darstellung der Kranken- 
und Yersorgongsanstalten zu München mit medizinisch- 
administrativen Bemerkungen aus dem Gebiete der Nosoko- 
mialpflege. München 1834. kl. 8®. XU u. 296 S. 

3729. Marlius, Dr. Georg, Pharmakologisch-medicinische Studien über 
den Hanf. In.-Abhdl. d. medic. Facultät in Erlangen (1855>. 
80. IV u. 92 S. 
Jahns, Max, s. Cohausen, Aug. v. 

8829. MekUngen, Verein f. Pomologie u. Gartenbau in — : Heft XX 
der Ver.-Scbrftn. 8®. Die Hansgärten auf d. Lande, ihre 
Anlage, Bepflanz, u. Pflege. 1877. VHI, 90 S. u. 7. Taf. 

3717. Meyer, Dr. Oust,, Leitfaden d. Botanik f. landwirtscb. Winter- 
schulen u. Landwirte. Mit 248 Textabb. Berlin 1899. 8®. 
VI u. 162 8. 

3690. MüUärepUäl, Ein römischer — , Bäder von Baden bei Zürich, 
Schweiz. Mit 10 Taf. Lichtdr. 8». 16 S. 
Molendo, Ludwig, s. Walther, Dr. Alex. 

3822. Moleschott, Joe., Georg Forster, der Naturforscher des Volkes. 
2. verbess. Aufl. Berlin 1862. 8^ XIV u. 230 S. 

3782. — , Zur Erforschung des Lebens. Rede beim Antritt der 
Professur für Physiologie an der Hochschule zu Turin am 
16. Dezember 1861. Giefsen 1862. kl. 8<>. IV u. 32 S. 

3683. Möller, Dr. H., Die Hufkrankheiten d. Pferdes, ihre Erkennung, 
Heilung und Verhütung. Mit 30 i. d. Text gedr. Holzsch. 
Berlin 1880. 8». VIII u. 260 S. 

3763. Mühry, Dr. A., Über die historische Unwandelbarkeit der Natur 
and der Kränkelten. Hannover 1844. 8®. 50 S. 
Müller, Carl, s. Poulsen, V. A. 
Mufmnenhoff, Ernst, s. Nürnberg, Stadtmagistrat. 

3695. München, kgl. Akademie der Wissensch.: Bodensee-Earte in 
2 Blättern. 1 : 50,000. Hrsg. v. d. Vollzugskom. f. Erstell, 
einer Bodenseekarte i. Auftr. d. 5 Staaten: Baden, Bayern, 
Österreich, Schweiz, Württemberg. Erstellt durch d. Eidg. 
Topogr. Bur. in Bern 1895. Ein Exemplar in Mappe, Folio ; 
ein Exemplar in 8^. 

3745. Naturforscherversammlung^ Andenken an d. XXXI. Versammlg. 
D. Naturf. u. Ärzte in Göttingen v. 18.— 24. Sept. 1854. 
4«. Mit Abb. 67 S. 

3844. Nees von Esenbeck, Dr. C. G., Dr. Fr. Homschuch und Jacob 
Sturm : Bryologia Germanica od. Beschreibung der in Deutsch- 
land und in der Schweiz wachsenden Laubmoose. 1. TheiL 
Mit XH farbigen Tafeln. Nürnberg 1823. 8». CLinu.210S. 

3676. Neger, Dr. F. W., Die Ausbeutung u. Verwertung der natürL 
Waldungen in Chile. S.-A. a. d. Forstl.-naturw. Ztschr. 
9. Heft 1808. M. Abb. 8«. S. 801-320. 



87 

3720. New Souih Wales, the Broken Hill Proptietary Company Ltd., 
Barrier Banges Silver Field. Reports and Statements of 
Accoant for Halfyear ending 80th Nov. 1898 (nebst Report 
' über die General- Versamml. v. 27th Jan. 1899 Melbourne. 
4 S.). 4<^. 40 S. m. 2 Karten. (Za d. Qesteinssendong, 
vorgelegt 19. Joli 1899.) 
3743. Noe^ Hemrieh, Baierisches Seebneh. Naturansichten q. Lebens- 
bilder y. d. baier. Hochlandseen. München 1865. S^, YIU 
u. 676 S. 
3689. Nürnberg: AUmmaeh Marci Freunds f. d. Jahr 1815. Schmal S®' 

M. handschriftl. Einträgen. 
3704. — Anthropolog. Sektion der Naturhistor. Gesellsch., Fund- 
protokolle in je 2 Exemplaren, von denen nur je 
eines ausgeliehen werden darf. Hektogramme in 
Kanzleüormat: 
Wunder, Justin, Ausgrabg. eines pr&h. Grabhügels am 
Hirschberg bei Behringersdorf am 80. M&rz 1899. 
2 S., 2 Tafeln u. 1 Pause. 
— , Grabung bei Hammer am 24. Aug. 1899. 4 S. m. 

Zeichngn., 1 Tafel 1 : 100. 
— , Ausgrabung im Vogelherd auf d. Weifsenbrunner 
Berg am 26. Aug. 1899. 3 S. Text mit Zeichngn. 
1 Tafel 1:100. 
Wunder, Ludw., Bericht über d. Ausgrab. d. Grabhügels III 
bei Labersricht, vorgen. am 21. bis 23. März 1899. 
4 S. u. 5 Taf. 
— , Bericht über d. Abgrabg. d. Grabhügels VIII bei 
bei Labersricht, vorgen. am 80. u. 31. Aug. 1899. 
4 S. Text, 1 Taf. 1 : 50 u. 1 Planskizze. 
— , Beckersloher Grabungen 1898. 9 S. Text u. 9 Tafeln. 
3674. — Autographen-Sammlung, 10 Beiträge zur — . 
^^- ~ BaWioms Nürnberger Wanderbuch, II. Aufl. 1889. (Zweites 
Exemplar.) 8<>. 
^2. — Bayer. Volkssehullehrerverein: Festgabe zur 14. Haupt- 
versammlung des — , Die Lehrervereinigungen Nürn- 
bergs, dargest in ihrer geschichtl. Entwickig. Mit 
einem Anhang: Das Schulwesen d. Stadt Nbg. 1899. 
8». 134 S. 
— , Album mit Nürnberger Ansichten von F. Trost in 
Farberdruck, Randzeichnungen von E. Loesch and 
Gedichten von Dittmar. Quer 8®. 
— , Führer durch Nbg. f. d. Teilnehmer a. d. 14. Hptv. 
d. B. V.-V. mit vielen Illustrationen uS^f Stadtplan. 
H^. 120 S. und 40 S. Annoncen. 



88 

Nürnberg: Katalog der Lehrmittel-AosstellQng. 30. Juli bis 
4. August 1899. 80. 110 S. 
— , Fest-Zeitung d. 14. H. d. B. V.-V. No. 1, 1. Aug.; 
No. 2, 2. Aug. 1899. 4« 24 S. 
3900. — Beriohi über d. am 8. Juni 1898 zu Nürnberg abgehalt. 
XXVllI. allgem. Pastoralkonferenz evangel-luther. 
Geistlicher Bayerns. S. 48—83 Pfr. Eichhorn, über 
d. Behandig. d. Aberglaubens in Predigt, Unterricht 
u. Seelsorge. 8®. 
3678. — Bat Allgem. Krankenhaus der Stadt Nürnberg. Hrsg. 
Y. d. St&dt. Kollegien. 1898. li. vielen Taf. u. Abb. 
gr. 8». XVI u. 606 S. 
3875. — Festechrift z. 40. Hauptversamml. d. Vereins D. Ingenieure 
in Nbg. V. 11.— 15. Juni 1899. Reich illustr. gr. 8«. 
Vni u. 568 S. 
3494. — Sehuliheifi, Fr., Ph&nol. MitteU. Unser Frühjahr 1899. 
Die Sommerperiode 1899. A. d. Gen.-Anz. No. 151 
V. 30. Juni, No. 276 v. 23. Nov. 
3758. — ffister^ Heinrich, Handbuch der vorzüglichsten Denk- u. 
Merkwürdigkeiten d. Stadt Nürnberg, aus &ltem o. 
neuern anerkannt guten Schriften gezogen o. zu- 
sammengest Mit lithograph. Knpfertaf. 1830. 8®. 
IV u. 384 S. 
3880. — Stadtmagietrat, Das Hans Sachsfest in Nürnberg am 4. 
u. 5. Nov. 1894. Im Auftr. d. Festltg. v. E. Mummen- 
hoff, Archivrat. Nürnberg 1899. 8«. VIII u. 
300 S. illustr. 
3277. OefeUf Dr. Felix v., Sonder- Abdrücke. Keilschriftmedicin : 
Pharmakologie. XXV. XXVI. (allg. medic. Gentr. Ztg. 1899.) 
8®. 4 S. — Thierarzneikunde vor viertausend Jahren. (Prag. 
Med. Woch. XXIV. 1899.) 13 S. — Gonorrhoe 1350 v. Chr. 
(Monatshefte f. Prakt. Dermat. 1899). S. 260-264. 
3877. — , Geschichte d. vorhippokratischen Medicin. 139 Blatt Auto- 

graphien. 4«. Neuenahr 14./11. 1896— 22./2. 1898. 
3780. Oersted, H. Chr., Der Geist in der Natur. Deiftsch von K. L. 
Kannegieser. Mit d. Portrat d. Verfafs. Leipzig 1850. 8<>. 
XXXII u. 200 S. 
3877. Panzer, G. W. F., Index Entomologicus sistens omnes insectonim 
species in G. W. F. Panzeri Fauna Insectorum Germanica 
descriptas atque delineatas secund. method. Fabricianam. 
Pars I. Eleutherata. Norimbergae 1813. kL S^. VHI a. 

3777. Petermann, Dr. Wüh. Ludw., Taschenbuch '^Ä^Wäfiß'%it 
12 Taf. Abbdgn. Leipzig 1842. kl. 8®. 484 S. 



89 

3784. JMienkofeTf Max von, Über Nahrungsmittel im Allgemeinne und 
über den Werth des Fleischextrakts als Restandtheil der 
menschlichen Nahrung insbesondere. Braunschweig 1873. 
80. 16 S. 

3748. — , Was man gegen die Cholera thon kann. Ansprache an das 
Pabliknm im A. d. Gesondheitsrathes. München 1873. 8®. 
64 S. 
ffitter, HeinHeh, s. Nürnberg 3758. 

3799. Piank, Dr., Grundrifs der Yeterin&r-Botanik oder Thierarznei- 
Pflanzenkunde. München 1840. 8». Vorw. n. 114 S. 

3741. Pianck, K, Ch., Wahrheit u. Flachheit des Darwinismus. Ein 
Denkstein zor Geschichte heutiger deutscher Wissenschaft. 
Ndrdlingen 1872. 8«. XVU u. 210 S. 

3705. ÄwerW», Dr. Hermann, S.-A. a. d. 7. Bd. d. Denkschr. d. k. 
botan. Ges. in Regensburg. 8®. Die bayer. Arten, Formen 
u. Bastarde d. Gattung Potentilla. 122 S. — Flora exsiccata 
Bavarica. Fascic. primus Nr. 1—75. 68 S. — Die seit Prantls 
„Exkursionsflora f. d. Kgr. Bayern« (1. Aufl. Stuttg. 1884) 
erschienene Litteratur über Bayerns Phanerogamen- und 
Gef&fskryptogamenflora. 1899. 28 S. 
^^ Poioniä, Dr. H., Die morpholog. Herkunft d. pflanzl. Blattes u. d. 
Blattarten. Mit 12 Abb. S.-A. a. d. „Naturw. Wochenschr.'' 
Heft 21 d. allg.-verst. naturw. Abhdlgn. BerUn 1899. 8«. 32 S. 
3890. — , Lehrbuch der Pflanzenpalaeontologie mit besonderer 
Rücksicht a. d. Bedürfnisse d. Geologen. Mit 3 Taf. n. 
fast 700 Einzelbildern in 355 Text-Fig. Berlin 1899. 8®. 
VIU u. 402 8. 
^^- BouUm, F. iL, Botanische Mikrochemie. Eine Anleitung zu 
phytohistologischen Untersuchungen z. Gebr. f. Studierende. 
Aus d. Dänischen übers, u. Mitwirkg. d. Verf. y. Carl Müller. 
Cassel 1881. 8». XVI u. 84 S. 
^an4l, Dr. K., Exkursionsflora für d. Kgr. Bayern. Stuttgart 
1884. 8» XVI u. 668 S. 
^' Priem, /., Rupprechtstegen und das Pegnitzthal. Landschaft- 
liche Bilder. Nürnberg 1863. Mit einem Kärtchen. 8^. 
46 S. 
Babenharst, Dr. L., Kryptogamen-Flora ▼. Sachsen, d. Ober- 
Lausitz, Thüringen u. Nordböhmen m. Berücksichtig, d. 
benachb. Länder. 1. Abt. Algen im weitesten Sinne, Leber- 
und Laubmoose. Mit über 200 Illustr. Leipzig 1863. 8^. 

XVI u. 654 S. 
3847 

—, Kryptogamenflora von Sachsen, der Ober-Lausitz, Thüringen 

u. Nordböhmen mit Berücksichtig, der benachbart. Lände^^ 

IL Abt. Die Flechten. Mit zahlr. Illustr. Leipzig 1870. 

80. XD u. 406 S. 



3872. 



3827. 



90 

3826. Rabmiiorst, Dr. X., Kryptogamen-Flora von Deutschland, Öster- 
reich und der Schweiz. II. Aufl. Leipzig, gr. 8*^. III. Bd. 
Luerfsen, Dr. Chr., Die Fampflanzen oder Geföfsbündel- 
kryptogamen (Pteridophyta). Mit 225 Abb. 1889. XII u. 906 S. 
IV. Band: Limpricht, K. Gusta?, Die Laubmoose Deutsch- 
lands, Österreichs und der Schweiz. Mit 533 Einzelabbild. 
I. Abth. : Sphagnaceae, Andreaeaceae, Archidiaceae, Bryineae. 
1890. Vin u. 836 S. — II. Abth. Heft 14—28. 1890—1896. 
RadelkofeTy L., s. Sendtner, Otto. 

3849. Redslob, Dr. JtUius, Die Moose und Flechten Deutschlands. 
Mit bes. Berücksicht. auf Nutzen n. Nachtheile dsr. Gew&chse. 
40. 96 S. (Text). — Atlas dazu 4« 82 kol. Kupfertaf. 

3709. Beinecke, Dr. P., S.-Abdrücke aus dem Corresp.-Blatt d. D. 
anthrop. Gesell. 1896, 1897 u. 1899; do. aus d. Verhandlgn. 
d. Berl. anthrop. Gesell. 1897, 1898; do. aus Schlesiens 
Vorzeit in Bild u. Schrift Band YII 1898; aus d. Beiträgen 
z. Anthrop. u. Urgesch. Bayerns 1894, 1897. 

3776. Beinsch, Hugo, Die Schöpfung. Vom Standpunkt der specu- 
lativen Naturforschung u. d. heiligen Schrift aus dargest 
Erlangen 1856. 8«. 190 S. 

3819. Richter, Dr. Hermann Eberhardt, Der menschliche Körper. 
Mit 18 Orig.-Abb. 2. verm. Aufl. Leipzig 1863. 8^. 72 S. 

3770. Romershausen, Dr- Elard, Das Miasma. Eine physikalisch- 
technische Mittheilung an Sanitätsbehörden, Ärzte, Orts- 
vorsteher, Bauunternehmer und Familienhäupter. Marburg 
1856. 8«. 1 Taf. u. 20 S. 

3873. Röae, A. — Dr. Harald 0. Lenz' nützliche« schädliche u. ver- 
dächtige Schwämme. V. Aufl. Mit 20 färb. Taf. Gotha 
1874. 8». IV, 212 u. (2) S. 

3796. Roux, Henri Frideric, Nouveau Dictionaire Frangois-Allemand 
et AUemand-Fran^ois. Berlin 1769. Tom. I. 8®. Avant- 
Propos u. 2070 S. 

3764. Rueff, Dr. Ä., Das Fleisch als menschliches Nahrungsmittel in 
seiner national-ökonom., polit. u. diätetischen Bedeutung. 
Stuttgart 1866. 8<>. 48 S. 

3802. Ruppricht, Dr. S., Der Arzt als Hausfreund, Ein treuer und 
zuverläfsiger Rathgeber für Familienväter u. Mütter b. d. 
Krankheiten eines jeden Alters u. Geschlechts. VL verm. 
u. verbess. Aufl. Glogau 1865. 8» XVI u. 490 S. 

3769. RiMslands inneres Leben. Drei- und dreifsigjährige Erfahr- 
ungen eines Deutschen in RuTsland. Braunschweig 1846. 
80. I. Bd. XVI u. 264 S. II. Bd. 264 S. III. Bd. 264 S. 

3869. Sachs, Dr. JtUius, Lehrbuch d. Botanik nach d. gegenw. Stand 
d. Wissenschaft. II. v. u. teilw. umgearb. Aufl. Mit 458 Abb. 
in Holzsch. Leipzig 1870. 8» XII u. 688 S. 



3870. 



91 

3868. Sachs, Dr. Julius^ Geschichte der Botanik vom 16. Jahrh. bis 1860. 

15. Band der Geschichte der Wissenschaften in Deutschland. 

Manchen 1875. 8«. XII a. 612 S. 
3867. — , Yorlesongen über Pflanzen-Physiologie. Mit 455 Fig. in 

Holzschnitt. Leipzig 1882. 8®. XII a. 992 S. 
3790. Sckaubach, Adolf, Die Deutschen Alpen. Ein Handbach für 

Beisende durch Tyrol, Österreich, Steiermark, Ulyrien, 

Oberbayem und die anstofsenden Gebiete. Jena 1845. 8®. 

1. Teil. Allgemeine Schilderung. XX u. 284 S. III. Teil. 
1846. IV u. 288 S. 

3697. 8chۆer% Jffim. Joh^ Gerh., latein. -deutsches u. deutsch-latein. 
Handlexikon, vom. f. Schulen v. n. durchges., verbess. u. 
vermehrt durch G. H. Lünemann. 2. Aufl. Zweiter oder 
deutsch-latein. Theü. Leipzig 1812. 8». XII u. 940 S. 
Schenk, Prof. Dr. A,, Handbuch d. Botanik. Unter Mitwirkg. 
von Gohn-Breslau, Detmer-Jena, Drude-Göttingen, Frank- 
Leipzig, Kienitz-Gerloff- Weilburg, Kraus-Halle, Müller-Lipp- 
stadt, Sadebeck-Hamburg. Mit zahlr. Holzschn. Breslau 
1879-1890. 8». Zugleich 1. Abtheilg. 1. Theü der Ency- 
klopaedie d. Naturwissensch. 1. Bd. X u. 766 S. — 2. Bd. 
XU u. 696 S. — 3. Bd. 1. HÄlfte VUI u. 432 S. — 3. Bd. 

2. Hälfte XX u. 716 S. — 4. Bd. VHI u. 782 S. 
Schenk, Dr. Ernst, s. Schlechtendal. 
SchlechtendcU. — Flora v. Deutschland. Hrsgbn. v. d. Prof. 

Dr. D. F. L. V. Schlechtendal, Dr. L. E. Langethal u. Dr. 
Ernst Schenk, akad. Zeichenlehrer i. Jena. 5. Aufl. Bev., 
verb. u. m. d. neuest, wissensch. Erfahrgn. bereich. v. Dr. 
Ernst Hallier, Prof. d. Botanik a. d. ünivers. Jena. Gera- 
üntermhaus 1880—1887. 8®. 30 Bände mit 3283 Tafeln 
u. 1 Band General-Register 1888. 1 Bändchen mit den 
Namens-Begistern des 1.— 12. Bandes. 

Schleichert, F., Pflanzenphysiologische Experimente im Winter. 
S.-A. a. d. „Naturw. Wochenschr.« Heft 19 d. allg.-verst. 
naturw. Abhdlgn. Berlin 1899. 8®. . 28 S. 

Schieiden, Dr. M. J., Die Pflanze und ihr Leben. Populäre 
Vorträge. 2. verm. Aufl. Mit 5 färb. Taf. u. 15 Holzschn. 
Leipzig 1860. 8». VIH u. 392 S. 

Schnari, Dr. Carl Wilh , Neuester Schwarzwaldführer. Heidel- 
berg 1876. 8^. I. Theü. Der nördliche Schwarzwald. Mit 
3 Karten und dem Plan von Constanz. VIH u. 314 S. 
n. Teil. D. südl. Schwarzwald. Mit 3 Karten, dem Plan 
V. Freiburg u. ein Alpenpanorama v. Höchenschwand aus. 
VIII u. 330 S. 



3824. 



3765. 



Dipitized by VnOOQlC 

Schnülein, Dr. Adalbert, Analysen zu d. natürl. OrdnungeiTd. 
Gewächse u. dm. sämtl. Familien in Europa. I. Phanerogamen 



92 

auf 70 Taf. mit 2500 Fig. Erlangen 1858. Atlas in Folio, 
Erläatergn. 60 S. in 4t^. 
Schnülein, Prof. Dr, A., e. auch 1931 Sturm, Dr. J. W. 

3762. Schreber, Dr. D. O. M., Ein Ärztlicher Blick in das Schul- 
wesen, in der Absicht: zu heilen, und nicht: zu verletzen. 
Leipzig 1858. 8^. 50 S. 

3803. Schubert, Dr. O. jBf., Wanderbüchlein eines reisenden Gelehrten 
nach Salzburg, Tirol und der Lombardey. Erlangen 1823. 
kl. 80. VIII tt. 278 S. 
SchultheisSy Fr., s. Nürnberg. 

3881. Schumann, Prof. Dr. Karl, Gesamtbeschreibung der Kakteen 
(Monographia Gactacearum). Mit einer kurz. Anweisg. z. 
Pflege d. Kakteen v. Karl Hirscht. Mit 117 Abbüd. Neu- 
damm 1899. 80. Xn u. 832 S. 
Schütz, Prof Dr., s. Ellenberger, Dr. W. 

3752. Schwab, G. u. K. Klüpfel, Wanderungen durch Schwaben. 
Wegweiser d. Württemberg u. Baden. Mit 30 Stahlst. 
3. veränd. u. verm. Aufl. Leipzig 1851. S®. IV u. 244 S. 

3821. Schwäre, August, Giftpflanzen, Heilpflanzen, N&hrpflanzen. 
Fürth (1898). 8«. 1. Heft Giftpflanzen, 82 S. u. 4 Taf. 
2. Heft Heilpflanzen, 76 S. u. 4 Taf. 3. Heft N&hrpflanzen, 
69 S. u. 4 Taf. 

3677. Schwarz, Christ, Neuer Raupenkalender od. Beschreibg. aller 
bis jetzt bek. europ. Raupen nebst ihrer Verwandig. / wie 
solche alle Monate erscheinen. Nürnberg 1791. Erste Ab- 
theüg. Vorrede, 336 S. u. 1 Taf. Zweite Abteiig.: LXXX S. 
u. 337-798 S. 

3712. Schweder II, G,, Die Bodentemparaturen bei Riga. 1899. 
Naturf.-Ver. in Riga. 4®. 24 S. 1 Taf. 

3696. Schwimmer^ M. F. M., Kurtzweiliger u. Physical. Zeitvertreiber, 
Worinnen bey nahe in die Tausend höchst anmuthige, nach- 
denkl. u. recht nützl. Natur-Fragen Fleifs^st untersuchet / 
u. gründl. erörtert / auch zu Gelehrter u. Ungelehrter sonderb. 
Ergezzung / netter / reiner u. liebl. Sprach-Übung Höchst 
gedeihlich u. behagl. aufgeführt. Jehna u. Leipzig 1676. 
12®. Vormerkg. u. 376 S. 
ScoheU, A., s. Andrees Handatlas. 

3746. Seidlüz, Dr. Qg., Die Darwin'sche Theorie. Elf Vorlesungen 
über die Entstehung der Thiere und Pflanzen durch Natur- 
züchtung. Dorpat 1871. 8®. XXXVllI u. 230 S. u. 1 Tab. 

3891. Sendtner, Otto, Die Vegetationsverhältnisse Südbayems n. d. 
Grundsätzen d. Pflanzengeographie u. m. Bezugnahme auf 
Landescultur. Mit 18 Holzschn., ^'^fa?.^ u. 1 Charte. 
München 1854. 8^ XU u. 910 S. 



93 

S857. — , Die Vegetations-Verhältnisse des Bayerischen Waldes nach 
den Grundsätzen der Pflanzengeographie. Nach d. Manascr. 
d. Verf. Yollendet t. W. Gömbel q. L. Radlkofer. Mit8 Taf. 
München 1860. 8». XIV, 605 u. (6) S. 
3866. Seubert, J)r. MoriUy Lehrbuch der gesamten Pflanzenkunde. 
4. Y. u. T. Aufl. Mit T. Holzsch. Leipzig a. Heidelberg 1866. 
8« IV u. 488 S. 
3679. Seuiter^ Maitheus, Brandenburg. Teutschland. 2 alte Karten. 

Folio. 
3785. Siebert, Dr. Ä., Die Schlange des Aeskulap und die Schlange 
des Paradieses. Eine Remonstration im Intresse der freien 
Wissenschaft gegen die Restauration des Dr. J. Nepomuk 
von Ringseis. Jena 1841. 8<>. 86 S. 

Siedamgrotzky, Prof. Dr., s. EUenberger, Dr. W. 

Sind, J. B, van, s. Ammon, Karl Wilh. 
2232. Sonnerat, Reise n. Ostindien u. China, a. Befehl d. Königs 
unternommen v. Jahr 1774 bis 1781. I. Band m. Kupf. 
Zürich 1783. 4«. XU u. 268 8. 
2230. Sorauer, Dr. Paul, Handbuch der Pflanzenkrankheiten. Für 
Landwirthe, Gärtner und Forstleute. Mit 20 Holzschn. u. 
16 färb. Taf. Berlin 1874. 8«. IV u. 406 S. 
^1- Spandel, Erich, D. Foraminiferen des deutschen Zechsteins u. 
ein zweifelhaftes mikroskop. Fossil. Nürnberg 1898. 8®. 
16 S. 
^^ Spinoloj Dr. W. Th. J., Die Influenza der Pferde in ihren 
Terschiedenen Modiflcationen. Berlin 1844. 8®. Xu. 198 S. 

Stefanescu, Or., Harta Geologica Generala a Romaniei. 4 Blätter 
in Folio aus d. Tauschschrifien : Bucuresci, Museulu de 
Geologiä si de Paleontologia. 

Stöhfoann, F. u. Carl Engler, Handbuch d. techn. Chemie.* 
Nach A. Payen's Chimie industrielle frei bearb. 8^. Stutt- 
gart. I. Bd. Anorgan. Chemie y. Carl Engler. Mit 
193 Holzschn. u. 17 Kupfertafaf. 1872. VII u. 746 S. 
U. Bd. Organ. Chemie v. F. Stohmann. Mit 210 Holzschn. 
u. 83 Kupfertaf. 1874. VHI u. 876 S. 

Sturm, Dr. J. W. u. Prof. Dr. A. Schnizlein, Verzeichnis der 
phanerogamen u. gefäfscryptogamen Pflanzen in der Um- 
gegend Yon Nürnberg u. Erlangen. Mit zahlreichen hand- 
schrifd. Notizen. II. gänzl. umgearbeit. Aufl. 1860. 16^ 
XU u. 140 S. 

Sturm, Jacob, Deutschlands Fauna in Abbldgn. n. d. Nai m. 
Beschreibgn. II. Abteiig. Die Vögel, bearb. v. J. H. C. F. 
u. J. W. Sturm, Nürnberg. 8». 1. Heft m. 6 kolor. Kupf)^- 
tafeln 1829. 2. Heft 1830, 3. Heft 1834. 

— , s. Nees von Esenbeck. 



3721. 



3711. 



8878. 



r 



94 

Schmeü, Dr. 0., s. Deutsche Zool. Gesellsch. 
3775. TaubetuBuchty Gründlicher Unterricht in der ~. Nach dreifsig- 

j&hriger Erfahrung aufgesetzt u. z. allgem. Nutzen u. Ver- 
gnügen hersau^gegeben von einem Taubenfreund. 6. Aufl. 

München 1801. 8<>. 66 S. 
3817. Tennecker, Seyffert t?., Lehrbuch der Veterinär- Wundarzney- 

kunst zu Vorlesungen u. auch z. Selbstbelehrung f. Land- 

wirthe, Offiziere, Cur- u. Fahnenschmiede u. s. w. Prag 

1820. I. Teil 620 S. U. Teil 380 8. 8«. 
— , s. auch Ammon, Karl Wilh. 
3861. ThonU, Dr, Otto Wilh., Lehrbuch d. Botanik f. Gymnasien, 

Realschulen, forst- u. landwirtsch. Lehranstalten, pharmac. 

Institute sowie z. Selbstunterrichte etc. Mit 890 Holzschn. 

II. V. u. V. Aufl. Braunschweig 1872. 8». XU u. 364 S. 
3848 Thüme, Osmar, Zeitschrift f. Pilzfreunde. Populäre Mitteilgn. 

über efsbare u. schädl. Pilze. Dresden u. Bodenbach. 8®. 

1. Jahrg. 1883. 12 färb. Taf., 282 S. u. Register. 2. Jahrg. 

1885. 12 färb. Taf. 286 S. u. Register. 
3427. Toldt, Dr, Carl, Anatom. Atlas. 8. Liefrg. 
3794. Trautwein, Th., Das Baierische Hochland u. d. angrenzende 

Tirol u. Salzburg nebst Salzkammergut. 4. neubearb. Aufl. 

mit 20 Karten u. 2Stadtpl. Augsburg 1888. 8^. XII u. 213 pag. 
3679. Ulrich, Dr. Wilh., Englische u. französische Gärtnersprache 

od. Ililfsbüchlein f. Kunst- u. Handelsgärtner bei geschäftl. 

Anwendg. engl. u. franz. Ausdrücke in b. Sprachen. Weimar 

1869. 8°. VI u. 80 S. 
3869. Vogel, Dr. A. jr.. Über eine neue Darstellung von Eisenroth 

als Polirmittel für optische Gläser u. f. Metalle. München 

1855. 8<>. 16 S. 
Vogel, O., s. Königsberg, Preufs. Bot. Ver. 
3893. Vogel, Dr. Julius, Das Mikroskop ein Mittel d. Belehrg. u. 

Unterhalt g. f. Jedermann, sowie des Gewinns f. Viele. Mit 

119 Holi5a€hn. S^. X u. 278 S. Leipzig 1867. 
378tl Wagner j Andreas, Naturwissenschaft u. Bibel im Gegens. z. d. 

Kohl er Urlauben d. H. Carl Vogt, als des wiedererstandenen 

u aus d. Französ. übersetzten Bory. Stuttgart 1855. S^. 56 S. 
B886. Wtt^nrr^ }h\ M. H., Der Schwämmesammler. Geniefsbare 

Seil Wümme und ihre Merkmale. Mit farbig. Text-Abbildgn. 

Trüppau 1867. 8<>. 22 S. 

mnr^ Hermann, Illustrierte Deutsche Flora. Eine Be- 
ehre ibung der in Deutschland u. d. Schweiz einheim. Blüten- 
flÄasfien u. Gefäfscryptogamen. Mit 1250 Holzschn. Stutt- 

jart 187L 80. LXVUI u. 940 S. ^ GoO^Ic 

Führer ins Reich der Kryptogamen. Siiir^Siirer u. ^nuler 

1— V. *i. Aufl. Bielefeld 1877. kl. 8«. Mit 5 Tafeln u. 296 S. 



95 

3837. Wagner, Hermann, (fortgesetzt durch Alb. Wagner), Crypto- 

gamen-Herbarimn. 9 Hefte in einer Mappe mit 208 auf- 
geklebten Pflanzen. Bielefeld 1860 bis 1879. 8^. 

3795. Wagner^ Rudolph, Icones Zootomicae. Handatlas z. vgleich. 
Anatomie n. fremd, n. eign. üntersuchgn. 85 Taf. Leipzig 
1841. Folio. XVI n. 46 8. 

3757. Wagner, Br. Budolf, Die Chemie fafslich dargest. n. d. nenesten 
Standpunkte d. Wissenschaft f. Studirende d. Medizin, d. 
Natorw. n. d. Pharmacie. II. verm. u. verbess. Aufl. Mit 
98 Text-Abb. Leipzig 1851. 8^. Xu. 636 S. 

3675. Waiderdorff, Hugo Qraf v., Die Römerbauten an dem Königs- 

berge bei Regensburg. S.-A. a. d. L. Bande d. Yhdlgn. d. 
bist. Ver. v. Obpf. u. Rgsbg. Mit 10 Taf. u. Abb. i. Text. 
8'. 130 S. 

3815. Waldinger, Hieron., Über Krankheiten an Pferden und ihre 
Heilung in gerichtlicher Hinsicht beim Kaufe und Verkaufe. 
Wien 1806. 8^. 144 S. 
Wakamiya, s. Chicago Weltausstellung. 

3853. Walther, Br. Alex, u. Ludw, Molendo, Die Laubmoose Ober- 
frankens. Beiträge zur Pflanzengeographie und Systematik 
und zur Theorie vom Ursprung der Arten. Leipzig 1868. 
8^. VH u. 280 S. 

3707. Walter, Bruno, Beitrag z. Kenntnis d. Erzlagerstätten Bosniens. 
Im Auftr. d. k. k. gem. Minist, in Wien. Mit 1 Karte u. 
38 Abb. 1887. Wien 1888. 8» VIII u. 222 S. 

3888. Wamsdorf, C, Sonder-Abdr. 8®. Neue Beiträge z. Krypto- 

gamenflora d. Mark Brdbg. I u. IL (A. d. Vhdlgn. d. bot. 
Ver. d. Prov. Brandenburg XL. Jhrg. 8. 178—193; XLI. Jhrg. 
S. 19—80.) Verbreitg. d. Torfmoose u. Moore in Brasilien. 
(Engler's bot. Jhrb. 27. Bd. 1899 S. 238—258.) Miscellen 
a. d. europ. Moosflora; weitere Beiträge z. Flora v. Pommern. 
III. (Allg. botan. Zeitschr. f. Systematik., Florist., Pflanzen- 
geogr. etc. 1899 16 S. u. 10 S.) Bryolog. Ergebn. d. Reise 
des Dr. Matz durch die iber. Halbinsel. (Österr. botan. 
Zeitschr. 1899. No. 11.) 

3685. Weidenkeller, Dr., Katechismus v. d. Pferdekenntnifs, sowie v. 
d. Zucht, Wartg., Pflege u. Behandig. d. Pferde. Hrsg. v. 
Industrie- u.Kultur-Ver. in Nürnberg. 1881. 8®. Vinu.252S. 

3715. Weinsierl, Bob. Bitter v., Das La T^ne-Grabfeld von Langugest 
bei Bilin in Böhmen. Mit 49 Abbild., 1 Grabfelderplan u. 
13 Lichtdr. Braunschweig 1899. 4®. XVIII u. 72 S. 

3754. Weiss, Dr. J. E., Die deutschen Pflanzen im deutschen Garten. 
Eine k. Anltg. ü. Kultur u. Verwendg. d. schönst, d. Pflanzef^ 
im Zimmer, Garten u. Parke. Mit vielen Holzschn. Stutt- 
gart 1884. 8<>. VHI u. 248 S. 






96 

3808. Wiesendy Dr. Anton, Topographische Geschichte der Kreis- 

hanptstadt Landshnt in Niederhayern. Lands hat 1Ö58. 

kl. 8«. VIII u. 288 S. 
3793. WöMer, F.j Grundrifs der anorganischen CJiemie. XL Aofi. 

Berlin 1854. 8<>. Vm u. 256 S. 
3761. Wähler j Dr. F.^ Grundrifs der organischen Chemie. lY. umg. 

Aufl. Berlin 1848. 8<>. X u. 214 S. 
Wunder y JusUn, s. Nürnberg- AnthropoL Sektion. 
Wunder, Ludwig, s. — — 
3889. Zittel, Karl Alfred v., Geschichte d. Geologie u. Paläontolofrle 

bis Ende des 19. Jahrhunderts. München u. Leipzig 1899. 

8®. XII u. 868 S. 28. Band d. Gesch. d. Wiasßn schaffen 

in Deutschland. Neuere Zeit. Hrsgbn. d. d. k^I. Akademie 

d. Wissensch. 
3774. Zsigmondy, Dr, Emil, Die Gefahren der Alpen. Praktische 

Winke f. Bergsteiger. IL, von Dr. Otto Zsij?inondy besorgte 

Ausgabe. Mit Holzschn. u. d. Porträt d. Verf. Leipitig 1&8B. 

8» XVIII u. 236 S. 



Digitized by VjOOQ IC 



Of THh 



pr- WISCO N SIN ACADEMY vn 



AS 



Sciences, Artsand Letters. 

Jahresbericht 



der 



NaturMstorischen Gesellscbaft 



ztt 



Nürnberg 



ftir 



1900. 



■^•>#^<- 



Nürnberg. 

Druck von U E. Sebald. 



b^ 






p q 

Jahresbericht 



der 



Naturbistoriscben Gesellscbaft 



Nürnbergs 



far 



1900. 



►•>•<•«- 



Nürnberg. 

Druck von U. E. Sebald. 
1901. 



L A - ÄJ 

Digitized by VjOOQ IC 



Digitized by VjOOQ IC 



Jahresbericht 

der 

Naturhistorischen Gesellschaft 

für 1900. 



L/ie Gesellschaft zählte am Anfang des Jahres 405 Mitglieder; 
im Lauf des Jahres traten ihr 27 ordentliche und 11 aufserordent- 
liche Mitgheder bei, während 29 Mitgheder, darunter 9 infolge von 
Wegzug austraten ; 9 Mitglieder aber sind im Laufe des Jahres ver- 
storben: nämUch die Herren: Dr. Rupprecht, früher Schriftführer; 
Gust Greiner, Gg. Zölsmann, Gg. Voigt, K. v. Schedel, Ant. 
Ertheiler sr., L. Palm, Gg. Süfs, W. v. Puscher. Zahl der 
ordentUchen Mitgheder incl. auswärtiger 404, deraufserordenthchenll. 

Von ihren korrespondierenden Mitgliedern verstarben 3: die 
Herren Dr. Müller, Univers.-Prof. in Jena; Dr. Rehm, Medic.-Rat 
in Memmingen; G. Wörlein, Zahlmeister in München; Zahl der 
Mitgheder Ende 1900: 40. 

Von ihren 20 Ehrenmitgliedern wurden der Gesellschaft 2, 
nämhch die Herren Prof. Dr. Surringar (Direktor des botan. Gartens 
in Leyden) mid Herr A. Müller, eines der langjährigsten und treuesten 
Mitgheder der Gesellschaft, durch den Tod entrissen. Wie die Ge- 
sellschaft den Namen der Dahingeschiedenen hier in ihrem Bericht 
ein bleibendes Gedächtnis stiftet, so werden dieselben dem Kreise 
der Mitgheder in ehrenvQller Erinnerung bleiben. 

Die Vorstandschaft bheb die gleiche wie bisher. 

Von der Möghchkeit, als aufserordentliches MitgUed der Gesell- 
schafl beizutreten, wurde im verflossenen Jahr nur ein mäfsiger Ge- 
brauch gemacht. Die Arbeiten der einzelnen Sektionen, wurden mit 

Digitized by VjOOÖIC 



regem Eifer fortgeführt; näherer Aufschlufs hierüber findet sich in 
den Sektions-Berichten. 

Der Besuch der Sammlungen von Seiten der verschiedenen 
Schulen und Lehranstalten war wieder ein recht erfreulicher. Es 
besichtigten etwa 20 Klassen mit zirka 700 Schülern unser Museum; 
auch der Besuch seitens Erwachsener an den Tagen freien Eintritts 
war zufriedenstellend. Eine noch zahlreichere Benützung unserer 
reichhaltigen Sammlung wird freilich erst dann eintreten, wenn end- 
lich einmal unsere Gesellschaft in den Stand gesetzt wird, aus der 
Misere des immer drückender werdenden Raummangels und der da- 
durch bedingten geradezu unwürdigen Unterbringung ihrer wertvollen 
Sammlungen herauszukommen. Letzteres ist nur durch opferfreudiges 
Eingreifen aller für die Ziele unserer Gesellschaft und die Förderung 
naturhistorischer Volksbildung begeisterten Kreise, sowie durch eine 
reichbemessene Unterstützung von Seiten der städtischen Verwaltung 
zu erhoffen. 

Dem speziellen Nachweis über die Thätigkeit in den wöchent- 
lichen Gesellschaftssitzungen schicken wir voraus den Ausdruck herz- 
lichen Dankes gegenüber denjenigen, welche durch Vorträge, Referate 
und Demonstrationen, sowie durch Geschenke zur Belehrung der 
MitgUeder und zur Bereichenmg der Sammlungen beitrugen. Zu be- 
sonderem Dank aber sind wir verpflichtet gegenüber Herrn Universitäts- 
professor Dr. Fleisch mann in Erlangen, der an 3 Abenden uns 
mit ausführlichen Vorträgen biologischen Inhalts imd mit daran sich 
anschliefsenden höchst interessanten Demonstrationen erfreute; femer 
Herrn Prof. Dr. Sohlered er in Erlangen für die freundliche Führung 
der Mitglieder durch den botanischen Garten in Erlangen; Herrn 
Kinkel in für seine mühevolle aufopfernde Thätigkeit in Präparierung 
und Konservierung teils gekaufter, teils von ihm geschenkter Rep- 
tilien; ferner Herrn V. Schultheifs für eine grofse Anzahl schöner 
Sukkulenten, die derselbe zum Besten des Archäopteryx gestiftet 
hat. Endlich sei hier erwähnt, dafs durch die unermüdUche Thätig- 
keit der anthropologischen Sektion die Durchforschung der Grab- 
hügel in der Beckerslohe mit höchst erfreuHchem Resultate zum 
Abschlufs gebracht würde; die Gesellschaft ergreift diese Gelegen- 
heit, um dem Stiftungsadministrator Herrn Freiherm v. Behaim für 
die bereitwillige Überlassung der betr. Grabhügel den ergebensten 
Dank auszusprechen. Auch die chemische Sektion hat sich um die 
Gesellschaft ein wesentliches Verdienst erworben dadurch, dafs sie 
einem auch in den allgemeinen Sitzungen längst schon lebhaft em- 
pfundenem Bedürfnifs eines praktischen, mit Gas- und Wasserleitung 

Digitized by VjOOQIC 



zweckentsprechend aptierten Experimentiertisches durch Schenkung 
eines solchen entgegengekommen ist. Desgleichen wird für die Rück- 
gabe von 6 Schuldscheinen bestens gedankt. 

Schliefslich hat der diesjährige Bericht noch den sehr erfreu- 
lichen Erfolg der schon wiederholt an ein kgl. Staatsministerium, 
sowie an die Kammer der Abgeordneten gerichteten Bitte um einen 
Zuschufs aus Staatsmitteln im verflossenen Jahr zu verzeichnen. Es 
wurde unserer Gesellschaft für die laufende Finanzperiode d. J. für 
die Jahre 1900 und 1901 je 400 ^ bewilligt. Die Gesellschaft 
spricht hiefür den erfreulichsten Dank aus, des;:leichen für die im 
verflossenen Jahre vom Staate fortbewilligte Unterstützung von 
300 X aus den Mittehi des Kreises Mittelfranken und von 600 Ji 
von Seiten der beiden Kollegien unserer Vaterstadt. Wie alljährlich 
haben wir auch in diesem Bericht noch die Bereitwilligkeit zu 
rühmen, womit die verehrUchen Redaktionen des Fränkischen Kurier, 
des General- Anzeigers und der Nord bayerischen Zeitung die Pro- 
tokolle unserer Sitzungen veröffentlichten. Dem im Folgenden über 
die einzehien Sitzungen auf Grund der Protokolle gegebenen Spezial- 
Nachweis sei vorausgeschickt, dafs über den literarischen Einlauf 
jeweils von Seiten des Direktors referiert wurde. 

Verzeichnis der in den Sitzungen des Jahres 1900 gehaltenen Vortrftge, 
Referate und Demonstrationen. 

m 

1. Sitzung am 3. Januar: 

Herr Kinkel in, Schenkung und Demonstration einer Agama bibroni 
aus Marokko; 

» Schlegel, Vorlage einer Reihe von Photographien und An- 
sichtskarten aus Singapore, gesandt von Herrn Apotheker 
Mayr dortselbst; 

» Schwarz, über Ektoparasiten der Pferde, Schafe und Hunde 
aus der Klasse der Insekten; 

» Dr. Stadlinger, über zwei Arten von Bakterien unter Vor- 
zeigung von Präparaten. 

2. Sitzung am 10. Januar: 

Herr Kinkelin, Demonstration eines lebenden Varanus varius aus 
Neuholland ; 
» Schwarz, über eine für unsere Gegend neue Form von 
Chrysanthemimi inodorimi, übersandt durch Herrn Professor 
Dr. Fischer in Bamberg, dann über die Verbreitung der 
Gentianeen unseres Florengebietes; 

Digitized by VjOOQ IC 



6 

Herr Schwarz, Vorlage von Schenkungen für Bibliothek und 
Sammlung. 

3. Sitzimg am 17. Januar: 

Herr Seel, Vortrag über »Schönheitsgesetze im menschlichen und 
tierischen Körper»; 
» Dr. Heerwagen, Vorlage von Schenkungen der Herren 
Pfarrer Rudel, Bauriedel und cand. med. Lotthammer. 

4. Sitzung am 24. Januar: 

Herr Dr. He erwägen, Referat über eine Abhandlung von Palmer, 
die Einwanderung fremder Wirbeltiere in Nordamerika 
betreffend ; 

> Schwarz, über ein neues Vorkommen von Ornithogalum 

nutans und über die Anatomie des Pferdefufses; 
» Schwarz und Dr. Heerwagen, Vorlage von Geschenken 
der Herren Dr. Oefele und Apotheker Kinkelin. 

5. Sitzung am 31. Januar: 

Nach Schlufs der ordentlichen Generalversammlung erfolgt die 
Aufnahme einer Anzahl neuer Mitglieder. 

6. Sitzung am 7. Februar: 

Herr Kinkelin, Schenkung eines schwarzen Leguan, Cxenosaura 
acanthura; * 

» Dr. Küspert, Vortrag über Anatomie und Physiologie der 
Wurzeln, unter Vorführung von Zeichnungen und mikro- 
skopischen Präparaten. 

7. Sitzung am 14. Februar: 

Herr Engelhardt, Vortrag über eine Wanderung im südlichen 
Tirol, durch Judicarien und Oberitalien, unter Vorlage von 
Photographien; 

> Sebald, Vorlage eines Homissennestes, Geschenk des Herrn 

Hans Freiherrn Ebner v. Eschenbach. 

8. Sitzung am 21. Februar: 

Herr Dr. Küspert, Vortrag über » Kohlensäure Verflüssigung « ; 

* Schwarz, Vorlage von Geschenken für die Bibüothek und 
geognostische Mitteilungen aus hiesiger Gegend; 

» Kinkelin, Demonstration eines japanischeu Zierfisches, ge- 
schenkt durch Herrn Weid und verschiedener Palmen- 
früchte, geschenkt durch ihn selbst. ^ , 

Digitized by VjOOQ IC 



9. Sitzung am 28. Februar : 

Herr Kinkelin: Demonstration eines lebenden Leguans aus 
Jamaika; 

> Schwarz, Vorlage verschiedener Präparate vom Fufs des 

Pferdes imd über pathologische Veränderungen desselben. 

10. Sitzung am 7. März: 
Herr Knapp, Vorlage einiger Geschenke; 

» Kinkelin, über den Ochsenfrosch; 
» Schwarz, Schenkung einiger Werke für die Bibliothek; 
» Dr. Heerwagen, Vorlage einiger Neuanschaffungen für die 
zoologische Sammlung; 

> Schwarz, Vorlage eines Kibitzpaares, Geschenk des Herrn 

Braumeisters Rogg. 

11. Sitzung am 14. März: 

Herr Dr. Heerwageit, Verlesung eines Briefes und Übergabe von 
Geschenken für die Bibliothek, eingesandt von Herrn 
Krapfenbauer in Manilla; 

> Kinkel in, Schenkung und Demonstration von Macroscincus 

coctaei von der Insel Branko; 
» Schwarz, Schenkung und Demonstration einer von ihm selbst 
entworfenen Tafel, die Anatomie des Pferdes veranschau- 
lichend ; 

> Zölsmann, Vorlage von Geröllsteinen aus der Trettach, resp. 

der thüringischen Saale; 
» Eckert, über Vergleichsauftiahmen des Sonnenspektrums imd 
Vorlage von Reproduktionen farbiger Darstellungen auf 
gewöhnhchen und sogen, orthochromatischen Platten. 

12. Sitzxmg am 21. März: 

Herr Schwarz, über fossiles Holz aus den Gruben von Ildehausen 
im Harz, resp. von Oberndorf bei Schwandorf; 

> Kinkelin, Vorlage und Besprechung einiger Neuanschaffungen 

der zoologischen Sektion; 
» V. Schultheifs, Demonstration einer Mamillaria mit Früchten; 

> Schwarz, über die Ausbildung der Blüten bei den Labiaten. 

13. Sitzung am 28. März: 

Herr Konsul Knapp, Übergabe eines Geschenkes für die Bibliothek; 

> Wunder jun., über Zell Wucherungen am tierischen und pflanz- 

Uchen Organismus; 

Digitized by VjOOQ IC 



Herr Kinkelin, Schenkung und Demonstration einer Agama stellio 
aus Ägypten; 
» V. Schultheifs, Demonstration einer Mamillaria pusilla 
texana; 

> Paalzow, Vorlage von Graptolithen aus den silurischen 

Schiefem des Vogtlandes und aus den silurischen Kalken 
Skandinaviens; 

• Wunder jun., Demonstration eines Präparates: »Biologie des 

Stichlings« ; 

• Dr. Küspert, Vorlage einer Sammlung von Nutzhölzern nebst 

ihren botanischen Merkmalen. 

14f. Sitzung am 4. April: 
Herr Kinkelin, Schenkung von Varanus varius (Shaw); 

» Dr. Heerwagen, Vorlage von Neuanschaffungen für die 
zoologische Sammlung. 

15. Sitzung am 11. April: 

Herr Dr. He erwägen, Übergabe einer Anzahl Reptilien, geschenkt 
von Herrn Reitmayer; 

> Kinkel in, Schenkung von Bufo arenarium und Rana halecina 

aus der Umgebung von New- York; 

• Wunder jun., über Krebs bei der Kiefer; 

> Knapp, Schenkung zweier Idole aus Cuba; 

» Wunder jun., über Hügelausgrabungen bei Labersricht; 

> A. Schmidt, über zwei von Herrn Fischereibesitzer Blümmel 

geschenkte Seeteufel (Lophius piscatorius) ; 

> Dr. Fleischmann, über die Anatomie des letzteren und 

Sektion eines solchen. 

16. Sitzung am 18. April: 

Herr Dr. Fleischmann, Vortrag über den Bau der Delphine unter 
Vorlage eines von Herrn Fischereibesitzer Blümmel ge- 
schenkten secierten Braunfisches; 
» Dr. Heerwagen, Vorlage zweier eigenartiger Bilder (Stern 
aus Käfern, Blumenbouquet aus Schmetterlingsflügeln), aus- 
gestellt von Herrn G. Greim in Bamberg; 

> Kinkelin, Vorlage einer Anzahl Exemplare des mittleren 

Weinschwärmers (Deilephia Elpenor). 

17. Sitzung am 25. April: 

Herr Dr. Heerwagen, über das sogen. »Seemoos«; 

» Huber, Referat über einen Besuch der Pariser Weltausstellung; 

Digitized by VjOOQIC 



9 

Herr V. Schultheifs, Vorzeigung von Mamülaria multiceps mit 
Früchten; 
» Erhard, Vorlage von Blumenabbildungen; 

* Dr. Heerwagen, Demonstration einer Löffelente (Anas clypeata), 

geschenkt von Herrn Kommerzienrat Sachs. 

18. Sitzung am 2. Mai: 

Herr Dr. Stadlinger, Vortrag über das Vorkommen und die Bild- 
ung von Pseudophit und Speckstein im Fichtelgebirg; 

> Kinkelin, Schenkung und Demonstration einer Wassernatter 

von Florida, Ischnognathus occipitomaculatus; 

> Schwarz, über die Biologie grüner Schmarotzer, dann Be- 

richt über die botanische Ausbeute eines Gesellschafts- 
ausfluges und Schenkung einiger Werke für die Bibliothek. 

19. Sitzung am 9. Mai: 

Herr V. Schultheifs, Demonstration von Sedum fruticosum im 
normalen und veränderten Zustand; 

• Hub er, Vorlage einer Kollektion konservirter Seetiere, ge- 

schenkt durch Herrn Oberleutnant v. Pechmann; 
» Schwarz, über Aecidium euphorbiarum ; 
» Kinkelin, Schenkung und Demonstration einer Zornnatter 

(Zamenis gemonensis). 

20. Sitzung am 16. Mai: 

Herr Dr. Heer wagen, Referat über Rein, Beiträge zur Kenntnis 
der spanischen Sierra Nevada; 

> Kinkelin, über den Furchenmolch (Necturus maculatus) aus 

Nordamerika ; 
» Erhard, Demonstration »explosionssicherer Gefäfse« für leicht- 

entzündUche Flüssigkeiten; 
» V. Schultheifs, Vorlage von Mamillaria elongata und Geb- 

weileriana; 
» Paalzow, Schenkung von Eisenoolith aus dem Dogger; 
» Schwarz, Botanische Mitteilungen. 

21. Sitzung am 23. Mai. 

Herr J. Wunder, Vortrag über die letzte Ausgrabung bei Labers- 
richt und Vorlegung der Funde; 

> V. Schultheifs, Vorlage eines schön blühenden Cereus; 

» Dr. Stadlinger, Vorlage imd Erläuterung einer Serie von 
Umwandlungsprodukten des Granit in Pseudophit und von 
Bergleder; 

Digitized by VjOOQ IC 



10 

Herr Kinkelin, über einige Reptilien, geschenkt durch Herrn 
Kommerzienrat Sachs; 
» Schwarz, über ein Vorkommen von Orchis mascula und über 
Ulmen in unseren Wäldern. 

22. Sitzung am 30. Mai: 

Herr Huber, zweiter Bericht über die Pariser Weltausstellung, 
illustriert durch eine gröfsere Zahl von Diapositiven; 

> V. Schultheifs, Vorlage von Amaryllis vittata und Gasteria 

trigona; 

> K i n k e l i n , Demonstration von Lacerta viridis, muralis, coerulea 

und bedriagae, geschenkt durch Herrn Kommerzienrat Sachs; 

» Hub er, Vorführung einer Anzahl von Phologrammen, Szenen 
aus dem chinesischen und japanischen Volksleben dar- 
stellend; 

» Knapp, Schenkimgen zur paläontologischen Sammlung. 

23. Sitzung am 8. Juni: 

Herr V. Schultheifs, Vorlage einer blühenden Gasteria maculata 
imd einer von Herrn Dr. Buchner eingesandten frucht- 
tragenden Opuntia; 

> Schwarz, über die wichtigsten Krankheiten des Weinslocks 

unter Vorlage einer von Herrn Dr. Appel entworfenen und 
von der Verlagshandlung geschenkten kolorierten Tafel; 

> Dr. Heerwagen, Schlufs des Referats über das Eindringen 

und die Vermehrung unserer Vögel in Nordamerika nach 
Palmer; 

> Kinkel in, Übergabe von Tropidonotus natrix var. persa und 

atra, geschenkt durch Herrn Kommerzienrat Sachs. 

24f. Sitzung am 13. Juni: 
Herr Enslin, Vorlage von Iris sibirica aus der Ziegelsteiner Gegend; 
» Schwarz, Demonstration von lebenden Ixodes ricinus; 

> Kinkelin, Demonstration von Testudo graeca und Coluber 

longissimus, geschenkt durch Herrn Kommerzienrat Sachs; 
» V. Schultheifs, Vorlage von Mamillaria Stella aurata, M. 

Boccasana Wildiana und eines blühenden Sempervivum 

arachnoideum; 
» Schwarz, Demonstration verschiedener für die Sammlung 

ausgestopfter Tiere, darunter eines Nasua sociahs, Geschenk 

des Herrn Markert. 

Digitized by VjOOQ IC 



u 

25. Sitzung am 20. Juni: 

Herr Dr. Stadlinger, über Ringbildung des Maischwamms; 
» V. Schultheifs, Vorlage einer blühenden Aloe verrucosa; 

> Kinkel in, Vorlage und Schenkung von Trionyx ferox von Ohio; 
* Huber, Vorführung einer Serie von Skioptikonbildem aus der 

Schweiz ; 
» Hoermann, Referat über die kulturelle Entvricklung Chinas. 

26. Sitzung am 27. Juni: 

Herr Dr. Leyh, über das vorweltLche Reptil Homoeosaurus von 
Solenhof en unter Vorlage eines Abdrucks; 

> Engelhard, Vorlage von Hainbuchenzweigen mit eichenähn- 

lichen Blättern, 

> Dr. Stadlinger, Demonstration einer Serie von Bakterien- 

präparaten; 

> A. Schmidt, Schenkung eines Ceratites nodosus aus dem 

Muschelkalk von Rothenburg; 
» Kinkel in, Demonstration und Schenkung eines amerikanischen 

Frosches Hyla versicolor; 
» V. Schultheifs, Vorlage eines blühenden Echinocereus pro- 

cumbens. 

27. Sitzung am 4. Juli: 

Herr A. Schmidt, Demonstration und Schenkung mehrerer Proben 
von Leitungskabeln für Telegraphen- und Fernsprechdienst; 

> Kinkelin, Vorlage eines sehr langen Exemplars von Vipera 

berus 9 vom Schmausenbuck; 

> Schwarz, Übergabe von Beiträgen zur lokalgeognostischen 

Sammlung und botanische Mitteilungen; 
» V. Schultheifs, Vorlage von Aloe aprica atrovirens und 

Haworthia cymbifoUa; 
» Dr. Stadlinger, Demonstration einiger Mineralien aus dem 

bayerischen Wald, geschenkt durch Herrn Dr. Schrenk; 
» L i n d n e r , Vorlage eines schönblühenden Phyllocactus Cooperi ; 

> Hoermann, Übergabe eines Schellenbogens, geschenkt für die 

ethnographische Sammlimg von Herrn Kohl in Offenhausen ; 

28. Sitzung am 11. Juli: 

Herr Rudel, Übergabe eines Blumengrufses aus dem Fichtelgebirg, 
übersandt durch Herrn Oskar Gebhardt in Marktredvritz ; 

> Dr. Stadlinger, Bemerkungen zur Frage über die künsthche 

Umwandlung von Phosphor in Arsen; ^ , 

Digitized by VjOOQ IC 



12 

Herr Paalzow, Demonstration paläontologischer Funde vom letzten 
Gesellschaftsausflug ; 

> Schul theifs, Vorlage von Aloe ciliata; 

> Kinkelin, Demonstration einer jungen Schnappschildkröte, 

Chelydra serpentina aus Mittelamerika; 
» Rudel, über Blattabnormitäten. 

29. Sitzung am 18. Juli: 

Herr Kinkelin, Demonstration von Pityophis melanoleucus aus 
Florida; 

> Schwarz, Vorlage einer Verbänderung von Pinus silvestris, 

geschenkt durch Herrn Meisenbach, über Verbreitung von 
Galinsoga parviflora und Bericht über einen stattgehabten 
Gesellschaftsausflug ; 

> V. Schultheifs, Demonstration einer blühenden Amaryllis 

hybrida vittata. 

30. Sitzung am 25. Juli: 

Herr Schwarz, Mitteilungen über verschiedene Pflanzen hiesiger 

Gegend (Matricaria suaveolens, Ornithopus perpusillus etc.); 

» Kinkelin, Vorlage verschiedener von ihm präparirter Seetiere, 

geschenkt von Herrn Oberleutnant v. Pechmann, und von 

Diplotaxis tenuifoUa; 

> Dr. Stadlinger, über Verwitterung des Granits und die da- 

durch bedingten Bildungen; 
» V. Schultheifs, Demonstration von Haworthia semimar- 
garitifera; 

> Schwarz, Bericht über einen Ausflug an den Glasschleif- 

weiher hei Roth. 

31. Sitzung am 1. August: 

Herr Kinkelin, Schenkung einer Wassernatter aus Spanien, Tropi- 
donotus viperinus; 
» Hoermann, Bemerkungen zu den gegenwärtigen Fremden- 
verfolgungen in China. 

32. Sitzung am 8. August: 

Herr Schwarz, über Morphologie und Vorkommen einiger Scro- 
phulariaceen; 

> Staedler, Demonstration lebender mexikanischer Seidenraupen, 

Attacus orizaba; 
» Kinkelin, über Tropidonotus fasciatus aus den Ver. Staaten; 

Digitized by VjOOQIC 



13 

Herr Dr. Heerwagen, Vorlage von Dasyurus viverrinus aus Queens- 
land, Creschenk des Herrn Apotheker Kinkelin; 

> V. Schultheifs, Vorlage von Mamillaria imbricata; 
» Schwarz, über Salvinia und AzoUa. 

33. Sitzung am 15. August: 

Herr Schwarz, Vorlage eines bei Vilseck erlegten Haubensteifsfufs, 

Podiceps cristatus, Geschenk des Herrn Franz Wilhelm; 

über die zeitliche Verschiedenheit phanerogamer Blüten, 

unter Vorführung von Rudbeckia laciniata; Vorlage von 

Geschenken ; 
» Kinkel in, Demonstration einer nordamerikanischen Natter, 

Tropidonotus ordinatus var. sirtalis; 
» V. Schultheifs, Vorlage von Stapelia variegata u. Agapanthus 

umbellatus im blühenden Zustand; 
» Kinkelin, Beantwortung einiger im Fragekasten befindlichen 

Anfragen ; 
» Schwarz, über die Biologie des Mutterkompilzes, Claviceps 

purpurea. 

34. Sitzung am 22. August: 

Herr Dr. Heerwagen, Vorlage einer Raupe von Acherontia atropos 
und zweier monströser Sporen einer Hühnerart, übersandt 
von Herrn Privatier Greiner in Steinach; 
» Wunder jun., vorläufige Mitteilungen über Ausgrabimgen in 
der Beckerslohe; 

> Paalzow, Vorlage von Pecten personatus aus dem Eisen- 

sandstein bei Trockau; 
» Dr. Heerwagen, Referat über verschiedene Arbeiten Köhlers, 

die Haustiere Chinas betreffend; 
» V. Schultheifs, Vorlage von Umbilicus spinosus. 

35. Sitzung am 29. August: 

Herr Dr. Heerwagen, Vorlage eines Amselweibchens, Geschenk 
des Herrn Verwalter Baumann; 

> Rudel, Seel und Schultheifs, Botanische Mitteilungen; 
» Knapp, Schenkung einer Perna aus der Südsee; 

» Hoermann, Vortrag über die Geschichte der Missionen in China. 

36. Sitzung am 5. September: 

Herr Dr. Heerwagen, Schlufs des Referats über die Haustiere in 
China nach Köhler; 

Digitized by VjOOQ IC 



u 

Herr Kinkel in, Demonstration und Schenkung einer amerikanischen 
Wasserschildkröte, Clemmys geographica aus Ohio; 

> Knapp, Schenkung zweier alter Werke über China und Japan; 

> V. Schultheifs, Vorlage eines blühenden Tanacetum bal- 

samita; 

> K. Hub er, Vorlage von Schenkungen zur Gesteinssammlung. 

37. Sitzung am 12. September: 

Herr Dr. Heerwagen, Vorlage von Geschenken für Bibliothek und 
Sammlung; 

> Dr. Stadlinger, Vortrag über den geologischen Aufbau der 

Gegend um die »schiefe Ebene«, unter Vorlage einer reich- 
haltigen Kollektion von Gesteinsproben; 

> Dr. Leyh, Vortrag über »Steinsalz im allgemeinen und speziell 

bei Windsheim«; 
» Kinkel in, über Biologie der Katzenschlangen imter Vorlage 
von Tarbophis fallax und vivax aus Dalmatien; Schenkung 
einer Tigerschlange (Python molurus). 

38. Sitzung am 19. September: 

Herr J. Wunder, Bericht über die Ausgrabungen bei Beckerslohe; 

> Knapp, Vorlage eines Geschenks für die Bibliothek; 

> V. Schultheifs, Demonstration von Euphorbia caputMedusae; 
» Wunder jun., über Carlina acaulis bei Erlenstegen. 

39. Sitzung am 26. September: 

Herr Dr. Heerwagen, Vorlage von Geschenken der Herren Scheuer- 
mann und Dr. Metzger für die Sammlungen; 

> Schwarz, über die als Zierpflanzen kultivirten Mohnarten; 

» Dr. Stadlinger, Vortrag über das Vorkommen von Eklogit 

im Fichtelgebirg; 
» Wunder jun., Vorlage von Mistehi auf Kieferzweigen von der 

Steinplatte bei Erlenstegen. 

40. Sitzung am 3. Oktober: 

Herr Dr. Leyh, Vortrag: »Ein geologischer Ausflug in das Thüringer 

Steinachthal« ; 
» Dr. Heerwagen, Vorlage eines Krokodileis, geschenkt von 

Herrn Ritter v. Stransky; 
» Kinkel in, Schenkimg von Tropidonotus piscator aus Palästina 

und eines Dauerpräparats von Armillaria mellea; 
» Schwarz, Bericht über zwei Geselbchaftsausflüge nach Simons- 

hofen und Erlangen zum Besuch des botanischen Gartens. 

Digitized by VjOOQIC 



16 

41. Sitzung am 10. Oktober: 

Herr A. Schmidt, Vorlage und Besprechung einer Reihe genieds- 
barer und giftiger Pilze; 
» Seel, Vorlage verschiedener blühender Zierpflanzen, ins- 
besondere DahUen in verschiedenen Farben; 
» Schwarz, Geologisch-botanische Mitteilungen aus dem heurigen 
.Manöver des 3. Armeekorps; 

> V. Schultheifs, Vorlage einer Frucht von Cereus peruvianus. 

42. Sitzung am 17. Oktober: 

Herr Dr. Küspert, Vortrag über die angebUche Umwandlung von 
Phosphor in Arsen; 

> Dr. Heerwagen, Vorlage von Schenkungen der Herren Prof. 

Schröder, Konsul Lambrecht und Konsul Knapp zur 
Bibliothek; 

> Dr. Finkh, über Vorkommen, physikalische und chemische 

Eigenschaften von Augit- Syenit, Laurockit, Anorthoklas 
und Turmalingranit unter Vorlage von Handstücken; 

> Dr. Heerwagen, über den Waldrapp (Geronticus eremita); 

> Kinkel in, Schenkung und Demonstration von Rana clamata 

aus Ohio und 2 Emys lutaria aus Italien; 

> Schwarz, Bericht über einen Gesellschaftsausflug nach Oster- 

nohe und auf den Schlofsberg; 

> Dr. Stadlinger, Vorlage eines angeblich prähistorischen 

Fundstückes. 

43. Sitzung am 24. Oktober: 

Herr Dr. Heerwagen, Vorlage von Geschenken der Herren Konsul 
Knapp, Apotheker Pfautsch und Braumeister Rogg; 

> V. Schultheifs, Demonstration von Hedychium Gardneriana; 
» Spandel, Vorlage von Planorbis comu aus dem Cyrenen- 

mergel von Offenbach und über Einbäume aus dem oberen 

Diluvium daselbst; 
» Dr. Heerwagen, Demonstration eines Gipsabgusses eines 

Aepyorniseis, Geschenk des Herrn Apotheker Landauer in 

Würzburg ; 
» Schwarz, über Gallen an Fichtenwurzeln, Ängesandt von 

Herrn Direktor Krell, und andere botanische Mitteilungen. 

44. Sitzung am 31. Oktober: 

Herr Dr. Stadlinger, Vortrag »Die Goldfrage in Vergangenheit, 
Gegenwart und Zukunft«; 
» Kinkelin, Schenkung von Cistudo Carolina aus Ohip^ ^ 

Digitized by VjOOQ IC 



16 

45. Sitzung am 7. November: 

Herr Dr. KQspert, Vortrag über die Creschichte der Begriffe Ele- 
ment und Atom; 

> Dr. Stadlinger, Vorlage der Photographie eines Mammuth- 

Schädels der Universitätssammlung in Erlangen; 

> Kinkel in, Demonstration einer Abgottschlange; 

» Schwarz, Vorlage von Agaricus atramentarius uud Myoma 
pura, sowie eines sehr grofsen Nierensteins vom Pferd. 

46. Sitzung am 14. November: 

Herr Paalzow, Vortrag über das Steinheimer Becken; 

> Ortmann, über die Varietäten von Chrysanthemum indicum 

und die Gewinnung neuer Spielarten, verbunden mit Aus- 
stellung einer reichhaltigen Kollektion von solchen; 

» V. Schultheifs, Demonstration einer blühenden Mamillaria 
gracilis ; 

» Kinkelin, Vorlage einer Entenmuschel (Lepas anatifera) und 
einer amerikanischen Schildkröte (Malacoclemmys terrapen); 

» Spandel, Mitteilungen geologischen Inhalts. 

47. Sitzung am 21. November: 

Herr V. Schultheifs, Vorlage von Euphorbia cordiformis und einer 
Verwachsung zweier Aloen; 

> Knapp, Vorlage von Pecten gracilis mit aufgewachsener Ser- 

pula und Hippocampus brevirostris von der kubanischen 
Nordküste; 
» Kinkelin, Demonstration von Ischnognathus occipitomaculatus 
aus Ohio. 

48. Sitzung am 28. November: 

Herr Dr. Fleischmann, Vortrag über »Das Steinheimer Becken 
und die Abstammungslehre«; 
» Kinkelin, Demonstration von Zamenis diadema, Tropidonotus 
saurita und Boa constrictor; 

> Dr. Heerwagen, Demonstration einer Reihe ausgestopfter 

Vögel, Geschenk des Herrn Benda in Adelaide; 

> Knapp, Schenkimg zur geognostischen Sammlung. 

49. Sitzung am 5. Dezember: 

Herr Dr. Prior, Experimental Vortrag über Theorie und Praxis der 
Bierbereitung. 

Digitized by VjOOQ IC 



_ p^ 

50. Sitzimg am 12. Dezember: 

Herr Schwarz, Bericht über einen Gesellschaftsausflug auf den 
Haidenberg und nach Kammerstein; 

> K in k e 1 i n , Demonstration von Varanus griseus, Agama inermis, 

Coluber leopardina, Coranella tringulum var. collaris; 
» Dr. Heerwagen, Demonstration für die Sammlung angekaufter 

ausgestopfter Vögel; 
» Schwarz, Vorlage einer Frucht von Pyrus japonica, über- 

sandt durch Herrn Gorpsstabsveterinär Zwengauer; 

> Dr. Ort mann, über den Export von Lilium longiflorum durch 

die Firma Boehmer & Co. in Yokohama; 

> V. Schultheifs, Vorlage einer pathologisch interessanten Alog. 

51. Sitzung am 19. Dezember: 

Herr Dr. Kant, Vortrag über »Die Zukunft der Steinkohle«; 

> Dr. Heerwagen, Vorlage einer Raupe von Satumia pyri, 

Geschenk des Herrn Dr. L. Koch; 
* Dr. Stadlinger, Schenkung eines Ölgemäldes, sehr natur- 
getreu ausgeführte Schmetterlinge darstellend; 

> Paalzow, Hoermann, Kinkelin, Vorlage von Geschenken. 



Ausflüge. 

Der erste Ausflug des heurigen Jahres, ein Nachmittagsausflug, 
fand am 29. April bei sehr zahlreicher BeteiUgung von Mitgliedern 
und deren Familienangehörigen ins Regnitzthal von Vach nach Er- 
langen statt. Nachdem die Bahn bis Station Vach benützt worden 
war, ging der FuTsmarsch zunächst gegen Mannhof und konnten bei 
Überschreitung des Landgrabenbaches die ersten blühenden Exem- 
plare von Corydalis solida besprochen werden. In Vach selbst stund 
die Pestwurz, Petasites ofQcinalis in Blüte. Nachdem einige Zeit 
der Besichtigung des Schlosses mit dem ehemaligen Schlofsgarten 
gewidmet worden war, wurde das linksseitige Gehänge des Regnitz- 
thales erstiegen, und ergab eine schöne Fernsicht auf den Erlanger 
Jura, auf die alte Klosterkirche von Gründlach und die Burg von 
Nürnberg. Veilchen in Blüte, Corydalis solida, hier auch in weifser 
Blütenmodification und die goldgelben Sterne der Gagea stenopetala 
erfreuten das Auge des Sammlers; auf dem weiteren Marsche im 
Thal machte Herr Dr. Küspert auf die Bildung der Senker Jj^i der, 

Digitized by VgiOOQlC 



18 

Brombere aufmerksam ; an der Eltersdorfer Brücke wurde das Thal 
verlassen und nach kurzem Marsch durch den Föhrenwald auf 
diluvialsandiger Unterlage ward Fräuenaurach bald erreicht. Hier 
wurde Rast gehalten, die alte ehemalige Klosterkirche mit einigen 
Ornamenten aus romanischer Bauzeit betrachtet und dann nach 
Brück marschiert. Ein Teil der Excursionsteihiehmer benützte hier 
die Bahn zur Heimfahrt, die andere Hälfte zog es vor, längs des 
Kanales nach Erlangen zu gehen; auf dieser Strecke wurden zwei 
durch das Räumen des Kanales ausgeworfene Muschelarten mit- 
genommen, in Erlangen Abendtisch gemacht imd dann die Rückkehr 
mit der Bahn bewerkstelligt. Im Ganzen hatte sich ergeben, dafs 
die überaus kalte Witterung des Frühjahres auf die Vegetations- 
entwicklung sehr verzögernd eingewirkt hatte. 

Der zweite, wieder sehr zahlreich besuchte Ausflug fand am 
17. Juni statt. Er war ein Tagesausflug und hatte den Besuch des 
Südteiles des Hetzleszuges zum Ziel. Die 25 Teilnehmer wurden in 
Hebens würdiger Weise von Herrn Universitätsprofessor Dr. Solereder 
durch den Erlanger Schlofsgarten geführt, wobei der sogenannte 
Emigrantenbrunnen und das Markgrafendenkmal besichtigt wurden. 
Herr Professor Solereder demonstrierte die Blütenverhältnisse von 
Impatiens parviflora und zeigte die grofsen Hexenbesen auf Quercus 
coccifera, auch der parasitäre Pilz: Peronospora Gorydalis auf 
Corydalis solida wurde besichtigt. Dann zog sich die Excursion auf 
dem Fufsweg längs der Schwabach nach der Schleifmühle hin und 
hier gelang es Herrn Leidig in den losen Sandäckern den Alectoro- 
lophus hirsutus in einem Prachtexemplar auszugraben, welches das 
parasitäre Leben dieses grünen Schmarotzers auf den Zaserwurzeln 
des Roggens, Seeale cereale überaus deutlich erkennen liefs. Nach 
Überschreitung des Flüfschens zog sich der Marsch durch Föhren- 
wald, wo zahlreich Melampyrum pratense, auch ein grüner Parasit, 
stund, nach Spardorf. Den Lehmgruben ober der dortigen Ziegelei 
wurde lange Zeit gewidmet, die Suche ergab wohl zahlreiche Fossil- 
resie aus dem Dogger und oberen Lias, aber für die Theorie eines 
glacialen Transportes an diese sekundäre Lagerstätte konnten keine 
triftigen Unterstützungsmerkmale konstatiert werden. Kurz vor Mar- 
loffstein wurde der formverändernde Exoascus in den Früchten der 
Schlehe gefunden, der später auf der Liashöhe auf den Zwetschgen- 
bäuraen noch ganz besonders häufig in Erscheinung trat Da in- 
zwischen etwas Regen sich eingestellt hatte, konnte die Aussicht 
vom weithinsichtbaren MarlofTsteiner Schlofs nicht in gewünschter 
Weise ausgenützt werden, dies machte sich auch auf>dem weiteren 

Digitized by V^jOOQ . 



19 

Blarsche geltend, indem auch die Aussicht vom Liasplateau nord- 
wärts nach Forchheim und Bamberg zu nicht rein war. Auf dem 
Marsch nach Ebersbach fand sich Trifohum ochroleucum und das 
prächtige Melampyrum arvense, der Ackerwachtelweizen, dieser aber 
auffallender Weise nicht, wie gewohnt, in Äckern, sondern in Menge 
in den saftigsten Wiesen. Hier war auch Gelegenheit, zahlreiche 
Formen schöner wilder Rosen zu sammeln. Auf dem weiteren Wege 
östlich Ebersbach fanden sich zahlreiche Eisensandsteinbrocken aus 
dem mittleren Dogger, dieses Vorkommen ist somit nicht auf Spar- 
dorf beschränkt. Dann zog sich der Weg nach Neunkirchen von 
der Liashöhe herab, wo die noch erhaltenen Thore und die Kirche 
in Augenschein genommen wurden imd Mittagsmahlzeit gemacht 
wurde. Von hier aus begann unter kundiger Führung des Herrn 
Richard Paalzow der Aufmarsch zum Jurasteilrand. In fast un- 
unterbrochener Reihe ergaben sich schöne Profile für die meisten 
den Rand unseres Jura bildenden Gesteinsschichten. Gleich ober- 
halb Neunkirchen, bei einer kleinen gotischen Kapelle traten in ein 
paar flachen Gruben intensiv rote Zanclodonletten zu Tage. Die 
auf diese Letten folgenden weifsen Sandsteine des Rhaet, die den 
Keuper und mithin im ganzen die Trias nach oben abschliefsen, 
konnten etwas höher in einigen Aufschlüssen beobachtet werden. 
Ein kleiner Steilrand zeigte endlich die gelblichen, grobkörnigen 
Sandsteine des unteren Lias, den Bucklandisandstein , wie ihn 
Sehr Ufer nennt nach Ammonites Bucklandi. Von hier führte der 
Weg z¥dschen Getreidefeldern und Hopfengärten, die das Gestein 
nicht zu Tage treten lassen, bis Grofsenbuch. In diesem Dorfe 
konnten wir in einigen sehr schönen Profilen sämtUche Schichten 
des oberen Lias, die Posidonienschichten mit der Monotisplatte und 
darüber die Jurensismergel, sehen. 

Beim weiteren Aufstieg zum Hetzlas, wozu wir jetzt den Weg, 
der über diesen Berg nach Rödlas und Ermreut führt, benutzten, 
kamen wir in das Gebiet des braunen Jura oder Dogger, dessen 
unterste Abteilung, der Opalinusthon , gleich oberhalb von Grofsen- 
buch beginnt und an den Wegrändern überall aufgeschlossen ist. 
Zahlreiche Kirschbäume stehen auf dieser Etage, sowie im unteren 
Teil der folgenden, dem Eisensandstein, der sich auch hier durch 
einen für diese Schichte so charakteristischen Hohlweg links wie 
rechts anstehend mit rostroter Farbe des feinkörnigen Gesteins zu 
erkennen gibt. Der Eisensandstein oder Personatensandslein, nach 
seiner Leitmuschel Pecten personatus, begleitete uns bis oberhalb 
eines kleinen Wäldchens, dort zeigen harte, gelbverwitternde undj 

Digitized by VjOOQIC 



2 

mit Fossilien, besonders Austernschalen und anderen Bivalven dicht 
bedeckte Kalksteine und gelbe Mergel an, dafs wir uns bereits in 
einer höheren Etage des braunen Jura befinden. Diese Schichten 
repräsentieren die Stufe des Ammonites Sowerbyi, die hier sehr 
mächtig entwickelt ist. In den gelben Mergebi konnten wir zahlreiche 
Stachelfragmente von Rhabdocidaris anglosuevica, Pentacrinitenglieder, 
Serpeki und Belemniten sammeln. Die auf die gelben Mergel folgen- 
den dunklen Kalke imd Thone vertreten die höheren Stufen des 
mittleren Dogger. 

Der obere braune Jura, der sogenannte Omatenthon, ist sehr 
mächtig auf dem Sattel, wo die Strafse ihren höchsten Punkt erreicht, 
entwickelt, und zwar findet sich hier, wie überhaupt auf der West- 
seite des Jurazuges von Lichtenfels bis in die Erlanger Gegend, 
vorzugsweise die tiefere Stufe des Ammonites macrocephalus. Die 
zahlreichen kleinen Goldschnecken — in Brauneisenstein umgewandelte 
Ammoniten, die häufig einen goldschillernden Schweielkiesüberzug 
haben — welche sich in diesen Thonen finden, erregen besonders 
das Interesse der Ausflugsteilnehmer, die sich mit grofsem Eifer mit 
dem Sammeln dieser hübschen Petrefacten beschäftigten. Besonders 
häufig fanden sich Macrocephalites macrocephalum und tumidum, 
Perisphinctes curvicosta und Oppelia subcostaria. 

Die Hochfläche des Hetzlas wird durch die obere Stufe des 
unteren weifsen Jura, den Werkkalk, gebildet, dessen kompakte 
weifse Bänke in einigen Steinbrüchen ausgebeutet werden. Da sich 
inzwischen auch das Wetter ganz aufgehellt hatte, genofs man von 
diesen Kalkbrüchen eine herrliche Fernsicht ins Ermreuter Thal und 
auf das ferne, weifse Schlofs Hilpoltstein sowohl, wie in die 
Eschenauer Gogend und den Kaichreuter Liaszug, sowie in weiterer 
Ferne auf die Hersbrucker Berge bis zum weit vorgeschobenen 
Moritzberg. Eine Serie parasitärer Pilze und das schöne Farmkraut 
Aspidium aeuleatum waren inzwischen auch gesammelt worden, auch 
auf der Plateauhöhe die Repräsentanten der Kalkflora, dann wurde 
der Abstieg auf demselben Wege bewerkstelligt und von Neunkirchen 
aus zur Rückkehr die Bahn benützt. 

Der dritte Ausflug, ein Nachmittagsspaziergang, bei dem die 
ohnehin nicht kleine Teilnehmerzahl in Schwabach sich noch mehrte, 
fand am 22. Juli statt und benützte die Bahn bis zur Station 
Büchenbach. Nachdem die Rednitz bei Pfaffenhofen überschritten 
war, ging man eine Zeitlang auf der Rother Strafse südwärts, wobei 
Verbaseum nigrum + Lychnitis gefunden wurde, bis zu der Stelle, 
wo der Brunnbach diese Strafse kreuzt. Hier stehen ethche Pappel- 

Digitized by VjOOQIC 



21^ 

bäume, die sich alle als Populus ontariensis ergaben, sodafs die 
Vermutang, dafs alle sogenannten Balsampappeln unserer Gegend 
nicht balsamifera, sondern ontariensis sind, weitere Unterstützung 
erhielt. Von hier gingen wir längs des Brunnbaches hinauf über 
diluvialen Sand, der aufser dessen charakteristischer Flora auch 
Euphrasia stricta ergab. Am Glasschleifweiher angelangt, wurde 
ab zahlreich vorhanden die schöne Seerose, Nymphaea semiaperta, 
konstatiert, der hübsche Teich lud zur Kahnfahrt ein und da ein 
Gewitter, das auf dem ganzen Herweg schon durch häufigen Donner 
gedroht hatte, nun auch mit erfrischendem Regenfall sich einstellte, 
so wurde an dem zum Bleiben ohnehin so einladenden Orte lange 
verweilt, in dem nun nassen Grase wäre ein weiteres Vorgehen den 
ßrunnbach aufwärts doch nicht mehr möglich gewesen. Gegen 
Abend hatte sich das Wetter wieder ausgehellt und bei herrlicher 
Luft wurde durch den Wald nach Roth marschiert, beim Verlassen 
des Waldes erfreute nicht nur ein prächtiger Regenbogen, sondern 
auch der Blick auf das nahe Roth, dahinter die Heydecker Berge, 
die Wülzburg, der Mäbenberg etc. Das alte wohlerhaltene Schlofs 
in Roth mit Burggraben, das ein Ansbacher Markgraf aus den Ein- 
künften seiner schlesischen Besitzungen erbaut hat und welches 
deshalb heute noch Ratibor genannt wird, wurde noch umgangen 
und dann die Heimkehr vom Bahnhof Roth aus mit der Bahn be- 
werkstelUgt. 

Der vierte Ausflug, ein Nachmittagsausflug am 26. August, 
erfreute sich einer noch höheren Teihiehmerzahl , als die vorher- 
gehenden. 36 Mitglieder und Gäste entstiegen in Lauf dem Zuge, um 
gleich oberhalb Lauf sich der sommerlich beleuchteten Landschaft 
mit dem Blick in den nahen Hersbrucker Jura zu erfreuen. Hier 
wurde das parasitäre Vorkommen der Puccinia Malvacearum auf 
der wilden Malve, dann die terrestre Form von Polygonum am- 
phibium in Blüte, gleich darauf das Schmarotzerleben der Cuscuta 
europaea auf Nesseln und Weiden demonstriert, ein Weiher bei 
Heuchling ergab Potamogeton obtusifolius und die morgensternähn- 
lichen Fruchtstände des Igelkolbens, Sparganium ramosum. Noch 
vor Eintritt in den Wald stellte sich Centaurea nigra ein. Völlig 
unaufgeklärt bleibt es, dafs diese Pflanze, sonst nirgends im Floren- 
gebiet vorhanden, nördlich von Lauf ein dichtbesetztes, geschlossenes 
Verbreitungsgebiet besitzt, welches mit dem hellgelben Sand zer- 
fallenen Rhaetsandsteines begiimt und in die schweren Lehmböden, 
die ans der Vervntterung des mittleren und oberen Lias entstehen, 
bis Tauchersreut sich erstreckt, also Bodenschichten einschliefst, die j 

Digitized by VjOOQLC 



22 

in physikalischer wie chemischer Beziehung die gröfsten Verschieden- 
heiten zeigen; geschlossene Verbreitungsgebiete sind sonst doch fast 
nur auf eine und dieselbe geologische Stufe beschränkt Der Wald 
am Wege nach Dehnberg ergab die immer mehr sich, einbürgernde 
aus Nordamerika stammende Stenactis annua oder nach ihrer Ähn- 
lichkeit in der Blüte mit Bellis perennis, dem Gänseblümchen, auch 
bellidiflora genannt. Zwischen Dehnberg und Höflas erfreute der 
Ausblick auf den gegenüberliegenden Jurazug von Gräfenberg bis 
zur Festungsruine Rothenberg, dann wurde die Liashöhe verlassen, 
ein Umgang um den Höflaser Weiher gemacht und dann auf den 
schwarzen Bach zu marschiert, welcher im folgenden der neuen 
Laufer Wasserleitung entlang die Richtung angab. Eine Herde 
schellenbögengeschmückter Kühe kam eben Herrn Hörmann recht 
in den Weg zu weiteren einschlägigen Studien. Auf dem Wald- 
marsch erfreuten sodann die gelbleuchtenden Blütenköpfe der Arnica 
montana, dann konnte Herr Wunder einen praehistorischen Grab- 
hügel demonstrieren und nachdem die in dieser ganzen Gegend eine 
Rolle spielende Latsche, Pinus Pumilio sich viermal eingestellt hatte, 
war der Ort Simonshofen, unser Ziel, bald erreicht. Nach einiger 
Rast brach man wieder auf, um die beiden grofsen Weiher zu um- 
gehen. Alsbald fand sich Oryza clandestina mit sehr entwickelter 
Blütenrispe und von den schönen braunsammtenen Kolben der Typha 
angustifolia wurde zur Zimmerdekoration manches Stück abge- 
schnitten und mit heim genommen; am unteren Weiher blühte 
Ranunculus Lingua, die gröfste unserer Ranunculusarten, zahlreiche 
Taucherlein, Podiceps minor tunmielten sich auf der klaren Wasser- 
fläche, eine herrliche Abendbeleuchtung vergoldete den nahen Hans- 
görgelberg und die ferne Hubirg, dann trat man bei einbrechender 
Dunkelheit den Rückmarsch an nach Lauf behufs Abendmahlzeit, 
und Benützung der Bahn zur Rückfahrt. 

Der fünfte Ausflug am 30. September, ebenfalls ein Nach- 
mittagsausflug war der Besichtigung des botanischen Universitäts- 
garten zu Erlangen gewidmet. In bekannter Liebenswürdigkeit führte 
Herr Universitntsprofessor Dr. So lere der die zahhreichen Teinehmer 
nicht nur durch die Freilandanlagen, sondern auch durch die Ge- 
wächshäuser, dabei in klarem Vortrag zahlreiche biologische und 
morphologische Verhältnisse erläuternd. Gleich zu Beginn konnte 
man die Blattbewegung der Fliegenklappe, Dionaea muscipula be- 
wundem, auch andere Insektenverspeisende Pflanzen, wie Drosera, 
Aldrovandia kamen zur Demonstration, die sonderbaren schwammigen 
Luftwurzeln einer fremdländischen Onagrariacee, die eigentümlichen 

Digitized bj 



23 

Gefäfskryptogamen Azolla, Salvinia, Marsilea, Pilularia und vieles 
vieles andere hatten wir zu besichtigen Gelegenheit; es ist hier 
nicht der Raum vorhanden, aufzuzählen was alles noch gezeigt 
wurde, eines aber steht fest, dafs alle Teilnehmer, denen sich nach 
Ankunft des Bamberger Zuges noch Herr Landauer aus Würzburg 
and Herr Vi 11 aus Bamberg angeschlossen hatten, diese Stätte 
der Wissenschaft mit dem Gefühle verhefsen, unter vorzüglicher 
Führung Hochinteressantes in grofser Menge gesehen und kennen- 
gelernt zu haben. 

Der sechste Ausflug, am 14. Oktober mit dem 11 Uhr-Zug 
nach Schnaittach begonnen, galt der Ruine Osternohe. Er war 
leider nicht vom Wetter begünstigt, und bei dem schon während 
der Bahnfahrt sich einstellenden Regen war man sich von vorne- 
herein klar, dafs der Wald- und Wiesen weg nicht mehr zum An- 
marsch zu benützen war ; so benützte man von Herdersdorf, wo an 
der Hand von Odontitis serotina über den Saisondimorphismus ver- 
schiedener Pflanzen gesprochen wurde, die schon sehr nafs gewordene 
Strafse zum Anmarsch nach Osternohe, bei welcher Gelegenheit 
Uncinula Aceris einen ganzen Mafsholderstrauch bedeckend, be- 
sichtigt wurde. Trotz trüber Witterung bestieg man sodann den 
Ostemoher Schlofsberg, erfreute sich an den mächtigen epheu- 
bedeckten Dolomitfelsen in der obstreichen Ortschaft Schlofsberg 
und betrat bei strömendem Regen die malerisch zerfetzte Burgruine 
und dann noch die Höhe ober derselben. Hier erfreute der mit 
kirschroter Farbe von dem dunklen Laub abstechende Arillus der 
Eibe, Taxus baccata, der Tintenpilz, Rhytisma acerinum auf Spitz- 
imd Bergahom wurde besichtigt, dann aber der Abstieg gemacht in 
die Wirtschaft zu Osternohe, woselbst ein wohldurchwärmtes Zimmer 
und gute Verpflegung nicht als etwas überflüssiges empfunden wurde. 
So hatte die Ungunst der Witterung, Regen und Oktoberwind zwai- 
die botanische Ausbeute und die Aussicht in diesem herrlichen 
W^inkel das Jurazuges wesentlich beeinträchtigt, eines aber litt nicht 
darunter: die fröhhche Stimmung der Ausflügler, welche sich vor- 
nahmen, bei besserer Jahreszeit wieder zu kommen. 

Auch der siebente, der letzte Ausflug des heurigen Jahres, 
war wegen ungünstiger Witterung mehrmals verschoben worden, 
bis er am 25. November doch noch zur Ausführung kam. In 
Schwabach schlössen sich den Nürnberger Teilnehmern noch zwei 
liebe Gäste an, dann ging es durch die Meisenlach, wo Herr 
Rudel junior ein Goldhähnchen, Regulus flavicapillus, fand, nach 
Obermainbach. Jenseits der Ortschaft beginnt sofort der Wald, wo 

Digitized by VjOOQ IC 



24 

Peplis Portula noch zu Gnden war, anfangs Föhrenwald, wird er 
an der sogenannten langen Wiese zum herrlichen, dunklen Fichten- 
wald, smaragdgrün deckt die dichte Moosdecke den feuchten Wald- 
boden, zierliche Cladonien stehen am Strafsengraben und von den 
Bäumen hängt, wie ehrwürdiger Greifsenbart, Bryopogon jubatus 
herab. Auf der ansteigenden Neppersreuter Waldschneufse erreichte 
man an der Kreuzeiche die Höhe des Haidenberges , ein kleiner 
Aufschlüfs rhaetischen Keupers orientierte über die geognostische 
Schichtenhöhe, Potentilla procumbeus blühte noch in ethchen 
Exemplaren, auch Blechnum Spicant hatte seine regelmäfsigen Farrn- 
wedel noch frischgrün bewahrt; dann besuchte man die Anlage der 
Douglasfichten, Tsuga Douglasii, nahm Abschied von dem Hügelland, 
von dem die malerische Burg Abenberg aus herbstlichem Grau 
herübergrüfste und trat den Rückmarsch an nach Kammerstein. 
Hier stiefs noch Herr Eckert, der inzwischen zwei gelungene 
photographische Aufnahmen des hochgelegenen Kirchleins von 
Kammerstein gemacht hatte, zu uns. Bei der Rast in Kammerstein 
kam selbstredend wieder die frühgeschichtliche Bedeutung des Haiden- 
berges zur Sprache, die isoUerte Lage des waldbedeckten Höhenzuges, 
das Zusammenklingen des Namen Haidenberg und Opferplatte für 
dessen südlichen Zug, den mifsverstandene Schreibweise heutzutage 
Ofenplatte benennt, mit den Ortsnamen Götzenreut und Haag gibt 
eine merkwürdige Parallele zur hohen Neubürg im Mistelgau, an 
deren Fufs auch ein Wohnsgehaig, ein Frankenhaag liegen, das alles 
kann kein Zufall sein! Trotz eingetretener Dunkelheit war auf der 
breiten Landstrafse der Rückweg nach Schwabach leicht zu finden. 
So schlofs, wie vorigen Jahres, auch heuer wieder der Haidenberg 
die Reihe der Ausflüge. Wie kein anderer Platz ist dieser geeignet, 
noch im Spätherbst den Besucher zu erfreuen, seine Moosdecke, 
sein Tannengrün lassen nochmal auf kurze Zeit vergessen, dafs : 
Der Wandrer mufs scheiden. 
Der Sommer ist hin. 
Wir kehren heim, doch wir kommen wieder. 
Wenn der Kuckuck ruft, wenn erwachen die Lieder, 
Wenn mit Blumen die Erde sich kleidet neu, 
Wenn die Brünnlein fliefsen im Ueblichen Mai! 

A. S. 



Digitized by LjOOQ IC 



26 



BibUotheksbericht für 1900. 

Im abgelaufenen Jahr vermehrte sich der Bestand der BibUothek 
um 108 Einlaufe; die letzte Nummer ist 3995. Es befinden sieh 
danmter, wie in den Vorjahren, zahlreiche Separatabdrücke, welche 
der Gesellschaft zugeeignet wurden von den Herren Dr. 0. Appel, 
Oberlandesgerichtsrat Arnold, Paul Bauriedel, Dr. Rud. Blasius, 
Hermann Eckert, Dr. Gordon, Prof. Dr. A. Heerwagen, 
Dr. Kaul, Dr. F. Kinkelin, Prof. C. B. Klunzinger, M. Lotter, 
Prof. Dr. P. Magnus, Dr. R. A. Philippi-Santiago, Dr. H. 
Rehm, Dr. P. Rein ecke, Prof. Dr. E. Selenka, Dr. Herrn. 
Sladlinger, Prof. Dr. Fr. Wagner. Die Sektion des D.-Österr. 
Alpenvereins und der Stadtmagistrat Nürnberg ehrten die Gesellschaft 
durch Überreichung ihrer Festschriften. 

Der Schriftenaustausch führte der Bibliothek 657 Sen- 
dungen zu. Erfreuhcherweise hat wieder eine Anzahl auswärtiger 
Gesellschaften unsere in den beiden Vorjahren ergangenen Ein- 
ladungen zum Tauschverkehr angenommen, während andere 4 Ge- 
sellschaften ein gleiches Ersuchen an uns richteten, welchem Folge 
geleistet wurde. Wir sind jetzt mit 278 Gesellschaften im Schriften- 
austausch. 

Die an die Mitglieder unserer Gesellschaft dauernd gerichtete 
Bitte, um Überlassung älterer Jahrgänge unserer Abhandlungen 
hatte mehrfachen Erfolg. Es wäre sehr erwünscht, wenn auch 
weiterhin solche Schenkungen erfolgen würden. Ausgeliehen wurden 
104 Werke an 85 Entleiher. 



Verzeichnis der Körperschaften, mit denen wir im Schriftenaustausch 
stehen und der Einsendungen, die uns 1900 zugegangen sind: 

Europa 

Dentsekes Beiok 

Altenburg — Naturforschende Gesellschaft des Osterlandes. 
Annaberg — Annaberg-Buchholzer Verein fQr Naturkunde. 
Ansbach — Historischer Verein für Mittelfranken. 
Augsburg — Naturwissenschaftlicher Verein fiir Schwaben und Neu- 
burg: 34. Bericht 1900. 
Bamberg — Gewerbeverein. 

» — Naturforschende Gesellschaft: XVII. Bericht (1899). 

Bautzen — Naturwissenschaftliche Gesellschaft >Isis«. 

Digitized by VjOOQ IC 



26 

Berlin — Botanischer Verein der Provinz Brandenburg: Verhand- 
lungen 41. Jahrg. 1899. 

— Deutsche geologische Gesellschaft: Zeitschrift 51. Band 
3. 4. Heft; 52. Band 1.-3. Heft. 

— Entomologischer Verein: Berliner entomolog. Zeitschrift 
45. Band. 

— Gesellschaft naturforschender Freunde: Sitzungsberichte 
Jahrg. 1899. 

— Kgl. preufsisches meteorologisches Institut: Bericht 1899; 
Ergebnisse d. Beobachtungen a. d. Stationen II. u. III. Ord. 
1895 Heft III; 1899 Heft I II; Ergebnisse d. Niederschlags- 
Beobachtungen in d. Jahren 1895 u. 1896; Ergebnisse der 
Gewitter-Beobachtungen im Jahre 1897; Hellmann, Regen- 
karte d. Prov. Ostpreufsen, Westpreufsen u. Posen. 

Bonn — Niederrheinische Gesellschaft für Natur- und Heilkunde : 
Sitzungsber. 1899 2. Hälfte. 
» — Naturhistorischer Verein der preufsischen Rheinlande, 
Westphalens und des Regierungsbezirks Osnabrück : Ver- 
handlungen 56. Jahrg. 
Braunschweig — Herzogliches naturhistorisches Museum. 

> — Verein für Naturwissenschaft: Jahresber. VIII. 

Bremen — Naturwissenschaftlicher V^ein: Abhandlungen XVI. Bd. 

3. Heft. 
Breslau — Schlesische Gesellschaft f vaterländische Kultur : 76. Jahres- 
bericht 1898. 
Chemnitz — Naturwissenschaftliche Gesellschaft: Vierzehnter Be- 
richt 1896-1899. 
Dan zig — Naturforschende Gesellschaft: Schriften N. F. zehnten 

Bandes 1. Heft. 
Darmstadt — Verein ftir Erdkunde und der grofsherzogl. geologischen 

Landesanstalt: Notizbl. lY. Folge 20. Heft 1899. 
Dresden — Statistisches Bureau des kgl. Sachs. Ministeriums des 
Innern. 
> — Naturwissenschaftliche Gesellschaft Isis: Sitzungsber. 

und Abhandlungen Jahrg. 1871 Mai bis Juli; 1878 Jan. 
bis Juli; 1879 Jan. bis Juni; 1891 Jan. bis Juni; 1892 
Juli bis Dez.; 1899 Jan. bis Dez.; 1900 Jan. bis Juli. 
Dürkheim — Pollichia: Festschrift z. 60 jähr. Stiftungsfest. 
Düsseldorf — Naturwissenschaftlicher Verein : Mitteilungen 4. Heft : 
Festschrift d. 70. Versammig. d. d. Naturforscher u. 
Ärzte (in die Bibliothek überführt als Nr. 3931). 
E 1 b e r f e 1 d — Naturwissenschaftlicher Verein. 
Emden — Naturforschende Gesellschaft: 83. und 84. Jahresbericht 

für 1897/99. 
E r f u r t — Kgl. Akademie gemeinnütziger Wissenschaften : Jahrbücher 

N. F. Heft XXVI. 
Erlangen — Physikalisch-medicinische Societät: Sitzungsberichte 

31. Heft 1899. 
Frankfurt a. M. — Physikalischer Verein : Jahresber. f. d. Rechnungs- 
jahr 1898—1899. 
» — Senckenbergische Naturforschende Gesellschaft: 

Abhandlungen 20. Band 2. Heft ; 26. Band 1. Heft ; 
Bericht 1899. 
Frankfurt a. O. — Naturwissenschaftlicher Verein des Reg. -Bei. 
Frankfurt: Helios 17. Band; Soc. Litt. Jahr- 
gang XIII 1899. ^ T 

Digitized by VjOOQIC 



27 

Fulda — Verein för Naturkunde : Erstes Ergänzungsheft: Vonderau, 

Pfahlbauten 4^ (in d. Bibl. überf. als Nr. 3951). 
Giefsen — Oberhessische Gesellschaft für Natur- und Heilkunde. 
Görlitz - Naturforschendc Gesellschaft. 

» — Gesellschaft f. Anthropologie u. Urgeschichte d. Ober- 
lausitz: Tafel vorgesch. Altertümer d. Oberlausitz (in d. 
Bibl. überf. als Nr. 3988). 
Göttingen — Kgl. Gesellschaft der Wissenschaften ' und Georg 
Augusts-Universität : Nachrichten Mathem.-physik. Kl. 
1899 Heft 3; 1900 Heft 1 2; Geschäftl. Mitteilungen 
1899 Heft 1 ; 1900 Heft 1. 
Greiz — Verein der Naturfreunde. 

Guben — Niederlausitzer Gesellschaft für Anthropologie und Alter- 
tumskunde: Mitteilungen Band VI 2. bis 7. Heft. 
Güstrow — Verein der Freunde der Naturgeschichte in Mecklen- 
burg. 
Halle a. S. — Landwirtschaftliches Institut an der Universität: Be- 
richte a. d. physiol. Laboratorium 14. Heft (1899). 
> — Kaiserlich Leopoldino-Carolinische Deutsche Akademie 

der Naturforscher: Leopoldina Heft XXXVI. 
» — Verein für Erdkunde: Mitteilungen 1900. 

Hamburg und Hamburg-Altona — Naturwissenschaftlich. Verein : 
Verhandlungen 1899 III. Folge VII. 
> — Verein fdr naturwissenschaftliche Unterhaltung : Ver- 

handlungen 1896-1896 X. Bd. 
Hanau — Wetterauische Gesellschaft für die gesamte Naturkunde. 
Hannover -- Naturhistorische Gesellschaft. 
Heidelberg^ — Naturhistorisch-medizinischer Verein : Verhandlungen 

N. F. sechster Bd. 3. Heft (1899). 
Hof— Nordoberfränkischer Verein f. Natur-, Geschichts- und Landes- 
kunde : II. Bericht Jan. 1900. 
Karlsruhe — Naturwissenschaftlicher Verein : Verhandlungen 12. Bd. 
1898; 13. Bd. 1895 bis 1900. 
» — Badischer Zoologischer Verein: Mitteilungen 1900 

Nr. 1-7. 
Kassel — Verein för Naturkunde: Abhandlungen und Bericht XLIV 
über das 63. Vereinsjahr 1898—1899; XLV über das 64. 
Vereinsjahr 1899 - 1900. 
Kiel — Naturwissenschaft!. Verein für Schleswig-Holstein. 
» — Anthropologischer Verein in Schleswig-Holstein : Mitteilungen 
13. Heft. 
Königsberg i. Pr. — - Physikalisch-ökonom- Gesellschaft: Schriften 
40. Jahrg. 1899. 
» — Preufsischer Botanischer Verein : Jahresbericht 

1899/1900. 
Krefeld — Verein far Naturkunde. 
Landshut — Botanischer Verein. 

Leipzig — Kgl. sächsische Gesellschaft der Wissenschaften : Berichte 

über die Verhandl., math.-phys. Kl. 51. Bd. 1899 Heft 

I— VI; 52. Bd. 1900 I— V; naturw. Teil 1899; allgem. Teil 

1899; lahresber. 1900 d.F. Jablonowsky'schen Gesellschaft. 

» — Naturforschende Gesellschaft. 

» — Verein fQr Erdkunde: Mitteilungen 1899; wissenschaftl. 

VeröfTentl.: Ratzel, Geogr. d. mittl. Deutschland. 
Lüneburg — Naturwissenschaftl. Verein d. Fürstentums Lüneburg. 

Digitized by VjOOQIC 



28 

Magdeburg — Naturwissenschaftlicher Verein: Jahresber. und Ab- 
handlungen 1898—1900. ' 
Mainz — Rheinische naturforschende Gesellschaft. 

> — Römisch - Germanisches Centralmuseum : Bericht über die 
Vermehrung der Sammlungen des Vereins zur Erforschung 
der rheinischen Geschichte und Altertümer i. J. 1898/99. 
Mannheim — Verein für Naturkunde. 

Marburg — Gesellschaft zur Beförderung der gesamten Naturwissen- 
schaften: Sitzungsberichte Jahrg. 1898? Schriften Bd. 12, 
7. (Schlufs-) Abteilung; Bd. 13, 3. Abteilung. 
Metz — Verein für Erdkunde: XXII. Jahresbericht für das Vereins- 
jahr 1899—1900. 
München — Kgl. Bayer. Akademie der Wissenschaften : Sitzungs- 
berichte der mathem.-phys. Kl. 1899 Heft III; 1900 
Heft I u. IL 
» — Bayer. Botanische Gesellschaft: Berichte Bd. VII 1900 

I. u. II. Abteilung. 
» — Geographische Gesellschaft. 

> — Ornithologischer Verein. 

Münster — Westphälischer Provinzialverein für Wissenschaft u. Kunst. 
Neifse -— Philomathie. 
Nürnberg — Ärztlicher Verein. 

» — Germanisches Nationalmuseum: Anzeiger Jahrg. 1899. 

Mitteilungen Jahrg. 1899. 

> — Medicinische Gesellschaft und Poliklinik: XXI. Jahres- 

bericht für 1899; Sitzungsberichte 1899. 
» — Verein für Geschichte der Stadt Nürnberg. 

» — Verein für öffentliche Gesundheitspflege: Bericht über 

d. Gesundheitsverh. u. Gesundheitsanstalten i. J. 1898. 
> — Verein Merkur. 

Offenbach — Verein für Naturkunde. 
Osnabrück — Naturwissenschaftlicher Verein. 
Passau — Naturhistorischer Verein. 
Regensburg — Kgl. Botanische Gesellschaft. 

» — Naturwissenschaftlicher Verein: Berichte VII. Heft 

1898 u. 1899. 
Reichenbach — Voigtländ. Verein für allgem. u. spez. Landeskunde. 
Reutlingen — Naturwissenschaftlicher Verein. 
Schneeberg — Wissenschaftlicher Verein. 
Schweinfurt — Naturwissenschaftlicher Verein. 
Strafsburg i. E. — Direktion der geolog. Landes-Untersuchung v. 
Els.-Lothringen : Mitteilungen Bd. V Heft 1 u. 2. 
Stuttgart — Verein für vaterländische Naturkunde in Württemberg : 

Jahreshefte 56. Jahrg. 
Weimar — Thüringischer Botanischer Verein. 
Wernigerode — Naturwissenschaftlicher Verein des Harzes. 
Wiesbaden — Nassauischer Verein für Naturkunde: Jahrbücher 

Jahrg. 53. 
Würzburg — Physikalisch - medicinische Gesellschaft: Sitzungs- 
Berichte Jahrg. 1899 Nr. 1—7 u. Titelbl. 
» — Polytechnischer Zentralverein för Unterfranken und 

Aschaffen bürg : Gemeinnützige Wochenschrift 50. Jahr- 
gang 1900. 
Zerbst — Naturwissenschaftlicher Verein. 
Zweibrücken — Naturhistorischer Verein. 

' i c k a u — Verein für Naturkunde. ^ , 

Digitized by VjOOQ IC 



Tal 
- Ve 



öftanreiek-üigmn 

Agram — Hrvatsko Narovoslovno DruStvo: Glasnik godina VI— XI 

(1891-1899); god. XII broj 1—3 (1900). 
Aufs ig a. E. — Naturwissenschaftlicher Verein. 
Baden bei Wien — Gesellschaft zur Verbreitung naturwissenschaft- 
licher Kenntnisse. 
Brunn — Club für Naturkunde (Sektion d. Brünner Lehrervereines) : 

Zweiter Bericht f. d. Jahr 1899. 

> — K. K. mährische Landwirtschaftsgesellschaft. 

> — Naturforschender Verein : Verhandlungen XXXVII. Bd. 1898 ; 

XVn. Bericht d. metcor. Comm. 1897. 
Budapest — K. M. Termöszettudomänyi Tärsulat (K. U. naturwissen- 
schaftliche Gesellschaft). 
> — Rovartani Lapok (entomolog Monatsschr.) VII. Kötet 

1900 fazet 1— 18. 
Graz — K. k. Gartenbau - Gesellschaft in Steiermark: Mitteilungen 
25. Jahrg. 1900. 
» — Naturwissenschaftlicher Verein fftr Steiermark. 
» — Verein der Ärzte in Steiermark : Mitteilungen 36. Jahrg. 1899. 
Hermannstadt — Siebenbürgischer Karpathenverein : Jahrbuch 
XX. Jahrg. 1900 u. >Beilage«. 
> — Siebenbürgischer Verein f. Naturwissenschaften : 

Verhandlungen und Mitteilungen XLIX. Band 
Jahrg. 1899. 

/erein f. siebenbürgische Landeskunde : Archiv 
N. F. 29. Bd. 2. Heft; Müller, die Repser Burg; 
Jahresbericht f. d* Ver.-J. 1898/99. 
Innsbruck — Ferdinandeum für Tirol und Vorarlberg: Zeitschrift 
3. Folge 44. Heft. 
» — Naturwissenschaftlich-medizinischer Verein: Berichte 

XXm. Jahrg. 1896/97; XXV. Jahrg. 1899/1900. 
Klagenfurt — Naturhistorisches Landesmuseum für Kämthen. 
Klausenburg — (Kolozsvärt) — Siebenbürgischer Museumsverein: 
firtesitö XXrVövfolyam 1899 XXI.Kötetll-inFüzet. 
Laibach — Musealverein für Krain: Izvestja Letnik IX se$itek 1—6 

1899; Mittheilungen XII. Jahrg. Heft 1-6 1899. 
Linz — Museum Francisco-Carolinum : 58. Jahresber. nebst 52. Lief, 
der Beiträge z. Landesk. v. Österreich o. E. ; n. Nachtrag 
z. Bibl. Katalog. 
L w o w i e (Lemberg) — Towarzystwo Ludoznaw : Lud, rocznik sgöstv 
1900 ; Mtynek, zycie Sierskich Pasterzy (in d. 
Bibl. überf. u. Nr. 3991). 
Prag — K. Böhmische Gesellschaft der Wissenschaften: Sitzungs- 
berichte 1899; Jahresber. 1899. 

> — Deutscher naturwissensch.-medicinischer Verein fdr Böhmen 

>Lotos« : Sitzungsberichte 1898 46. Bd. (N. F. XVIII. Bd.) ; 
1899 47. Bd. (N. F. XIX. Bd.). 
* — Lese- und Redehalle der Deutschen Studenten : Bericht über 
d. J. 1899. 
Pressburg (Pozsony) — Verein für Heil- und Naturkunde: Verhand- 
lungen, Jahrg. 1899 N. F. XL Heft. 
Reichenberg — Verein der Naturfreunde: Mitteilungen 31. Jahrg. 
Salzburg — Städtisches Museum Carolino-Augusteum : Jahresberichte 
f. 1897 1898 1899. ^ j 

Digitized by VjOOQ IC 



30 

Sarajevo — Bosnisch - Hercegovinisches Landesmuseum : Wissen- 
schaftliche Mittheilungen aus Bosnien u. d. Hercegovina 
sechster Band 1899. 

Tri est — Societä adriatica di scienze naturali. 

Wien — Entomologischer Verein: 10. Jahresbericht 1899. 

— K. Akademie der Wissenschaften : Sitzungsberichte mathemat.- 
naturw. Cl. CVII. Band VI-X. Heft. 

— K. k. Gartenbaugesellschaft: Wiener illustr. Gartenzeitung 
1900 Heft 1 12. 

— K. k. geographische Gesellschaft : Mitteilungen 1898 XLII. Bd. 
(d. n. F. XXXII; Abhandlungen I. Bd. 1899; II. Bd. 1900. 

— K. k. geologische Reichsanstalt: Verhandinngen Jahrg. 1899 
Nr. 11—18; Jahrg. 1900 Nr. 1—10. 

— K. k. zoologisch-botanische Gesellschaft : Verhandlgn. Jahr- 
gang 1899 XLIX. Band. 

— Naturhistorisches Hofmuseum: Annalen Bd. XHI Nr. 2—4; 
Bd. XIV. 

— Natur wissenschaftl. Verein an der Universität. 

— Verein zur Verbreitung naturwissenschaftlicher Kenntnisse: 
Schriften XL. Bd. 1899/1900. 



SehweiB 

Basel — Naturforschende Gesellschaft: Verhandlungen Bd. XII Heft 2; 

Anhang d. Basler Chemiker Schönbein. 
Bern — Naturforschende Gesellschaft. 
[»] — Schweizerische Naturforschende Gesellschaft. 
Chur — Naturforschende Gesellschaft Graubündens. 
Frauen feld — Thurgauische naturforschende Gesellschaft. 
Gcn^vc — Le Conservatoire et le Jardin botanique : Annuairc 4 mo 

Annöe 1900. 
Lausanne — Sociötö Vaudoise des Sciences Naturelles: Bulletin 
4 e S. Vol. XXXV Nr. 131—137 ; Observations mötöoro- 
logiques Annöe 1898 XII c Ann^e. 
St. Gallen — Naturwissenschaftliche Gesellschaft: Bericht 1897—98. 
Solothurn — Naturforschende Gesellschaft. 

Zürich — Naturforschende Gesellschaft : Vierteljahrsschrift 44. Jahrg. 
1899 3. u. 4. Heft. 
> — Bibliothek der Schweizerischen Botanischen Gesellschaft: 

Berichte Heft X. 



Dlnemark 

Kjöbenhavn — Botaniske Forening i Kjöbenhavn : Botanisk Tidskrift 
21. Bind ; 22. Bind ; 23. Bind 1. Hefte^. 



Belgien 

Anvers — Acad^mie Royale d'Archöologie de Belgique: Bulletin 

5e S^rie des Annales VIII, IX. 
Bruxelles— Soci^t^ beige de Microscopie. 

> — Soci^t^ Royale de Botanique de Belgique: Bulletin 

Tome trente-huiti^me 1899 ; Comptes rendus des Scc- 
ances I 38 2e partie. ^ j 

Digitized by VjOOQ IC 



81 

Bruxelles — Soci^t^ Soyale malacologique de Belgique : Annales 
Tome XXXI Fase. 2 1896; Tom XXXlfl Fase. 2 1898; 
Bulletins S. XCVU— CXXVIII. 
» — Soci^tö Royale Linnöenne: Bulletin 25nae Ann^e Nov. 

1899 — Juillet 1900; 26roe Annöe Nr. 1 Nov. 1900. 



Frankreioli 

Cherbourg — Sociöt^ Nationale des Sciences naturelles et mathö- 

matique. 
Lyon — Sociöt^ botanique de Lyon: Annales Tome XXIV (1899). 
» — Soci^t^ Linn^enne de Lyon : Annales Tome 46e Ann^e 1899. 
Paris — Biblioth&que de laFeuille des jeunes Naturalistes: La Feuille, 
Ille Sörie, 2ie bis 30. Ann^e Nr. 351—360; Cataloques 
XXVni, XXDC. 
» — Soci^t€ d* Anthropologie de Paris: Bulletins Tome dixi6me 
(IVe Serie) 1899. Fase. 2-5. 
S e m u r (Cöte d'Or) — Soci^t^ des Sciences historiques et naturelles : 
Bulletin 3e S^rie Nr. 1 Annöe 1898. 



Orottbritannien 

Dublin — Royal Irish Academy. 
Glasgow — Natural History Society. 
London — Geological Society. 

Manchester — Geographical Society: The Journal Vol. XV Nr. 10 
bis 12; Vol. XVI Nr. 1 bis 6. 



Holland 

Amsterdam — Genootschoopp Natura Artis magistra. 

> — Koninklijke Akademie van Wetenschappen : Ver- 

handelingen Afd. Natuurkunde le Sectie Deel VII 

No. 1—5; 2e Sectie Deel VII 1—3. Zittingsverlagen 

Mei 1899 — Apr. 1900 Deel VIII. 

H a a r 1 e m — Mus^e Teyler : Archives S^r. II Vol. VII 5« Partie ; Vol. VII 

le Partie. 
Leyden — Nederlandsche Dierkundige Vereeniging: Tijdschrift 2de 
Serie Deel VI Afl. 3. 
» — Rijks Geologisch-Mineralogisch Museum : Serie I Beiträge 

zur Geologie Ostasiens und Australiens Bd. VI Heft 2. 
» [Nijmegen] — Nederlandsche Botanische Vereeniging : Neder- 
landsch Kruidkundig Archief Derde Serie 
2e Deel le Stuk. 



IteUen 

Brescia — Ateneo: Commentari 1899. 

Catania — Accademia Gioenia di Scienze Naturali: Atti Anno LXXVI 

1899 Vol. XII; BuUettino N. S. Fase. LIX bis LXIII. 
Firenze — Bibliotheca Nationale Centrale: Bolletino d. Public. Ital. 
Nr. 336—359 Indici 1899. ^ j 

Digitized by VjOOQLC 



Firenze — R. Istituto di Studi Superiori, Pratici e di Perfczion- 

amento : Pubblicazioni (Sezione di Medicina e Chirurgia) 

Trambusti: Ricerche s. midollo d. ossa n. ditterite; Chi- 

anigi : Studio dei nervi encef. ; Lustig : Vaccin. c. la Feste 

bubbo ; Staderini : Osserv. s. sviluppo de 4® ventric. ; 

(Sezione di Scienze fisiche e naturali) Botazzi : Sviluppo 

embrion. d. Funz. mot. ; Bottazzi: Fisiol. d. tessuto di 

cell. musc. 

> — Societä Entomologica Italiana: Bulletino Anno XXXI; 

XXXII 1900 Trim. I— lU. 

M o d e n a — Societä dei naturalisti : Atti 1899 S. IV. Vol. I Anno XXXII. 

Padova — Societä Veneto-Trentina di Scienze Naturali: Atti Anno 

1899 Serie U Vol. IV Fase. I. 
Pavia — Orto botanico, Istituto botanico dell' Universitä di Pavia: 

Atti II. Serie Vol. 1<>; 3^ bis 6« 
Pisa — Societä Toscana di Scienze Naturali: Atti, Proc. vcrb. Vol. XI. 

S. 159—178; Vol. XVH* 
Roma — R. Accademia dei Lincei ; Atti, S. V. Rcndiconti Vol. IX®. 

> — Bibliotheca nationale centrale Vittorio Emanuele. 
Torino — Accademia Reale delle Scienze: Atti Vol. XXXV 1899/1900 

la bis 15 a; Dr. Rizzo, Osserv. meteorol. 1899. 
Venezia — Reale Istituto- Veneto di Scienze, Lettere cd Arti: 

Memorie Vol. XXVI. Nr. 3 5. 
Verona — Accademia d'Agricoltura, Scienze, Lettere, Arti e Com- 
mercio: Memorie Serie HI Vol. LXXIV Fase. HI; Vol. 
LXXV Fase. I II; Nicolis: Marmi Pietre e Terre color.; 
Perez: Verona ed i suoi vini. 

Lnxembiirg 

Luxemburg — Sociötö botanique de Grand-duchd de Luxembourg. 
» — Fauna, Verein Luxemburger Naturfreunde : »Fauna« 

Mitteilungen 8. Jahrg. 1898; 9. Jahrg. 1899. 

Portncral 

Lisboa — Direc^äo dos Servigos Geolgicos de Portugal: Communi- 
ca^öes Tom HI [1895—1898]. 

BviBliiieii 

Bucuresci — Museulü de GeologiSi si de Paleontologia. 

BnstUad 

Dorpat — Naturforscher-Gesellschaft bei der Universität: Sitzungs- 
berichte Xn. Band 1898 2. Heft. 

Helsingsfors — Societas pro Fauna et Flora Fennica: Acta Vol. 
XV 1898—1899; XVII 1898-1899. 

Kiew — Naturforscher-Gesellschaft der Universität. 

Mi tau — Kurländische Gesellschaft f. Literatur und Kunst: Sitzungs- 
berichte und Jahresber. d. Kurland. Prov. Museums 1899. 

Moskau — Sociöt^ Imperiale des Naturalistes : Bulletin Ann^ 1899. 

Riga — Naturforscher -Verein: Korrespondenzblatt XLII; XLIII; 
Arbeiten N. F. Achtes Heft ; Neuntes Heft. ^ , 

Digitized by VjOOQ IC 



33 

St. Petersburg — Hortus petropolitanus : Akta Tomus XV Fase. 11; 
XVII I und II. 
* — Imperatorskaja Nauk : Iswjestiia Seria V Tom XI 

Nr. 1-5 ; Tom XU Nr. 1. 

Sehwedeii und Vorwehen 

Bergen — Museum : Aarbog for 1899 2det hefte ; 1900 Iste hefte ; 

Sars, Crustacea of Norway Vol. III Part. I~VIII. 
Cbristiania — Kgl. Norske Frederiks Universitet. 

• — Editorial Commitee of Den Norske Nordhavs-Ex- 

pedition 1876-1878, Professor H. Mohn, Det Me- 

teorologiske Institut: Zoologi XXV Thalamophora 

XXVI Hydroida XXVII Polyzoa. 

Göteborg — Kongl. Vetenskaps och Vitterhets-Samhället : Handlingar 

4 de Följden Tome 1 2dra haftet. 
Stavanger — Museum: Aarsberetning for 1899 lO^e Aargang. 
Stockholm — Kongliga Svenska Vetenskaps Akademien: ölversigt 
afFörhandlingar 1899 56. ärgängen; Bihang 25. Bandet 
Afdelning I— IV ; Handlingar 32. Bandet ; Joh. Müller, 
Briefe (in d. Bibliothek übergef. als Nr. 3979). 
» — Entomologiska Föreningen : Entomologisk Tidskrift 

arg. 20 1899. 
Tromsö — Museum: Aarsberetning for 1897. 

üpsala — Kongliga Universitets Bibliothek : Bulletin Vol. IV. Part. 2. 
1899 Nr. 8. 

Spanien 

Madrid — Sociedad Espailola de Historia Natural: Actas 1900 
Jan. — Octubre. 

Afrika 
Ägypten 

Le Caire — Institut figyptien : M^moires Tome IV Fase. I; Bulletin 
3e Serie Ann^e 1899 Fase. 10 No. 12 4/5; Livre d'Or, 
Text und Atlas. 

Amerika 

Argentinien 

Buenos Aires — Museo Nacional : Comunicaciones Tomo I No. 5—7. 
» — Deutsche Akademische Vereinigung : Veröifent- 

lichungen 1. Bd. Heft 1—3. 
Cordoba — Academia Nacional de Ciencias de la Republica Argentina. 
La Plata — Bureau g^nöral de Statistique. 

BeÜTia 

La Paz — Sociedad Geogräfica: Boletin Afto I Tomo 1 Nr. u. 2. 

Brasilien 

Parä — Museu Paraense de Historia Natural e Ethnographia : Boletim 

Vol. m No. 1. 
Rio de Janeiro — Museu Nacional: Revista Vol. I (seg. aos Ar- 

chivos Vol. IX). C"nif^n]o 

Digitized by V^OOQIC 



34 

Britisoh Amerika 

Halifax — (Nova Scotia) : Nova Scotian Institute of Natural Science: 
Proccedings and Transactions, Session of 1898/99 Vol. X 
Part. 1. 
Ottawa — Geological Survey of Canada: Annual Report (New 
Series) Vol. X 1897; Maps 560 589 599 606 652-654; 
Fletcher: Sydney Coal Field; Mc Connell: Klondyke 
Gold Fields. 
Toronto — Canadian Institute: Transactions Vol. VI; Memoria Vol. 
1849—1899; Proceedings No. 9. 

Chüe 

Santiago — Deutscher wissenschaftlicher Verein. 

— Socidt^ Scientifique du Chili: Actes Tome IX 1899 
40 5e livr; Tome X 1900 l^re livr. 

Costa Kiea 

San Jos6 — Museo Nacional: Director J. F. Ferraz, Informe de 1898 
ä 1899 secundo Sem.; 1899 ä 1900. 

Hexioo 

Mexico — Instituto Geolögico de Mexico: Boletfn Nr. 12; Nr. 13. 

Peru 

Lima — Sociedad Geografica: Boletin Afto IX — Tomo XI, Tri- 
mestre I^, II« 1899. 

üniflriiay 

Montevideo - Museo Nacional: Anales Tomo II Fase. XII, XVI; 
Tomo III Fase. XIII -XV. 



Vereioigte Staaten 

Albany (N. Y.) — State Museum of Natural History. 

» — University of de State of N.-V. 
Boston (Mass.) — American Academy of Arts and Sciences : Procce- 
dings N. S. Vol. XXXV Nr. 1-27; XXXVI Nr. 1-4. 
» — Society of Natural History : Proceedings Vol. XXIX Nr. 1—8. 
Buf falo (N. Y.) — Society of Natural Sciences : Bulletin Vol. VI Nr. 2 — 4. 
Cambridge (Mass.) — Museum of comp. Zoology at Harvard College : 
Bulletin Vol. XXXIV; Vol. XXXV No. 3-6 8; Vol. XXXVI 
No. 1-8; Vol. XXXVn No. 1 2; Memoirs Vol. XXIII 
Nr. 2; Vol. XXIV 1 u. 2. 
» — Peabody Museum of Archaeology and Ethnology. 
Chicago (in.) — Academy of Sciences: Bulletin No. ni Part 1. 

— Field Columbian Museum : Publications Nr. 8 16 21 
23 28 41 (Anthropological Series). ^ i 

Digitized by VjOOQ iC 



35 

Cincinnati (Ohio) — Lloyd Library of Botany, Pharmacy and Ma- 

teria Medica: Bulletin 1900 Nr. 1. 
Colorado Springs (Colo.) — Colorado College: Studies Vol. VIII. 
Davenport (Jowa) — Academy of Natural Sciences. 
Madison (Wisc.) — Wisconsin Academy of Sciences, Arts and Letters: 
Transactions Vol. XII Part 1. 
» — Wisconsin Geological and Natural History Survey. 
Meriden (Conn.) — Scientific Association. 
Milwaukee — Natural History Society of Wisconsin. 

» — Public Museum. 

Minneapolis (Minn.) — Geological and Natural History Survey of 
Minnesota: The twenty-fourth (final) Ann. Rep. f. the 
years 1895—1898. , 

> — Minnesota Academy of Natural Sciences. 
New-Haven (Conn.) — Academy of Arts and Sciences. 
New-York (N.-Y.) — Academy of Sciences, late Lyceum of Natur. 
History: Annais Vol. XII Part 11 and III; Memoirs Vol. II 
Part I 1899. 
> — American Geographical Society : Bulletin 1899 Vol. XXXI 

No. 5; 1900 Vol. XXXn No. 1-4. 
» — American Museum of Natural History: Bulletin Vol. XI 

Part I n ; Vol. XII 1899 ; Annual Report 1899. 
» — Microscopical Society. 

* — Torrey Botanical Club, Columbia University. 
Palo Alto (California) — Leland Stanford Junior University. 
Philadelphia (Pennsylv.) — Academy of Natural Sciences: Procee- 
dings 1899 Part I III; 1900 Part I. 
• — American Philosophical Society: Proceedings XXXVIII 

No. 159—162. 
» — Commercial Muserm: American Commerce. 

> — Wagner Free Institute of Science. 

Rochester (N.-Y.) — Academie of Science: Proceedings Vol. 3 

Brochure 2. 
Rock Island (111.) — Augustana College: Publications No. 2. 
Salem (Mass.) — Essex Institute. 
St. Louis (Miss.) — Academy of Science. 

» — Missouri botanical Garden : Eleventh Annual Report 1900. 
San Francisco (Cal.) — California Academy of Sciences. 
St. Paul (Minn.) — Geological and Natural History Survey. 
Topeka (Ark.) — Kansas Academy of Science. 
T renton (N.-Y.) ~ Natural History Society. 
Tufts College (Mass.): Studies Nr. 6. 

Washington — U. S. Department of Agriculture : Bulletin No. 12 13; 
Nord-Amer. Fauna No. 17 18. 
• — U. S. Geological Survey : Nineteenth Annual Report 

1897-98 Part II III V, V (Atlas); Twentieth Annual 
Report 1898-99 Part I VI, VI continued. 
» — Smithsonian Institution: 

Contributions to Knowledge. 
Miscellaneous Collections: No. 1171 1173. 

— Bureau of American Ethnology. 

— U. S. National Museum : Annual Report of the Board 
of Regents for the year ending June 1897 Part I; 
Proceedings Vol XXI. 

— Microscopical Publishing Company. ^,^,^^^^^^^GoOgle 



36 

Asien 

Britisoli Indien 

Calcutta — Asiatic Society of Bengal : Journal Vol. LXVIII Part II 
No. 1 4 ; Part III No. 1 ; Vol. LXIX Part II No. 1. 

Japan 

Tokyo — Anthropological Society: The Journal Vol. XV No. 164 175. 
» — Deutsche Gesellschaft für Natur- und Völkerkunde Ost- 
asiens : Mitteilungen Band VII Teil 3. 
• — Zoological Society, Imperial University. 

t 
Hiederlftndisch Indien 

Data via — Koninklijke Natuurkundige Vereeniging in Nederlandsch- 
Indie: Natuurkundig Tijdschrift Deel LIX. 



Australien 

Vioteria 

Melbourne — Royal Society of Victoria. 

New South Wales 

Sydney — Royal Society of New South Wales : Journal and Procee- 
dings Vol. XXXn 1898; Vol. XXXIII 1899. 

Queensland 

Brisbane — Royal Geographical Society of Australasia : Procecdings 
and Transactions 14 th Session 1898-99 Vol. XIV; 
Geographical Journal (N. S.) 15th Session 1899— 1900 
Vol. XV. 

South Australia 

Adelaide — Royal Society of South Australia: Transactions Vol. XXIIl 
Part I II; Vol. XXIV Part I; Memoirs Vol. I Part I. 



Die Jahresberichte und Abhandlungen der Naturhistorischen 
Gesellschaft werden aufserdem an folgende Adressen gesandt : 
München — Kgl. Hof- und Staatsbibliothek. 
Nürnberg — Stadtmagistrat (zwei Exemplare). 

» Gymnasialbibliothek. 

* Kgl. Bayer. Gewerbemuseum. 



Digitized by VjOOQ IC 



37 



IE Bericht über den Zuwachs zu den Sammlungen. 



Ä 
»' 


... , 
Gegenstand 


Fundort 


Schenker 


la. Anthropologie. 






64 Thongeftfse, Scherben 


Labersricht bei 


Anthropologische 


65 Bronzenägel und andere Gegen- 


Neumarkt 


Sektion. 


stände 


do. 


do. 


100 Schellenbogen 


Offenhausen 


Kohl. 


209 Doppelzugjoch für Zugochsen 


Hilpoltstein, 
Oberfranken 


Schmidt. 


Ib. EthDOgrraphle. 






106 1 Geflochtene Matte 


Mexiko 


angekauft. 


107 Steingeräte 


do. 


do. 


55 Hausgottheit, menschliche Figur 


Cuba 


Knapp. 


56 GötzenbUd, kleines Schwein . . 


de. 


do. 


129 


Bema 


Südsee 


do. 




2. Zoologie. 






a. Säugetiere. 






26 


Sorex fodiens, Wasserspitzmaus 


Oberösterreich 


angekauft. 


25 


„ araneus, Ackerspitzmaus . 


do. 


do. 


24 


„ vulgaris, gemeine Spitz- 








maus 


do. 
Südamerika 


do. 


8 


Nasua sodalis, Nasenbär, Coati 


Markert. 




b. Vögel. 






48 


Picus viridis, Grünspecht. . . . 


Nürnberg 


Kinkelin. 


190 


Trichoglossus Novae HoUandiae. 


Neuholland 


Benda. 


192 


Halcyon sanctus 


do. 


do. 


191 


Petroeca Goodenii 


do. 


do. 


205 


Anthus arboreus, Heidelerche. . 


— 


angekauft. 


206 


Anthns pratensis, Wiesenpieper . 


— 


do. 


41 


Anthus sp 


Nürnberg 


Rogg. 


103 


Turdus menüa, Amsel, 9 . . . 


do. 


Baumann. 


215'Tardus musicus, Drossel .... 


do. 


Zippelius. 


165 


Regnlus cristatus, Goldhähnchen 


Schwabach 


Adalb. Rudel. 


203 


Emberiza miliaria, Grauammer . 


— 


angekauft. 


204 


Emberiza schoeniclus, Rohrammer 


— 


do. 


166 Fringüla canaria, Kanarienyogel 


gezogen 


Rodler. 


202 Passer petronius, Steinsperling . 


— 


angekauft. 


193{Merop8 omatus 


Neuholland 


Benda. 


154.3 


Rallus aquaticus, 2 Exemplare . 


Nürnberg 


S^«?:.CoocT 



38 






29.30 

189 

216 

102 

27 

28 



105 

36 

182 

35 

131 

152 

178 

82 

143 

84.37 



68 

198 

1 

9 

69 

200 ! 



Gegenstand 



Fundort 



Vanellus cristatus, Kiebitz cJ 9. Nürnberg 
Phoenicopterus ignipalliatus . . I Paraguay 
Anas clypeata, Löffelente. . . . ! — 

Podiceps cristatus, Haubentaucher I Vilseck 

Alca torda, Tordalk ' Trontjen, Nor- 

Mormon fratercula, Papagei- ^ wegen 
taucher cJ Helgoland 



71 
72 
73 

74 

31 



c. Reptilien. 

1. Schildkröten. 

Chelydra serpentina (L.) .... 

Chrysemys picta (Schneid.) . . . 

Malacoclemmys terrapen.(Schöpff.) 

„ lesueri (Gray) . . 

Clemmys geographica 

Emys orbicularis (L.) 2 Stück. . 

Cistudo Carolina (L.) 

Testudo graeca (L.) 

„ (Panzer) .... 
Trionyx ferox, 2 Stück 

2. Eidechsen. 
Alligator mississippiensis (Daud.) 

Agama inermis (Renfs) 

Agama bibroni (A. Dum.). . . . 
Ctenosaura acanthura (Shaw) . . 

Ophisaurus apus (Pall.) 

Varanus griseus (Daud.) .... 

Lacerta viridis (Laur.) 

yy muralis (Laur.) .... 
Lacerta muralis (Laur.) var. tili- 

guerta Gmel. subv. coeruleaEim. 
Lacerta muralis (Laur.) var. be- 

driagae Cam 

Macroscincus coctaei 



8. Schlangen. 
179 Python Sebae (Gmel.) . 
139 1 „ molurus (L.) . . 



Mittel- Amerika 

Ohio 

Nord-Amerika 

Florida 

Ohio 

Italien 

Verein. Staaten 

Griechenland 

Ohio 



Verein Staaten 
Aegypten 
Marokko 
Mexiko 
Dalmatien 
Syrien 
Italien 
do. 

Capri 

Corsika 
Branko 



Schenker 



Rogg. 

Benda. 

Sachs. 

Frz. Wilhelm. 

angekauft, 
do. 



Zoolog. Sektion. 
Kinkelin. 
Zoolog. Sektion. 
Kinkelin. 

do. 

do. 

do. 
Sachs. 

Dr. Metzger. 
Zoolog. Sektion. 



Sachs. 
Kinkelin. 

do. 

do. 
Sachs. 

Zoolog. Sektion. 
Sachs. 

do. 

do. 

! do. 
I Kinkelin. 



West- Afrika . Zoolog. Sektion. 
Ost-Indien | ^ do.j 

Digitized by VjOOQ IC 



39 





Gegenstand 


Fundort 


Schenker 


188 


Boa constrictor (L.) 


Mexiko 


KinkeUn. 


124 


TropidonotuB ordinatus (L.) var. 








sirtalis (L.) 


Nord- A merika 


Zoolog. Sektion. 
Kinkelin. 


187 


Tropidonotus saurita (L.) . . . 


Verein. Staaten 


78 


„ natrix (L.) var. persa 








(PaUas) 


ItaUen 


Sachs. 


79 


Tropidonotus natrix (L.) var. atra 






(Eichw.) 


do. 


do. 


148 


Tropidonotus piscator (Schnd.) . 


Palästina 


Kinkelin. 


117 


„ viperinus (Latr.) . 


Spanien 


do. 


119 


Tropidonotus fasciatus (L.) cJ 9 


Verein. Staaten 


Zoolog. Sektion. 


217 


Ischnognathus occipitomaculatus 








(Stör.) 


Ohio 


do. 


185 


Ischnognathus occipitomaculatus 






(Stör.) 


Florida 


Kinkelin. 


62 


Zamenis gemonensis (Laur.) . . 


Italien 


do. 


186 


„ diadema (Schlg.) . . . 


Algerien 


do. 


199 


Coluber leopardinus (Bonap.) . . 


Dalmatien 


do. 


83 


„ longissimus (Laur.) . . 


ItaUen 


Sachs. 


220 


„ melanoleucus (Daud.) . . 


Florida 


Zoolog. Sektion. 


201 


Coronella triangulum (Daud.) var. 








coliaris (Cope) 


Ohio 


do. 


137 


Tarbophis fallax(Flei8chm.)2 Stück 


Dalmatien 


do. 


40 


Elaps corallinus Wied 


St. Georgia 


Kinkelin. 


89 


Vipera berus (L.) Kreuzotter . . , Nürnberg 


do. 






(Schmausenbuck) 






4. Lurche. 






221 


Rana catesbiana Shaw 


Nord-Amerika 


Zoolog. Sektion. 


54 


„ halecina (Kalm.) 


New-York 


Kinkelin. 


222 


„ palustris (Lee.) 2 Stück . 


do. 


do. 


89 


„ arvalis (Nilss.) 


do. 


do. 


53 


Bufo arenarium (Hens.) .... 


do. 


do. 


87 


Hyla versicolor (Lee.) 


St. Louis 


do. 


63 


Necturus maculatus (Rafin.) . . 
d. Fische. 


Nord-Amerika 


Zoolog. Sektion. 


112 


Conus bubalis, Seebutte .... 


Nordsee 


V. Pechmann. 


111 


Cottus scorpius, Seeskorpion . . 


do. 


do. 


51 


Lophius piscatorius , Seeteufel, 








2 Exemplare 


— 


Blümel. 



Digitized by VjOOQ IC 



40 






Gegenstand 



Fundort 



Schenker 



113 
184 

75 
13 

57 



125 

58 

207 
208 
176 



144 
81 



4 

59 

184 



60 



115 
183 



114 
61 



Syngnathus acus, Seenadel . . . 

Hippocampus brevirostris , See- 
pferdchen 

CarassiuB aorattiB 

Garassius auratus var. japonicos, 
Schleierschwanz 

Carassius aoratus, Brannfisch . . 

e. Insekten. 
Acherontia Atropos, Todenkopf, 

Raupe 

DeilephiaElpenor, mittlerer Wein- 

Schwärmer 

Satomia pyri, Ranpe 

Eine Tafel gemalte Schmetterlinge 
Gryliotalpa vulgaris, Werre. . . 

f. Arachnoideae. 
Scorpio, verschiedene Exemplare 
Ixodes ricinuSj Zecke vom Hand. 

g. Crnstaceae. 

Grofse Dreieckskrabbe 

Verschiedene Krabben 

Lepas anatifera, Entenmnschel . 

h. Vermes. 
Aphrodite, Seeraupe 

i. Mollusca. 

Octopus, Tintenfische 

Pecten gracilis (mit Serpula) . . 



Nordsee 

Cuba, Nordküste 
Japan 

do. 



Steinach bei 
Grändlach 

St. Johannis 



Lauf 



Nordsee 
do. 



Nordsee 

Cuba, Nordküste 



k. Echinodermata. 

Holothurie ! Nordsee 

Asterias, mehrere Seesteme . . I — 



> 1. Anatomie. 
34 Zerlegbare anatomische Modell- ' 
tafeln vom Pferd 1 



von Pechmann. 

Knapp. 
Kinkelin. 

Weid. 
Blümel. 



Greiner. 

Kinkelin. 
Koch sen. 
Dr. Stadlinger. 
Krell. 



Dr. Metzger. 
Schwarz. 



Lotthammer. 
von Pechmann. 
Kinkelin. 



von Pechmann. 



von Pechmann. 
Knapp. 



von Pechmann. 
von Pechmann. 



I Schwarz. 

Digitized by VjOOQ IC 



41 






Gegenstand 



Fundort 



Schenker 



135 Felsenbein vom Barten wal . . 



126 



147 
12 



2 grofse Sporen Yom Haashahn, 
Gallos domesticos 

m. Biologie. 

Krokodil-Ei 

Hornissennest 



n. Pathologie. 
180 j Nierenstein , grofs, lappig, vom 
\ Pferd 



8. BoUnik. 

a. zam Nürnberger Lokal- 
herbar. 

Pirola media 

Viele Formen der Gattung Mentha 



219 
5 

45 

162 

218 

46 

47.48 

50 

49 

7 

163 

164 



Stachys silyaticus var moUissimus 

Scholtheifs 

Verschiedene Calycifloren. . . . 

Verschiedene Monochlamideen 
Trientalis und andere Primulaceen 
Labiaten, Monochlamideen . . . 
Amarantus undChenopodiumarten 
Kochia scoparia, adventiv . . . 

Omithogalnm natans 

Jancos capitatas 

b. zum bayerischen Herbar. 
Erythraea polchella 



Steinach b. Fürth 



Eschenbach bei 
Hersbnick 



Nürnberg 



Plech 

Nürnberg und 
fränk. Jura 

Berching 
Umgegend von 
Nürnberg 



Nürnberg 

Hohenstein 

Oberasbach 



Fr. L. Antony. 
Greiner. 

R. V. Stransky. 
Frhr. v. Ebner. 

Schwarz. 



Zeidler. 



Fr. Scholtheifs. 



Schwarz. 

Fr. Scholtheifs. 

Kaolfofs. 

Ermer. 

Fr. Scholtheifs. 



197 Verschiedene Phanerogamen . . 

c. frische Pflanzen, Früchte, 
Biologie. 
104 1 Verschiedene Phanerogamen . . 
6 j Helleboros niger, Winterblüte 
94 Liriodendron tulipifera, Blüte . . 
106 Diplotaxis tenoifolia, Ein- 

I bürgerang mit der Bahn . . . 



Maihingen i. Ries Seel. 
Bayern Schwarz. 



Fichtelgebirg Gebhardt. 
Berchtesgaden Strohfeldt. 
hier gezogen Bürger. 

St. Jobst .Kinkelin. . 

Digitized by VjOOQ IC 



42 





Gegenstand 


Fundort 


Schenker 


128 


Brassica oleracea, Apiom grave- 








olens, Gemüsepflanzen .... 


Nürnberg 


Seel. 


146 


Pirus Malus, Apfel, 1 Kammer 


Salach, Geisel- 






mit 3 Kernen 


höring 


Schwarz. 


167 


Cydonia japonica, Frucht .... 


hier gezogen 


Zwengauer. 


175 


Frucht von Rosa arvensis, rubi- 








ginosa, rugosa 


verschieden 


Krell. 


130 


Citrone mit gekeimten Kernen in 








unverletzter Frucht 


Italien 


Knapp. 


2.212 


Escheveria, mehrere Arten . . . 


hier gezogen 


Veit Schultheifs. 


120 


Rudbeckia laciniata, verschieden- 








zeitiges Aufblähen 


Gostenhof 


Schwarz. 


109 


Galinsoga parviflora, eingebürgert 


Grofsreuth 


Hartwig. 


110 


Matricaria suaveolens, eingewan- 








dert, Omithopus etc 


Peterhaide 


Schwarz. 


150 


Helianthus cucumerifolia, Mon- 








pretia, Tritona 


G&rten, hier 


Seel. 


140 


Carlina acaulis 


Schafhof, Se- 








balderwald 


Wunder. 


93 


Ailanthus glandulosa, blühend . 


hier gezogen 


Zippelius. 


17 


Plectomia elongata Rb., Frucht . 


Java 


Kinkelin. 


18 


Livistona chinensis 


China 


w 


19 


Livistona rotundifolia Mart. . . 


Java 


» 


118 


Melampyrnm nemorosum, Mono- 








tropa, rote Varietaet 


Plech 


Schwarz. 


86 


Carpinus Betulus mit tief buchtigen 








Blättern 


Kissingen kult 


Engler. 


153 


Aristolochia Sipho, 2 Früchte. . 


kult. Weidenbach 


Pfautsch. 


80 


Iris sibirica, blühend 


Ziegelstein 


Enslin. 


214 


Kleinia articnlata 


hier gezogen 


Veit Schultheifs. 


213 


Aloe nigricans 






14 


Daemonoropis elongatus .... 


Java 


Kinkelin". 


15 


Raphia vinifera, Weinpalme . . 


Madagaskar 


» 


16 


Raphia Ruffia W 


Zentralafrika 


n 


127 


Oryza clandestina, entwickelte 








Blütenrispe 


Simonshofen 


Schwarz. 


172 


Taxus baccata, Arillus mit Samen 


Ostemohe 


rt 


196 


Blechnum Spicant 


Haidenberg bei 




10 


Wurzelwerk von Pflanzen, Wasser- 


Schwabach 


« 




leitungsrohre verstopfend . . 


Eschenbach bei 








Hersbruck 


SebMd. , 



Digitized by VjOOQ IC 



43 



^ 

^ 


Gegenstand 


Fundort 


Schenker 




c. Grofspilze. 






169 


Eine Serie Grofspilze, frisch . . 


Irrhain etc. 


Schmidt. 


149 


Armillaria mellea, Hallimasch. . 

d. Biologie, Symbiose, 
Parasitismus. 


Hallerwiese 


Kinkelein. 


95 


Rosa centifolia mit Durchwach- 








sunff . 


Nürnberg, kult. 


Enslin. 


177 


Cascuta enropaea auf Lycium. . 


Fürth 


Schwarz. 


145 


Kiefemast mit Viscum album . . 


Steinplatte, 








Erlenstegen 


L. Wunder. 


170 


Kiefemsprosse mit Insektenstich- 








gallen 


Rückersdorf 


Knapp. 


101 


Centrale Verbänderung der Föhre 


Erlenstegen 


Meisenbach. 


174 


Mifsbildnng an den Wurzelästen 








der Fichte 


Kerchtesflraden 


Krell. 


211 


Sogenannte Hexenbesen auf der | 






Fichte Titting 


Mayr, Mantlach. 


171 


Hexenbesenähnliche Bildungen auf 1 






Sarothamnus 


Rückersdorf 


Knapp. 


170 


Föhrentriebe mit Gallen der 








Chermes viridis 


» 


» 


121 


Bedeguar der Rose durch Rho- 








dites rosae erzeugt 


Nürnberg 


Brunko. 


52 


Tithymalus Gyparissias, trotz Be- 
setzung mit Aecidium zur Blüte 








gelangt 


Neuenahr 


von Oefele. 


11 


Verschiedene parasitäre Pilze. 

4. Oeologio. 

a. Palaeontologie. 


Franken 


Kaulfufs. 


21 


Graptolithus serratus Schlotheim 


Linda, Voigtland 


Knapp. 


22 


Calymene Blumenbachii .... 


Beraun, Böhmen 


n 


77 


Schilfähnliche Fossilreste .... 


sächsisches 








Voigtland 


n 


76 


Sphenopteris crassifolia .... 


Pilsen 


^ 


86 


Ceratites nodosus 


Rothenburg 


Schmidt, Post- 
direktor. 


161 


Belemnites, mehrere Arten . . . 


Oberferrieden 


Schwarz, t 

1 r^r^r\lr> 



44 



I 



160 
96 
42 



43 

44 
178 

155 



156 

157 

158 

195 
67 

66 
136 

194 

210 

90 
168 

91 

220 

159 

142 



Gegenstand 

Posidonomia Bronii 

Ammonites aus dem Werkkalk . 

BitominöseB Holz, Stammstbck aus 

Braunkohle 

Desgleichen, grofses brettartiges 
Stück 

Desgleichen 2 Stamrastücke . . 

Planorbis comu aus dem Gyrenen- 
mergel 

Aepiornis maximus, £i, Nach- 
bildung in Gips 

b. Geognosie. 
Granit, rot 

Granit, blau 

Gneifs 

Talkschiefer mit Granaten . . . 

Pseudophit in mehreren Yerwand- 
lungsstadien 

Bergleder 

Bohrcylinder aus dem Muschel- 
kalk 

Ausfüllungspseudomorphosen Yon 
Thon nach Steinsalz 

Gipsplatte 

Blasensandstein 

Stubensandstein und derber Sand- 
stein des mittleren Keuper . . 
Eeuperquarzit 

Rhätischer Keuper-Sandstein . . 

Posidonomienschiefer, Papier- 
schiefer 

Dolomit. 



Fundort 



Oberferrieden 
fränk. Jura 

Ddehausen, 
Braunschweig 



Schwandorf 
Offenbach 



Falkenstein, 
bayr. Wald 

Haibach, bayr. 
Wald 

Mitterfels, bayr. 
Wald 



Markt Redwitz 



oberes Aischthal 



Galgenberg bei 
Amberg 
Deutenbach 

Greussen 
Wurzeldorf, 

Wendelstein 
Haidenberg, 

Schwabach 



Oberferrieden 
Tirol 



Schenken 



Schwarz. 
Hübner. 



Reif. 



Spandel. 



Landauer, Würz- 
burg. 



Schwarz. 



Dr. Stadlinger. 
Dr. Leyh. 



Knapp. 
Schwarz. 



leuexmann. ^ 
jbyLjOOgle 



Scheu^xmann. 

Digitized t 



45 



^ 

^ 



133 
134 
132 
32 
33 
123 

122 



97 

141 

99 

20 



88 



Gegenstand 

Scyphie aus DilnvialgeröUe . . . 

Desgleichen 

Hornsteinmasse aosDilavialgerölle 
YerkieseltesHolz „ „ 

2 Geschiebe 

Rollstein von auffallender Fonn 
Raseneisensteinbildangen ver- 
schiedener Form 

Diverse Gesteine 

5. Mineralogie. 

Rosenqnarz 

Kalkspatdrase 

Baryt 

Triphelin 

Tantalin 

6. TecliBolofie. 

Verschiedene Leitnngskabel. . . 



Fundort 



Eibach 

Dutzendteich 

Dutzendteich 

r 

Trettach, AUgäu 
Reufs 



Sylt 
Brixlegg 



Rabenstein bei 
Zwiesel 

Tirol 

Rabenstein bei 
Zwiesel 
Tirschenreuth 



Schenker 



Schwarz. 
K. Huber. 



Zölsmann. - 



Frdr. Merkel. 
F. Huber. 



Schrenk. 

Scheuermann. 

Schrenk. 
Strohfeldt. 

Schmidt, Aug. 



Der Konservator: A. Schwarz. 



Digitized by VjOOQ IC 



46 

IV. Jahresbericht der Verwaltung 1900. 

Von den entbehrlichen Räumen des Hauses ist der zweite 
Stock des Vorderhauses und das Hinterhaus an die Nürnberger 
Frauenarbeitsschule vermietet, der eine Keller an einen Obsthändler. 

Die Gesellschaftsräume waren von dem Pegnesischen Blumen- 
orden, dem Stenographen-Hort, dem Verein für Gesundheitspflege 
und dem Apothekergremium gemietet. 

Schuldscheine wurden fünf zurückgegeben. Zur jährlichen 
Abzahlung von Mk. 200. — an der Hypothek haben auch in diesem 
Jahre eine Anzahl Herren Extrabeiträge geleistet. 

Für alle Geschenke und freiwilUgen Beiträge wird der herz- 
Uchste Dank ausgesprochen. 

Eine Verlosung der Schuldscheine konnte noch nicht vor- 
genommen werden, da die Verwaltung noch immer grofse Zuschüsse 
aus der Gesellschaftskasse benötigt. 



Der Vermögensstand beziffert sich wie folgt: 
a. Immobilien. 

Haus in der Schildgasse, 1. Januar 1900 JL ^ 

Hypothek darauf 48800 — 

Abzahlung pro 1900 200 — 

sohin am 31. März 1900 Hypothekenbestand . . 48600 — 

b. Mobiliar. 

Stand am 1. Januar 1900 1308 61 

Abschreibung pro 1900 163 61 

1145 — 

c. Schuldscheine. 

Gesamtausgabe derselben Ji. 30175 

Hie von am 31. Januar 1900 noch ausstehend .... 24500 — 

Im Jahr 1900 zurückgegeben 250 — 



Stand 31. Dezember 1900 . . 24250 
H. Sebald. 



Digitized by VjOOQ IC 



47 



V. Kassenbericht für 1900. 

a. Ober die Gesellschaftskassa. 

Einnahmen: M 

Kassabestand 1055 

Guthaben bei der Sparkassa (.Ml 1283.31) — 

Auihahmsgebühren 75 

Milgüederbeiträge 3931 

Beitrag vom Stadtmagistrat Nürnberg 500 

Beitrag vom Landrat für Mittelfranken 300 

Beitrag vom bayerischen Staatsministerium 400 

FreiwiUige Beiträge von Mitgliedern 150 

Smnma . . 6411 

Ausgaben: M 

Titel la. Einrichtmig des Museums 88 

Ib. Unterhaltung desselben 297 



na. Bibliothek 

üb. Einrichtung derselben . . . . 

üc. Druck des Kataloges 

lila. Schreibbedarf 

lUb. Porü . . ; 

nie. Inserate 

Illd. Gehalt des Vereinsdieners. . . 

nie. Feuerversicherung (1897/1902) 

IV. Oberzahlung zum Hauskonto 



735 



6045 65 



Vllb. Abzahlung an der Hypothek 200 

VUI. Reservefond . — 

Summa . . 

Absehlnss: M ^ 

Summa der Einnahmen .... 6411 85 

Summa der Ausgaben . . . . 6045 65 

Kassabestand a. Bar . . 
b. 2 Sparkassabücher mit. 
zum Fond für das 100jährige Jubiläum .^ 



25 



60 



38 
117 
127 

548 

1675 

V. Jahresbericht und Drucksachen 1557 

200 

100 

50 

100 

60 

50 



85 

30 
65 
40 



58 
60 
10 
70 

15 
17 



Via. Zuschufs zur anthropologischen Sektion . 

VIb. » » botanischen Sektion .... 

VIc. » » geographischen Sektion. . . 

VId. » » chemischen Sektion .... 

VI e. » » zoologischen Sektion .... 

Vif. » » technologischen Sektion. . . 

VUa. Fond für das 100 jährige Jubiläum 100 — 



366 20 
1421 54 wovon 
700. — bestimmt sini}. 

by LjO 



Digitized t 



oogle 



48 

b. Ober die Verwaltungskassa. 

Einnahmen: JL ^ 
Extrabeiträge der Mitglieder zur Abzahlung an der 

Hypothek 111 — 

Miets-Erträgnisse 2174 70 

Eintrittsgelder 9 — 

Überzahlung aus der Gesellschaftskassa 1675 15 

Summa . . 3969 85 

Ausgaben: M /^ 

Reparaturen und Bauarbeiten 422 07 

Steuern, Wasserzinse und Holzpfandgeld 413 52 

Hypothek-Zinsen 1978 02 

Ökonomie und Regie 1156 24 

Summa . . 3969 85 

Absehlass: M. ^ 

Summa der Einnahmen. . . . 3969 85 
Summa der Ausgaben . . . . 3969 85 



Für die Richtigkeit: 

HttrnbergTy den 31. Dezember 1900. 

Georg Rhau. 

Die Richtigkeit vorstehender Aufstellung und die Oberein- 
stimmung mit den vorliegenden Belegen bestätigen 

HOmbergy den 24. Januar 1901. 

Heinr. Enslin. August Müller. 

August Ertheiler. 



Digitized by VjOOQ IC 



49 

VI. Mitgliederverzeichnis. 

Vontandschaft : 

Direktor: Herr Dr. Augast Heerwagen, k. Gymn.-Professor. 
L Sekretär: Herr Wilhelm Rudel, k. Pfarrer. 
IL Sekretär: Herr Dr. Franz Küspert, k. Reallehrer. 
///. Sekretär: Herr Herrn. Eckert, Kaufmann. 
BibUoihekar: Herr Konrad Hörmann, Lithograph. 
Conservator: Herr Aug. Schwarz, k. Stabsveterinär. 
SciMzmeUter: Herr Georg Rhan, Fabrikbesitzer. 
Admmistrator: Herr Hans Sebald, Buchdruckereibesitzer. 
Bautedimker: Herr Emil Hecht, Architekt und Qemeindebevoll- 
mächtigter. 

Kustoden : 

1) f&r die anatomische Sammlung: Herr Dr. Frankenburger; 

2) „ „ anthropologische Sammlung: Herr Wunder; 

3) „ „ botanische Sammlung und zwar: 

a. f£b- das allgemeine Herbar: Herr Fr. Schultheifs; 

b. „ „ Kryptogamen-Herbar: Herr Kaulfufs; 

c. „ „ Nürnberger Herbar: Herr Schwarz; 

d. „ „ bayerische Landesherbar: Herr W. Rudel; 

4) für die chemische Sammlung und zwar: 

a. für die anorganisch-chemische: Herr Dr. Metzger; 

b. „ „ organisch-chemische: Herr Wunder; 

5) für die ethnographische Sammlung: Herr Th. Obormayer; 
mikroskopische Sammlung: Herr Dr. Goldschmidt; 
lokal-geognostische Sammlung: Herr Schwarz; 
mineralogische Sammlung: Herr Dr. Zwanziger; 
paläontologische Sammlung: Herr Spandel: 
physikalische Sammlung: \ „ 7* vacant- 
technologische Sammlung: / ^ ^^ vacant, 
zoologische Sammlung und zwar: 

a. für Säugetiere und Vögel: Herr Dr. Heerwagen; 

Reptilien, Amphibien und Fische: Herr Kinkelin; 
Weichtiere und Conchylien: Herr Knapp; 
Insekten: z. Zt. vacant; 

Arachniden und Myriapoden: Herr Dr. Koch sen.; 
Crustaceen und niedere Tiere: Herr Kinkelin. 



A. Ehrenmitglieder. 

Sr. Kgl. Hoheit Dr. Carl Theodor, Herzog in Bayern. 
Herr Agassiz, Alexander, Professor in Cambridge. 

„ Arnold, Fr, k. Oberlandesgerichtsrat in München. 

„ Ballhorn, Hermann, Buchhändler in Würzburg. 

n Dr. Blas ins, R., Professor in Braunschweig. 

n Dr Blasius, W., Geh. Hofrat in Braunschweig. 

» Doval-Jouve, J., Ancien Inspecteur de T Academie de Montpell ier . 

n r>r. Flügel, Felix, Privatgelehrter in Leipzig. 

» Dr. Günther, Sigmund, k Professor an der techn. Hochschule 
in München. 

n Dr. ▼. Koch, Gottlieb, Direktor des zoolog. Instituts in Darrastadt 

. Dr. Koch, Ladwig sen., prakt Arzt in Nürnberg. ^^^^^^^Q^^gj^ 



6) 


T) 


^) 


» 


8) 


1» 


9) 


» 


10) 


n 


11) 


Tt 


12) 


n 




a 
b 




c. 




d 




e. 




f. 



60 

Herr Lambrecht, Fr, k holl. Hauptmann in Hannöverisch-Münden. 
„ L Otter, M., Waisenhaus vater in Nürnberg. 
„ Dr. V. Pettenkofer, M., k. Geheimer Obermedizinalrat in 

München. 
„ Philippi, R. A., Professor an der Akademie in Santiago in Chile. 
„ Dr. von Ranke, Johannes, k. Professor in München. 
„ Dr. Selenka, Emil, Professor hon. an der Universität München. 
„ Dr. Virchow, R., k. Geh. Rata. Üniversitäts-Professor in Berlin. 



B. Eorrespondierende Hitglieder. 

Herr Dr. Appel, Otto, Beamter am Reichsgesundheitsamt in Berlin. 

„ Dr. Ascherson, Paul, Professor an der üniversitÄt Berlin. 

„ Ben da, Emest, Kaufmann in Adelaide. 

„ Dr. Biehringer, Joachim, Professor am Polytechnikum zu 
Braunschweig. 

„ Dr. Böttger, Oskar, Professor in Frankfurt a. M. 

„ Braun, Heinrich, Naturforscher und Gemeinderat in Wien. 

„ Dr. Buchenau, Franz, Professor in Bremen. 

„ Dr. Dieudonn^, Adolf, k. Stabsarzt und Privatdozent in Wurzbarg. 

„ V. Docoupil, Wilhelm, Direktor der k. k. Fachschule in HoHc 

„ Dr. Fleischmann, Albert, Professor an der Universität in 
Erlangen. 

„ Gebhart, Oskar, Kaufmann in Markt Redwitz. 

„ Dr. Glück, Hugo, Privatdozent in Heidelberg. 

„ Goeringer, k. Generalmajor in Metz 

„ Dr. Gordon, y de Acosta, Akademieprofessor in Habanna. 

„ Hall, J., Staatsgeolog in Jowa und Paläontolog für die Staaten 
New- York, Albany etc. 

„ Dr. V. Heldreich, Direktor des botan. Gartens und Direktions- 
mitglied des naturhistorischen Museums zu Athen. 

„ Dr. Herz, Fr. J., Konsulent für Molkerei wesen in Neupasing- 
München. 

„ Dr. Holler, August, k. Medizinalrat in Memmingen. 

„ Hornung, Heinrich, k. Reallehrer in Ansbach. 

„ Dr. Hartz, Kurt, Reallehrer in Kulmbach. 

„ Le Jolis, Auguste, Direktor der Soci^t^ des sciences naturelles 
et math^matiques de Cherbourg. 

„ Dr. Issel, Arthur, Professor in Genua. 

„ Kleylein, P'abrikbesitzer in Gablonz. 

„ Dr. Klunzinger, Benjamin, k. Professor in Stuttgart. 

„ Kränzle, Joseph, k. Korps-Stabsveterinär a. D. in München. 

„ Krapfenbauer, Andreas, Apotheker in Manilla. 

„ Dr. Kratzmann, E., prakt. Arzt in Marienbad. 

„ Landauer, Robert, Apotheker in Würzburg. 

„ Macco, Eduard, Kapitän. 

„ Dr. Magnus, Paul, k. Professor an der Universität in Berlin. 

„ Dr. Mehlis, Christian, k. Gymnasiallehrer in Neustadt a. H. 

„ Dr. Müller, W., ordentlicher Professor an der Universität Jena. 

„ Dr. Peters, Karl, Reichskommissar a. D. 

„ Dr. Rehm, H., k. Medizinalrat in Regensburg. 

„ Dr. Rein seh, Paul, Privatgelehrter in Erlangen. 

„ Tempsky, Fr., Buchhändler in Prag. 

„ Teufel, Gustav, Ingenieur in München. 

„ Warnstorf, Karl, Professor in Neuruppin. ^ j 

Digitized by VjOOQ IC 



51 



Herr Weidner, Gutsbesitzer in Gerasmahle. 
jj W ei gel, Friedrich, Kaufmann in Ansbach. 
„ Dr. Will, Priyatgelehrter in Erlangen. 
„ V. Wissmann, kais. Gouverneur a. D. 
„ Wörlein, Gg., k. Zahlmeister a. D. in Nymphenburg. 



C. Ordentliche Mitglieder. 

n Herr Aischberg, Joseph, Hopfenhändler. 

2) „ Ammon, Gottfried, Kaonnann. 

3) „ Ammerbacher, Max, Postofficial in Fürth. 

4) „ Dr. Baal fs, Hans. Veterinär. 

5) „ Bach, Leo, Fabrikbesitzer. 

6) „ Bach, Siegfried, Fabrikbesitzer. 

7) „ Bäumler, Job. Konrad, Kanfinann. 

8) „ Dr. Barabo, Adam, prakt. Arzt. 

9) „ Barbeck, Hugo, Buchhändler und Magistratsrat. 

10) „ Barth, Johannes, Kaufmann in Weigelshof. 

11) „ Bart hell, Georg, Hopfenhändler. 

12) „ Dr. Bauer, Friedrich, prakt. Arzt. 

13) „ Baur, Joseph, Anton, Ingenieur. 

14) „ Bauriedel, Paul, KunstmOhlbesitzer. 

15) „ Beckh, August, Priratier. 

16) „ Dr. Beckh, August, prakt. Arzt. 

17) „ Beckh, Edwin, Fabrikbesitzer und Kommerzienrat. 

18) „ Beckh, Georg, Fabrikbesitzer. 

19) „ Dr. Beckh, Wilhelm, Hofrat und Oberarzt am städt. 

Krankenhaus. 

20) „ Berlin, Max, k. Oberlandesgerichtsrat. 

21) „ Dr. B ernett, Wilhelm, prakt. Arzt. 

22) „ Bernstiel, Charles, Kaufmann. 

23) „ Dr. Berthold, Eugen, prakt. Arzt. 

24) Bibliothek, Königliche, in Berlin. 

25) Herr Bing, Adolf, Kaufmann. 

26) „ Bing, Berthold, Kaufmann. 

27) „ Bing, EmU, Ingenieur. 

28) „ Bing, Heinrich, Kaufmann. 

29) n Bing, Hermann, Kaufmann. 

30) „ Bing, Ignaz, Fabrikbesitzer und Kommerzienrat. 

31) „ Bing, Oskar, Kaufmann. 

32) „ Birkmann, Michael, Zimmermeister. 

33) „ Birkner, Rudolf, Bankier und Konsul der chil. Republik. 

34) „ Bloch, Samuel, Privatier. 

35) „ Dr. Blöde 1, Georg, prakt. Arzt. 

36) „ Dr. Blümcke, Adolf, k. Professor. 
37^ „ Bock, Georg, Zahnarzt. 

38) „ Bodky, Julius, k. Reallehrer. 

39) „ Dr. Braun, Professor. 
Breitschopp, Leonh., Fabrikant 
Bromig, Hans, Kaufmann. 

42) „ Brunner, Martin, Kaufmann. 

43) „ Brust, Max, Kaufmann und Kommerzienrat. 

44) „ Dr. Buchner, Wilhelm, prakt. Arzt. 

45) „ Bücking, Johannes, Privatier. 

46) „ Bürger, Leonhard, Architekt. DigitizedbyGoOgle 



40) 
41) 



62 

47) Herr Bnz, Franz, k. Oberst and Brigade-Kommandeur. 

48) „ Carettc, Georges, Eaafoiann. 

49) „ Cnopf, Karl, Bankier und Gemeindebevollmächtigter. 

50) „ Dr. Cnopf, Rudolf, prakt. Arzt. 

51) „ Conradty, C, Fabrikbesitzer. 

52) » Cr am er, Friedrich, Prokurist. 

53) „ Crailsheimer, Hugo, Kaufmann. 

54) „ Cramer, Paul, Kaufmann. 

55) „ Denk, Hugo, Privatier, 

56) „ Dr. D euer lein, Georg, prakt. Arzt. 

57) „ Dietrich, Theodor, k. Bahnhofdirektor in Schweinau. 

58) » Dietz, Georg, Kaufmann und Handelsrichter. 

59) „ Diez, Gregor, Maurer- und Tünchermeister. 

60) „ Dönneweg, Ernst, Kauhnann. 

61) „ Dormitzer, Louis, Kaufmann. 

62) „ Dürr, Konrad, k. Professor an der Industrieschule. 

63) „ Dr. Eberle, Fr., k. Gymnasiallehrer. 

64) „ Dr. Eckart, Karl, Apotheker. 

65) „ Eckert, Hermann, Kaufmann. 

66) „ Ehrenbacher, Sigmund, Kaufinann. 

67) „ Eisenbach, Georg, Kaufmann. 

68) „ Dr. Elliesen, Paul, Privatier. 

69) „ Dr. Emmerich, Max, prakt. Arzt 

70) „ Engelhardt, Adolf, k. Pfarrer. 

71) „ En giert, Hans, Kaufmann. 

72) „ Enslin, Heinrich, Kaufmann. 

73) „ Dr Epstein, Ernst, prakt. Arzt. 

74) „ Erdmann, Friedrich, Bankier. 

75) „ Erhard, Theodor, Apothekenbesitzer. 

76) „ Erlenbach, Max, Kaufmann. 

77) „ Ertheiler, August, Kaufmann. 

78) „ Etz, Friedrich, Kaufmann. 

79) „ Dr. Fischer, k. Prof. und Inspektor des Natnralienkabinets 

und Lyceum, Bamberg. 

80) „ Fischer, Karl, Privatlehrer. 

81) „ Föttinger, Karl, Gasthofbesitzer. 

82) „ Forchheimer, H. S., Kaufmann. 

83) „ Dr. v Forster, Sigm., prakt. Arzt. 

84) „ Dr. Franke nburger, Alex., prakt. Arzt 

85) „ Frauenfeld, Emil, Kaufmann. 

86) „ Frauenfeld, Karl, Kaufmann. 

87) „ Frauenfeld, Moritz, Kaufmann. 

88) „ Frauenknecht, Gustav, k. Notar und Justizrat. 

89) „ V. Frays, Freiherr, Philipp, Fabrikbesitzer. 

90) „ Friedrich, Johann, k. Reallehrer a. D. 

91) „ Füchtbauer, Gg., k. Rektor und Oberstudienrat. 

92) „ Funk, Stephan, Kaufmann 

93) „ GaDinger, Jakob, Kaufmann und Kommerzienrat. 

94) „ Gar eis, Wilhelm, k Regierungsrat und Bezirksamtmann. 

95) „ Gebhardt, Heinrich, Fabrikbesitzer. 

96) „ Gebhardt, Ludwig, Kaufmann und Kommerzienrat 

97) „ Gebhardt, Wilhelm, Kaufmann. 

98) „ Dr. Geifsler, Gustav, prakt. Zahnarzt 

99) „ Gerngros, Ludwig, Kaufmann und Kommerzienrat 

100) „ Gerngros, Wilhelm, Kaufmann und Kommerzienrat. 

101) „ Dr. Giulini, Ferdinand, prakt Arzt r^^^^^l^ 

Digitized by VjOOQ IC 



63 

102) HerrGöbel, Otto, k. Veterinärarzt. 

103) rt Göschel, Ludwig, Privatier. 

104) „ Qoldmann, Max, Eanfmann. 

105) „ Dr. Goldschmidt, Ferdinand, prakt. Arzt. 

106) „ Gombrich, M., Institutsdirektor. 

107) „ Gonnermann, Karl, Fabrikbesitzer und Eommerzienrat. 

108) „ Dr. Gottschalk, Reallehrer in Fürth. 

109) „ Dr. Gramming, Karl, Bechtsanwalt. 

110) „ Dr. Grether, Fritz, Apotheker. 

111) „ Griesbach, Otto, Kaunnann. 

112^ „ Grofs, Ludwig, k. Gymnasiallehrer. 

113} „ Y. Grundherr, Benno, Eanfmann und k. niederl. Eonsul. 

114) „ Güter mann, WUhelmL Eanfmann. 

115) „ Guldmann, Arthur, Kaufmann. 

116) „ Gutmann, Gustav, Bankier. 

117) „ Gutmann, Moritz, Eanfmann. 

118) „ Haas, Eduard, Fabrikbesitzer und Eommerzienrat. 

119) „ Haas, Earl, Bankier. 

120) „ Dr. Hartwig, Earl, k. Gymnasialprofessor. 

121) „ Haymann, Julius, Direktor des städt. Gaswerks. 

122) „ Hecht, Emil, Architekt and Gemeindebevollmächtigter. 
123^ „ Heerdegen, Albrecht, Eanfmann und Handelsrichter. 

124) „ Dr. Heerwagen, August, k. Gymnasialprofessor. 

125) „ Helling, Christian, Eanfmann. 
126J „ Heim, Hermann, Kaufmann. 

127) „ Heim, Earl, Eanfmann. 

128) „ Held, Hermann, k. Professor an der Ereisrealschule. 

129) „ Heller, Friedrich, Fabrikbesitzer. 

130) „ Heller, Louis, Eanfmann. 

131) „ Hellmuth, Joseph, Bechtsanwalt und Justizrat. 

132) „ Hellmuth, Earl, städt. Bezirkstierarzt. 

133) „ Hellmuth, Sigmund, Magistratsrat. 

134) „ Hering, August, Ingenieur. 

135) „ Hertel, Friedrich, Eanfmann. 

136) „ Dr. Hefs. Hans, k. Reallehrer. 

137) „ Hesselberger, David, Eanfmann. 

138) „ Heydolph, Georg, Buchdruckereibesitzer. 

139) „ Heidolph, Hans, Rechtsanwalt. 

140) „ Hilpert, Christian, Fabrikdirektor. 

141) „ Dr. Hirsch, Jakab, Fabrikbesitzer in Fürth. 

142) „ Hörmann, Eonrad, Lithograph. 

143) „ Dr. Hof mann, Hans, Inspektor am bayr. Gewerbemuseum. 

144) „ Hopf, Eduard, Eanfmann. 

145) „ Hopf, Emil, Eanfmann. 

146) „ Hopf, Hans, Eanfmann. 

147) „ Hub er, Friedrich, Eanfmann. 

148) „ Huber, Earl, Staatsbaupraktikant. 

149) „ Hussong, Ludwig Apotheker in Eempten. 

150) „ Jang, Heinrich, Eanfmann. 

151) „ Eann, Paul, k. Telegrapheningenieur. 

152) „ Eann, Samuel, Privatier. 

153) „ Eantenseder, Johann, Schreinermeister. 

154) „ Dr. Eanfmann, Ludwig, Chemiker u. Fabrikbes. in Fürth. 

155) „ Dr. Eaul, Hermann, Chemiker. 

156) „ Eaulfufs, Johann, städt. Trichinenschauer. 

157) „ Dr. Eellermann, Rektor und Prof. an der Kreisrealschule. 

Digitized by 



54 

158J HenrKempe, Karl, Fabrikdirektor. 

159) „ Kiefer, Andreas, k. Hauptmann und Kompagniechef 

160) „ Kinkelin, Adolf, Apotheker. 

len „ Dr. Kirste, Wilhelm, prakt Arzt. ' 

162) „ Klein, Benedikt, Kaufmann. 

163) „ Dr. Klenker, Otto, Fabrikbesitzer in Doos. 

164) „ Knapp, Friedr., Kaufm. u. kgl. span. Konsul. 

165) „ Dr. Koch, Heinrich, prakt. Arzt. 

166) „ Dr. Koch, Karl, prakt. Arzt. 

167) „ Dr. Koppel, August, Realschulassistent. 

168) « Kohn, Emil, Baiüder und Handelsrichter. 

169) „ Kohn, Ernst, Bankier. 

170) „ Kohn, Georg, Bankier. 

171) „ Krakenberger, Leopold, Kaufmann. 

172) „ Krakenberger, Max, Kaufmann. 

173) „ Kraussold, Max, k. Pfarrer und Senior. 

174) „ Krell, Otto, Fabrikdirektor. 

1 75) „ K r e 1 1 , tto , i'un. , Ingenieur. 

176) „ Krell, Rudolf, Oberingenieur. 

177J „ Kreutzer, Ludwig, Fabrikbesitzer. 

178) „ Kromwell, Karl, Kaufmann. 

179) n Dr. Küspert, Franz, kgl. Reallehrer. 

180) „ Kugler, Sal., Direktor. 

181) „ Kuhlo, Richard, Generaldirektor. 

182^ „ Lambrecht, Hermann, Fabrikbesitzer u. kgl. span. KodsoL 

183) „ Dr. Landmann, Joseph, Rechtsanwalt 

184) „ Dr. Landsberg, Ludwig, P'abrikbesitzer in Doos. 

185) „ Lang, Bernhard, Kaufmann und k. schwed. Konsul. 

186) „ Lang, Ignaz, Kaufmann. 

187) „ Lang, Leopold, Kaufmann. 

188^ „ Langermann, Moritz, Kaufmann. 

189) „ Lauer, Jean, Fabrikbesitzer und Magistratsrat. 

190) „ Lauinger, Leopold, Kaufmann. 
191 j „ Dr. Lehnert, Wilhelm, Apotheker. 

192J „ Leidig, Georg Friedrich, Optiker und k. Hoflieferant. 

198) „ Lenz, Ernst, Erzgiefser. 

194J „ Dr. Lessing, Kurt, Fabrikbesitzer. 

196) „ Lessing, Walter, Techniker. 

196) „ Leuchs, Georg, Chemiker und kgl. Hoflieferent. 

197) „ Dr. Leuchs, Karl, Chemiker. 

198) „ Lex, Hans, Apotheker. 

199) „ Dr. Leyh, F., Lehrer. 

200) „ Leykauf, Georg, k. Hofstahlwarenfabrikant. 

201) „ Dr. Limpert, L., prakt. Arzt und Zahnarzt. 

202) „ Lindinger, Leonh., stud. rer. nat. in Erlangen. 

203) „ Lindmann, Jakob, Direktor des Gaswerks in Fürth. 

204) „ Lindner, Heinrich, Kaufmann. 

205) „ Lösch, Friedrich, k. Postkassier. 

206) „ Dr. Maas, Markus, prakt. Arzt. 
207J „ Maerl, Georg, Baumeister. 

208) „ Mandel, Karl, Kaufmann. 

209) „ Mandel, Wilhelm, Kaufmann. 
Mansbach, Sigmund, prakt. Arzt. . . 
•Her, JuUus, Kaufmann und I. Vorstand des Gemeinde- 
Kollegiums. 



210) „ Dr, 

211) „ Marl 



212) 



Martin, Eugen, Rechtsanwalt und Justizrat:^ j 

Digitized by VjOOQIC 



55 

213) Herr Marx, Georg, Ober-Ingenieur. 

214) „ Dr. Mayer, M. L., prakt. Arzt. 

215) „ Mayer-Dinkel, Albert, Kaufmann. 

216) „ Dr. Mehler, Heinrich, prakt. Arzt in Georgensgmünd. 

217) „ Meise r, Franz, Ingenieur. 

218) „ Dr. Merkel, Gottl., k. Medizinalrat u. Krankenhaus-Direktor. 

219) „ Dr. Merkel, Wilhelm, prakt. Arzt und k. Hofrat. 

220) „ Merzbacher, Joseph, Kaufmann. 

221) „ Mesthaler, Joh.. Fabrikbesitzer und Kommerzienrat. 

222) „ Metzger, Ludwig, Kaufmann und Kommerzienrat. 

223) „ Dr. Metzger, Sigmund, Fabrikbesitzer und k Hoflieferant. 

224) „ Michahelles, Georg, k. Hauptmann und Kompagniechef. 
'22b) „ Miederer, Kaufmann. 

226) „ Dr. Mohr, Gustav, prakt. Arzt. 

227) „ Dr. Morgenstern, Friedrich, Fabrikbesitzer in Fürth. 

228) „ Mühlberger, Karl, Gymnasialzeichnenlehrer in Kitzingen. 

229) „ Müller, August, Kaufmann. 

230) „ Müller, Heinrich, Kaufmann in Neumarkt i. 0. 

231) „ Müller, Jean, Kaufmann. 

232) „ Dr. Müller, Wühelm, prakt. Arzt. 

233) „ Münderlein, Johann, k. Pfarrer. 

234) „ Dr. Münz, Pinkus, prakt. Arzt 

235) „ Münzinger, Augus^ Kaufmann. 

236) „ Munker, Georg, k. Professor a. D. 

237) „ Münze r, Julius, Kaufmann. 

238) „ Naue, Otto, Kaufmann. 

239) „ Dr. Neub erger, Jos., prakt. Arzt. 

240) „ Dr. Neuburger, S., Augenarzt. 

241) „ Dr. Neukirch, Richard, Oberarzt am städt. Krankenhaus. 

242) „ Neumeyer, Hans, Direktor. 

243) „ Nister, E., Kunstanstaltsbesitzer und Kommerzienrat. 

244) „ Nowack, Lorenz, Fabrikdirektor. 

245) „ Obermayer, Theodor, Kaufmann. 

246) „ Dr. Oppler, Theodor, Beauftragter der chemischen Berufs- 

genossenschaft. 

247) „ Ortmann, Albert, Kunst- und Handelsg&rtner. 

248) „ Ottenstein, Albert, Kaufmann. 

249) „ Ottenstein, Justin, Kaufmann und Kommerzienrat. 

250) „ Ottenstein, Max, Kaufmann. 

251) „ Paalzow, Richard, Kaufmann. 

252) „ Pabst, Friedrich, Fabrikbesitzer. 

253) „ Pabst, Julius, Fabrikbesitzer. 

254) „ Dr. Pauschinger, Leonhard, prakt. Arzt. 

255) „ Dr. Per et z, E., prakt. Zahnarzt. 

256) „ Pf autsch, Frieor., Apotheker in Weidenbach b. Triesdorf. 

257) „ Pilhofer, Joh., k. Bahnexpeditor. 

258) „ Dr. PGschel, Gustav, k. Bezirksarzt in Neustadt a. A. 

259) „ Popp, Adolf, Kaufinann. 

260) „ Preifs, Konrad Philipp, Mechaniker. 

261) „ Prell, August, k. Ober-Bankbuchhalter. 

262) „ Dr. Prior, Eugen, k. Professor und Direktor. 

263) „ Putz in, Ludwig, Fabrikbesitzer. 

264) „ Raab, Karl, Fabrikbesitzer und Magistratsrat. 

265) „ Dr. Rabus, Heinrich, prakt. Arzt. 

266) „ Ratz, Heinrich, Apotheker. 

267) „ Rau, 8. E., Kaufinann. r^^r^r^]^ 

Digitized by V^OO^ IC 



66 

268) Herr Dr. Raam, Wilhelm, Fabrikbesitzer. 

269) „ Rehlen, Wilhelm, Fabrikbesitzer und Magistratsrat. 

270) „ Reif, Jean, Braaereibesitzer und Konmierzienrat. 

27 ij „ Reif, Zacharias, Braaereibesitzer und Kommerzienrat. 

272^ „ Dr. Reitzenstein, Fritz, Privatdozent in Würzburg. 

273) „ Reizenstein, Hugo, Kaufmann. 

274) „ Rettelbusch, Ernst, Architekt. 

275) „ Rh au, Georg, Fabrikbesitzer. 

276) „ Dr Riedel, Heinrich, Apothekenbesitzer. 

277) „ Dr. Riegel, Wilhelm, prakt. Arzt. 

278) „ Rieppel, A., Direktor der Maschinenbau- Aktiengesellschaft 

und k. Baurat. 

279) „ Rockstroh, Gustav, Kaufmann. 

280) „ Rodler, Karl, Apothekenbesitzer. 

281) „ Rogner, Konrad, Direktor des städt. Schlachthofes. 

282) „ Rohn, Severin, Direktor in Buch. 
288) „ Dr. Rosenfeld, L., prakt. Arzt. 

284) „ Rosenfeld, Sigmund, Kaufmann. 

285) „ Rudel, Albert, Assistent an der Industrieschule. 

286) „ Rudel, Wilhelm, k. Pfarrer. 

287) „ Rupprecht, Friedrich, Privatier. 

288) „ Rupprecht, Wilhelm, Kaufmann. 

289) „ Sachs, Karl, Kaufmann und Kommerzienrat. 

290) „ Sachs, Wilhelm, Kaufmann. 

291) „ Sandner, Friedr., stud. rer. nat. in Erlangen. 

292) „ Schäfer, Jakob, k. Bezirkshauptlehrer in Fürth. 

293) . Schafft, Emil, Charkutier. 

294) „ Dr. Scheidemantel, Heinrich, prakt Arzt und k. Hof rat. 

295) „ Scheuermann, Ferdinand, Privatier. 

296) „ Schilling, Theodor, Grofshändler und ital. Konsul 

297) „ Schlegel, Hans, städt Inspektor. 

298) „ Schlegel, Hermann, Apotheker. 

299) „ von Schleich, Herm., k. Kammerjunker und Oberleutnant 

i. k. 8. Feldart.-Regiment. 

300) „ Schmidmer, Chr., Fabrikbesitzer und Kommerzienrat. 

301) „ Dr. Schmidmer, E., Fabrikbesitzer. 

302) „ Schmidt, August, k. Postamtsdirektor. 
308) „ Schmidt, Rudolf, Optiker. 

304) „ Schmiedel, Theodor, Fabrikbesitzer in Doos. 

805) „ Schneider, Peter, k. Veterinärarzt. 

306) „ Schönner, Georg, jun, Reifszeugfabrikant. 

307) „ Scholler, Friedrich, Hauptagent. 

308) „ Schräg, Karl, Hofbuchh&ndler und k. k. österr. Konsul. 

309) „ Schreiber, Aug., Vergolder und Fabrikant. 

310) „ Dr. Seh renk, Friedrich, prakt. Arzt. 

311) „ Schröder, Theodor, k. Gymnasialprofessor. 

312) „ Dr. Schubert, Paul, prakt. Arzt und Gemeiudebe vollmächt. 

313) „ Dr. V. Schuh, Georg, I. Bürgermeister der Stadt Nürnberg. 

314) „ Schuh, Heinrich, Fabrikbesitzer. 
316) „ Schuh, Wilhelm, Apotheker. 

316) „ Schultheifs, Friedrich, Apotheker. 

317) „ Schultheifs, Veit, städt. Trichinenschauer. 

318) „ Schultheifs, Oskar, k. Postoffizial in Nördlingen. 

319) „ Schwanhäufser, Gustav, Fabrikbesitzer u. Kommerzienrat. 

320) „ Dr. Schwanhäufser, Eduard, Kaufmann. 

321) „ Schwarz, August, k. Stabsveterinär. ^ , 

Digitized by VjOOQ IC 



57 

322) Herr Schwarztranber, Jobs., k. Veterinär I. Klasse 

323) „ Sebald, Hans, Bnchdruckereibesitzer. 

324) „ Sobald, Cari, Kalkwerkbesitzer. 

326) „ Seel, W., Lebrer in Grofsreuth. 

326^ „ Seiler, Cbristopb, Ingenieur und Fabrikbesitzer. 

327) „ Dr. Seiler, Hermann, prakt. Arzt. 

328) „ Sichling, Riebard, Kaufmann. 

329) „ Sieb er th, 0., Zahnarzt. 

330) n Silbermann, Julias, Kaufmann. 

331) „ Dr. Simon, Max, prakt. Arzt. 

332) „ Sommer, Theodor, Chemiker in Fürth. 
333^ „ Spandel, Erich, Buchdruckereibesitzer. 

334) „ Speckhardt, Georg, Bäckermeister. 

335) „ Dr. Spoerl, prakt. Arzt in Neumarkt i. 0. 

336) „ Stadler, Friedrich, Zahntechniker. 

337) „ Stahl, Job. Christ, Kaufmann. 

338) „ Stand t, Erdmann, Fabrikbesitzer und k. Hoflieferant. 

339) „ Dr. Stein hard, Ignaz, prakt. Arzt. 

340) „ Dr. Steinheimer, Ludwig, prakt. Arzt. 

341) „ Dr. Stich, Eduard, Oberarzt und k. Hofrat. 

342) „ Stich, Karl, Buchdruckereibesitzer. 

343) „ Dr. Stockmeier, Hans, Vorstand der chemischen Abteilung 

des bayer. Gewerbemuseums. 

344) „ St Öhr, August, Sekretär a. polyt. Zentral verein in Würzburg. 

345) „ Dr. Straub, Adolf, I. Assistent an der städt. Untersuchungs- 

anstalt. 

346) „ St raus, Simon, Kaufmann. 

347) „ Dr. Straufs, Julius, Oberlehrer an der städt. Handelsschule. 

348) „ Straufs, Louis, Kaufmann. 

349) „ Straufs, Willy, Kaufmann. 

350) „ Dr. Sturm, Jakob, prakt. Arzt in Mögeldorf. 

351) „ Süfs, Clemens, Apotheker. 

352) „ Tafel, Hermann, Fabrikbesitzer in St. Jobst. 

353) „ Tauber, Christ., Baumeister. 

354) „ Thurnauer, Bernhard, Fabrikbesitzer. 

355) „ Tölke, Konrad, Kunstgärtner und Gemeindcbevollmächtigter. 

356) „ Tuchmann, Franz, Kaufmann. 

357) „ Tuchmann, Friedrich, Kaufmann. 

358) „ Tuchmann, Max Joseph, Kaufmann. 

359) „ ühl, Adolf, Kaufmann. 

360) „ ülmer, Julius, Direktor der Nürnberger Bank. 

361) „ Dr. Ullrich, August, Rektor der höheren Töchterschule und 

k. Schulinspektor. 

362) „ Völker, Georg, Kaufmann. 

363) „ Voit, Paul, Kaufmann. 

364) „ Voit, Robert, Kaufmann. 

365) „ Vollhardt, Oskar, k. Advokat und Justizrat. 

366) „ VoUrath, Franz, Kaufmann. 

367) „ Dr. Wagner, Friedrich, k. Professor in Weihenstephan. 

368) „ Waydelin, W. Fr., Kaufmann. 

369) „ Webel, Edmund, Fabrikant. 

370) „ Weidemann, Herrn., I. Direktor der Central molkerei. 

371) „ Dr. Weigel, Karl, prakt. Arzt in Berlin. 

372) „ Weigle, Theodor, Apotheker und Gemeindebevollinächtigtcr. 

373) „ Weil, Philipp, Kaufmann. 

374) „ Weinberger, Max, Fabrikant. ^ , 

Digitized by VjOOQ IC 



58 

875) Herr Weinschenk, Hermann, Kaufmann. 

376) „ Dr. Welzel, Karl, prakt. Arzt. 

377) „ Wenck, Richard, Buchhändler. 

378) „ Wertheimer, Sigmund, Kaufmann. 

379) „ Dr. Wiegmann, Dietrich, I.Assistent der Brauereiversuchs- 

station. 

380) „ Wieland, Peter, Privatier. 

381) „ Wirsching, Franz, Apotheker u. Bürgermeister in Yelburg. 

382) „ Wölfel, Konrad, Grofsfleischermeister. 
383^ „ Wolf, Mathias, k. Postamtsdirektor. 

384) „ Wunder, Justin, Chemiker und Fabrikbesitzer 

385^ „ Wunder, Ludwig, geprüfter Lehramtskandidat. 

386) „ Dr. Zagelmeier, Hans, städt. Sanitätstierarzt. 

387) „ Zeltner, Johannes, Kaufmann nnd Kommerzienrat. 

388) „ Zeltner, Johannes, jun., Kaufmann. 

389) „ V. Zenetti, Julius, Ritter, Excellenz, königl. Regierungs- 

präsident a. D. 

390) „ Zippelius, August, Kaufmann. 

391) „ Dr. Zwanziger, Georg, k. Professor an der Industrieschule. 



D. AuCsierordeiitlielie Mitglieder. 

1) Herr Buchholz, Richard, Ass. a. d. Versuchsstat. für Bierbrauerei. 

2^ „ Degener, Hans, Ass. a. d. Versuchsstation für Bierbrauerei. 

3) „ Dr. Dürr, Felix, Betriebsleiter in Fürth. 

4^ „ Elliesen, Max, cand. rer. nat. 

5) „ Dr. Falk, Richard, Ass. a. d. Versuchsstat. für Bierbrauerei. 

6) „ Gareis, Wilhelm. 

7) „ Knoesel, Christian, cand. rer. nat. 

8) „ Dr. N ar r a w a y , Franz, Ass. a. d. Versuchsstat. für Bierbrauerei. 

9) „ Dr. Stadlinger, Hermann, Apotheker. 

10) „ Dr. St über, Walter, Ass. a. d. Versuchsstat. für Bierbrauerei. 

11) „ Wolff, Justus, Assistent am ehem. Laboratorium des bayer. 

Gewerbemuseums. 

12) „ Wolf, Lorenz, Ingenieur. 



Digitized by VjOOQ IC 



_59 

Vn. Jahresbericht der Sektion für Anthropologie, 
Ethnologie und Urgeschichte. 

Die Sektion zählte im Jahre 1900 34 Mitglieder; eines der- 
selben ist Ende des Jahres infolge Wegzugs von hier ausgeschieden. 
In 8 Sitzungen wurden in einer Reihe interessanter Vorträge, 
Demonstrationen und Referate u. a. nachfolgende Gegenstände be- 
handelt: 
Herr v. Forster: 

1) Über >Dr. Beltz, Steinzeit in Mecklenburg«, 

2) Über »Prof. v. Fritsch, Veränderung der Typen«, 

3) Über die Funde bei Hammer, 

4) Über die im Zirkus Barnum vorgeführten Leute von Borneo 

und einen mikrocephalen Malayen, 

5) Über MonteUus »Das Alter des Eisens«. 
Herr Wunder sen.: 

1) Über Grabhügel bei Speckfeld, 

2) Über den Froschfels bei Brunn, 

3) Über eine Reihe von Grabhügeln. 
Herr Wunder jr.: 

1) Über die VeröffentHchung einzelner Bestandteile unserer 

Sammlung, 

2) Über die Grabhügel bei Labersricht. 

Die für dieses Jahr geplante Abhaltung der 2. Versammlung 
nordbayerischer Prähistoriker wurde, nachdem sich Hindernisse in 
den Weg gelegt, auf das nächste Jahr verschoben. 

Die Sektion hat im Berichtsjahre die beiden letzten Grabhügel 
in der Beckerslohe ausgegraben und zwar unter der bewährten 
Leitung der Herren Wunder sen. und jr. Der eine sehr grofse Hügel 
(Nr. n) enthielt über den oberen Brandschichten mehrere Skelette, 
3 Armreifen, 1 Armbrustfibel, 1 Paukenfibel, 3 Bronzedrahtringe, in 
der unteren Brandschichte fanden sich einzelne Skeletteile calcinirt 
und 1 Eisenschwert mit einem Ortband aus Weifsbronze. 

Hügel I enthielt in der oberen Brandschichte keinerfei Bei- 
gaben, in der imteren dagegen 2 Bronzeblechringe und 1 Fragment 
einer Schwanenhalsfibel. 

Mit diesen Grabungen ist die langjährige Thätigkeit der Sektion 
auf der Beckersloher Nekropole erschöpft. Der grofse Reichtum an 
Funden aus diesem wichtigen Grabfeld der jüngeren Hallstattzeit 
kennzeichnet einen Erfolg der Sektionsarbeit, auf welchen die^reuenj 

izedbyCjOOgle 



60 

Mitarbeiter an den Grabungen mit Stolz zurückblicken können. Eine 
ausführliche Beschreibung des Grabfeldes und der dabei geförderten 
Funde soll im kommenden Jahre veröffentUcht werden. 
In der Geschäftssitzung wurden gewählt: 

Als Obmann: Herr; Dr. v. Forster, 
Als Schriftführer: Herr; F. H. Hub er, 
Als Kassier: Herr Veit Schultheifs. 
Nürnberg, Dezember 1900. 

Dr. V. Forster, F. H. Huber, 

Obmann. Schriftführer. 



Vm. Jahresbericht der botanischen Sektion 
pro 1900. 

Die Zahl der Mitgheder betrug bei Beginn des Jahres 25 ; ein 
Mitglied trat im Laufe desselben aus, während Herr Lehrer Seel der 
Sektion beitrat; Mitgliederstand Ende 1900 ist 25. 

Die Vorstandschaft blieb dieselbe wie bisher. 

Die Sektion hielt folgende Zeitschriften: 

Uhlworm, bot. Zentralblatt; Leimbach, deutsche bot. Monats- 
schrift; Kneucker, allgem. bot. Zeitschrift; Wettstein, Österreich, bot. 
Zeitschrift; aufser diesen zirkulierten in der Sektion noch: Rosen- 
thal, biolog. Zentralblatt; Prometheus; Wiener und Grazer Garten- 
zeitung. Neu angeschafft wurden: Hartig, Lehrbuch der Pflanzen- 
krankheiten; Prantl, Lehrbuch der Botanik, 11. Aufl., herausgg. von 
Pax; Weber, Vegetation der Diluvialzeit; Berens, Leitfaden der Bo- 
tanik; Meyer, Leitfaden der Botanik ftir landwirthschaftl. Schulen; 
in Fortsetzung: Ascherson und Gräbner, Synopsis der mitteleurop. 
Flora, und Göbel, Organographie. Geschenkt wurden: Von Lycealprof 
Dr. Fischer (Bamberg), Referat über Chrysanthem. inodorom 
V. ambiguum; Gynmasiallehrer Grofs, Referat über Draba Thomasü; 
von Univers.-Prof. Dr. Fl ei seh mann: Noll, über Geotropismus, und 
über Einflufs der Wurzelkrümmung auf die Bildung von Seitenwurzeb; 
von Medizinalrat Dr. Rehm: Hedwigia, über Pilzformen in Süd- 
Amerika; Prof. Rudel und Fr. Schultheifs: Bericht über die 
meteorol. und phänolog. Beobachtungen im Jahre 1899; Dr. Buchner: 
Autographen von Prof. Dr. Willkomm, Celakovsky imd Kemer v. Mari- 
laun; Stabsveterinär Schwarz: Autographen von Hofrat Dr. Hauss- 
knecht und Prof. Dr. Sagorsky. ^ ^ 

Digitized by VjOOQ IC 



_ ßl 

Das Herbar erfreute sich einer sehr beträchtlichen Bereicherung 
durch Geschenke seitens der Herren Kränzle, Fr. Schultheifs, 
Schmidt, Kaulfufs, Schwarz u. a.; das Nürnberger Herbar 
wurde von letzterem einer vollständigen Neubearbeitung unterzogen, 
wobei eine grofse Anzahl von Handexemplaren früherer Mitarbeiter : 
der Herren Dr. J. W. Sturm, Prof. Dr. Schnitz lein, Dr. Rosen- 
müller, Schmidt (Kadolzburg), Dr. Model u. a. zur Einreihung 
kamen. 

Nachdem auch im letzten Jahre Hr. Paalzow den Grofspilzen 
seine Thätigkeit zugewendet hatte und durch Herrn Vi 11, Bezirks- 
tierarzt in Bamberg, eine grofse Anzahl parasitärer Pilze zu den hier 
gesammelten hinzugekommen war, hatte sich ein nicht nur zahl- 
reiches, sondern auch sehr interessantes Material angesammelt, so 
daÜB der ständige Referent hierüber, Herr Prof. Dr. Magnus, Berlin, 
es für angezeigt hielt, die gewonnenen Resultate in unseren Abhand- 
lungen unter dem Titel: »3. Beitrag zur Pilzflora von Franken« zu 
veröffentlichen. Diese Sammlung enthält drei neue Arten: Ovularia 
Schwarziana (P. Magn. n. sp.), Ovularia Villiana (P. Magn. n. sp.), 
Entyloma Achilleae (P. Magn. n. sp.) Aufserdem ist zu erwähnen, 
dafs ein vom Obmann Hm. Schwarz bei Brennberg östlich von 
Regensburg auf Weifsdorn gefundener Pilz Septogloeum Crataegi 
P. Magn. bisher nur aus Virginien bekannt war. Herr Kinkel in hat 
durch Konservienmg von Grofspilzen in mit Formalinlösung gefüllten 
Gläsern, worin sich die Pilze nach Form und Farbe ganz vortreff- 
lich halten, den Grund zu einer Sammlung solcher Pilze gelegt. 

Während in der Erforschung der Lokal-, sowie der Adventiv- 
flora von Hm. Fr. Schultheifs, Hrn. Schwarz u. a. eifrig weiter- 
gearbeitet wurde, wobei sich wieder erfreuliche Resultate ergaben, 
waren bezüglich der pflanzengeographischen Verbreitung in den nörd- 
lichen Grenzgebieten die Mitteilungen der Herren Apotheker Böhner 
in Creufsen, Professor Braun an der Industrieschule dahier, Gym- 
nasiast Dittmar hier und Dr. Harz, Reallehrer in Kulmbach, sehr 
willkommen. 

Von der Flora von Nüraberg-Erlangen hat der Verfasser die 
Dikotyledonen zum Abschlufs gebracht und damit dies Werk seiner 
Vollendung um einen bedeutenden Schritt näher geführt. 

Der Verkehr mit auswärtigen Botanikern war wiederum ein 
sehr reger; aufser mit den bisherigen fand schriftlicher Austausch 
statt mit den Herren Prof. Dr. Fischer in Bamberg, Geheimen 
Hofrat Dr. Hau 88 kn echt in Weimar, Forstmeister Donle in Schwa- 

Digitized by VjOOQIC 



62 

bach, Lehrer Meyer und Dr. Pöverlein in Regensburg, Pfarrer 
Dr. Gradmann in Forchtenberg (Württemberg) u. a. m. Endlich 
mufs noch erwähnt werden, dafs Herr Gymnasiallehrer L. Grofs im 
Verein mit Herrn Reallehrer Kneucker eine gröfsere botanische 
Reise nach Istrien, Damlatien, Montenegro, Herzegowina und Bosnien 
unternahm, von welcher er eine überaus reiche Ausbeute interessanter 
Pflanzen mitbrachte, darunter zwei neue Hieracien: Hieracium 
Grossianum Zahn und Hieracium trichophyton Zahn, dann 2 Algen 
Spirogyra Grossi Schmidle und Lemanea Grossi Schmidle, sodann 
eine für Europa neue Adventivpflanze Oldenlandia capensis. Ein 
ausführliches Referat über die Reise erscheint zur Zeit in der 
Kneucker'schen Zeitschrift. 

An den zahhreichen Vereins-Ausflügen dieses Jahres, von denen 
einer der Besichtigung des botanischen Gartens in Erlangen unter 
Leitung des Herrn Prof. Dr. Solereder gewidmet war, beteiligten 
sich stets auch viele Mitglieder der botanischen Sektion. 

In den 17 Sitzungen, welche die Sektion im Laufe des Jahres 
hielt, wurden folgende Referate und Demonstrationen gebracht: 
Herr Dr. Buchner: Über die Flora von Süd-Tyrol, sowie diejenige 
der Südwest-Schweiz ; über abweichende Formen von Quercus 
Hex; über einige Adventivpflanzen aus der Umgebung Nürn- 
bergs; auch legt er blühende Pflanzen vom Genfersee vor, 
sowie Fruchtexemplare von einer Opuntia. 

> Erhard: Über die Flora des Contrinthals und der Umgebung 
von Bozen ; über Desinfektion imd Konservierung von Pflanzen, 
Insekten u. dgl. durch Formahndämpfe. 

> Gar eis: Ober Geum rivale mit gefüUter Blüte, gefunden bei 
Kersbach. 

> L. Grofs: Über die Flora von Istrien, Dalmatien, Bosnien, 
Herzegowina und Montenegro. 

> Dr. Heerwagen legt vor: Früchte von Cupressus pyramidalis 
und Nerium Oleander (vom Gardasee) ferner als Surrogat für 
Mandeln in den Handel kommende Angola-Erbsen (Voandreia 
subterranea). 

» Kinkelin legt am 12. Februar als erste Frühlingsboten 
blühende Helleborus niger von Berchtesgaden vor. 

> Dr. Fr. Küspert: Über die Anatomie der Wurzel mit Zeich- 
nungen und mikroskopischen Präparaten. 

> R. Paalzow: Über fossile Pflanzenreste ausHötting (bei Inns- 
bruck), sowie über solche aus dem Miocän bei Bilin. 

Digitized by VjOOQ IC 



63 

Herr A. Prell: Über die Flora des Contrinthals und der Marmolata. 

> W. Rudel legt vor in Blüte Lonicera involucrata aus dem 
Garten des städtischen Krankenhauses. 

» Fr. Schultheifs referiert über seine regelmäfsigen phänolog. 
Beobachtungen, sodann über die Flora von Nürnberg, besonders 
des Hersbrucker und des Altmühljura, sowie die Adventivflora. 

> V. Schultheifs legt Pflanzen aus JalO am Gardasee vor. 

» A. Schwarz: Über Matricaria inodora mit braungeränderten 
Hüllkelchblättchen (gefunden bei Pettstadt von Prof. Dr. Fischer); 
über Cuscuta europaea auf Lycium bei Fürth; über Papaver 
nudicaule, gegenwärtig von Gärtnern viel gezogen, Heimat 
Grönland; über Euphorbia Cyparissias, pilzbefallen und den- 
noch blühend, gesammelt von Dr. v. Öfele in Neuenahr; Orchis 
mascula, dunkelpurpum, gesammelt von Lehrer Besold in Neu- 
markt; über Euphorbiaceen, speziell über die verschiedenen 
Arten von Mercurialis ; über die charakteristischen Unterschei- 
dungsmerkmale der Populus-Arten, besonders von Populus 
balsamifera und Populus candicans-Ontariensis; erstere kommt 
hier gar nicht vor, womit auch die Beobachtungen der Herren 
Dr. Buchner und Fr. Schultheifs übereinstimmen; über inter- 
essante Standortsangaben des Herrn Dittmar aus der Umgegend 
von Bayreuth; über Saison-Dimorphismus bei Euphrasia und 
Alectorolophus; über Helleborus viridis, gefunden von Dittmar 
bei Artelshofen; über Ornithogalum nutans, gesammelt von 
Herrn Postadjunkt Ermer am Hohenstein; über die Flora von 
Plech; Gräfenberg-Göfsweinstein-Ebermannstadt; Simonshofen; 
Schwabach-Hilpoltstein-Roth ; Geiselhöring; endlich legte er vor: 
die Verbreitungskärtchen der Scrophulariaceen, Rhinanthaceen 
und Labiaten. 

SchhefsUch spricht die Sektion der Gesellschaft für die ge- 
währte finanzielle Unterstützung, der Redaktion des General-Anzeigers 
aber für die unentgeldliche Aufnahme der Einladungen zu den Sitz- 
ungen den ergebensten Dank aus. 



IX. Jahresbericht der ^^Geographischen Sektion^^ 

Die Anzahl der Mitglieder betrug am Anfang des Jahres 27; 
leider verlor die Sektion durch Tod des Herrn Gust. Greiner ein 
treues MitgHed, so dafs sie am Ende des Jahres 2(i Mitglieder^ zählte- 

Digitized by VjOOQIC 



64 

Wie im Vorjahre traten auch heuer die Mitglieder jeden dritten 
Montag im Monat zusammen imd hielten so zehn Sitzungen ab, die 
teils durch Vorträge, teils durch Berichterstattungen aus den Fach- 
schriften ausgefüllt wurden. 

Die Geschäfte der Sektion besorgten: 

als Obmann: Herr Postdirektor A. Schmidt, 
> Schatzmeister: Herr Heinrich Enslin, 
» Schriftführer: Herr Th. Obermayer. 
In jeder Sitzung teilte der Obmann das Hauptsächhchste des 
literarischen Einlaufs mit. Umfassendere Vorträge in den einzelnen 
Sitzungen fanden statt: 

18. Dezember: Obermayer: Berichterstattung über »Die Eisenbahn 

der Zukunft«. 

22. Januar: Enslin: Vortrag über »Die Termiten«. 

Schmidt: Berichterstattung über » Überschwemmungen in der 
Sahara«. 

19. Februar: Heer wagen: Vortrag über »Kultur- und Landschafts- 

bilder aus Japan«. 
Dr. Berthold als Gast: Vorzeigung einer Sammlung Photo- 
graphien und gemalter Bilder von Japan. 

23. April: Schmidt: Berichterstattung über »Kohlengruben in 

unserer chinesischen Interessensphäre«. 
F. Hub er als Gast: Vortrag über »Pariser Weltausstellung«. 
21. Mai: Knapp: Vortrag über »Meine Reise nach Uxmal, der 
tultäkischen Ruinenstadt«. 

18. Jimi: Schmidt: Berichterstattung über »Die Erforschung des 

Xingu durch Dr. H. Mayer«, sowie über »Die Bapda-lnseln« . 
17. September: Schmidt: Berichterstattung über »Sven Hedin's 

Reise durch die Wüsten Asiens«. 
15. Oktober: Schmidt: Berichterstattung über »Die grofse Sibirische 

Bahn«, sowie über »Das Leben der Eingeborenen auf 

Ponap^«. 

19. November: Heerwagen: Berichterstattung über »Das Theater- 

wesen in Japan«, sowie über »Die Bedeutung Japans als 
Industriestaat«. 
17. Dezember: Schmidt: Berichterstattung über »Der Fischfang in 
Tanga«. Hieran schlofs sich die Geschäftssitzung, in der die 
Mitgheder der Vorstandschaft wiedergewählt wurden. 
Für die GesellschafUbücherei wurden aus Sektionsmitteln 
schafft : 

Digitized by VjOOQ IC 



65 

Verhandlungen der Gesellschaft für Erdkunde, Berlin, 
Zeitschrift > > » » » 

Deutsche Kolonialzeitung, 
Geographisches Jahrbuch XXII. 
Als Schenkung ging der Bücherei zu: 

»Der Staat von Sina 1708 nebst einer Karte von China 
von Stieler aus dem Jahre 1804«. 
Nürnberg, Dezember 1900. 

Th. Obermayer. 



X. Bericht über die Thätigkeit der chemischen 

Sektion. 

In der Sitzung am 9. Januar 1900 wurde, nachdem die üb- 
lichen Geschäfte, als: Vorstandswahl, Erstattung des Jahresberichtes, 
sowie des Kassenberichtes erledigt waren, durch den 1. Obmann, 
Insp. Schlegel, der schon länger vorbereitete Antrag auf An- 
schaffung eines Experimentier-Tisches aus Mitteln der Sektion 
eingebracht. Durch Genehmigung dieses Antrages war der Mutter- 
gesellschaft ein Inventurstück in Aussicht gestellt, dessen Mangel 
sich schon lange fühlbar gemacht hatte. Die Obergabe des im 
grofsen Ganzen fertiggestellten Tisches fand in der Sektionssitzung 
am 23. Oktober statt; der Muttergesellschaft wurde er am 31. Oktober 
übergeben, vollständig montiert mit Gas- und Wasser-Zuflufs ; zur 
Fertigstellung auch des Wasserabflusses reichten die Geldmittel der 
Sektion nicht hin. 

Das Stiftungsfest wurde am 29. März im Hotel »Deutscher 
Kalserc abgehalten; den Glanzpunkt der zahlreich besuchten Ver- 
anstaltung bildete eine amerikanische Versteigerung verschiedener 
von den Mitgliedern zur Verfügung gestellter Gegenstände. An der 
Ausführung der Kneipzeitung, bezw. humoristischer Vorträge be- 
teiligten sich die Heeren : Dr. Metzger, Dr. Rohn, Dr. Straub, 
Dir. Weidemann. 

An Sitzungen hielt die Sektion im ganzen ab: acht, gegen 11 
im Vorjahre. Dieser Ausfall erklärt sich dadurch, dafs laut Sektions- 
beschlufs nur im Wintersemester Sitzungen abgehalten wurden. 

In diesen Sitzungen wurden 8 Vorträge gehalten (im V.-J. 10); 
davon waren 6 wissenschaftlichen, 3 technischen Inhaltes. 

Von den ersteren war derjenige des Herrn Fabrikbesitzers 
Sehmiede l: »Über Atom- und Molekulargravitation« eine^Priginal- 

Digitized by ^OOQIC 



66 

arbeit, bestimmt zum Druck in der Festschrift der Gesellschaft 
zur Jahrhundertfeier ihres Bestehens. 

Referate wurden 4 erstattet (im V.-J. 7); Demonstrationen 
veranstaltet 2 (gegen 4 im V.-J.) Denmach belauft sich die Gesamt- 
zahl der Vorträge, Referate und Demonstrationen auf 14 (gegen 21). 
Die Zahl der Redner betrug 11. 

Trotzdem weniger Sitzungen abgehalten wurden, betrug die 
Anzahl der insgesamt anwesenden Teilnehmer 18 mehr als im Vor- 
jahre, nämlich 228. 

Von diesen waren: Mitglieder 141 (123 im V.-J.), 
Gäste 87 ( 97 » » ). 

Der Besuch der Sitzungen war ein besserer als im Vorjahre, 
denn die höchste Teilnehmerzahl betrug 46 (gegen 31), die nied- 
rigste 14 (gegen 14), die mittlere 28,5 (gegen 19,09). 

Vorträge, Referate und Demonstrationen verteilten sich auf die 
einzelnen Sitzungsabende wie folgt: 
9. Januar: Erledigung der Geschäfte. 
23. Januar: Vortrag des Herrn Dr. Stockmeier: »Über flüssige 

Luft« mit Demonstrationen. 
13. Februar: Vortrag des Herrn Fabrikbesitzers Schmied el: >Alom- 

und Molekulargravitation«. Teil IL 
13. März: 1) Vortrag des Herrn Dr. Kaul: >Über das Vorkommen 
von Thon in der Umgebung von Nürnberg«. 
2) Demonstration des Herrn Paalzow: >2 Pflanzen- 
abdrücke aus dem Rhät von Schnaittach«. 
23. Oktob.: 1) Vortrag des Herrn Dr. Kaul: Ȇber Kohlen- und 
Torf vorkommen in Bayern«. 

2) Referat des Herrn Dr. Barth (Lauf): »2 neue Nähr- 
präparate aus Brauereihefe«. 

3) Bericht des Herrn Dr. Oppler über die »Einweihung 
des Hoffmann-Hauses in Berlin«. 

13. Novbr. : 1) Vortrag des Herrn Dir. Weidemann: »Ober Milch- 
konservierung« mit Demonstrationen. 

2) Vortrag des Herrn Dr. Stadlinger: »Das Gold im 
Lichte der neueren Forschung«. 

3) Demonstration des Herrn Insp. Schlegel: »Spektrum 
von Kohlenoxydblut«. 

27. Novbr. : 1) Vortrag des Herrn Dr. Küspert: »Über Stoffver- 
wandlung«. 

Digitized by VjOOQ IC 



67 _ 

2) Referate des Herrn Insp. Schlegel: 
»Über einige Explosionen». 
»Ein Todesfall durch Kohlenoxyd Vergiftung«. 
11. Dezbr.: Vortrag des Herrn Prof. Dr. Prior: »Gährungstheorien 
sonst und jetzt«. 
Im Mitghederstand haben sich insoferne Änderungen ergeben, 
als dem Austritt von 2 Mitgliedern der Eintritt von 13 gegenüber- 
steht. Davon sind ordentliche Mitglieder 6, aufserordentliche 7. Die 
gegenwärtige Anzahl beträgt 52 (43 ordentliche, 9 aufserordentUche) 
Mitglieder. 

Der I. Schriftführer: 

Dr. Küspert. 



XI. Jahresbericht der zoologischen Sektion 1900. 

Die zoologische Sektion, die am Schlüsse des Jahres aus 
20 Mitgliedern bestand, hielt im Laufe des Berichtsjahres 9 ordent- 
liche Sitzungen ab, in denen folgende Referate, Demonstrationen und 
Vorträge erstattet wurden: 

I. am 12. Januar 1900: 

Herr Paalzow referiert über »Zoologische Gärten in Australien«. 
» Dr. Koppel demonstriert einen Wurf junger Mäuse, dann die 
Maulwurfsgrille nebst Larve und aus den Eiern präparierte 
Ringelnattern. 

II. am 16. Februar 1900: 

Herr Kinkelin demonstriert Macroscincus coctaei und Python mo- 

lurus und legt als Geschenk des Herrn Weid einen japanesischen 

Zierüsch vor. 
» Dr. Koppel demonstriert Larven von Hornissen und von 

Dytiscus marginalis, ferner einen Hühnerkopf mit 2 Schnäbeln 

und 3 vollständig ausgebildeten Augen. 
» Paalzow demonstriert Pteropoden, Conularien und Foramini- 

feren und referiert über Wanderung und Verbreitung von 

Insekten. 
> Dr. Heerwagen referiert über das Vogelleben des böhmischen 

Mittelgebirges, 
m. am 16. März 1900: 
Herr Wunder jun. hält einen Vortrag über den histologischen Bau 

verschiedener Organe und demonstriert eine grofse Anzahl von 

Präparaten unter dem Mikroskope. 

Digitiz^y VjOOQ IC 



_68 

Herr Kinkelin demonstriert einen Ochsenfrosch, ferner Melacoclem- 

mys lesueri, Trionyx ferox, und Chrysemys picta. 
» Webel demonstriert Endromis versicolora, Saturnia pyri, 

spini, pavonia, hybridae emiliae und bornemanni, caecigena, 

isabellae und Aglia tau. 
» Dr. Heerwagen zeigt Abbildungen von Vögeln aus den 

Werken von Naumann, Riesenthal und Giglioli. 

> Paalzow referiert über den literarischen Einlauf. 

IV. am 20. April 1900: 

Herr Wunder jun. hält einen Vortrag über die Jugendstadien des 
höheren und niederen Krebse und demonstriert mit Hilfe der 
Projektionsapparates eine grofse Anzahl yon Präparaten. 

> Stadler demonstriert das Gespinnst des Prozessionsspinners. 
» Paalzow zeigt Macrocephalites tumidum und macrocephalum 

und referiert über den literarischen Einlauf. 

V. am 18. Mai 1900: 

Herr Paalzow bespricht den literarischen Einlauf und demonstriert 
aus den Riffen von Pöfsneck: Fenestella retiformis, Phyllopora 
Ehrenbergi, Acanthocladia anceps, Thamniscus dubius, Steno- 
pora columnaris Var. ramosa. 
* Webel demonstriert Papiho machaon, Anarta cordigera und 
myrtilli. 

VI. am 15. Juni 1900: 

Herr Paalzow zeigt eine gröfsere Anzahl von Brachiopoden aus 
den Riffen von Pöfsneck und referiert über eine Arbeit von 
Eugen Penard über die Wurzelfüfsler. 
VII am 19. Oktober 1900: 

Herr Paalzow legt den literarischen Einlauf vor und bespricht 
einen Artikel über die Verbreitung der Raubtiere in Sachsen 
in früheren Jahrhunderten. Derselbe rcferiet dann über die 
Ammonitenfauna des braunen Jura's von Laufen a^Eyach und 
zeigt eine Anzahl von Fundstücken aus dem dortigen Gebiete. 
Vm. am 23. November 1900: 

Herr Paalzow verliest ein Referat von Böttger über die Fort- 
pflanzung des Aales und referiert über eine Arbeit von Carus 
Sterne über die Tapezierbiene. Derselbe demonstriert eine 
Anzahl von Schnecken aus dem Carbon von Toumay. 
IX. am 21. Dezember 1900 (Geschäftssitzung): 

Herr Paalzow referiert über den literarischen Einlauf und demon- 
striert 2 Ganoidfische. 

Digitized by VjOOQ IC 



69 

Es erübrigt noch, der sehr verehrl. naturhistorischen Gesell- 
schaft für den gewährten Beitrag von 60 Mark, sowie Herrn Spandel 
für die unentgeltliche Aufnahme der Annoncen im General-Anzeiger 
den verbindlichsten Dank auszusprechen. 

Karl Hellmuth, 
Schriftführer. 



Xn. Jahresbericht der technologischen Sektion. 

Die technologische Sektion wurde durch die konstituierende 
Versammlung vom 4. Januar 1900 mit 26 Mitgliedern ins Leben ge- 
rufen. Als Vorstandschaft wurde gewählt: 

I. Obmann: Herr F. H. Huber, 
II. Obmann: > Georg Rh au, 
Schriftführer: » Th. Obermayer, 
Kassier: » Walter Lessing, 

[m Laufe des Jahres traten 7 neue Mitglieder der Sektion bei ; 
leider verlor dieselbe in der gleichen Zeit 2 Mitglieder, eines durch 
den Tod, eines durch Wegzug, so dafs am Schlüsse des Jahres der 
Mitgliederstand 31 beträgt. 

Die Sektion trat anfangs am zweiten Donnerstag, später am 
zweiten Dienstag im Monat zusammen und hielt so neun ordentliche 
Sitzimgen ab, die teils durch Vorträge, Referate und Diskussionen, 
teils durch Berichterstattung aus dem stets sehr namhaften Einlauf 
von Fachzeitschriften ausgefüllt vnirden. 

Die Tagesordnungen der einzelnen Sitzungen waren folgende: 
11. Januar: Vorlage der Statuten, sowie Beratung betr. anzuschaffen- 
der Zeitschriften etc. 
S.Februar: Schmidt: Vortrag über Cerebotanische Apparate und 
die Schnelltelegraphie. 
Hub er: Demonstration von Schwarzfärbung des Messing. 
Obermayer: Über den Doktoringenieur. 
8. März: W. L essin g: Vortrag über flüssige Luft. 
Hub er: Referat über Magnalium. 
Obermayer: Referat über Telegraphie ohne Draht. 
19. April: Rhau: Referat über Aluminiumverbindungen unter Vor- 
lage verschiedener Fohen. 
15. Mai: Rhau: Vortrag über Flitterschlägerei. 

Huber: Referat über den heutigen Stand der Elektro- 

^'^''^^'^- Digitizedby Google 



70 

W. Lessing: Referat über die Anwendung der Galvano- 
plastik bei Kunstwerken gröfseren Umfangs. 
11. Septbr.: Huber: Vortrag über die Wasserkräfte der Niagarafälle 

und deren industrielle Verwertung. 
9. Oktob.: Obermayer: Vortrag über das Torpedowesen. 

Huber: Referat über das Riesenfemrohr auf der Pariser 

Weltausstellung, sowie über Telephonographen. 
Schmidt: Referat: Wie das Petroleum entstand. 
13. Novbr.: Hub er: Vortrag über Calorische Maschinen mit Demon- 
stration von Modellen. 
W. Lessing: Referat: Aus dem Leben Werner von 

Siemens. 
Obermayer: Referat über Silbronit. 
18. Dezbr.: Obermayer: Bohrungen auf elektrolyt. Wege. Hierauf 
Geschäftssitzung mit Vorlage des Kassen- und Jahres- 
berichtes, sowie Neuwahl der Vorslandschaft, in welche 
dieselben Herren wieder gewählt wurden, wie im Be- 
richtsjahre. 
Die Sektion ist auf nachfolgende 6 Zeitschriften abonniert: 
Bayerisches Industrie- und Gewerbeblatt, München, 
Polytechnisches Zentralblatt, Berlin, 
Kraft und Licht, Düsseldorf, 
Journal des Inventeurs, Bruxelles, 
Technische Revue, München, 
Technisch industrielle Rundschau, Nürnberg. 
Die BibHothek erhielt als Schenkung: 

Stand und Zukunft der Acetylenbeleuchtung von Dr. 0. Frölich. 
Meine Telegraphie von Dr. Cerebotani. 
Nürnberg, Dezember 1900. 

Th. Obermayer, 
Schriftführer. 



Digitized by VjOOQ IC 



71 



Zugänge zur Bibliothek 

vom 1. Januar bis 31. Oeeember 1900. 



PßHodiea: 



3270. — 



3257. — 



3260. 



Archiv für Anthropologie y 26. Band, Heft III, IV (von der 

Natnrh. Gesellschaft angeschafft). 
ZeUsehrift f. Ethnologie, 82. Jahrg. 1900 Heft* 1. (von d. 

Naturh. Qesellsch. angesch.) 
Globuiy 77. Q. 78. Bd. (▼. d. naturhist. Gesellsch. angesch.). 
Beiträge %, Anthropologie u. Urgeeehichte Bayerns (von d. 

anthrop. Sektion angesch.). 
Centralblatt f, Anthropologie, Bthnologie u, Urgeschichte 

(von d. anthrop. Sektion angesch.). 
Limesblati (von d. anthrop. Sekt, angesch.). 
Nachrichten über deutsche AUertunufunde, 11. Jahrg. 1900. 

Heft 4 (von d. anthrop. Sekt, angesch.). 
Geographische Zeitschrift von Hettner VI. Jahrg. 1900 (v. 

d. Naturh. Gesellsch. angesch.). 
Petermanns Mitteilungen, 46. Bd. 1900 (v. d. Naturhist. 

Gesellsch. angesch.). 
— Erg&nzungshefte Nr. 131—133 (▼. d. Naturh. Gesellsch. 

angesch.). 
Geographisches Jahrbuch, XXH. Bd. 1899 2. Hälfte; XXIII. 

Bd. 1900 1. Hälfte (von d. geogr. Sektion angesch.). 
Deutsche Kolonialzeitung, 17. Jahrg. 1900, Nr. 1-20. 

22—44, 46—52 (v. d. geogr. Sektion angesch.). 
Zeitschrift d. Gesellschaft f Erdhunde zu Berlin, XXXIV. 

Bd. Heft 4-6; XXXV. Bd. Heft 1-4. (v. d. geogr. 

Sekt, angesch.) 
Verhandlungen d. Gesellschaft f. Erdkunde zu Berlin, 

XXVI. Bd. Nr. 7-10; XXVH. Bd. Heft 1-4; (v. d. 

geogr. Sekt, angesch.) 
Prometheus, Nr. 533—581 (v. d. Naturhistor. Gesellsch. 

angesch.) 
Naturwissenschaftliehe Rundschau, XV. Jahrg. 1900 (v. d. 

Naturh. Gesellsch. angesch.). 
Biologisches Centralblatt, XX. Bd. 1900 (v. d. Naturhist. 

Gesellsch. angesch.) 
Botanisches Centralblatt, 78. Bd. Nr. 12, 13 u. Titel, 79. 

Bd.; 80. Bd. (▼. d. botan. Sektion angesch.) 
Deutsche botan. MonaUschrift, 17. Jahrg. 1899 Heft 7-8 

(V. d. botan. Sekt, angesch.). „^,,,,,^GoOgIe 



72 

Penodiea: 
3213. — Oeaterr. botm. Zuschrift, XLIX. Jahrg. 1899 Nr. 11—12 
(v. d. botan. Sekt, angesch.). 

— Allgemeine hotameche Zeitschrift v. A, Kneucker, 1899 Nr. 

6—12 (v. d. botan. Sekt, angesch.) 

— Der Zoohgische Garten, XLI. Jahrg. (v. d. zoolog. Sekt. 

angesch.) 

— Zeitschrift für anorgan. Chemie, Bd. XIX— XXII; (v. d. 

ehem. Sekt, angesch.) 
3314. — Berieht Ober die Witterungs- und Krankheitsverhältnisse 
Nürnbergs, Nov. Dez. 1899; Jan.— Okt. 1900. (Ge- 
schenk der meteorol. Station.) 



3898 b. Allgem.-verst. naturw. Abhdlgn. Heft 22: Dr. C. A. Weber, Ver- 
such eines Überblicks über d. Vegetation d. Diluvialzeit in 
den mittl. Regionen Europas. Berlin 1900. S^. 32 S. 

3953. Appel, Dr. Otto, Der echte Mehltau. Hrsgb. v. der biol. Abt. 
d. K. Gesundheitsamtes. Foliotafel in Farbendr. 8*. gefalzt. 

3915. Arnold, Dr. Ferd,, Lichenes exsiccati (1894—1899) Nr. 1601— 
1800. 17 S. — William Nylander. 8 S. m. 2 Portr. — S.-A. 

3948. Aseherson, Dr. Paul u. Dr. Paul Graebner, Synopsis d. Mittel- 
europäischen Flora. Erster Band. Leipzig 1896—98. 8®. 
XI u. 416 S. 
Ailems, H, Grßf, s. Graz, k. k. Gartenbau-Ges. 
Barrows, John Henry, s. Chicago. 
Bass, Eugen, s. Tiermedicin. 

3987. Bayer. Jahrbuch, Kalender f Bureau, Comptoir u. Haus. 1894. 
München. 4«. XVI u. 414 S. 
Blasius, Dr. Rud., s. Gabanis' Joum. f. Ornith. 

3985. Bramme, Traugott: Gemälde v. Nord-Amerika in a. Beziehungen 
V. d. Entdeckg. an b. a. d. n. Zeit. Eine pitt. Geographie 
f. Alle, welche unterhalt. Belehrung suchen u. ein umfass. 
Reise-Handbuch f Jene, welche in dsm. Lande wandern 
wollen. Stuttgart 1842. 8<». Erster Band 796 S. u. 45Taf.; 
Zweiter Band X u. 800 S., 39 Taf. 

3917. Buchner, Jos. Bened., homöopath. Arzneibereitungslehre. Mit 
2 lith. Abb. München 1840. 8^. 420 S. Supplement dazu. 
München 1843. 42 S. — 

- Dasselbe, 2. s. verm. Aufl. 1852. XVI u. 468 S. 
255. 1 — IX Buffon, Geo Louis Ledere^ Comte de — , sämmtl. Werke, 
sammt Ergänzgn. nach d. Elassifik. v. G. Cuvier. Einzige 
Ausg. in deutscher Übersetzung ▼. H. J. Schaltenbrand. 
Mit Abb. Köln 1837. L bis IV. Bd. Allgem. Gegenstände; 
V., VI. Bd. vierfüfsige Tiere; Vil. bis IX. Bd., Vögel. 

Digitized by VjOOQ IC 



73 

3944. Cabam$' Jowmal f, Omiihologie, Sep.-Abdr. aus -, S^: VUI. 
Jahresbericht (188B) d. Ausschusses f. Beobachtungsstationen 
d. Vögel Deutschlands. S. 226 -337; desgl. IX. Jahresber. 
(1884) S. 129-388; desgl. X. Jahresber. (1886) S.337 648. 

3922. Chicago WeltauMlellung i893 — The Parliament oi Religions 
at the World^s Fair. By Rev. John Henry Barrows. Aus 
the Missionary Review of the World, June 1892. New York. 
S. 461—466. 8«. 

3913. China. Der Staat von Sina. (Anno 1708.) 342 8. Der Staat 
von Persien. 166 S. Der Staat von Türckey, Vorrede und 
172 S. In einem Band geb. kl. S^. 

3964. Comtey P. Louis U: Nouveaux Memoires sur l'etat present de 
la Chine. 3")» Edition reveüe et corrig^e sur la demiere 
de Paris. A. Amsterdam MDCXCVIII. kl. 8<^. Tome prä- 
mier: Mit Epistre, Avertissement u. 342 8. ; Tome second 
366 S. » 

3328. DetUsehe Zoolog. Gesellschßfl, Das Tierreich. 11. Liefg. Orthop- 
tera. Fordculidae u. Hemimeridae. XVI u. 142 S. 

3968. Eckert, Herrn., zwei photograph. Aufnahmen, Kühe mit Schellen- 
bögen auf der Weide (Altensittenbach). 
Feyerabend, L., s. Görlitz, Gesell, f. Anthrop. u. Urgesch. der 
O.-Lausitz. 

3911. Fiori, Dr. Adriane — e Dr. Giulio Paolelti, Flora analitica 
d'Italia. Padova 1896. gr. S^. Vol. I— Parte I: le Pterido- 
fite, le Ginnosperme e le Angiosperme roonorotilc^oni. 266 S. 
— Parte II: Angiosperme Dicotiledoni. S. 257-610. 

3951. Fuida — Verein f. Naturkunde, 1. Ergänzungsheft: Jos. Von- 
derau, Pfahlbauten im Fuldathale. Mit 2 Plänen u. 7 Taf. 
1899. 4« 36 S. 

3814. Geheimmilteleckwindei, Der. Ein Beitrag z. Kulturgeschichte d. 
19. Jahrhdts. Basel. 8^ VIII u. 336 S. 

3918. Genzke, J.C.L, Homöopath. Arzneimittellehre f. Thierärzte nebst 
Anweisg. z. Bereitg. d. homöop. Arzneien u. Hinweisg. auf 
deren Anwendg. in verschiedenen Krankheitsformen. Leipzig 
1837. 8«. XVI u. 440 S. 

3623. Goebei, Dr. K., Organographie d. Pflanzen, II. Teil. Specielle 
Organogr. 2. Heft: Pteridophyten u. Samenpiizn. I. Teil. 
Mit 173 Abb. Jena 1900. S. XIll— XVI, 385-648. 

3315. Gordon, Dr. Antonio de: X) La Legislaciön Sanitaria Escolar 
en los principales Estados de Europa. 8^. Habana 1900. 
36 S. 
— Y) El Azucar como Alimento del Hombre. 1899. 32 S. 

3988. Görlitz, Gesell, f. Anthropologie u. Urgesch. der Oberlausitz: 
Tafel vorgeschichtl. Altertümer d. Oberlausitz, herausggbn. 
V. d. Kommunalständen d. Preufs. Markgraft.^berlausitz, 

Digitized by VjOOQIC 



74 

bearb. v. L. Feyerabend, gez. v. J. Schurig. Farbendruck 
(2. Aufl.) gr. Folio. 
Graebner, Dr. Paul, s. Ascberson, Dr. Paul. 

3923. Grazy k. k. Gartenbau-Gesellschaft: Der Schulgarten des k. k. 
steierm. Gartenbau-Vereins auf d. Landes-Ausstellung zu 
Graz 1880, v. H. Graf Attems. S^. 40 S. 
Groaaey Dr. St., s. Tiermedizin. 

3986. Günther, Dr. Siegm., Lehrbuch d. Geophysik u. physik. Geo- 
graphie. Stuttgart. 8«. I. Bd. 1884. X, 418 S. u. 77 Textabb. 
IL Bd. 1885. XII, 672 S. und 118 Textabb. 

3919. Hartig, Dr. Robert, Lehrbuch d. Pflanzenkrankheiten. Für Bo- 
taniker, Forstleute, Landwirthe u. Gärtner. Mit 280 Text- 
abbildungen und 1 Tafel. 3. v. neu bearb. Aufl. des Lehr- 
buches d. Baumkrankheiten. Berlin 190o- S^. Xu. 324 S. 

3984. Hat^f, Weltpriester, Fr. J. : Margaritologie, vermischt m. Conchy- 
liolQg. Beyträgen z. Naturk. v. Baiem. München 1795. 12®. 
Vorr. u. 128 S. 

3742. Hayne, Anton, Die Seuchen d. nutzbaren Hanssäugethiere. Wien 
1836. 8«. VIII u. 504 S. 

3981. Heine, Wilh., Japan u. s. Bewohner. Geschieht!. Rückblicke n. 
ethnogr. Schildergn. v. Land n. Leuten. Leipzig (1860) 8^ 
XX u. 384 S. 

3963. Heerwagen, Dr. Aug.: Leitfaden d. Chemie u. Nahrungsmittel- 
lehre f. h. Mädchenschulen u. Fortbildgssch. Mit 20 Textill. 
• u. 3 Doppeltaf. Bamberg 1900. 8". VII u. 188 S. 

3965. Kaefnpfer, Engelbert: Ilistoire naturelle, civile et ecclesiastique 
de FEmpire du Japon: compos^e en AUemand; et traduite 
en Fran^ois sur la Version Angloise de J.-Gasp. Scheuchzer. 
Enrichi des Plans et des cartes. Amsterdam MDCCXXXII. 
kl. 8®. Tome premier LXX u. 312 S ; Tome second 416 S ; 
Tome troisieme 379 S. und Table des matiereB. 

3970. Kaul, Dr. Herrn. : Geolog.-chem. Studien üb. d. Thon- u. Lehm- 

vorkommen um Nürnberg. (1899.) 8«. 126 S., 3 Taf., 1 Tab. 
3978. Kinkelin, Prof. Dr. F., Beiträge z. Geologie d. Umgegend von 
Frankfurt a. M. Mit 2 Taf. u. 6 Textfig. S.-A. a. „Ber. d. 
Senckenberg. Naturf. Ges.** 1900. S. 121-166. 8<^. 

3971. Klinkhardt, Victor, Beiträge z. Morphologie u. Morphogenie d. 

männl. Genitalapparates d. Rhopaloceren. 8^. 32 S, 2 Taf. 
3699. Klunzinger, Prof. Dr. C. B., Über Zwergrassen bei Fischen u. 

bei Felchen insb. S.-A. Jahrb. d. V. f. v. Naturk. Württ 

1900. Bd. 56, S. 519—532. 8«. 
3945. König, Prof. Dr. Walter — , Goethes optische Studien. Festrede 

z. Feier v. Goethes 150. Geburtstag, geh. am 26. Aug. 1899 

im Hörsaal des Physikal. Vereins zu Frankfurt a. M. 8^. 

32 s. r- T 

Digitized by VjOOQLC 



75 

3947. Kreümair, Dr. med. Aug., )4ie Kunst, d. Auge vor Krankht. a. 
Schwäche zu bewahren, zugleich eine Anweisg. z. Pflege d. 
kranken u. schwach. Auges mit bes. Rücksicht auf Erziehg. 
u. Lebensw. nebst einer Einltg. ü. d. Werth a. d. Beschaifht. 
d. Sehorgans, geschr. f. Eltern, Lehrer u. z. Selbstunterricht 
f. Jedermann. Nürnberg 1846. 8<^. VIu. 126S. Beigebunden: 
Heinrich. Schmidt, Über Knochennenbild. i. Innern d. Auges. 
Inaug.-Diss. Erlangen 1861. 82 S. 

3327. Leipzig, Verein für Erdkunde: wissenschaftl. VeröflFentlichungen 
IV. Band; Friedr. Ratzel, Beiträge z. Geographie d. mittl. 
Deutschland. Mit Abbildgn. u. Karten. Leipzig 1890. 8<^. 
VIU u. 382 S. 

3991 . Lemberg, Verein f. Volkskunde : Mlynek Ludw . Zycie Sierskich 
Pasterzy przed dwudzicstu laty. S.-A. aus dem 4. Bd. des 
„Lud.** 1898. S^. 22 S. 

3982. Lengenfeldt, Theod. v,, Rufsland im 19. Jahrhdt. Berlin 1875. 
8«. 416 S. 

3949. lAnne, des Ritters Karl v, — vollst, l^anzensystem nach d. 13. 
latein. Ausg. u. n. Anleitg. d. holländ. Iloutuynischen Werks 
übers, u. m. einer ausführl. Erklärung ausgefertiget. Nürn- 
berg. 8®. 1777. Erster Theil. Von den Palmbäumen u. a. 
Bäumen nebst 11 Kupf. 796 S.; Zweiter Theil. Von den 
Bäumen. Nebst 9 Kupf. 548 S. u. Register; Dritter Theil. 
1778. Von d. Gesträuchen. N. 10 Kupf. 684 S. 
— , 8. auch Stockholm, k. schw. Akad. d. Wiss. 
Lotier, /. N., s. Nürnberg. 
Maver, John, s. Zufiiga Martinez de. 

3749. Meyer, Carl Heinr. Gottl., Gründl. u. treue Anweisung z. Obst- 
baumzucht für Gärten u. d. freye Feld. Zur Beförderg. e. 
allg. Obstbaues insond. f. d. Bürger u. Landmann. 3 Hefte 
in einem Band. Hof 1826 u. 1827. XXXII u. 86 S.; VIII 
u. MO S.; VI u. 114 S. 8«. 
M\ffnek, Ludw,, s. Lemberg, Ver. f. Volkskunde. 
Müller, Joh., s. Stockholm, Akad. d. Wiss. 

3447. Naiurfor Scherversammlung. Histor. Studien u. Skizzen zu Natur- 
wissenschaft, Industrie u. Medizin am Niederrhein. Der 70. 
Versammig. d. d. Naturforscher u. Ärzte gewidmet v. dem 
naturw. Verein, d. Architekten- u. Ing.-Ver., d. Geschichts- 
Ver. u. d. Ver. d. Ärzte Düsseldorfs. Düsseldorf 1898. 8^ 
134 u. 173 ♦ S. nebst Register (aus den Tauschschriften, 
4. Band d. Mitteilungen d. naturw. Ver. in D.) 

3976. Noll, F., Über Geotropismus. (Sep.-Abdr. a. d. Jahrb. f. wissen- 

schafU. Botanik, Bd. XXXIV.) Leipzig 1900. 8«. S. 457—506. 

3977. — , Über den bestimmenden Einflufs v. Wurzelkrümmungen auf 

Entstehung u. Anordnung d. Seitenwurzeln, ^lit 3 Taf. u. 

Digitized by VjOOQIC 



76 

UTextab. Berlin 1900? 8^. Sep.-Abdr. a. Landwirt. Jahr- 
bücher 1900. S. 361—426. 

3969. Iilordaee-Bäder, Beschreibung der — , Sylt, Westerland u. Wenning- 
stedt. V. d. Seebade-Direktion. 1900. ill. kl. 8«. 80 S. 

3704. Nürnberg, Anthropolog. Sektion der Naturh. Gesellsch. Fund- 
bericht Nr. 7 : Ludw. Wunder. Bericht über die Abgrabung 
des Grabhügels YII bei Labersricht, vorgen. am 9. u. 10. 
April 1900 durch d. Naturh. Ges. 2 Seiten Text, 8 S. Zeich- 
nungen, Hectogramme. 

8964. — , Bayer. Gewerbemuseum. Jahresber. 1899. ill. 66 S. 4®. 

3382. — , Chemische Sektion der Naturhistor. Gesellschaft, Festblatt 
z. Stiftungsfeste. 1895. 1896 (induplo), 1897 (in duplo). 1898. 
1899, je 4 S. 40 
~, Deutscher Hopfenbau-Ver., s. Paris 1900 Expos, univ. 

3962. — , Erinnerungsschrift an die 600-jähr. Geburtsfeier Job. Guten- 
bergs zu Nürnberg. Veranstaltet v. d. Buchdruckern Nürn- 
bergs am 16. u 17. Juni 1900. 4« 

3932. — , Festschrift z. Feier d. 30jähr. Bestehens d. Sektion Nürn- 
berg d. D. u. Österr. Alpenvereins. 1899. 4*. reich illust. 
70 S. u. Jahresber. 

3494. — , Fr. SchuUheifs, Phänolog. Mitteilgn. Unser Frühjahr 1900. 
Nr. 148 d. Gen.-Anz. 

3956. ~ , /. M. Lotier, Sagen, Legenden u. Geschichten d. Stadt Nbg. 
Mit 96 Abb. 1899. 8«. VI u. 496 S. 

3960. — , Naturhistor. Qesellsehaft: Drucksachen vom 80-j. Stiftungsfest. 

3961. — , Statut f. d. Benützg. d. städt. Wasserleitungen. 1893. 4« 8S. 
3966. — , Rogner, h'onr., Der Vieh- u. Schlachthof der Stadt N. Unter 

Mitwirkg. d. städt. Bauamtes. 1900. illust. 8«. 72 S. 

3314. -, Rudel, Prof., Die Witterung Nürnbergs i. J. 1899. 8«. 32 S. 

3277. Orfele, Dr, Felis v., Materialien zu e. Geschichte d. Pharaonen- 
medicin, S.-A. a. d. Wiener klin. Wochenschrift. 1899. 8^. 12 S. 
— Nagana vor drei- bis viertausend Jahren. S.-A. a. d. Thier- 
ärztl. Wochenschr. 1899. 4 S. — Zum konträren Geschlechts- 
verkehr in Altägypten. S.-A. a. Monatsschr. f. Prakt. Der- 
matol. 29. Bd. 1899. S 409—411. 

1246 b. Oken, Abbildgn. zuOkens allgem. Naturgeschichte f. alle Stände. 
Stuttgart 1843. Fol Mineralogie 6 Taf., Botanik 22 Taf., 
Anatomie 13 Taf., Zoologie Taf. I— XXI, Taf. 36-96; Supp- 
lement dazu Taf. 1—32. 

3930. Oppel, Dr. Albert, Palaeontologische Mitteilungen a. d. Museum 
d. k. bayer. Staates. Stuttgart 1862. 8*>. Ein Band Text. 
IV u. 322 S. - Ein Band Atlas, 88 Taf. m. Texterläutgn. 
Paolettiy Dr. Giulio, s. Fiori, Dr. Adriano. 

3955. Paris 1900, Exposition univers. (Prof. Dr. Fr. Wagner), Der 
Deutsche Hopfenbau. Ursgbn. v. D. Hopfenbau- Verein in 

Digitized by VjOOQIC 



77 

Nürnberg. München. S^. 24 S. — Ders., La Galtare alle- 
mande da hooblon. 8<^. 24 S. 
3978. Pariiy Les Curiositez de —, de Versailles, de Marly, de Vincennes, 
de S. Cload, et des Envirions; avec les Antiquitez justes 
et pr^cises sar chaque sajet. Par M. L. R. Noav. £dit. ill. 
Paris MDCCXLIl. kl. 8« Tome Ir; VIII a. 456 S.; Tome 
2«. 396 S. 

3974. — , Nouv. Voyage de France Geographiqae , Histor et Curieax. 

Dispos^ par diff^rentes Roates, k TUsage des Etrangers et 
des Fran^ois. Par M. L. R. Demiere Edit. ill. Paris 
MDCGXXXVIU kl. 8<». 444 S. a. Table aiphabet 
Fax, Dr. Ferd , s. Prantl. 

3992. Fhüippi, Dr. Boduifo A., Gontribacion a la osteolojfa del Grypo- 

tberiom Domesticom Roth i an naevo Delfin. Mit 4 Taf. 
Santiago 1900. S^. 12 S. 

3993. —, Gomparadon de las Floras i Faanas de las Repübiicas de 

Ghile i Aijentina. S.-A. aas d. „Anales de la Universidad^. 
Tomo 84. 1893. 8^ %. 529—555; Sobre los tibarones y al- 
ganos otros peces de Ghile. S.-A. aas demslbn., Tomo 71, 
1887. 42 S. ; Notidas preliminares sobre los haesos fösiles de 
ülloma. S.-A. aas dems., Tomo 82, 1893 S. 499 - 506. 
3968. Pigamol de la Force^ M., Nonv. Description de la France: dans 
laquelle on roit le goavememont general de ce Royaome, 
celai de chaque province en part.; et la Description des 
Villes etc. etc. Amsterdam MDGCXIX. 8». ill. Tome I. : 
Avertiss., 310 S. a. Table des Matieres. Tome II ; Distances, 
333 S. a. Table des Matieres. 

3975. [— ,] Noav. Description des Ghasteaax et Paris de Versailles et 

de Marly. Avec les Plans. Seconde Edit. Paris MDGGVII 

kl. 8«. Preface a. 466 S. 
3908. Pöpta, Canna M, L., Beitrag z. Kenntnis der Hemiasci. In.- 

Dissert. Bern. - S.-A. aas „Flora o. all. Bot. Ztg." 1899. 

Heft 1. 8<>. 50 S. a. 2 Taf. 
2596 b. PrantV^ Lehrbach der Botanik, hrsg. a. nea bearb. v. Dr. B^erd. 

Pax. Mit 414 Fig. 11. v. a. v. Aafl. Leipzig 1900. 8<>. 

VIII a. 456 S. 
3990. Prechil, Joh. Jos., üntersachgn. üb. d. Fing der Vögel. Mit 3 

Kpfrtfl. Wien 1846. 8«. VI a. 260 S. 
3927. Rnmön Zueco de St Joaqfän, M. R. P. Lr. Fr,, Gramätica Bisayo- 

Espaftola adaptada al sistema de Ollendorff. Declarada de 

texto para las escaelas de Filipinas por Real orden de 1876. 

Oaadalape 1890. 8<^. LXIII u. 222 S. 
3918. Rankey Joh., Erinnerang an die vorgeschichtl. Bewohner d. Ost- 
alpen. 4« Iß S. S.-A. a. d. Z. d. I). a. Österr. Alpenver. 

1899. 30. Bd. 

Digitized by VjOOQ IC 



78 

Raizely Fr., s. Leipzig Verein f. Erdkunde. 

3920. Begnum Florae. Das Reich der Blumen mit allen seinen Schön- 
heiten nach d. Natur u. ihren Farben vorgestellt. Nürnberg 
bey Georg Wolffgang Knorr. (Mit dem Bildnis desselben, 
nat. d. 30. Dec. 1705, denat. d. 17. Sept. 1764.) 199 u. 101 
kolor. Tafeln in grobem Kupferstich. Folio. 

3916. Rehm, Dr. H., Ascomycetes I«\iegiani a P. Dus^n collecti. Cum 
tabula. Stockholm 1899. 8. S.-A. a. Bihang tili k. S. Vet.- 
Akad. Bd. 26. Afd. III. Nr. 6. 

3952. — , Beiträge z. Pilzflora v. Südamerika. S.-A. a. d. „Hedwigia" 
XXXIX. 1900. S. 80-99, Taf. IV— VI, S. 209-234. 8^. 

3950. Rohling, Joh., Christoph, Deutschlands Flora, od. System. Ver- 
zeichnis a. in D. entdeckten Gewächsarten; nebst Anleitg. 
z. Kenntn. der äufs. Teile d. Pflanzen. Ein Handbuch f. 
Botaniker z. nützl. Gebrauche b. Unterricht u. Selbststudium, 
auf Exkurs, u. in Biblio. 2. durchaus umg. Ausgabe mit 4 
Kupf. Frankfurt a. M. 1813. 8«. Erster Theil. 1812: XXXII 
u. 428 S. Zweiter Theil 1812: XIV u. 574 S. Dritter Theil 
1813: 1. Abth. 210 S., II. Abth. 190 S., lU. Abth. 409 S. 

3972. Rössler, Dr. Rieh., Die Raupen d. Grofsschmetterlinge Deutsch- 
lands. Eulen u. Spanner m. Auswahl. Eine Anleitung z. 
Bestimmend. Arten. Mit 2 Taf. Leipzig 1900. S^. XVI u. 170 S. 
Rudolf, Prof., 8. Nürnberg — Rudel, Prof. 

3925. Ru^, Dr. Ä., Über Bau u. Verrichtungen des Körpers unserer 

Hausthiere. Anatom. -physioL Einleitung in d. Thierkunde u. 
Thierzucht bearbeitet f. d. Landwirth, Gestütsbeamten, Thier- 
besitzer etc. 2. durch Zusätze u. Holzschnitt verm. Aufl. 
Stuttgart 1859. VI u. 108 S. 

3926. Rychner, J. J., Bujatrik od. System. Handbuch d. äufserl. und 

innerl. Krankheiten d. Rindviehes. 2. stark verm. u. verb. 
Aufl. Bern 1841. 8«. XVI u. 648. 
SchaUenbrand, H. /., s. Buffon, Geo Louis Ceclere Comte de. 
Scheuehzer, Jean-Gaspar, s. Kaempfer. 
Schmidt, Heinr., s. Kreitmaier, Dr. med. Aug. 
3929. Schwarz, Aug., Zerlegbares Modell des Pferdes. Eine Wand- 
tafel in 5 Bildern zum Zusammenklappen. — Dazu: Erklä- 
rung 10 S. 40. 
3921. Selenka, Emil, Der Schmuck des Menschen. Mit 90 Textfig. 

Beriin 1890. gr. 8«. 72 S. 
3967. Slam, — Journal ou Suite du Voyage de Siam. En Forme des 
Lettres familieres fait en 1685 et 1686 par M'- L. D. C. 
Amsterdam MDCLXXXVII. kl. 8. 380 S. 
— , Voyage de Siam des Peres Jesuites, Envoy^s par le Roy, 
aux Indes ä la Chine. Knrichi des Fig. Amsterdam 
MDCLXXXVIII. kl. 80. 317 S. u. Table des Matieres. 

Digitized by LjOOQ IC 



79 

Siam, Second Voyage du Pere [Guy] Tachard Et des Jesultes 
Envoy^s par le Roy, au Boyaume de Siam. illustr. Amster- 
dam MDCLXXXIX. kl. 8». 369 S. u. Table des Matiercs. 

3946. SiadUnger^ Herrn., Über d. Bildg. y. Pseudophit in granit. Ge- 
steinen m. bes. Berücksichtig, d. geol. Verbältn. d. Strebler- 
berges bei Markt Redwitz im Fichtelgeb. inaug.-Dissert. 
Erlangen 1900. Mit e. geolog. Skizze d. Umgebg. v. Mkt- 
Redwitz. 8«. 64 S. 

3912. SUeler, H. F. A., Charte von China. Weimar 1804. 

3979. Stockholm, k. schwed. Akad. d. Wiss.: Briefe v. Job. Müller an 
Anders Retzius v. d. J. 1830-1867. 1900. 4«. Mit Portr., 
II u. 84 S. 

3996. — : Carl von Linn^s Brefvexling. Förteckning upprättad af 
Ewald Ährling. 1885. 8<>. XVIII u. 112 S. 
Taehard, Guy, s. Siam. 

3983. Tiedemann, H,, A Topographical Map of the Isthmus of Panama. 
New- York 1861. 12«. 

3914. Tiermedum, — Eugen Bass, Das Amyloform ein neues Wund- 
heibnittel. S.-A. a. d. Zeitschr. f. Tiermedicin. 1. Bd. 1897. 
4 S. 8^ — Das Tannoform in d. Thierheilkunde. S.-A. a. d. 
Thierärztl. Centralanz. 1899. 8^ IV S. — Dr. St. Grosse, 
Die therapeut. Bedeutg. d. Tannoform. S.-A. a. d. klin -the- 
rap. Woch. 1899. 8«. 32 S. 

3427. Toldt, Dr. Carl, Anatom. Atlas f. Studierende u. Arzte. 7. u. 9. 
(Schlufs-)Lieferg. 1900. 

3933. Visino , J. N., Meine Wanderung nach Palästina. In Briefen 
an einen Geistlichen d. Diözese Passau. Mit Plänen und 
Zeichnungen. Passau 1840. 8«. XIV u. 496 S. 
Vonderau, Jos., s. Fulda Ver. f. Naturkunde. 
Wagner, Prof. Dr. Friedr., s. Paris 1900. Expos, univ. 
Weber, Dr. L. A., s. AUgem.-verst. naturw. Abbdlgn. Heft 22. 

3376. Webar, Fr., Bericht üb. neue vorgesch. Funde in Bayern. Für 
d. Jahre 1897 u. 1898 zusammengestellt. 4«. 22 S. S.-A. 
a. Beitr. z. Anthrop. u. Urgeschichte Bayerns. 

3924. Weife, Dr. C. F. H., Anleitg. z. Erkennung u. Beurtheilg. der 
Hauptmängel d. Hausthiere. Mit dem diest. Bad. u. Würt- 
temb. Gesetze etc. etc. Stuttgart 1862. 8«. VIII. u. 192 S. 
Wunder, Ludw., s. Nürnberg — anthrop. Section. 

3989. Zander, Dr. phil. Enoch: S.-A. a. d. Zeitschr. f. w. Zoologie 
LXVII, 2 1899 u. 3 1900. Beiträge zur Morphologie des 
Stachelapparates d. Hymenopteren S. 289-333; Beiträge 
z. Morph, d. männl. Geschlechtsanhänge d. Hymenopteren, 
S. 461-489; S.-A. a. d. Archiv f. d. ges. Physiol. Bd. 66, 
1897 S. 646-673: Vergl. u. krit Unters, z. Verstand, d. 
Jodreaktion d. Chitins. 

Digitized by VjOOQ IC 



80 

3957. Ziehen, Prof. Dr. Th., Leitfaden der Physiolog. Psychologie in 
15 Vorlesungen. Mit 27 Abb. 5. theilw. umg. Aufl. Jena 
1900. 80. IV u. 268 S. 

3928. Zuniga, Marimez de, An historical view of the Philippine Islands: 
exhibiting their discovery, population, language, government, 
manners, customs, productions and commerce. Published 
at Manila 1803. In two Vol. With a new and accurate 
Map of the Islands. Translated by John Maver. Second 
edition. London 1814. 8« Vol. I XVI u. 308 S.; Vol. II 
296 S. (in einem Band, defekt). 



Digitized by VjOOQ IC 



^ 



Jahresbericht 



der 



Naturhistoriscben Gesellschaft 



SU 



N\irrit)erg^ 



fttr 



1901. 



^•>#<*«- 



Nürnberg. 

Druck von U. £. Sebald. 
190X 



LA . AJ 



Digitized by VjOOQ IC 



Jahresbericht 

der 

Naturhistorischen Gesellschaft 

für 1901. 



I. 

JL)ie Gesellschaft zählte am Anfang des Jahres 390 ordent- 
liche und 12 auTserordentliche Mitglieder; im Laufe des Jahres traten 
25 ordentliche und 15 aufserordentliche Mitglieder ein, während 21, 
darunter 5 infolge Wegzugs, austraten; 5 Mitglieder verlor die Ge- 
sellschaft durch den Tod, nämhch die Herren : C. Conrad ty, Fabrik- 
besitzer; Dr. Hartwig, Gymnasialprofessor; M. Kraufsold, Pfarrer; 
J. Lang, Kaufmann, rmd H. Müller, Kaufmann in Neumarkt, 
welchen die Gesellschaft ein dankbares Andenken bewahren wird. 
Zwei bisherige ordentliche Mitglieder wurden zu Ehrenmitgliedern 
ernannt. Stand der Mitglieder am Ende des Jahres : 385 ordentUche 
und 24 aufserordentliche, Summa 409. 

Von unseren Ehrenmitgliedern feierte Herr Dr. Koch sr. sein 
50 jähriges Doktorjubiläum, wozu ihm in einer von unserem Biblio- 
thekar Hm. Hör mann künstlerisch ausgeführten Adresse die Glück- 
wibische der Gesellschaft dargebracht wurden. 

Anläfslich der Centenarfeier der Gesellschaft erfolgte die Er- 
nennung von 14 EhrenmitgUedern und 11 korrespondierenden Mit- 
gliedern, während aus der Zahl der Ehrenmitglieder die Herren: 
Fr. Arnold, Oberlandesgerichtsrat a. D., München, Fr. Lambrecht, 
Hauptmann, Hann.-Münden und Dr. v. Pettenkofer, Geh. Ober- 
medicinalrat, München; aus der Zahl der korrespondierenden Mit- 
glieder die Herren: H. Hornung, Reallehrer, Ansbach, Weidner, 
Gutsbesitzer, Gerasmühle und G. Wo r lein, Zahlmeister^ a. D.. 

Digitized by VpOOQlC 



Nymphenburg, verstarben ; auch ihnen bleibt ein ehrendes Gedächtnis 
gesichert. 

Die einzehien Sektionen setzten ihre Thätigkeit auf ihren 
speziellen Arbeitsgebieten mit Eifer und erfreulichem Erfolge fort, 
worüber das Nähere in den Sektionsberichten zu finden ist Die 
Früchte dieser stillen Arbeit in den Sektionen kamen in belehrenden 
Referaten und Demonstrationen an den Mittwochsabenden der Ge- 
samtgesellschaft reichlich zu Gute. Der Besuch dieser regelmäfsigen 
Wochenabende war ein zufriedenstellender. Freilich wäre eine noch 
regere Beteiligimg zu wünschen, da durch interessante Vorträge und 
instruktive Vorführungen ein sehr reichhaltiges und manichfaltiges 
Material zur Belehrung der Anwesenden geboten wird, was aus dem 
nachfolgenden Protokollauszuge ersichtlich ist. 

Verzeichnis der in den Sitzungen des Jahres 1901 gehaltenen 
Vorträge, Referate und Demonetrationen. 

1. Sitzimg am 2. Januar: 

Herr G. Sebald, Vortrag: »Bilder aus Kleinasien« unter Vorzeigung 
zahlreicher Photographieen und dortiger Industrieerzeugnisse ; 

Herr Kinkelin, Demonstration und Schenkung von Iguana tuber- 
culata. 

2. Sitzung am 9. Januar: 

Herr Seel, Vortrag: »Etymologie unserer Tiernamen«; 

> Dr. Heerwagen: Demonstration des Skeletes einer Tiger- 

schlange (Python molurus). 

3. Sitzung am 16. Januar: 

Herr Dr. Küspert, Vortrag: »Über die Probleme der Alchemie« ; 
» Dr. Stadlinger, über Einwirkung von Giften, speziell Pfeil- 
giften auf den menschlichen Organismus; 

> Dr. Heerwagen, Vorlage eines durch Herrn Leutnant 

V. Lottner zur Verfügung gestellten Photogramms eines in 
Kamerun erlegten Gorillas. 

4. Sitzung am 23. Januar: 

Herr Kinkelin, Demonstration zweier Schleuderschwänze (Agama 
stellio) aus Palästina; 
» Dr. Heerwagen, über einige Neuanschaffungen zur Vogel- 
sainmiung. 

Digitized by VjOOQ IC 



5. Sitzung am 30. Januar im AnscUufs an die General- 

versammlmig: 
Herr Kinkelin, Übergabe yerschiedener Geschenke für die ethno- 
graphische Sammlmig. 

6. Sitzmig am 6. Februar: 

Herr Paul Bauriedel, Vortrag über eine Reise in Südspanien und 
Marokko ; 

> Kinkelin, Demonstration und Schenkung eines Kapwaran 

Varanus albogularis aus Südafrika; 
» Herrn. Schlegel, Vorlage einer Reihe yon Bildern aus Singa- 
pore und Schenkung einer Karte. 

7. Sitzung am 13. Februar: 

Herr Rhau, Vortrag: >Das Aluminium und seine Gefahren«; 
» Fr. Hub er, Referat über die Fortschritte der Elektrogravure ; 
» Kinkelin, Demonstration und Schenkung einer Kröteneidechse 

(Phrynosoma comutum); 
* Fr. Hub er, Demonstration einer Reihe vom Kanzleramt des 
deutschen Flottenvereins zur Verfügung gestellter Diagramme 
durch das Skioptikon; 
Herr Dr. Heerwagen, Vorlage eines Ichneumons, geschenkt durch 
Herrn Val. Markert in Würzburg. 

8. Sitzung am 20. Februar: 

Herr Erhard, Experimentalvortrag über Sauerstoff und Ozon; 
» Kinkel in, Demonstration und Schenkung eines Leguans (Iguana 
tuberculata). 

9. Sitzung am 27. Februar: 

Herr Dr. Stadlinger, Vortrag: »Über die Entstehung der Alpen«; 

> Paalzow, Demonstration fossiler Schnecken aus dem Ries, 

geschenkt von Herrn Offizial Schultheifs und von Ichthyo- 
sauruswirbeln aus der Gegend von Hersbruck; 

> Dr. Heerwagen, über Edentaten unter Vorlage der in der 

Sammlung vorhandenen Vertreter. 

10. Sitzung am 6. März: 

Herr Scliwarz, Vorlage einer Schenkimg für die Bibliothek; 
» Dr. Stadlinger, über einige vorliegende Mineralien; 
» Kinkel in, Demonstration einer Mokassinschlange And^trodon 
contortrix ; dq^ ^^^d ^y GoOglc 



Herr Schwarz, über den Eichßt&tter Botanischen Garten und jetzige 
Pflanzen Vorkommnisse an dortiger Stelle; 

> Paalzow, Vorlage von Ammoniten aus dem Opalinusthon von 

Eislingen und von Stringooephalenkalk mit Favosites aus 
dem Devon des Harzes: 

11. Sitzung am 13. März: 

Herr Dr. Heerwagen, über Feld- und Haubenlerche; 

> Kinkelin, über Coluber melanoleucus aus Florida; 

» Dr. Heerwagen, über das letzte Auftreten verschiedener 
Tiere in der Nürnberger Gegend, nach einer Publikation 
von Kreisarchivar Dr. Bauch. 

12. Sitzung am 20. März: 

Herr Fr. Hub er, Übergabe einiger Geschenke für Bibliothek und 
Sammlung; 
» Kinkelin^ Demonstration und Schenkung von Grotalos 
horridus; 

> Schwarz, über das Vorkommen von Berg- und Schilüsandstein. 

13. Sitzung am 27. März: 

Herr G. Sebald, Vortrag: »Bilder aus Kleinasien«, 11. Teil; 

» K ü hl k e n , Demonstration und Schenkung zweier amerikanischer 
Schlangen, Bascanium constrictor und Heterodon nasicus; 

> Schwarz, über Holzwespen; 

» Paalzow, Vorlage von Solnhofener Versteinerungen. 

14. Sitzung am 3. April: 

Herr Dr. Fleischmannn, Vortrag über den Bienenstachel mit 
Vorzeigung eines Modells; 

> Huber, über die Anlage des neuen Rangierbahnhofes unter 

Vorlage und Schenkung von Sandproben und Schienen- 
profilen ; 

> Kinkelin, Schenkimg von Zamenis hypocrepis aus Malaga; 

> Schwarz, Übergabe von Geschenken. 

IB. Sitzung am 10. April: 
Herr Dr. Glück, Vortrag: »Über Nebenblätter bei Monokotyledonen« 
unter Vorführung mikroskopischer Präparate nüttels des 
Skioptikons; 

> Rud. Schmidt, Vorzeigimg von Photographieen, Höhlen- 

wohnungen bei Schwabach vorstellend }.^g^^yQQQQ|^ 



Herr Knapp, Schenkung einer Pupa reUgiosa ron der Nordküste 
Kubas; 
» Schwarz, Vorlage von Geschenken und Bericht über einen 
Gesellschaftsauflflug nach Vach, bezw. die dortigen Schilf- 
sandsteinbrüefae. 

16. Sitzung am 17. April: 

Herr Dr. Leyh, Vortrag über die geognostische Beschaffenheit der 
Windsheimer Gegend imd die dort vorkommende Steppenflora; 
» Kinkelin, Schenkung von Elaps corallinus; 

> Schwarz, Vorlage von Gesteinsproben aus der Vacher Gegend. 

17. Sitzung am 24. April: 

Herr Dr. Fleischmann, Vortrag über Fischkrankheiten, insbesondere 
über die Pockenkrankheit unserer SüDswasserfische; 
» Dr. He er wagen, Vorlage von Heuschreckeneiern, geschenkt 
von Herrn Oberstleutnant Abelein; 

> Kinkelin, Schenkung von Algiroides nigropimctatus aus Korfu 

und Anolis carolinensis aus den Vereinigten Staaten; 
» Stadler, Vorlage einer gröfseren Anzahl prächtiger Käfer und 
anderer Insekten; 

> Huber, Vorlage von Stubensandsteinproben; 

> Knapp, Schenkung zweier Aquarelle auf chines. Reispapier. 

18. Sitzung am 1. Mai: 

Herr Dr. Heerwagen, Vorlage einer reichhaltigen Sammlung von 
Naturalien und Droguen, Geschenk der Frau Kaufoianns- 
witwe Zeiser; 
» Dr. Stadlinger, Referat über Olivin im Basalt von Marolds- 
weisach in Unterfranken. 

19. Sitzung am 8. Mai: 
Herr Knapp über Phryganidenlarven; 

> K i n k e 1 i n , Schenkung einer marokkanischen Eidechse, Eumeces 

algeriensis ; 
» Ortmann, Demonstration von Trollius chinensis und zweier 
Doronicumarten. 

> Schwarz, über Verbreitung von Adonis vemalis und Tulipa 

silvestris; 
» Ortmann, Bericht über die hiesige Blumenausstellung; 
» Seel, Vorlage von Photographieen aus Lagos; 
» Schwarz, Vorlage von Geschenken. DigtizedbyGooglc 



8 

20. Sitzung am 15. Mai: 

Herr Aug. Schmidt, Demonstration ethnographischer Gegenstände 
aus China; 
» Knapp, Schenkung weiterer chinesischer Bilder; 
» K i n k e 1 i n , Demonstration von Lioheterodon madagascariensis ; 
» r t m a n n , Demonstration von Iris pumila und von Papageitulpen ; 
» Schwarz, üher Taenia echinococcus. 

21. Sitzung am 22. Mai: 

Herr Dr. Sigm. Günther, Vortrag über den Nürnberger Natur- 
forscher £. V. Bibra; 

> Huber, Schenkung einer Anzahl älterer Werke geographischen 

Inhalts ; 

> Dr. Kellermann, über Myosotis Rehsteineri, Ranunculus 

reptans und Saxifraga opposififolia; 
» Dr. Heerwagen, Vorlage von Waffen und Photogrammen 
aus Neuguinea. 

22. Sitzung am 29. Mai: 

Herr Kinkelin, Vorlage von Geschenken des Herrn Apotheker 
Graf, dann einer Vipera berus, lebend vom Schmausenbuck, 
der Coronella laevis und Tropidonotus natrix; 

> Schwarz, diverse Mitteilimgen ; 

» Dr. Kellermann, über Mauerbienen; 

> V. Schultheifs, Demonstration zweier Mamillarien und einer 

Gasteria lingua var. nigrescens; 

> Schwarz, über die gelbe Farbenspielart von Cypripedium 

Calceolus. 

23. Sitzung am 5. Juni: 

Herr Kinkel in, Demonstration zweier lebender in der Färbung 

stark abweichender Kreuzottern; 
» Adalb. Rudel, Referat über seine auf Spaziergängen gemachte 

naturhistoriscbe Ausbeute; 
» V. Schultheifs, Demonstration von Echinocereus Roemeri 

und Sedum fruticosum im blühenden Zustand; 
» Schwarz, Referat über Gesellschaftsausflüge in die Reicheb- 

dorfer, bezw. Schnaittacher Gegend. 

24. Sitzung am 12. Juni: 

Herr Enslin, Mitteilung betr. das Nest einer Mauerbiene; 

» V. Schultheifs, Vorlage von Sempervivum arachnoideum 
und Haworthia cymbifoUa; ^^^^^^^^^ ^^ GoOglc 



9 

Herr Dr. Heerwagen, Referat über den Kukakstrieb; 

> Kinkeiin, über den Unterschied zwischen Spargelkohl und 

Rosenkohl und über die Araucarienarten; 

> Preifs, Vorlage von Seidenraupen in verschiedenen Ent- 

wicklungsstadien. 

25. Sitzung am 19. Juni: 

Herr Stadler, Vorlage von Wassernüssen aus der Gegend von 

Lugano ; 
» Dr. Heerwagen, Vorlage von Aspenholz, vom Aspenbock 

zerfressen, übergeben von Herrn Hofrat Dr. Scheidemantel; 
» Kinkelin, Demonstration von Zamenis constrictor und einer 

Kollektion photograplüscher Aufnahmen mikroskopischer 

Objekte, gefertigt von Herrn Fabrikbesitzer Wening; 

> Dr. Heerwagen, Referat über die Ausbildung des Rehgeweihs 

unter Vorlage von Belegstücken, überlassen von Herrn 
Meinecke und Herrn Sebald; 

* V. Schultheifs, Vorlage von Sedum dasyphyllum und 

Gasteria verrucosa im blühenden Zustande. 

26. Sitzung am 25. Juni: 

Herr Knapp, Schenkung einer Anzahl chinesischer Handmalereien; 

> Schwarz, Vorlage von Peziza auf faulendem Holz vom Hutberg ; 

> Kühlken, Schenkung einer amerikanischen Wasserotter, 

Ancistrodon piscivorus, und Vorlage einer lebenden Band- 
natter aus Nordamerika; 

* Dr. Kellermann, Vorlage von Sedum acre mit Luftwurzehi; 

> Hörmann, Vorlage ethnographischer Gegenstände; 

> Schwarz, Vorlage von Abbildungen. 

27. Sitzung vom 3. JuU: 

Herr Kinkelin, Demonstration von Geschenken; 
» V. Schultheifs, Vorlage von Gasteria pastinacifoUa ; 

* Schwarz, Bericht über einen Gesellschaftsausflug und über 

das Vorkommen der Latsche bei Simonshof; 
» Erhard, über Gewinnung des Latschenöls bei Reichenhall; 

* Schwarz, Vorlage von Geschenken für die BibUothek. 

28. Sitzung am 10. Juli: 

Herr Adalb. Rudel, Experimentalvortrag über Kohlensäure; 

* V. Schultheifs, Vorzeigung der Phloemstränge von Cereus 

speciosisämus. oigtized by Google 



29. Sitzung am 17. Juli: 

Herr Stadler, über den Schädling des Espenholzes, Glytus rusticus; 

> Hörmann, Vorlage eines Werkes »Mährische Ornamente«, 

vom Olmützer Museum herausgegeben; 

> V. Schultheifs, Vorlage von Portulaca oleracea. 

30. Sitzung am 24. Juli: 
Herr Schwarz, über Oestriden; 

» V. Schultheifs, Demonstration von Mamillaria iaciacantha; 

> Schwarz, über Nymphaea alba und semiaperta. 

31. Sitzung am 31. Juli: 

Herr Schwarz: Mitteilimgen über Ixodes ricinus; 

> Dr. Heerwagen, Referat über Rudolf Blasius, eine Reise im 

nordwestlichen Frankreich ; 
» Schwarz, Demonstration von Mikrolepidopteren der Sammlung 
und Bericht über einen Gesellschaftsausflug. 

32. Sitzung am 7. August: 

Herr Schwarz, Vortrag über die Erlangen-Höchstadter Weiher- 
gegend ; 

> V. Schultheifs, Vorlage von Scilla maritima; 

> Kinkelin, Demonstration von Polyphyllo fullo. 

33. Sitzung am 14. August: 

Herr V. Schultheifs, Demonstration von Aloe picta nigricans; 
» Dr. Schrenk, Reiseschilderungen aus Dalmatien, Montenegro 

und Bosnien; 
» Dr. He erwägen, über den Paraguaythee. 

34. Sitzung am 21. August: 
Herr Gust. Wunder, über Ausgrabungsfunde; 

» Kinkelin, Demonstration lebender Eidechs^i, Uromastix 
spinipes, Tupinambis teguixin und Ctenosaura acanthon; 
» V. Schultheifs, Demonstration von Eucomis punctata; 

> Schwarz, über einen Gesellschaftsausflug nach den Dechsen- 

dorfer Weihern und die gemachten botanischen Funde; 

> K. Huber, Schenkung eines Ceratites nodosus. 

35. Sitzung am 28. August: 
Herr Aug. Schmidt, über den Paraguaythee; 

> Kinkelin, Vorführung eines lebenden neuhoUindischen Skinks, 

Tiligua nigrolutea und lebender Chamäleons, sowie verschie- 
dener von demselben hergestellter Fgr^|^präparat^^ 



11 

Herr Schwarz, verschiedene botanische und zoologische Mitteilungen ; 

> Dr. Heer wagen, über verschiedene Entenarten. 

36. Sitzung am 11. September: 

Herr Dr. Küspert, Vortrag über den >Kreislauf des Kohlenstoffs« ; 

> Kinkel in, Schenkung von Ctenosaura aoanthura. 

37. Sitzung am 11. September: 

Herr Ortmann, Vortrag »über die Dahlien und ihre Formen« unter 
Vorführung eines grofsen Sortiments von Schnittblumen; 

> Kinkeiin, Demonstration von Tupinambis teguixin und eines 

Octopus ; 

> Erhard, Referat über Gewinnung billigen Sauerstofib nach 

Raoul Pictet; 
» Schwarz, Obergabe eines Geschenkes von Herrn Dr. v. Oefele 
in Neuenahr für die Bibliothek. 

38. Sitzung am 18. September: 

Herr Paalzow, Demonstration verschiedener Filze; 

> Wunder, Schenkung von Photographieen (Gräber aus der 

Steinzeit) ; 

> Schwarz, über das Vorkommen von Lepidium virginicum und 

Vorlage eines Geschenkes von Herrn Eugen Mayer in Mantlach. 

39. Sitzung am 25. September: 

Herr Dr. Stadlinger, chemische Demonstration; 

> Dr. Kellermann, über verschiedene Insekten; 

» Paalzow, über Kantengeschiebe und Windfurchen; 

» V. Schultheifs, Demonstration von Euphorbia caput Medusae ; 

» Kinkelin, Schenkung eines jungen Hechtalligators. 

40. Sitzung am 2. Oktober: 

Herr Dr. Kellerman, Vortrag über botanische und zoologische 
Beobachtungen auf Langeoog; 
» Dr. Leyh, über Rubellan; 

> Erhard, über Algen und Schizophyten unter Vorlage von 

Präpaiaten. 

41. Sitzung am 9. Oktober: 

Herr Dr. Glück, Vortrag über Utricularien unter Vorführung von 
Projektionsbildem ; 

> Dr. Kellermann, Mitteilungen zum gleichen Thema; 

» Schwarz, Schenkung eines Ceratites nodosus^g.^.^^^^yQQQoIe 



12 

42. Sitzung am 16. Oktober: 

Herr Enslin, Vortrag über »die Philippinen und ihre Bewohner«; 

> Knapp, Demonstration ethnographischer Gegenstände von 

Yucatan ; 

> Dr. Stadlinger, Schenkrmg einer Gesteinsplatte, phyllitgueiTs- 

artiges Gestein mit welliger Struktur; 
» V. Schultheifs zeigt Eucomis punctata, Mamillaria imbricata. 

43. Sitzung am 23. Oktober: 

Herr Dr. Grimm, Vortrag: »Beobachtungen auf Yesso« ; 

» Kühlken, Demonstration von Natrix sipidon und Tropidonotus 
ordinata, beide lebend; 

> Osk. Gebhart, über die schwarze Varietät der Kreuzotter; 
» Aug. Schmidt, Vorlage chinesischer Münzen. 

44. Sitzung am 30. Oktober: 

Herr Kinkelin, Demonstration von Reptihen, Geschenk des Herrn 
Kommerzienrat Sachs; 

> Erhard, Vorzeigung mikroskopischer Algenpräparate; 

> Kinkel in, über das Vorkommen der schwarzen Kreuzotter. 

45. Sitzung am 6. November: 

Herr Schwarz, über die Fruchstände des Tuipenbaums und über 
die Untergrundverhältnisse Nürnbergs; 
» Eckert, über die Bildung der sog. Lichthöfe bei Photogrammen ; 
» Schwarz, Bericht über einen Gesellschaflsausflug. 

46. Sitzung am 13. November: 

Herr Dr. Küspert, Vortrag über die lonentheorie I. 

47. Sitzimg am 20. November: 

Herr Dr. Küspert, Vortrag über die lonentheorie II. 

48. Sitzung am 27. November: 

Herr Paalzow, über eine neuangelegte Lokalsammlung von 
Conchylien ; 

> Dr. Heerwagen, Vorlage von Tafeln aus dem' Naumann'schen 

Vogelwerk. 

49. Sitzung am 4. Dezember: 

Herr Engerer, Referat über verschiedene in neugriechischer Sprache 
geschriebene botanische Abhandlungen von Dr. v. Heldreich 
in Athen; C^r^r^n]o 

' Digitized by V^OOQIC 



13 

Herr Schwarz, Demonstration einer hier in einem mit Cedemholz 
beladenen Eisenbahnwagen gefundenen lebenden Schlange; 

> Aug. Schmidt, Mitteilung einer astronomischen Erscheinung. 

50. Sitzung am 11. Dezember: 

Herr Wirth, Vortrag: »Fortschritte im Beleuchtungswesen« I; 

> K u h 1 k e n , Demonstration lebender Schlangen : Coluber guttatos, 

Lampropeltis getulus, Eutenia sirtalis, Natrix sipidon. 

51. Sitzung am 18. Dezember: 

Herr Wirth, Vortrag: »Fortschritte im Beleuchtungswesen« II. 

> Engerer, über Aufbewahrung von Blütenteilen. 

In den Sitzungen wurde wie bisher vom Direktor über die 
zahlreichen hterarischen Einlaufe eingehend referiert. Mit Dank ist 
zu erwähnen, dafs Herr Ortmann seine herrliche Kollektion von 
Edel-Dahlien, deren Vorführung hohes Interesse und reichen Genufs 
bot, zu Gunsten der Sammelbüchse (Archaeopteryx) geschenkt hat; 
Herr Kinkelin hat abermals in dankenswerter Weise der Reptilien- 
sammlung wertvolle von ihm selbst sorgfältig präparierte Exemplare 
hinzugefügt. 

Die von Seiten des Bibliothekars hinausgegebene Umfrage betr. 
der hölzernen Glockenhalsbänder oder Schellenbögen hat zahhreiche 
Beantwortimg gefunden, wofür bestens gedankt wird. Die Samm- 
lungen wurden seitens der hiesigen Schulen und Lehranstalten fleifsig 
besichtigt; ihr hoher Wert wird hinfort noch allgemeiner erkannt 
werden, da nun — dank der reichen Zuwendungen, welche aus 
Anlafs des 100-jähr. Jubiläums unsrer Gesellschaft gemacht wurden 

— dieselben endlich eine würdige, dem Zwecke eingehender Besich- 
tigung und ernsten Studiums entsprechende Aufstellung gefunden 
haben. Es steht zu hoffen, dafs in Zukunft der Besuch' unsres natur- 
historischen Museums auch von Seiten Erwachsener sich mehr und 
mehr steigern wird, zumal da dasselbe fortan zweimal wöchentlich 

— Sonntags von 10 — 12*/« Uhr und Mittwochs von 2—4 Uhr unent- 
gelthch geöffiiet ist. 

Am 6. Dezember v. J. hatte die Gesellschaft die Ehre, dafs 
von Mitgliedern der beiden städtischen Kollegien die Sammlungen 
einer eingehenden Besichtigung unterzogen und in ihrem Werte voll 
gewürdigt wurden. Möge das warme Interesse, das von Seiten der 
Gemeindevertretung der Gesellschaft im verflossenen Jahr entgegen- 
gebracht wurde, dauernd derselben erhalten bleiben und immer 

Digitized by VjOOQ IC 



14 

weitere Kreise zur Förderung der Bestrebungen unserer Gesellschaft 
angeeifert werden. 

Das verflossene Jahr brachte der Gesellschaft eine grofse An- 
zahl von Geschenken, sowohl für die Bibliothek als auch far die 
Sammlungen. Näheres hierüber im Sehenkimgs- und Bibliothek- 
bericht Der Tauschverkehr mit auswärtigen Gesellschaften und 
Instituten hat Dank der rastlosen Bemühungen unseres Bibliothekars 
sich abermals erweitert. Die zur Anschaffung eines Konversations- 
Lexikons auf Anregung eines Mitgliedes eingeleitete Sammlung frei- 
williger Gaben hatte den besten Erfolg. 

Zum ersten Male fand — am 10. Mai v. J. — eine Ver- 
losimg von Schuldscheinen statt; es wurden 3 Scheine ä 50 Mk. 
und 2 ä 25 Mk. ausgelost; 1 solcher ä 50 Mk. und 2 zu 25 Mk. 
wurden zur Rückzahlimg präsentiert, die andern geschenkt; aufser 
diesen wurden noch weitere 13 Schuldscheine geschenkweise zurück- 
gegeben, für welche Zuwendungen herzlich gedankt wird. 

Schliefslich erledigen wir uns der angenehmen Pflicht, für die 
Unterstützungs-Beiträge von Seite des Staatsministeriums, der Kreis- 
regierung und der Stadt Nürnberg den ergebensten Dank auszu- 
sprechen; ebenso ist dankbar zu erwähnen, dafs die Redaktion des 
»Frank. Kurier«, sowie des »General-Anzeigers« die Protokoll- Aus- 
züge unserer Mittwochssitzungen unentgeltlich veröffentlichten. 



Digitized by VjOOQ IC 



Bericht über das 100 jährige Jubiläum. 



Als unsere Gesellschaft in das Jahr ihres 100 jährigen Bestehens 
eintrat, waren es nicht blos hofTnungsvolle Gefühle, die die Mitglieder 
derselben beseelten, sondern ebenso auch bange Sorgen, verursacht 
durch die unzulänglichen materiellen Mittel und noch mehr durch 
die Beschränktheit der zu Gebote stehenden Räume. Sollte eine 
würdige Jubelfeier stattfinden, so mufste nach beiden Seiten hin 
grundUche Abhilfe geschaffen werden. 

Nachdem im Schofse der Vorstandschaft der Rahmen, in 
dem das bevorstehende Fest sich abspielen sollte, im allgemeinen 
festgestellt war, wurde der I. Bürgermeister unserer Stadt, Herr 
Dr. V. Schuh um Übernahme des Ehren Vorsitzes in dem zu bildenden 
Festkomit^ ersucht. Die höchst schätzenswerte Gewährung dieser 
Bitte liefs von vornherein- einen günstigen Verlauf der Vorbereitungen 
zum Feste erhoffen. 

Nach vorausgegangenen Besprechungen von Mitgliedern und 
Freunden der Gesellschaft bildeten sich 3 Ausschüsse: ein Fest- 
Ausschufs unter Vorsitz des Herrn Postamtsdirektor Schmidt, ein 
Finanz-Ausschufs, mit Herrn Magistratsrat Reh len als Obmann und 
ein Redaktions-Ausschufs, der sich Herrn Dr. v. Forster als Vor- 
sitzenden wählte. 

Letzterem Ausschusse stand sofort das nötige wissenschaftliche 
Biaterial für die Festschrift zur Verfügung, die städtischen Behörden 
hatten in hberaler Weise zu deren Herausgabe Mk. 1500. — bewilligt, 
während die Kosten für Druck und Einband durch das Entgegen- 
kommen der Herren Sebald und Nister ganz wesentlich verringert 
wurden. War auch hiedurch die Aufgabe des Finanz-Ausschusses 
erleichtert, so blieb ihm doch noch ein gewaltiges Stück Arbeit 
übrig, denn es galt nicht blos, die Mittel für eine würdige Durch- 
fuhrung des Festes selbst, sondern auch die Baukosten für Neu- 
aufstellung der Sammlungen aufzubringen. Beides wurde durch hin- 
gebende Thätigkeit, namentlich des Herrn Magistratsrates Rehlen 
in ausgiebiger Weise zu stände gebracht. So konnte man an den 
Umbau der benötigten Räume herantreten, welcher unter der Leitung 

Digitized by VjOOQ IC 



16 

der Herren Architekten Hecht und Bürger in ganz entsprechender 
Weise eben noch rechtzeitig fertig gestellt werden konnte. In den 
wenigen noch übrigen Tagen vor Beginn des Festes gelang es dem 
Konservator unter bereitwilliger Hitwirkung von mehreren Mitgliedern 
der Gesellschaft, die Umstellung der Sammlungen in letzter Stunde 
noch zum Abschlüsse zu bringen. Die oberen Räume des Gesellschafls- 
hauses wurden für die Dauer des Festes zur Ausstellung sonst nicht 
allgemein zugänglicher Teile der Sammlung benützt 

Im Bewufstsein, alles wohl vorbereitet zu haben, was einen 
befriedigenden Verlauf des Festes verbürge, fanden sieh die Fest- 
teilnehmer am Abend des 26. Oktober in den würdig geschmückten 
Räumen der Gesellschaft Museum zusammen. Aufser den Vertretern 
hiesiger Gesellschaften hatte sich bereits eine Anzahl auswärtiger 
Gäste aus Erlangen, Würzburg, Regensburg, Markt-Redwitz, München, 
Stuttgart und Manila eingefunden. Das philharmonische Orchester 
brachte ein gediegenes Programm in trefflicher Weise zum Vortrage. 
Die Begrüfsungsansprache hielt der Direktor der Gesellschaft, welchem 
sodann Herr Professor Dr. Kellermann das eben eingelaufene Diplom, 
in dem derselbe zum korrespondierenden Mitgliede der Senckenberg- 
schen Naturforschenden Gesellschaft zu Frankfurt a. M. ernannt 
wurde, übergab. Der Direktor dankte in seinem und der Natur- 
historischen Gesellschaft Namen für die Ehrung und brachte ein 
allseits lebhaft begrüfstes Hoch auf das fernere Gedeihen der Gesell- 
schaft aus. Zur Verteilung gelangte ein von Herrn Spandel der 
Gesellschaft zu ihrer Säkularfeier gewidmetes Gedenkblatt. Herr 
K. Hörmann hatte eine launige Jubiläumspostkarte mit Ansichten 
vom Inneren und Äufseren des Gesellschaftshauses und Herr Präge- 
anstaltbesitzer Lauer eine auf die Feier bezügliche Erinnerungs- 
medaille gestiftet. 

Den sonntäglichen Festtag eröffnete die Besichtigung der 
Sammlungen. Dieselben machten in der durch den Umbau ermög- 
lichten Ausdehnung einen recht erfreulichen Eindruck und wurden 
von zahlreichen Mitgliedern und Gästen, insbesondere vom Präsidenten 
der Kreisregierung Herrn Dr. von Sc he Hing und dem offiziellen 
Deputierten dieser Behörde Herrn Kreismedizinalrat Dr. Bruglocher 
mit Interesse besichtigt. 

Um 11 Uhr begann im festlich geschmückten Saale des 
»Museum« der eigentliche Festakt, eröffnet durch das vom phil- 
harmonischen Orchester vorgetragene Vorspiel zu den Meistersingern. 
Hierauf begrüfste Herr Professor Dr. Heer wagen die zahlreich er- 
schienenen Festgäste. Nach ihm überbrachte Herr Kreismedizinalrat 

Digitized by LjOOQIC 



17 

Dr. B ru g 1 c h e r die Glückwünsche der Kreisregierung. Herr I. Bürger- 
meister Dr . V. S c h u h sprach namens der städtischen Verwaltung, welche 
der Jubilarin deshalb ein ganz besonderes Interesse entgegenbringe, 
weil sie nicht blos die Verbreitung naturwissenschafUicher Kenntnisse 
im allgemeinen, sondern insbesondere die Erforschung der natur- 
geschichtlichen Verhältnisse unserer Umgebung sich zum Ziele gesetzt 
habe. Herr Professor Dr. Klunzinger aus Stuttgart beglückwünschte 
die Gesellschaft namens des Vereines für vaterländische Naturkunde 
in Württemberg- Herr Professor Dr. Eheberg, Erlangen, brachte die 
Grufse der benachbarten Hochschule, die seit langer Zeit die Be- 
strebungen der Gesellschaft mit Interesse verfolge. Herr Dr. Pöverlein 
übermittelte die Wünsche der königl. botanischen Gesellschaft zu 
Regensburg und auch des Naturwissenschaftlichen Vereines seiner 
Vaterstadt. Für den hiesigen Ärztlichen Verein . sprach Herr Dr. Karl 
Koch, für die Medizinische Gesellschaft und PolikHnik Herr Dr. Fiat au, 
für den Ärztlichen Bezirksverein Herr Dr. Heinrich Koch, für den 
Verein für öffentliche Gesundheitspflege Herr Dr. Goldschmidt. Die 
anthropologische, chemische und technologische Sektion liefsen durch 
ihre Obmänner Festgeschenke überreichen. Um für letztere, sowie 
für die wohlwollenden Ansprachen und die zahlreich eingelaufenen 
GlückMTünsche zu danken, ergriff der Direktor nochmals das Wort 
und knüpfte daran einen Rückblick über die Entwickelunp^ der 
Gesellschaft im ersten Säkulum ihres Bestehens. Es folgte hierauf 
der Festvortrag des Ehrenmitghedes Herrn Professor Dr. Günther, 
München, über die Bedeutung der VereinsthäUgkeit für die Natur- 
forschung, sein Thema mit der ihm eigenen Beredsamkeit durch- 
führend. Sodann wurden durch Herrn Pfarrer Rudel die Namen 
derjenigen Persönlichkeiten bekannt gegeben, welche bei Gelegenheit 
der Jahrhundertfeier zu Ehren- und korrespondierenden Mitgliedern 
erwählt worden waren. Erstere sind: Ihre Kgl. Hoheit Prinzessin 
Therese von Bayern, die Herren: Dr. Ascherson, Universitäts- 
professor, Berlin ; Dr. B ö 1 1 g e r, Professor, Frankfurt a. M. ; Dr. F 1 e i s c h- 
mann, Universitätsprofessor, Erlangen; Dr. Grembler, Professor, 
Breslau; Le Jolis, Cherbourg; Dr. Klunzinger, Professor, Stuttgart; 
Knapp, k. spanischer Konsul, Nürnberg; Dr. Magnus, Universitäts- 
professor, Berlin; Dr. Much, Professor, Wien; Dr. Naue, Historien- 
maler, München; Dr. v. Schuh, I. Bürgermeister, Nürnberg; Vofs, 
Geheimrat, Berlin; Dr. v. Wett stein, Univ.-Professor, Wien. Unter 
die Zahl der korrespondierenden Mitglieder wurden aufgenommen 
die Herren : Budde Lund, Kopenhagen ; Dr. G e n g l e r, Stabsarzt, 
Erlangen; Dr. Gräbner, Privatdozent, Berlin; Charles^anet* 

Digitized by VjOOQIC 



18 

Beauvais; Dr. Kinkelin, Professor, Frankfurt a. M. ; Dr. Lampert, 
Professor, Stuttgart; Dr. Parrot, prakt. Arzt, München; Peters, 
Waldhausen b. Hannover; Dr. Pöverlein, Rechtspraktikant, Regens- 
burg; Dr. Solereder, üniversitätsprofessor, Erlangen; Dr. Wagner, 
Professor an der Akademie Weihenstephan. 

Im Anschlüsse an diese Mitteilimgen brachte Herr Rudel ein 
begeistert aufgenommenes Hoch auf Se. kgl. Hoheit den Prinzregenten 
Luitpold von Bayern aus, unter dessen Regierung sich alle auf 
Bildung imd Volkswohl gerichteten Bestrebungen kräftiger Förderung 
zu erfreuen hätten. Mit Intonierung der Königshymne schlofs die 
erhebende Feier. 

Zu dem im Adlersaale stattfindenden Festmahle fanden sich 
zahlreiche Teilnehmer, darunter ein reicher Damenflor, ein. Den 
Reigen der Toaste eröffnete Herr Postamisdirektor Schmidt mit einem 
Hoch auf den Prinzregenten, an welchen ein Huldigungstelegramm 
abgesandt wurde, worauf noch im Laufe des Abends im allerhöchsten 
Auftrage eine dankende Antwort einlief. Herr I. Burgermeister 
Dr. von Schuh toastete unter Danksagung für seine Ernennung zum 
Ehrenmitgliede auf das fernere Gedeihen der Gesellschaft. Herr 
Regierungspräsident Dr. von Sc he Hing gedachte in anerkennenden 
Worten der Bestrebungen der Naturhistorischen Gesellschaft und der 
Stadt Nürnberg, deren fernerem Gedeihen sein Hoch galt. Es toastete 
dann Herr Dr. von Forster auf den Regierungspräsidenten, Herr 
Pfarrer Rudel auf Herrn Bürgermeister Dr. von Schuh, Herr Architekt 
Hecht auf die Gäste, Herr II. Bürgermeister Jäger auf die Vorstand- 
schaft, Herr Oberstudienrat Dr. Lechner auf den Direktor, Herr 
Dr. Stadlinger auf die Damen, Frau von Forster auf die Männer 
der Wissenschaft. Herr Dr. Küspert endlich machte Mitteilung von 
35 eingelaufenen Telegrammen aus aller Herren Länder, was Herrn 
Professor Dr. Günther Veranlassung gab zu erwähnen, dafs die 
Jubilarin sich auch über Deutschlands Grenzen hinaus hoher Achtung 
erfreue. Schliefslich toastete Herr Dr. Frankenburger auf die 
Familie des Direktors und dieser seinerseits auf den Konservator. 

Den Festabend im Saale des Museum würzten zahlreiche, teils 
ernste, teils launige Toaste. 



•Mt4« 



Digitized by VjOOQ IC 



19 

Ausflüge. 

Der erste Ausflug des heurigen Jahres war auf Sonntag, 
den 24. März angesetzt, aber die ungünstige Witterung des Vor- 
frühlings mit häufigem Schneefall machte es zur Notwendigkeit, 
denselben zweimal zu verschieben. Erst am Charfreitag, den 5. April 
kam derselbe zu Stande und auch da zeigte die Pflanzenwelt noch 
ein fast winterliches Bild. 16 Teilnehmer verliefsen in der Station 
Vach den Zug, um sich dem Regnitzthale zuzuwenden. Zwischen 
dem Bahnhof und der Ortschaft Manhoi überschreitet das Sträfschen 
den von Buch herabkommenden Landgrabenbach, hier ist ein be- 
kannter Standort von Corydalis solida, doch war die schmucke 
Frühlingspflanze noch so weit zurück, dafs kaum zwei blühende 
Exemplare vorgezeigt werden konnten. In Vach überschritt man 
auf der mit dem Hohenzollernwappen ausgestatteten Steinbrücke die 
Regnitz und wandte sich am linken Thalhang südwärts den dortigen 
Steinbrüchen zu. Das hier zu Bauzwecken gewonnene Material, 
ein ziemlich feinkörniger grüngraulicher Sandstein, gehört sicherlich 
noch dem Horizont des Schilfsandsteins an, wenn auch Pflanzen- 
reste nicht gefunden werden konnten; die mächtigen grünen und 
carminroten Letten darüber sind dann der Lehrbergstufe zuzurechnen. 
Nachdem noch einige weitere kleine Steinbrüche besucht worden 
waren, welche sämtlich die sogenannte Akazie, Robinia Pseudacaeia, 
beherbergen, und nachdem sich hier wenigstens der Huflattich 
blühend vorfand, wandte man sich dem Unterlauf der Zenn zu. 
Auf dieser Strecke hat man einen weiten Ausblick ins Thal der 
Regnitz, in welchem ein langer Zug grofser weifser Vögel: Silber- 
möven, Larus argenteus, zu sehen war. Ein alsdann durchschrittener 
Hohlweg zeigt diluviale Sandbildungen anstehend, bald darauf senkt 
sich der Weg nahe Flechsdorf ins Zennthal. Nachdem ein hier 
geöffneter kleiner Steinbruch besichtigt worden war, überschritt man 
das Zennflüfschen imd marschierte durch Atzenhof zu den dortigen 
Steinbrüchen; dieselben sind nicht mehr im Betrieb. Zahlreiche, 
früher ausgehobene feinkörnige graugrünliche, an Ort und Stelle mit 
feiner Omamentierung bearbeitete Sandsteine liegen daselbst sicher 
schon lange Zeit, denn schon beginnen Flechten auf dem unaus- 
genützten Material sich anzusiedeln. Auch hier viel Robinia Pseud- 
acaeia und zahlreich blühender Huflattich. 

Der Rückweg führt von Atzenhof gegen Stadelhof über eine 
diluvialsandige Fläche, welche, ziemlich hoch gelegen, eine hübsche 
Rundsicht in die Erlanger Gegend, nach Gründlach, dann rückwärts 

über Burgfarrnbach nach Cadolzburg gewährt. oigitizedbyGoOQlc 

2* ^ 



20 

Kurz vor Fürth wurde der Gedenkstein besucht, der, mitten in der 
Rednitzwiese gelegen, die Stelle bezeichnet, wo einstens die Martins- 
kapelle stand. Karl der Grofse soll dieselbe erbaut haben, \md da 
dieser weitsichtige Völkerbeherrscher schon den Versuch gemacht hat, 
Donau und Rhein durch einen Kanal — fossa Carolina bei Grönhart- 
Treuchtlingen — für die Schiffahrt zu verbinden, so ist doch sehr nahe- 
liegend, dafs er auch diesen Punkt bei Fürth, wo Rednitz und Pegnitz 
sich vereinigen, und von wo aus eben hiedurch der Flufs bessere Chancen 
auf Schiffbarmachung darbietet, besucht hat imd hiebei an dieser 
wichtigen Stelle die Martinskapelle erbaute; dies ist wenigstens sehr 
wahrscheinlich, selbst wenn es geschichtlich nicht erwiesen sein sollte. 

Abendessen wurde in Fürth eingenommen und dann zur Heim- 
kehr die Ludwigsbahn benützt. 

Trotz trüber Witterung hatten sich am 28. April nicht weniger 
als 36 Teilnehmer zum zweiten Ausflug am Bahnhof eingefunden. 
In der Station Eibach gesellten sich noch Herr Seminarlehrer Müller 
von Schwabach hinzu, sowie Herr Stadler, der schon vor Ankunft 
des Mittagzuges im Eibacher Laubwald auf Schmetterhngsfang aus- 
gegangen war, daher konnte der genannte Herr auch, alsbald eine 
interessante Spezies vorzeigen und hatte hiezu reichlich Zeit, da ein 
eben herniedergehender Regenschauer den sofortigen Antritt der 
Exkursion für kurze Zeit verhinderte. Nächst Eibach erfreute in 
zahlloser Menge weifs wie rosa blühend das liebliche Hainwind- 
röschen, Anemone nemorosa, dann wurde auf dem Hinterhofer 
Striifschen die Bahnlinie überschritten, gleich darauf konnte Salix 
repens, aurita und Caprea blühend besichtigt werden. So war man 
zur botanisch berühmten Waldabteilung Soos gelangt, in welcher 
alsbald an Primula elatior die Vorgänge der Heterostylie eingehend 
besprochen wurden. Prächtig blühende Leberblümchen, Hepatica 
nobilis oder Anemone Hepatica, verglichen mit ihrer Stiefschwester 
Anemone nemorosa, gaben Veranlassung, darauf hinzuweisen, dafs 
der Hüllkelch der Hepatica nur ein scheinbarer ist und mit Bildung 
eines wirklichen Kelches nichts gemein hat. Als man gegen Hinter- 
hof marschierte, fielen zahlreiche Rebhühnerpaare auf, dann zog 
sich der Weg in den Hochwald, wo Viola silvatica, Primula elatior 
und am Bache das zierUche Milzblüttchen, Chrysosplenium alterni- 
folium die Beschauer erfreuten. Der dunkle Fichtenwald macht 
alsbald dürftigem Föhrenwalde Platz, sobald man südwärts die 
Verbreitung diluvialen Sandes erreicht hat. Hier kommen auch 
schon zahlreich jene bekannten groben diluvialen Gerolle vor, die 
gegen Königshof zu in breiter Ausdehnxmg streichen.^ , 

Digitized by VjOOQ IC 



21 

Nach weiterem kurzen Marsche war der mächtige Damm 
erreicht, der jetzt durchstochen, die Grenze war für den von der 
Bildfläche verschwundenen, historisch wichtigen Königsweiher. Diesen 
hatte ja der Ansbacher Markgraf gefischt und lud zum Spott die 
Nürnberger Reichsstädter ein, mit ihm den Fischschmaus zu halten; 
derselbe fiel jedoch im Pillenreuther (Jefecht für den Einlader etwas 
sehr grob aus, wie die erbeuteten, heute noch vorhandenen Fahnen 
beweisen. Längs dem Entengraben hinaufmarschiert passierte man 
den Weiler Königshof, um dann im von Ruinenmauem umschlossenen 
Klösterlein Pillenreuth Rast zu halten. Dann wurden der Graben, 
di^ Blauem des Klostergartens, die zwei noch erhaltenen Thore be- 
sichtigt und darauf der Marsch nach Reichelsdorf angetreten. In- 
zwischen hatte sich warmer Sonnenschein eingestellt, Schachtelhalm 
und Espe mehrten die frühjährUch noch karge botanische Ausbeute, 
dem schön beschienenen Quarzithöhenzug der Worzeldorf- Wendel- 
steiner Steinbrüche wurde ein Besuch versprochen, dann war der 
Weiler Weiherhaus erreicht. Auch hier ein mächtiger, nun eben- 
falls längst durchstochener Weiherdamm mag die Südwestgrenze des 
einst grofsen Königsweihers gewesen sein. Der weitere Marsch durch 
hübschen Nadelwald brachte uns in die Nähe des Bahnhofes 
Reichelsdorf, und die Fahrgelegenheit wurde auch von etlichen 
Teilnehmern zur Heimkehr benützt. Ob es nun aber botanischer 
Forschimgsdrang allein war, der die übrigen bestimmte, den Bahn- 
hof unbenutzt zur Seite zu lassen, mufs dahin gestellt bleiben, man 
fand ja zwar noch als Frühlingskind blühendes Holosteum umbellatum, 
doch soll das auch anderswo viel zu finden sein und nicht blofs 
am Weg zum Reichelsdorfer Felsenkeller ! 

Während die zwei Vorfrühlingsausflüge selbstredend nur Nach- 
mittagsausflüge waren, galt die dritte Excursion am 19. Mai als 
Tagesausflug einem prächtigen Plätzchen am Jurasteilrand. Obwohl 
der Zug schon 5*** Uhr abfährt, hatte sich doch eine stattliche 
Teilnehmerzahl eingefunden. Vom Bahnhof Schnaittach nächst Neun- 
kirchen durchschritt man freudigen Herzens am duftigen Morgen 
den Wald, den man bei Rollhofen verües. Herr Paalzow und Spandel 
führten mm die Excursion zu einem der merkwürdigsten Plätze 
unserer ganzen Gegend : im Abraum der Ziegelei Wolfshöhe fand 
man eine Unzahl herrlich erhaltener pflanzlicher Fossilien, zierliche 
Farmblättchen, Sporangienähren und schilfähnliche Abdrücke, auch 
grofse Steinkohlenstücke wurden gefunden und alles zur Bereicherung 
der Vereinssammlungen sorglich eingepackt. Hart an der oberen 
Ziegelei ist auch ein überaus deutlicher Aufschlufs für die^ Grenze 

Digitized by VjOOQ Ic 



22 

des rhaetischen Keuper gegen den überlagernden untersten Lias, 
den rostfarbigen, grobkieselkörnigen Arieten- oder Buklandisandstein. 
Hinter RoUhofen ist der Essigbeerenstrauch, Berberis vulgaris, an 
den Hängen nicht selten, der sonst um Nürnberg nahezu fehlt Auch 
die Juraschottergrube wurde wieder besucht, und einige Versteine- 
rungen mitgenommen. Bei Kersbach wurde der Unterschied von 
der Knackerdbeere, Fragaria colhna, gegen die Erdbeerenähnliche 
Potentilla Fragariastrum erläutert Als man das freundhche Kirch- 
dorf verlies, erfreute nicht nur der duftige Ausblick auf die nahen 
Jurahöhen, sondern auch ein Bittgang, den unter Glockengeläute bei 
feierlicher Sonntagsstimmung die frommen Dorfbewohner um die 
Flur eben ausführten, um den Segen für die Feldfrucht vom Himmel 
zu erflehen. Am Fufs des Glatzensteins am Waldrand mit herr- 
hcher Aussicht wurde Rast gehalten und dann nach Siegersdorf 
marschiert, auf welchem Weg schon Türkenbund, Waldmeister und 
andere Vorposten der Juraflora sich einsteUten. Über Rabenshof 
nach Enzenreut wurde der Steilrand des Jurazuges erstiegen, links 
grüfste von statthcher Höhe die Festungsruine Rotenberg herab und 
Herr Konsul Knapp erzählte hiewegen von ihr, seinem Geburtsort, 
gar manche unterhaltende Episode aus der Festungszeit, auch von 
Spuckgeschichten, wie vom armen Tambourlein und anderes, dadurch 
den Auf weg zur Höhe in ansprechender Unterhaltung verkürzend. 

Kurz vor Enzenreut traf man in hübschem Zufall mit der 
Familie Wunder zusammen, welche sich sofort der ohnehin schon 
stattlichen Teilnehmerzahl anschlofs. Nachdem ein interessanter 
Pilz auf Falcaria Rivini für Herrn Professor Magnus in Berlin ein- 
geheimst, der nahe Wald durchschritten und Terebratula als Leit- 
fossil der Schichte gefimden war, machte man auf dem Plateau 
angesichts der Ruine Hohenstein Rast, welche Gelegenheit Herr Eckert 
sich nicht entgehen liefs, die ganze Reisegesellschaft photographisch 
aufzunehmen. Bei Bondorf senkt sich der Weg ins quellendurch- 
rauschte Thal hinab imd gleich darauf war Ostemoh erreicht, wo 
als freundlicher Gastgeber Herr Böhm schon unserer harrte. 

Nach dem Mittagstiscb wurde die malerisch gelegene Ortschaft 
Schlofsberg mit ihren Epheubedeckten grotesken Dolomitfelsen 
besucht und dann die Burgruine eingehend besichtigt, dann besuchte 
man den Knock mit den Eibenbäumen, Taxus baccata, und erfreute 
sich an dem noblen Weifs der in Menge blühenden Anemone silvestris. 
Alsdann gieng der Marsch zur Dolomitkuppe der W^indburg. Im 
Fichtenwald am Wege dorthin ist eine runde Trichtergrube, offenbar 
von Menschenhand erzeugt; vielleicht ist sie ein Rest prähistorischer 

Digitized by VjOOQIC 



23 

Besiedelung oder hat man hier auf Bohnerz gegraben, das ist ohne 
eingehende, streng wissenschaftliche Nachgrabung nicht zu entscheiden. 
Hiezu war aber heute keine Zeit, denn alles strebte der luftigen 
Höhe zu, von deren Pavillon man eine entziickende Rundsicht genofs. 

In nächster Nähe der mächtige Hohenstein, darunter das lieb- 
hche Sittenbachthal, der kühn zerfetzte Schlofsturm von Wildenfels, 
der Felsklotz von Spiefs, dahinter in duftigem Blau das Fichtel- 
gebirg, im Osten die Höhen vom Kutschenrain bis Amberg, Ossinger 
und Zant, im Süden der Poppberg, im Westen die glitzernde Wasser- 
fläche der Dechsendorfer Weiher, ein herrliches Bild. Massenhaft 
blähendes Wintergrün, Vinca minor, mit blaulila enzianähnlicher 
Blüte stand im nahen Buschwald, ein sandig verwitternder Dolomit- 
block erläuterte deutlich die Möglichkeit von oft scheinbar rätsel- 
haftem Vorkommen sandliebender Pflanzen mitten im kalkigen 
Höhenzug ; dann ging der Weg querfeldein nordwärts und traf man 
das Ostemoher Thal wieder gerade an der Stelle, wo ein grofser 
Kalkbnich die wagrecht parallele Schichtung des Werkkalkes vor- 
züglich zeigt. Der Abmarsch im Thal ergab unter vielem anderen 
auch schön blühenden Aronstab, Arum maculatum, und so waren es 
nur schöne Eindrücke, die man empfand bis herab nach Ostemoh, wo 
Abendmahlzeit eingenommen wurde. Ostemoh verfügt auch über eine 
sehr hübsche Ansichtskarte, kein Wunder also, dafs deren zahlreiche 
an liebe Freunde als Grüfse ausflogen, danmter auch eine an einen 
hochverehrten Gönner, an den Beschützer naturforschender Studien, an 
unseren hochverehrten I. Bürgermeister Herrn Dr. Ritter von Schuh! 

Dann wurde nach Hedersdorf marschiert und von da Lokal- 
and Hauptbahn zur Heimkehr benützt. 

Der vierte Ausflug am 9. Juni war eine Nachmittagstour 
in nächster Nähe. Wieder war es eine sehr zahlreiche Gesellschaft 
(34), die vom Bahnhof Schweinau aus zu den vier neuen Brücken 
der Ringbahn marschierte. Hierselbst fand sich unter anderem 
Trifolium elegans, dann zog sich der Marsch zur Cedernanlage des 
verstorbenen Reichsrates Freiherrn von Faber. Nachdem dieselbe 
eingehend besichtigt war, wobei auf die Verschiedenheit der an 
einem Stock vorkommenden Nadelblätter aufmerksam gemacht wurde, 
besuchte man das Birkenwäldchen, an dessen Rande Quercus rubra 
angepflanzt ist. Bei Stein gab Vicia villosa, die hier im Roggenfelde 
zahlreich auftretende zottige Wicke, Veranlassung, die Bildung von 
Wurzelknöllchen bei Papilionaceen zu besprechen. Kurz vor Neu- 
werk wurde der geländerlose Steg zum Übergang über die Rednitz 
benützt und dann Ras* gehalten. Die Rednitzauen ergaben Sisymbrium 



J4 

pannonicum, Carduus crispus, Berberis vulgaris, Erysimum strictum, 
die Gharakterpflanze des Rednitzthales, und zahlreiche Weidenarten 
und Bastarde. Der weitere Marsch zog sich über Gerasmühle auf dem 
Wiesenweg nach Reichelsdorf, wo Lepidium Draba in ungewöhnlich 
hoher und schöner Form sich fand. Auf dem Wege dahin konnten 
einige Störche in ihrem langbeinigen Dasein aus nächster Nähe ungeniert 
betrachtet werden. Nach Abendrast und Kegelpartie in Reichelsdorf 
führte der Bahnzug die Teilnehmer in die nahe Heimat zurück. 

Der fünfte Ausflug am Nachmittag des 30. Juni vereinigte 
wieder 34 Teilnehmer zur Besichtigung eines der merkwürdigsten 
Vorkommnisse unserer Gegend, des Latschenschlages im Untersdorfer 
Wald. Der Anmarsch von Lauf nach Dehnberg war etwas heifs, 
botanisch aber sehr ergiebig, ich nenne nur: Centaurea nigra, 
Trifolium spadiceum, Orchis maculata, Cuscuta Epithymum, Potentilla 
dacica. 

Nach kurzer Rast in Dehnberg ging man an dem Höflaser 
Weiher vorbei zum schwarzen Bach, wo Trientalis europaea und 
Phalaris anmdinacea var. palUda A. Schwarz sich einstellte, des 
weitern trat Cytisus nigricans entgegen und nach einigem Suchen 
war der Latschenschlag gefmiden. Fürwahr ein fremdartiger Eindruck: 
das frische Grün der dichtbuschigen Conifere mit ihren balsamisch 
riechenden derben Nadelblättern, teils am Boden breithingestreckt, 
teils mit knorrigem Stamme mehr aufrecht strebend fallt im hohen Grade 
auf gegen das Graugrün der benachbarten kümmerlich wachsenden 
Föhren. Auch zahlreiche Zapfen hatte die Pinus Pumilio wieder 
angesetzt von rundUcher fast kugeliger Form. Drei von Herrn 
Eckert hergestellte photographische Aufnahmen ergaben prächtig 
instruktive Vegetationsbilder, wie die beigegebene Reproduktion einer 
dieser Aufnahmen beweist. Der insektenverzehrende Sonnenthau, 
Drosera rotundifolia, die Rauschbeere, Vaccinium Oxycoccos und die 
grofsen gelben Sterne der Arnica montana, Orchis maculata u. a. ver- 
kürzten den Waldweg, der nach Simonshofen führte. Von da aus 
wurde der Weg nach Lauf bei schon einbrechender Dimkelheit gemacht; 
nachdem man hier mit einem früheren Mitghed, Herrn Distriktstierarzt 
Hochstein, zuföUig zusammengetroffen war, schlofs die Bahnfahrt diese 
interessante, auch wieder vom Wetter so sehr begünstigte Partie. 

Der sechste Ausflug war wieder eine Tagespartie, die ein 
tieferes Eindringen in den Jura als Ziel verfolgte. Er fand Sonntag 
den 21. Juli statt. 

Haupt- imd Lokalbahn brachten uns nach Bahnhof-Simmeis- 
dorf und da eine viel gröfsere Anzahl von TeiüiehmQrn aussliq;, 

Digitized by V^nOOQ . 



Digitized by VjOOQ IC 



I 



25 

als vermutet worden war, wurde von Simmeisdorf aus der Telegraph 
in Bewegung gesetzt, um für richtige Beköstigung zu sorgen. Das 
Thal über Diepoldsdorf hinauf ober die Achtelmühlen nach Ittling 
gab bezaubernd schöne Anblicke; im FrühUcht beschienen, hob 
sich das frische Grün der Buchen vom Tiefgrün der Fichten- 
waldongen herrlich ab, unten stets der rauschende Forellenbach; 
vor Ittling geben zwei Steinbrüche im Planulatenkalk ein deutliches Bild 
der horizontal-plattigen Ablagerung. Kurz unter Ittling entspringen 
drei Quellen mit köstlichem, kohlensäurereichen Wasser. Hier gegen- 
über ragt aus dem Waldesgrün ein isolierter Felsklotz empor. Be- 
trachtet man denselben genauer, so sieht man, dafs er aus zwei 
Schichten besteht, die untere hellgelbliche Hälfte ist glatter, sie 
gehört dem Horizont des wohlgeschichteten Werkalkes an, die obere 
ist mehr graublau, mehr zerfressen, dolomitfelsähnlicher, sie gehört 
der Schichte der Schwammkalke an. Mit den mächtigen Ittlinger 
Quellen wird der bekannte ergiebige Wasserhorizont des Ornaten- 
thones verlassen, darüber beginnt der weifse Jura mit seinen grotesken 
Felsbildungen und seiner Wasserarmut. An zwei Felsen, die schon 
dem Frankendolomit zugehören, fanden die Herren Rudel und Enslin, 
juniores, die grofsschotige Lunaria rediviva und Taxus baccata. 
Nach kurzem Plateaumarsch war die Ortschaft Spiefs erreicht, wo- 
selbst auf ergangene Einladung hin Herr Privatier Zeidler von Plech 
aus bereits eingetroffen war. Nach einiger Rast im Gasthaus wurden 
die Spiefser Burgfelsen bestiegen. Die charakteristische Dolomitflora 
mit Alectorolophus serotinus, Saxifraga decipiens und anderem trat 
alsbald in Erscheinung, und während man die herrliche Rundsicht 
vom Gipfel der ostwärts turmhoch senkrecht abfallenden Felsen 
genofs, umflatterten zahlreiche Apollofalter die luftige Höhe. Von 
Spiefs aus trennte sich die Excursion in zwei ungleiche Hälften. 
Herr Zeidler, in der Gegend mit jedem Gangsteig bekannt, führte 
den gröfseren Teil über Eibenthal und den rauhen Stein nach Plech, 
der andere Teil nahm den weniger interessanten und kürzeren Weg 
am Schweinsberg vorbei, dann auf der Landstrafse nach Plech, und 
doch traf diese Abteilung am gemeinschaftlichen Sammelpimkt 
wesentlich später ein, denn es galt hier zu sammeln die aufserdem 
nur bei Tüchersfeld bekannte laricetorum-Form von Melampyrum 
silvaticum, auch Melampyrum nemorosum, der Frauenschuh, Cypri- 
pedium calceolus, und anderes wurde hier mitgenommen. In Plech 
machte die Küche des Herrn Herzog ihrem bekannten Rufe alle 
Ehre, denn die drei Eigenschaften gut, reichHch und billig trifft man 
nicht immer beim Mittagstisch vereinigt an. Nach dem Mittagsessen 

Digitized by VjOOQIC 



_ ^6 

besuchte man den nahen Gottvaterberg. Von hier aus hat man eine 
überaus instruktive Rundsicht: alles nach Süd und West in der 
Nähe liegende, auch die ferneren Berge um Velden mit der Burg 
Hartenstein, zeigen das zackige Bild der Dolomitlandschaft, nach Osten 
dehnt sich bis Pegnitz und Auerbach die grofse Waldfläche aus, 
mit welcher der heute noch zahlreiche Hirsche bergende Veldensteiner 
Forst die cretacische Überlagerung bedeckt. In Nordwest bemerkt 
man noch einen geognostisch interessanten Punkt: hochgelegen 
grüfst der graue Kirchturm von Hohenmirsberg nördlich Pottenstein 
herüber, darüber eine grofse mit Getreidefeldern bedeckte Fläche: 
die Hohenmirsberger Platte; nordöstlich erscheint ein waldiger Höhen- 
rücken, der Kutschenrain oder Thurndorfer Calvarienberg, trotz 
seiner wenig prägnanten, langhingezogenen Kontour der höchste 
Punkt des nordöstlichen Jura, warum dies? — beide Ortschaften 
Hohenmirsberg sowohl wie Thurndorf liegen jenseits der hier durch- 
ziehenden grofsen Verwerfungsspalte, so liegt die Hohenmirsberger 
Platte auf Werkkalk, der Thurndorfer Calvarienberg sogar aus Dogger 
bestehend, viel höher als der dolomitische Aussichtspunkt, auf 
welchem wir stehen, die Ostprovinz ist eben auf ihrer ursprünglichen 
Höhe stehen geblieben, die westUche viel gröfsere Juralandschaft hat 
sich wesentlich gesenkt. Die Flora des Gottvaterberges ist auch im 
hohen Grade botanisch interessant. Teucrium montanum und 
Chamaedrys, Viola arenaria, Arabis petraea, Melica nebrodensis, 
Globularia vulgaris, Alsine verna, Veronica prostrata, Coeloglossum 
viride, Alectorolophus serotinus, Potentilla incana sind alles nicht 
häufige Sachen. Nach dem Abmarsch vom Berg ward bei Herzog 
Kaffee getrunken, dann trat man den Marsch in Ostrichtung an nach 
Neuhaus. Am Liegerberg betritt man den cretacischen Sandstein, 
Lycopodium clavatum, zahlreiche Pyrolaarten und Schwarzbeeren 
bezeichnen die Waldflora, die weiters auch wieder viel Melampynun 
silvaticum ergibt, meist in der typischen Form, die laricetorum-Form 
spärlich untermengt. Vor Höfen verläfst man den Wald und damit 
die cretacische Sandbedeckuug ; in der Ortschaft selbst erinnert eine 
Martersäule an eine kriegerische, für das in viele Einzelstaaten 
zerrissene Deutschland höchst trübselige Zeit. Auf einer Blechtafel 
zeigt eine kunstlose Malerei, wie französische Marodeure einen ein- 
heimischen Bauern, ich glaube gar es war der Bürgermeister des 
Ortes, niederschiefsen ; die Missethäter waren Soldaten der I. fran- 
zösischen Republik, die im Gefecht beim nahen, von hier aus schon 
sichtbaren Orte Krottensee von den Österreichern geschlagen und 
versprengt worden waren. Östlich Höfen macht sich /der Charakter 

Digitized by VjC 



27 

der dolomitischen Landschaft wieder geltend und im Weifsenstein 
steht eine mächtige charakteristische dolomitische Felshildung, besetzt 
mit der Felsenlilie, Anthericus ramosus mid dem gelben Fingerhut, 
Digitalis ambigua, an. Bald stellt sich auch Saxifraga decipiens, 
Arabis petraea und anderes wieder ein; kurz vor Neuhaus an der 
Ziegelhütte verändert plötzlich die Strafse im rechten Winkel ihre 
bisherige Richtung und mit einem Ruck präsentiert sich auf senk- 
rechter Felsenhöhe die ehemals bambergische Grenzveste Veldenstein, 
ein überraschender, herrlicher Anblick! In Neuhaus wurde in der 
bekannt guten Restauration Rofsbacher die Abendmahlzeit einge- 
nommen, dann führte der Bahnzug die Excursionsteilnehmer zurück 
nach Nürnberg, jedoch nicht alle, denn einem, Herrn Adalbert Rudel, 
war es vergönnt, in Neuhaus über Nacht zu bleiben, um an diese 
Excursion noch eine weitere dreitägige Tour in den Oberpßllzer Jura 
über Königsstein nach Hohenburg und über Velburg und Deining 
zurück nach Neumarkt anzufügen. 

In ganz andere Gegend führte uns am 18. August der siebente 
Ausflug, nämlich an die grofsen Dechsendorfer Weiher. Es war 
wieder eine sehr statthche Anzahl von Teilnehmern, die von Erlangen 
aus über die Regnitzbrücke nach Sankt Johann pilgerte. Hier war 
ein Rückblick sehr schön in die Streitberger Gegend, dem Walburgis- 
l>«rg gegenüber glänzte die weifse Vexierkapelle ober Reifenberg 
herab von waldiger Höhe. Alsdann wurde durch den Fohrenwald 
zum Thal der Seebach marschiert, in deren Wasserlauf in unzähliger 
Menge Potamogeton fluitans mit lederigen Blättern flutete. An den 
unteren Teilen der Stengel des Adlerfarns, Pteridium aquilinum wurde 
der Querschnitt gezeigt, auf welchem die durchschnittenen Gefäfs- 
bündel das Bild des heraldischen Doppeladlers zeigen. Bald war 
der sandige flache Rücken überschritten, dann lag in mächtiger 
Ausdehnung die Wasserfläche des BischofTsweihers vor uns. An 
seinem Gestade stund zahlreich Cyperus flavescens, und viele der- 
selben zeigten die durch den parasitären Pilz: Schinzia cypericola 
erzeugten weifsen knolligen Anschwellungen der Wurzelzasern, auch 
Hydrocotyle vulgaris war in Menge da, dann der stattliche Rohr- 
kolben, Typha latifolia und anderes. Nachdem so der untere 
Bischofsweiher umgangen war, mufste man sich mit einem Blick auf 
die oberen Weiher genügen, denn es war schon Abend geworden, 
bis man die Ortschaft Grofsdechsendorf erreichte. Hier fand sich 
die interessante Osterluzeipflanze, Aristolochia Clematitis, dann wurde 
Abendrast am grasigen Hügel der Wirtschaft gehalten und alsbald 
von dem jungen Volk allerlei Allotria getrieben. Es Ärar schon 

igi ize y g 



^8 

wacker dunkel geworden, als man den Heimmarsch auf der Land- 
strafse antrat ; in Erlangen wurde noch etwas eingekehrt, dann führte der 
Vorortszug die Teilnehmer zur Heimat zurück, während dem ein Mitglied 
mit Künstler hand ein wohlgelungenes Conterfei entwarf von unserem 
allverehrten, Rohrkolben tragenden, cigarrenschmauchenden Direktor. 

Der achte Ausflug am 22. September war nur von kurzer 
Hand her arrangiert, aber dennoch hatte sich schon am Abgangsort 
bei der Hallerwiese eine nicht kleine Teilnehmerzahl eingefunden, 
die später noch an der Ringbahnbrücke bei Spitalhof verabredungs- 
gemäfs durch Zuzug von Teilnehmern, wohnhaft in dem Maxfeld- 
bezirk und solchen, die mit der Bahn von Rückersdorf hereingefahren 
waren, wesentlich vermehrt wurde. 

Gleich beim Abmarsch wurde das seltsame Gras Cynodon 
Dactylon demonstriert, in Vorgärten zu Sankt Johannis war Ge- 
legenheit gegeben , die trichterförmig stehenden Wedel des hier 
kultivierten Straufsfarns , Struthiopteris germanica zu vergleichen 
mit dem ähnlichen Farnwedel unseres einheimischen Wurmfarnes. 
Angebauter Estragon, Artemisia Dracunculus, und die bisher nur 
in Baden, Sachsen und Böhmen beobachtete flatterig rispige Form 
des Bromus erectus unterbrachen in anregender Form den Marsch 
zur Herrnhütte, hinter welcher in den letzten Jahren ein ausgedehntes 
Schuttfeld Platz darbietet für gar manche adventive Spezies; so 
fand sich auch heute die schöne Salvia silvestris, dann das Gras 
Setaria verticillata , dessen rückwärts stehende Haken der Grannen 
es fertig bringen, dafs die Ähre sich wie Kletten an die Kleider 
anhängt und so das Synonym Setaria adhaerens rechtfertigt. Herr 
Adalbert Rudel machte hier auf einen prächtigen Fall von Mimicry 
aufmerksam : auf den an Blütenkörbchen reichen Ästen der Artemisia 
campestris kommt eine Raupe vor, die mit ihren grünlichen Höckern 
so täuschend den Blütenstand der Artemisia ähnlich sieht, dafs man 
schon scharf die Augen aufmachen mufs, um die Raupe von ihrem 
Substrat wog zu erkennen. Nach vollzogener Vereinigung mit den 
auf der Ringbahnbrücke bereits eingetroffenen Excursionsteilnehmero 
marschierte man in den Erlenstegener Wald. Hier kommt man bald 
auf eine Lokalität, die floristisch von ihrer monotonen Umgebung 
merkwürdig absticht. Da blühen in Menge die himmelblauen Glocken 
des gefranzten Enzians, ja auch die weifse Abänderung fehlt nicht, 
Berberis vulgaris, der Essigbeerenstrauch ist vorhanden und, was 
das merkwürdigste ist, auch die stengellose Welterdistel, Carlina 
acaulis ; auch Orchideen, wie Gymnadenia conopea und Orchis 
militaris sind hier in früherer Jahreszeit blühend anzuiiiefifen, gewifs 

Digitized by V^jOOv . 



29 

ein seltsames Florenbild in Mitte von Haidekraut und Fohren wald. 
Aber auch die Bodenbeschaffenheit ist eine andere als in der Um- 
gebung, es geht ein langer Kranz von Gruben fort bis zur Herolds- 
berger Landstrafse und wurde hier offenbar früher der Boden auf- 
gewühlt zur Gewinnung eines technisch verwertbaren Materiales. 
Es finden sich hier nämlich zahlreich gröfsere Brocken kalkhaltigen 
Gesteines und offenbar wurde früher auf dieses gegraben. Zur Er- 
klärung dieser Vorkomnmisse machten sich nun zwei Ansichten 
geltend; die eine glaubt, es genüge zur Erklärung die Annahme, 
dafs hier durch Stauchung die dolomitische Brocken genugsam 
bergende Quackenschichte des Semionotuskeuper etwas gehoben sei 
and so aus der diluvialen Sandüberdeckung an die Oberfläche aus- 
trete ; die andere Ansicht, vertreten durch Herrn Wunder junior und 
senior, erbUckt in diesem allerdings oft scharfkantigen und offenbar 
nicht gerolltem Materiale die Endmoräne eines Gletschers der dilu- 
vialen Eiszeit, die aus dem benachbarten Jura das Kalkmaterial 
hieher geführt und schliefsUch beim Zurückgehen des Gletschers 
habe hegen lassen. Es ist wohl noch weitere vorurteilsfreie Forschung 
verbunden mit chemischen Analysen des Gesteinsmaterials nötig, um 
zu entscheiden, welche Ansicht die richtige ist. Gegen die Herolds- 
berger Strafse ergibt die Vegetationsdecke der grubigen Unebenheiten 
des Terrains Gahum boreale, Gentiana ciliata, Peucedanum Oreose- 
linum, Cirsium acaule. Dann wurde über Herrenhütte nach Grofs- 
reuth marschiert und von da aus nach eingenommener Abendmahl- 
zeit der Fufsmarsch in die Stadt bewerkstelUgt. 

Den letzten, den neunten Ausflug schuf der Wunsch eines 
Gastes: Herr Dr. Poeverlein aus Regensburg hatte den Wunsch 
geäufsert, die Wassernufs, Trapa natans, im Unterbürger Altwasser 
beobachten zu können und so verliefs denn wieder eine zahlreiche 
Gesellschaft (26) ausnahmsweise an einem Werktage, am Nachmittag 
des 28. Oktober den Mögeldorfer Bahnhof. Die schöne gotische 
Ortskirche rief uns an geweihte Stätte, auf den dortigen Friedhof. 
Pietätvoll hatte die Feier des 100jährigen Jubiläums mit Fichten- 
kranz und rotweiser Schleife den Ort geschmückt, wo unser Aller 
Freund, der vorvorige Direcktor Professor Spiefs von einem arbeits- 
vollen Leben ausruht. Wie gerne hätten wir ihn noch in unserer 
Mitte gehabt an diesen schönen Ehrentagen der naturhistorischen 
Gesellschaft, und manches Auge wurde feucht angedenks des Wirkens 
dieses hochverdienten Mannes. 

Alsdann ergab die Flora des diluvialen Sandes für unsem 
Gast noch manches interessante, denn von den charakteristischen 

Digitized by LjOOQIC 



30 

Sandpflanzen war Statice elongata, Potentilla argentea und Scleranthos 
perennis trotz vorgeschrittener Jahreszeit noch in Blüte, auch 
Erucastrum Pollichii, das sich seit etwa 12 Jahren hier angesiedelt 
hat, stund noch in Blüte. Zwischen dem Ebensee und dem Unter- 
bürger Weiher wurden die Gruben besichtigt, welche zur Gewinnung 
von Formsand für hiesige Eisengiefsereien in Betrieb stehen. Das 
tiefe Unterbürger Altwasser war ganz mit der gewünschten Trapa 
natans bedeckt. Eine junge Frucht zeigte schön die nadeldünnen 
hackig rauhen Grannen, die so rasch abbrechen, und die man daher 
gewöhnlich an den aufbewahrten Früchten nicht mehr antrifft Von 
Unterbürg zog sich der Marsch über Blechhäubel zu den Höhen 
hinterm Schmausenbuck, auf welchem Wege Lycopodium clavatum 
mit eben stäubenden Sporangienähren, dann Nardus stricta und die 
die Preiselbeersträuchlein so gewaltig deformierende Callyptospora 
Goeppertiana beobachtet wurden. Am Schmausenbuck selbst wurden 
das Hochreservoir der Wasserleitung und dann bei schon ein- 
brechender Dunkelheit die Steinbruchsreste im Burgsandstein mit 
dem Durchgang durch das Felsenthor begangen, alsdann ward in 
der Restauration Rast und Abendmahlzeit gehalten. Mit zündender 
Rede dankte allhier Herr Dr. Poeverlein für die gastUche Aufnahme 
während der schönen Feststage der Jubiläumsfeier und eilte, begleitet 
von seinem Quartiergeber, der Rodlerschen Familie, voraus zur 
Rückkehr nach Regensburg. Die übrigen, noch etwas verweilenden 
Teilnehmer wurden von Herrn Konsul Knapp aufgefordert, noch im 
Spätherbst dem Rotenberg einen Besuch abzustatten. Diese An- 
regung wurde allseits zustimmend begrüfst, aber zur Ausführung 
des Vorhabens kam es nicht mehr, der Wille war zwar gut, aber 
das Wetter 'Ständig zu schlecht A. S. 



BibUotheksbericht für 1901. 

Der Bestand der Bibliothek wurde durch Schenkungen und 
durch die Anschaffungen der Sektionen um 121 Nummern 
mit insgesamt 204 Einlaufen vermehrt. Die letzte Nummer ist 4094. 
Reichen Zuwachs brachten insbesondere die Festgeschenke anläfslich 
der Jubiläumsfeier. 

Durch Überreichung eigener Pubükationen ehrten die Gesell- 
schaft die Herren K. Böhner, Dr. Ad. Dieudonn^, Herm. 
Eckert, Heinr. Enslin, Prof. Dr. A. Fleischmann, Dr. H. 
Glück, M. Goldschmid-Geisa, Dr. F. Grimm, TL v. Held- 
reich, V. Huene, Prof. Dr. B. Klunzinger, O.^relLsen., 

Digitized by VjOOQIC 



31 

Dr. Fei. v. Oefele, 'Herrn. Peters, Dr. P. Reinecke, Gg. 
Rudel, Prof. Dr. Fr. Wagner, F. A. Weber, Dr. Will, 
Enoch Zander. 

Im Schriftenaustausch liefen 746 Sendungen ein. Die 
Zahl der mit uns in Tauschbeziehungen stehenden Gesellschaften hat 
sich um 10 vermehrt und beträgt jetzt 280. 

Ausgeliehen wurden 170 Bücher an 120 Entleiher. Mehrfach 
gingen Büchersendungen auf Ansuchen an Mitglieder nach auswärts. 

Schriftenaustausch : 

Europa Deutsches Reich 

Altenburg — Naturforschende Gesellschaft des Osterlandes: Mittei- 
lungen. N. F. IX. Bd. 

Annaberg — Annaberg-Buchholzer Verein für Naturkunde. 

Ansbach — Historischer Verein für Mittelfranken: 47,-48. Jahresber. 

Augsburg — Naturwissenschaftlicher Verein für Schwaben u. Neuburg. 

Bamberg — Gewerbeverein. 

> — Naturforschende Gesellschaft: XVIII. Bericht <1900). 

Bautzen — Naturwissenschaftliche Gesellschaft »Isis«. 

Berlin — Botanischer Verein der Provinz Brandenburg: Verhand- 
lungen 19. Jahrg. 1877; 23. Jahrg., 4. Heft 1881; 30. Jahrg. 
1888; 32. Jahrg. 1891; 42. Jahrg. 1900. 

> — Deutsche geologische Gesellschaft: Zeitschrift 53. Bd. 1.-3. 

Heft. 
» — Entomologischer Verein : Berliner entomolog. Zeitschrift 
46. Band 1901 1.-3. Heft. 

> — Gesellschaft naturforschender Freunde : Sitzungsberichte 

Jahrg. 1900. 

> — Kgl. prcufsisches meteorologisches Institut : Bericht 1900 ; 

Ergebnisse d. Beobachtungen a. d. Stationen II. u. III. Ord. 
1900 Heft I, II; Abhandlungen Bd. I; Hellmann, Regenkarte 
d. Prov. Mecklenburg-Schwerin u. Strelitz. 
Bonn — Niederrheinische Gesellschaft fQr Natur- und Heilkunde: 
Sitzungsber. 1900. 

> — Naturhistorischer Verein der preufsischen Rheinlande West- 

phalens und des Regierungsbezirks Osnabrück: Verhand- 
lungen 67. Jahrg. 1900. 
Braunsberg — Botanisches Institut des kgl. Lyceuro Hosianum: 

Arbeiten I. 
Braunschweig — Herzogliches naturhistorisches Museum. 

> — Verein für Naturwissenschaft. 

Bremen — Naturwissenschaftlicher Verein: Abhandlungen VII. Bd. 

1. u. 2. Heft; XV. Bd. 3. Heft; XVII. Bd. 1. Heft. 
Breslau — Schlesische Gesellschaft f. vaterländische Kultur: 77. Jahres- 
bericht 1899 m. Ergänzungsheft 7. 
Chemnitz — Naturwissenschaftliche Gesellschaft. 
Danzig — Naturforschende Gesellschaft: Schriften N. F. zehnten Bds. 

2. u. 3. Heft. 
Darrastadt — Verein fQr Erdkunde u. der grofsherzogl. geologischen 

Landesanstalt: Notizbl. IV. Folge 21. Heft. 1900. 
Dresden — Statistisches Bureau des kgl. sächs. Ministeriums des 

Innern: Zeitschr. 46. Jahrg.; 47. Jahrg. Heft 1, ?^^^^T^ 

Digitized by VjOOQIC 



J2 

Dresden — Naturwissenschaftliche Gesellschaft Isis: Sitzungsber. u. 

Abhandlungen Jahrg. 1900 Juli bis Dez.; 1901 Jan. bis Juli. 

Dürkheim — Pollichia: Mitteilungen LVII. Jahrg. 1900 Nr. 13—15.; 

Dr. Schäfer, üb. d. Rehgeweih. 
Düsseldorf — Naturwissenschaftlicher Verein. 
Elberfeld — Naturwissenschaftlicher Verein. 

Emden — Naturforschende Gesellschaft: 85. Jahresber. für 1899/1900. 
Erfurt — Kgl. Akademie gemeinnütziger Wissenschaften : Jahrbücher 

N. F. Heft XXVII. 
Erlangen — Physikalisch - medicinische Societät: Sitzungsberichte 

32. Heft 1900. 
Frankfurt a. M. — Physikalischer Verein : Jahresbericht fiir d. Rech- 
nungsjahr 1899—1900; Dr. König, das Klima von 
Frankfurt a. M. 
» — Senckenbergische Naturforschende Gesellschaft: 

Abhandlungen 25. Bd. 1. u. 2. Heft; 26. Band 2. 
u. 3. Heft; 28. Band; Bericht 1900. 
Frankfurt a. O. — Naturwissenschaftlicher Verein des Reg.-Bezirks 
Frankfurt: Helios 18. Band; Soc. Litt. Jahrgang 
XIV 1900. 
Fulda — Verein für Naturkunde. 

Gera — Deutscher Verein z. Schutze d. Vogelwelt: Ornithol. Monats- 
schrift 1900. 
Giefsen — Oberhessische Gesellschaft für Natur- und Heilkunde. 
Görlitz — Naturforschende Gesellschaft : Abhandlungen 23. Bd. 1901. 

> — Gesellschaft f. Anthropologie u. Urgeschichte d. Oberlausitz. 
Göttingen — Kgl. Gesellschaft der Wissenschaften u. Georg Augusts- 
Universität: Nachrichten Mathem.-physik. Klasse 1900 
Heft 3 u. 4; 1901 Heft 1; Geschäftliche Mitteilungen 
1900 Heft 1 ; 1901 Heft 1. 

Greiz — Verein der Naturfreunde. 

Guben — Niederlausitzer Gesellschaft fQr Anthropologie und Alter- 
tumskunde: Mitteilungen Band VI 6. — 8. Heft. 
Güstrow — Verein der Freunde der Naturgeschichte in Mecklen- 
burg: Archiv 1899 53. Jahr II. Abt.; 1900 54. Jahr; 1901 
55. Jahr 1. Abt. 
Halle a. S. — Landwirtschaftliches Institut an der Universität: Be- 
richte a. d. physiolog. Laboratorium 15. Heft. 

> — Kaiserl. Leopoldino-Carolinische Deutsche Akademie 

der Naturforscher: Leopoldina Heft XXXVII. 

> — Verein für Erdkunde: Mitteilungen 1901. 
Hamburg und Hamburg-Altona — Naturwissenschaftlicher Verein : 

Verhandlungen III Folge VIII. 
Hamburg — Verein für naturwissenschaftliche Unterhaltung: Ver- 
handlungen XI. Bd. 
Hanau — Wetterauische Gesellschaft für die gesamte Naturkunde. 
Hannover — Naturhistorische Gesellschaft: 48. u. 49. Jahresbericht 

1897/98 u. 1898/99. 
Heidelberg — Naturhistorisch-medizinischer Verein: Verhandlungen 

N. F. sechster Bd. 4., 5. Heft (1900). 
Hof — Nordoberfränkischer Verein f Natur-, Geschichts- u. Landes- 
kunde. 
Karlsruhe — Naturwissenschaftlicher Verein: Verhandlungen 14. Bd. 
1900—1901. 
» — Badischer Zoologischer Verein: Mitteilungen 1900 Nr. 

Digitized by VjOOQ IC 



38 

Kassel — Verein itkr Naturkunde: Abhandhingen und Bericht XL VI 

über das 66. Vereinsjahr 1900—1901. 
Kiel — NaturwissenschaftUcher Verein für Schleswig-Holstein : Schriften 
12. Bd. 1. Heft. 
> — Anthropologischer Verein in Schleswig-Holstein : Mitteilungen 
14. Heft. 
Königsberg!. Pr. -— Physikalisch-ökonom. Gesellschaft: Schriften 
41. Jahrg. 1900. 
> — Preufsischer Botanischer Verein. 

Krefeld ~ Verein für Naturkunde. 
Landshut ~ Botanischer Verein: 16. Bericht. 

Leipzig — Kgl. sächsische Gesellschaft der Wissenschaften: Berichte 
über die Verhandl., math.-phys. Kl. 52. Bd. 1900 VI, VII 
63. Bd. I— III ; Jahresber. 1901 d. F. Jablonowskyschen 
Gesellschaft 

> — Naturforschende Gesellschaft: Sitzungsberichte 26. u. 27. 

Jahrg. 1899/1900. 

> — Verein für Erdkunde: Mitteilungen 1900; wissenschaftliche 

VeröffentL: Uhle, Würmsee u. Atlas. 
Lübeck — Geograph. Gesellschaft: Mitteilungen Heft 12—15. 
Lüneburg — Naturwissenschaftlicher Verein d. Fürstentums Lüne- 
burg: Jahreshefte XV 1899-1901; Erinnerung an das 
50iähr. Bestehen. 
Magdeburg — Naturwissenschaftlicher Verein. 

Mainz — Römisch-Germanisches Centralmuseum : Bericht über die 
Vermehrung der Sammlungen des Vereins zur Erforschung 
der rheinischen Geschichte und Altertümer i. J. 1899/1900. 
Mannheim — Verein fttr Naturkunde. 

Marburg — Gesellschaft zur Beförderung der gesamten Naturwissen- 
schaften: Sitzungsberichte Jahrg. 1899, 1900; Schriften 
Bd. 13 4. Abteilung. 
Metz — Verein für Erdkunde: XXIII. Jahresbericht fQr das Vereins- 
jahr 1900—1901. 
München — Kgl. Bayer. Akademie der Wissenschaften: Sitzungs- 
berichte der mathem.-physik. Kl. 1899 Heft III; 1900 
Heft UI; 1901 Heft I-III. 

> — Bayer. Botanische Gesellschaft. 

» — Geographische Gesellschaft: Jahresber. f. 1898 u. 1899. 

> — Ornithologischer Verein. 

Münster — Westphäl. rrovinzialverein für Wissenschaft u. Kunst. 
Neifse — Philomathie: 30. Bericht 1898—1900. 
Nürnberg — ÄrztKcher Verein. 

> — Germanisches Nationalmuseum: Anzeigern. Mitteilungen 

Jahrg. 1900. 
» — Medicinische Gesellschaft und Poliklinik : XXII. Jahres- 

bericht für 1900; Sitzungsberichte 1900. 
» — Verein für Geschichte der Stadt Nürnberg : Mitteilungen 

14. Heft. Jahresber. 1899, 1900. 
» — Verein für öffentliche Gesundheitspflege: Bericht über 

d. Gesundheitsverh. u. Gesundheitsanstalten i. J. 1900. 
Offenbach — Verein für Naturkunde: 37. 42. Bericht v. Mai 1895 

bis Mai 1901. 
Osnabrück — Naturwissenschaftlicher Verein : Vierzehnter Jahresber. 

1899 u. 1900. 
Passau — Naturhistorischer Verein : Achtzehnter Bericht 1898—1900. 
Regensburg - Kgl. Botanische Gesellschaft. DigitizedbyGoOgle 



34 

Regensburg — Naturwissenschaftlicher Verein: Berichte VIII. Heft 

f. d. Jahr 1900. 
Reichenbach — Voigtländ. Verein fttr allgem. u. spez. Landeskunde. 
Reutlingen — Naturwissenschaftlicher Verein. 
Schneeberg — Wissenschaftlicher Verein. 
Schwein fürt — Naturwissenschaftlicher Verein. 
Strafsburg i. E. — Direktion der geolog. Landes-Untersuchung von 

Els.-Lothringen: Mitteilungen Bd. V Heft IH. 
Stuttgart — Verein für vaterländische Naturkunde in Württemberg: 

Jahreshefte 57. Jahrg. 
Weimar — Thüringischer Botanischer Verein : Mitteilungen N. F. Heft 

Xni— XV; Hergt, Zwecke u. Ziele d. Pflanzenschutzes. 
Wernigerode — Naturwissenschaftlicher Verein des Harzes. 
Wiesbaden — Nassauischer Verein für Naturkunde. 
Würzburg — Physikalisch-medicinische Gesellschaft: Sitzungsberichte 
Jahrg. 1900 Nr. 1-6. 
» — Polytechnischer Zentralverein für Unterfranken und 

Aschaffenburg: Gemeinnützige Polytechnische Monats- 
schrift 51. Jahrg. 1901. 
Zerbst — Naturwissenschaftlicher Verein. 
Zwickau — Verein far Naturkunde. 

Österrelch-Uosram 
A g r a m — Hrvatsko Narovoslovno DruStvo : Glasnik godina XII, broj 4 — 6. 
Aufsig a. E. — Naturwissenschaftlicher Verein. 

Baden bei Wien — Gesellschaft zur Verbreitung naturwissenschaft- 
licher Kenntnisse. 
Brunn — Club für Naturkunde (Sektion d. Brünner Lehrerverein es) : 
Dritter Bericht f. d. Jahre 1900/01. 
» — K. K. mährische Landwirtschaftsgesellschaft. 
> — Naturforschender Verein : XVIII. Bericht der meteor. Comm. 
Budapest — K. M. Termdszettudomänyi Tärsulat (K. U. naturwissen- 
schaftliche Gesellschaft) : Aquila V., VI. Jahrg. 1898, 1899; 
mathem.-naturw. Berichte aus Ungarn Bd. 14—16. 
> — Rovartani Lapok (entomolog. Monatsschr.) VIII. kötet 

1901 fQzet 1—10. 
Graz — K. k. Gartenbau - Gesellschaft in Steiermark: Mittheilungen 
26. Jahrg. 1901. 
» — Naturwissenschaftlicher Verein für Steiermark : Mittheilungen 

36. Heft. 
» — Verein der Ärzte in Steiermark: Mitteilungen 37. Jahrg. 1900. 
Hermannstadt — Siebenbürgischer Karpathenverein : Jahrbuch XXI. 
Jahrg. 1901 u. »Beilage«. 
> — Siebenbürgischer Verein für Naturwissenschaften: 

Verhandlungen u. Mitteilungen L. Band Jahrg. 1900. 
» — Verein für siebenbürgische Landeskunde: Archiv 

N. F. 29. Bd. 3. Heft; Jahresbericht 1900. 
Innsbruck — Ferdinandeum für Tirol und Vorarlberg: Zeitschrift 
3. Folge 45. Heft. 
» — Naturwissenschaftlich - medizinischer Verein: Berichte 

XXVI. Jahr^. 1900/1901. 
Klagen fürt — Naturhistonsches Landesmuseum fQrKärnthen: Jahr- 
buch 26. Heft XLVIII. Jahrg. 1900; Seeland, Diagr. d. 
magnet. u. meteorol. Beobachtgn. 1900. 
Klausenburg (Kolozsvärt) - SiebenbürgischerMuseumsverein : £rtesit5 
XXV ^vfolyam 1900 XXII kötet; XXVI övf. 1901 XXIU 
köt. 1. füz. ^ , 

Digitized by VjOOQ IC 



36 

Laibach — Musealverein für Krain: Izvestja letnik X seSitek 1—6 
Mittheüungen XHI. Jahrg. Heft 1—6; XIV. Jahrg. Heft 
1 u 2. 
Linz — Museum Francisco-Carolinum : 59. Jahresber. nebst 53. Lief. 

der Beiträge z. Landesk. v. Österreich o. E. 
L wo wie (Lemberg) — Towarzystwo Ludoznaw. 
Prag — K. Böhmische Gesellschaft der Wissenschaften : Sitzungs- 
berichte 1900, Jahresber. 1900. 
» — Deutscher naturwissensch.-medicinischer Verein für Böhmen 
»Lotos« : Sitzungsberichte 48. Bd. (N. F. XX. Bd.) Jahrg. 1900. 
» — Lese- und Redehalle der Deutschen Studenten : Bericht über 
d. J. 1900. 
Pressburg (Pozsony) — Verein für Heil- und Naturkunde: Verhand- 
lungen N F. XIL d. g. R. XXI. Bd. lahrg. 1900. 
Reic he n be r g — Verein d. Naturfreunde : Mittheifungen 32. Jahrg. 1900. 
Salzburg — Städtisches Museum Carolino-Augusteum : Jahresberichte 

f. 1900. 
Sarajevo — Bosnisch - Hercegovinisches Landesmuseum: Wissen- 
schaftliche Mittheilungen aus Bosnien u. d. Hercegovina 
Siebenter Band 1900. 
Wien — Entomologischer Verein: XI. Jahresbericht 1900. 
» — K. Akademie d Wissenschaften : Sitzungsberichte mathemat.- 

naturw. Cl. CVIII. Band. 
* ~ K. k. Gartenbaugesellschaft: Wiener illustr. Gartenzeitung 

1901 Heft 1—12. 
> — K. k. geographische Gesellschaft : Mitteilungen 1900 XLIU. Bd. 

(d. n. F. XXXm.) 
» — K. k. geologische Reichsanstalt: Verhandlungen Jahrg. 1900 

Nr. 11—18; Jahrg. 1901 Nr. 1—13. 
» — K. k. zoologisch-botanische Gesellschaft : Verhandlungen Jahr- 
gang 1900 L. Band. 
» — Naturhistorisches Hofmuseum: Annalen Bd. XV. 
» — Naturwissenschaftlicher Verein an der Universität. 
» — Verein zur Verbreitung naturwissenschaftlicher Kenntnisse: 
Schriften XLI. Bd. 1900/1. 

Belgien 

Anvers — Acad^mie Royale d* Archäologie de Belgique: Bulletin 5« 

Serie des Annales X; 2« Partie I, H. 

Broxelles — Soci6t6 beige de Microscopie: Annales Tome VIII 

1881—1882 bis Tome XXVI Ann^e 1899—1900; Bull. 

Tome XI Ann^e 1884 -85 bis T.XXV Ann^e 1898 - 1899. 

> — Soci^tö Royale de Botanique de Belgique: Bulletin 

Tome trente-neuvi^me 1900. 
» — Sociöt^ Royale malacologique de Belgique: Annales Tome 

XXXV Annöe 1900; M^moirs p. 17—28; Bulletins p. 
CXXIX - Schlufs. 
» — Soci^t^ Royale Linn^enne : Bulletin 26 me Annöe Nr. 2 

bis 9 1900; 27« Annöe Nr. 1, 2 1901. 

Dänemark 
Kjöbenhavn — Botaniske Forening i Kjöbenhavn: Botanisk Tidskrift 
Bind 23, 2; Bind 24, 1, 2. 

Prankreich 

Cherbourg — Soci^t^ Nationale des Sciences naturelles et math^- 

matique : M^moires Tome XXXI. 
Lyon - Soci^t^ botanique de Lyon. oigi.ized by GoOQk 

3* " 



36 

Lyon — Soci^t6 Linn^enne de Lyon. 

Nantes — Soci^t6 des Sciences Naturelles de TOnest de la France: 

Bulletin lö e Ann^e 1900 Tome 10 e . 
Paris — Bibliothfeque de la Feuille des jeunes Naturalistes : La Feuille, 
IV e Sörie, 31 e Annöe Nr. 362 374; Cataloques XXX ; Cata- 
loque special Nr. 1, 2. 
» — Soci^tö d* Anthropologie de Paris: Bulletins V e Serie Tome I « 
1900 ; Tome II « Fase. 1 r; Table g6n. d. Publications 1860-1899. 
Semur (C6tc d'Or) — Soci^tö des Sciences historiques et naturelles: 
Creuze, Table gön. des noms d'auteurs. 

Qro68biitmiiieii 

Glasgow — Natural History Society. 

London — Anthropologicaf Institute of Great Britain and Ireland: 
»Man« 1901 Nr. 1 bis 14, 27 bis 153. 
» — Geological Society. 
Manchester — Geographica! Society: The Journal Vol. XVI Nr. 7 
bis 12; Vol. XVÜ Nr. 1 bis 6. 

Holland 

Amsterdam — Genootschap Natura Artis magistra. 

» — Koninklijke Akademie van Wetenschappen: Verh 

delingen Afd. Natuurkunde Deel VII 1« Sectie S. 
6, 7 ; 2 e Sectie 4 - 6 ; Zittingsverslagen Jahr 1900/ 
Deel IX. ft- 

Haarlem — Mus^e Teyler: Archives S^r. II Vol. VII 2 e, 3« Po 
Lcyden — Nederlandsche Dierkundigc Vereeniging: Tijdschrift 2 0«- 
Serie Deel VI Afl. 4 ; Deel VII Afl. 1 ; Aanwinsten van de 
Bibliothekk 1900. 
» — Rijks Geologisch-Mineralogisch Museum: Serie I Beiträge 
zur Geologie Ostasiens und Australiens Bd. VI Heft 3, 4. 
» [Nijmwegen] — Nederlandsche Botanische Vereeniging : Neder- 
landsch Kruidkundig Archief Derde Serie 2 « Deel 
2 e Stuk; Prodromus Florae Batavae Vol. I Pars 1. 

Itallea 

Brescia ~ Ateneo: Commentari per l'anno 1900. 

Catania — Accademia Gioenia di Scienze Naturali: Atti AnnoLXXVII 

1900 Vol. XIII; Bullettino N. S. Fase. LXV bis LXX. 
Firenze — Bibliotheca Nationale Centrale: Bolletino d. Public. Ital. 
Nr. 360; 1901 Nr. 1—12; Indici 1900. 
> — R. Istituto di Studi Superiori, Pratici e di Perfezion- 

amento. 
» — Societä Entomologica Italiana : Bulletino Anno XXXII 1900 
Trim. IV; Anno XXXIII 1901 Trim. I. U. 
Mode na — Societä dei naturaüsti : Atti S. IV. Vol. II Anno XXXIII. 
Padova — Societä Veneto-Trentina di Scienze Naturali. 
Pavia — Orto botanico, Istituto botanico dell* Universitä di Pavia. 
Pisa — Societä Toscana di Scienze Naturali. 
Roma — R. Accademia dei Lincei: Atti S. V. Rendiconti Vol. XI*; 

Rendiconto dell' adun. sol. 2/VI. 1901. 
Torin o — Accademia Reale delle Scienze : Atti Vol. XXXVI 1900/1901 

1 a bis 15 a ; Dr. Rizzo, Osserv. meteorol. 1900. 
Venezia — Reale Istituto- Venoto di Scienze, Lettere ed Arti. 
Verona — Accademia d'Agricoltura , Scienze, Lettere, Arti e Com- 
mercio: Memoric Serie IV (Vol. LXX>/I)> Vol.^I Fase. 1. 

Digitized by VjOOQ . 



L 



37 

LiixMiibiiri^ 

Luxemburg — Fauna, Verein Luxemburger Naturfreunde: »Fauna« 
Mitteilungen 10. Jahrg. 1900. 
» — Socidtd botanique de Grand-duchd de Luxembourg: 

Recueil des Memoirs et des Travaux Nr. XIV 1897—99. 

Portugal 

Lisboa — Direc^ dos Servi^os Geologicos de Portugal: Communi- 
cagöes Tomo V. 1900—1901. 

Raniiileo 
Bucuresci — Museulü de Geologii si de Paleontologia : Stefanescu, 
Harta Geol. Gen. a Rom. Blatt CVI/XLIX ; CVÜ/XXV; 
D/IV/L; DVILH; DVII/XXIX. 

Riusland 

Dorpat — Naturforscher-Gesellschaft bei der Universität: Sitzungs- 
berichte Xn. Band 3. Heft. 
Hclsingfors — Societas pro Fauna et Flora Fennica. 
Kiew — Naturforscher-Gesellschaft der Universität : Sapiski Tom XVI, 2. 
Mi tau — Kurländische Gesellschaft f. Literatur und Kunst: Sitzungs- 
> berichte und Jahresber. d. Kurland. Prov.-Mus. 1900. 

oskau — Soci^t^ Imperiale des Naturalistes: Bulletin Annöe 1900; 
^, 1901, 1 u. 2. 

4[a — Naturforscher- Verein: Korrespondenzblatt XLFV; Arl>citcn 

N. F. Zehntes Heft. 
^ ,?etersburg — Hortus petropolitanus: Akta Tom XVIII, 1—3. 

» — Imperatorskaja Akademija Nauk : Iswjestja Seria V 

Tom xn Nr. 2—6; Tom. XUI 1-3. 

Tiflis — Kawkasska Museja: Bericht 1892, 1894—99: Ottschctt 1893; 

Iswjetstija Tom I 1, 3; Mitteilungen Band I 1 bis 3; Dr. G. 

Radde, k. Geschichte d. Ent Wickelung d. Kaukas. Museums 

während der ersten 25 Jahre. 

Schwedeo und Norwegen 
Bergen — Museum: Aarbog for 1900 2dct hefte; 1901 Istc hefte; 
Sars, Crustacea of Norway Vol III Part. IX, X.; Vol. IV 
Part. I, 11; Appelöf, Meeresfauna v. Bergen Heft 1; aars- 
beretning 1900. 
Christian ia — Kgl. Norske Frederiks Universitet. 

» — Editorial Committee of Den Norske Nordhavs-Expe- 

dition 1876—1878, Professor H. Mohn, Det Meteoro- 
logiske Institut. 
Göteborg —KongLVetenskaps och Vitterhets-Samhället : Handlingar 

IV. Följ. Tome I, 3. 
Stavanger — Museum: Aarsberetning for 1900 11*« Aargang. 
Stockholm — Kongliga Svenska Vetenskaps Akademien: öfversigt 
af Förhandlingar 1900 57. ärgängen ; Bihang 26. Bandet; 
HandUngar 33., 34. Bandet; Lefnadsteckningar Bd. 4 
Hafte 1, 2. 
> — Entomologiska Föreningen: Entomologisk Tidskrift 

arg. 21 1900; arg. 22 1901. 
» — Nordiska Museet: Hazelius, Guide au Mus^e du Nord; 

Karta öfver N. Mus. Anläggningar ; Koenig, ein eigen- 
art. Mus. f. Natur- u. Völkerkunde ; Passarge, d. Nord. 
Mus. u. Skansen (i. d. Bibl. übergef. als Nr. 4018); Med- 
delanden 1897, 1898; Afbildningar Smäland etc.; Vin- 
terbilder frän Skansen. r^^^^T^ 

Digitized by V^OO^ Ic 



38 

Tromsö — Museum: Aarsberetning for 1898, 1899, 1900; Aarshefter 
I 1878, VI 1883. VII 1884, VIII 1886, IX 1886, XIII 1890, 
21 1898, 22 1899, 23 1900. 
Upsala — Kongliga Universitets Bibliothek: Bulletin Vol. V. Part. 1 
1900 Nr. 9. 

Schweiz 

Basel — Naturforschende Gesellschaft: Verhandlungen Bd. XII Heft 3; 

Bd. Xra Heft 1. 
Bern — Naturforschende Gesellschaft. 

f»] — Schweizerische Naturforschende Gesellschaft. 
Chur — Naturforschende Gesellschaft Graubündens: Jahresber. N. F. 

XLIII. Bd.; Campbelli, Topogr. Raetica. 
Frauen feld — Thurgauische naturforschende Gesellschaft. 
Genfeve — Le Conservatoire et le Jardin botanique. 
Lausanne — Soci^t^ Vaudoise des Sciences Naturelles: Bulletin 4« 
S. Vol. XXXV Nr. 138 - 141 ; Observations m6töoro- 
logiques 1899 XIH« Ann^e; 1900 XIV e Annöe. 
St. Gallen — Naturwissenschaftliche Gesellschaft: Bericht 1898—99. 
Solothurn — Naturforschende Gesellschaft. 

Zürich — Naturforschende Gesellschaft: Vierteljahrsschrift 45. Jahr ; 
1900; 46. Jahrg. 1. u. 2. Heft. , 

> — Bibliothek der Schweizerischen Botanischen Gesellsc ;^ 
Berichte Heft X. / 

Span ; f^. 

Madrid — Sociedad Espaftola de Historia Natural: Actas 1900 . 
Die; Boletin Tomo I 1901 Nr. 1, 2. 

Afrika, ' Ägrypten 

Le Caire — Institut fegyptien: M^moires Tome IV Fase. II; Bulletin 
3e S^rieAnn^e 1899 Fase 10 No. 3; 4e S^rie 1900 No.l 
Fase. 1—8. 

Amerika. Arfentlnlea 

Buenos Aires — Museo Nacional: Comunicaciones Tomo I No. 8—10. 
» — Deutsche Akademische Vereinigung : Veröffent- 

lichungen 1. Bd. Heft 4, 5. 
Cordoba — Academia Nacional deCiencias de la Republica Argentina. 
La PI ata — Bureau g^n^ral de Statistique. 

BolKia 

La Paz — Sociedad Geogräüca. 

Bnisilieo 

Parä — Museu Paraense de Historia Natural e Ethnographia : Boletim 

Vol. III No. 2; Arbor. Amazon. Decada 1*2». 
Rio de Janeiro — Museu Nacional. 

Britisch Amerika 

Halifax — (Nova Scotia) Nova Scotian Institute of Natural Science: 
Proceedings and Transactions, Session of 1899/1900 Vol. X 
Part. 2. 

Ottawa — Geological Survey of Canada: Annual Report (New Series) 
Vol. XI 1898; Maps 664/5 676; Macoun, Catalogue of Ca- 
nadian Birds Part 1. r^ T 

Digitized by VjOOQ IC 



k 



39 

Toronto -- Canadian Institute: Transactions Vol. VI 13; Vol. VII 1. 
Proceedings Nr. 10. 

CMIe 

Santiago — Deutscher wissenschaftlicher Verein. 

» — Soci^t^ Scientifique du Chili: Actes Tome X 1900 2 e livr. 

CocU Riga 

San ]o86 — Museo Nacional. 

Mexico 

Mexico — Instituto Geolögico de Mexico: Boletin Nr. 14. 

Peru 

Lima — Socicdad Geograika: Boletin Aäo IX — Tomo XI, Tri- 
mcstre P 11« 1899. 



Uruguay 

> Montevideo — Museo Nacional: Anales Tomo II Fase XVI, XVII; 
M Tomo m Fase. XVm—XXII. 

^U Vereinigte Staaten 

k ];Hbany (N. Y.) — State Museum of Natural History. 

— Univcrsity of the State of N.-Y.: Ann. Rep. Vol. m 1895; 
Vol. n 1896; Vol. 1, 2, 1897. 
Boston (Mass.) — American Academy of Arts and Sciences: Procee- 
dings N. S. Vol. XXXVI; XXXVII, 1—4. 
> — Society of Natural History: Proceedings Vol. XXIX, 9—14, 
16—23. 
Buffalo (N. Y.) - Society of Natural Sciences: Bulletin Vol. VII 1. 
Cambridge (Mass.) — Museum of comp. Zoology at Harvard College: 
Bulletin Vol. XXXVII No. 3 XXXVÜI 1-4; XXXIX 1 ; 
Memoirs Vol. XXV 1 ; Annual Rep. 1899 - 1900, 1900—1901. 
> — Peabody Museum ofArchaeology and Ethnology: Memoirs 
Vol. n 1 ; Archaeolog. and Ethn. Papers Vol. II. 
Chicago (111.) — Academy of Sciences: Bulletin No. III Part 1. 

» — Field Columbian Museum: Publications No. 51, 55, 56, 

(Anthropological Series); Ann. Rep. 1899—1900. 
Cincinnati (Ohio) — Lloyd Library: Bulletin No. 2. 
Colorado Springs (Colo.) — Colorado College: Studies Vol. IX. 
Columbus (Ohio) — Ohio State Univcrsity: Bulletins Series V 1; 

30. Ann. Rep. I II. 
Davenport O^wa) — Academy of Natural Sciences. 
Madison (Wisc.) — Wisconsin Academy of Sciences, Arts and Letters: 
Transactions Vol. XII 2; XIII 1. 
» — Wisconsin Geological and Natural History Survey: Bulle- 

tin m, V— Vn. (Econ. Ser.) 
Meriden (Conn.) — Scientific Association. 
Milwaukee — Public. Museum: 16. Ann. Report. 1898. 
Minneapolis (Minn.) — Geological and Natural History Survey of 
Minnesota. 
» — Minnesota Academy of Natural Sciences. 

New-Haven (Conn.) — Academy of Arts and Sciences: Transactions 
Vol. X 2. n ^ 

Digitized by VjOOQ IC 



40 

Ncw-York (N.-Y.) — Academy of Sciences, late Lyceum of Natur. 
History: Annais Vol. XIII 1—3; Memoirs Vol. H 2 1900 
3 1901. 

> — American Geographica! Society : Bulletin 1900 Vol. XXXII 5 

XXXIII 1—4. 
» — American Museum of Natural History: Bulletin Vol. XI 3; 

Vol. XIII 1900; Annual Report 1900. 
» — Botanical Garden: Bulletin Vol. IT 6. 
» — Microscopical Society. 
» — Museum of the Brooklyn Institute of Arts and Science: 

Science Bulletin Vol. I 1. 
» — Torrey Botanical Club, Columbia University. 
Palo Alto (California) — Leiand Stanford Junior University. 
Philadelphia (Pennsylv.) — Academy of Natural Sciences: Procee- 
dings 1900 Part 11 III; 1901 Vol. LIII 1 2. 
» — American Philosophical Society: Proceedings No. 

163—166. 

> — Commercial Museum. 

> - Wagner Free Institute of Science. 
Rochester (N.-Y.) ~ Academie of Science: Proceedings Vol. 4 p. 1—64. 
Rock Island (111.) — Augustana College. / 
Salem (Mass.) — Essex Institute. 

St. Louis (Miss.) - Academy of Science: Vol. VIII 6—9; Vol.Xl— ;fU 

> — Missouri botanical Garden : Twelfth Annual Rep. 19C / n. 
San Francisco (Cal.) — California Academy of Sciences. ^U 
St. Paul (Minn.) — Geological and Natural History Survey. aj 
Topeka (Ark.) — Kansas Academy of Science : Transactions Vol. XVli ^ 

1899-1900. 
Tufts College (Mass.) — . 
Washington — U. S. Departement of Agriculture: Bulletin No. 14; 

Nord-Amer. Fauna No. 16, 19—21 ; Prel. Report 1900; 

Yearbook 1900. 
» — U.S. Geological Survey: TwentiethAnn.Rcp. 1898-99 

Part n in rv V Vn Maps V; Twenty-first Ann. 

Rep. 1899—1900 I IV VI contin. 
» — Smithsonian Institution : Ann. Rep. f. the Year ending 

June 30, 1898; 1899. 

Contributions to Knowledge. 

Miscellaneous Collections. 
» — Bureau of American Ethnology: Annual Rep. 17 1*», 

1895—96 I H; 18 th 1896-97 I. 
» — U. S. National Museum : Annual Report of the Board 

of Regents for the year ending June 1898; 1897 II; 

1899; Bulletin No. 47 IV. Atlas; Special Bull. Parti. 
» — Microscopical Publishing Company: Journal for 1900 

Vol. XXI; 1901 Vol. XXn 1-7. 

Asien Britisch Indieo 

Calcutta — Asiatic Society of Bengal: Journal 1900 Vol. LXIX n, 
2—4; m; 1901 Vol. LXX U 1. 

J«|MUI 

Tokyo — Anthropological Society: The Journal No. 176—187. 

> — Deutsche Gesellschaft für Natur- und Völkerkunde Ost- 
asiens: Mitteilungen Band VIII 2; Dr. Florenz, Japan. My- 
thologie II. 

Digitized by VjOOQ IC 



41 

Tokyo — Zoological Society, Imperial University: Annotat. Zool. 
Jap. Vol. m 1 -4; Vol. IV 1. 

Niederländisch Indien. 

Batavia — Koninlclijke Natnurkundige Vereeniging in Nederlandsch- 
Indifi: Natuurkundig Tijdschrift Deel LX. 

Augtralien Victoria 

Melbourne - Royal Society of Victoria: Prooccdings Vol. XII 1 
Xni 1 2; XIV 1. 

New South Wales 

uth Wales: 
dings VoL X5CXIV 1900. 



Sydney — Royal Society of^New South Wales: Journal and Procee 



Queensland 

a: Proceec 
and Transactiöns 16 th Session 1900-1901 Vol. 16. 

South Australia 



Brisbane — IWval Geographica! Society of Australasia : Proceedings 
nd *" 



Adelaide — Royal Society of South Australia: Transactiöns Vol. XXIV 
2; Memoirs Vol. I 2. 



Die Jahresberichte und Abhandlungen der Naturhistorischen 
Gesellschaft werden aufserdem an folgende Adressen gesandt: 
München - Kgl. Hof- und Staatsbibliothek. 
Nürnberg — Stadtmajgistrat (zwei Exemplare). 

» — Gymnasialbibliothek. 

» — Kgl. Bayer. Gewerbemuseum. 

» — Verein Merkur. 



Digitized by VjOOQ IC 



42 



m. Bericht über den Zuwachs zu den Sammlungen. 



E.-Nr. 



131 

198. 199, 
204 



206-208 



Oegenstand 



Fundort 



145 



48 

115 
116 

37 

69, 70 
194 

36 
35 

237 

132 



la. Anthropolog:le. 

Photographieen von Steinzeit- 
gräbem 

Knochen, Scherben und Broncen 
aus drei GrabhQgehi am' Wei- 
denschlag bei der Beckers- 
lobe, frühere Hallstattzeit . . 

3 Urnen, Tierknochen und viele 
Eisenfunde aus einer frühmittel- 
alterlichen Niederlassung in der 
Solach am Rötenbach .... 

Gipsabgufs des Schädels von 
Pithecanthropos Dubois . . . 

Ib. EthnofTapliie. 

Joch für Rindviehgespann, mittel- 
fränkischer Typus 

Hirtenschalmei, altfränkisch . . 

Feineingelegtc Ringpeitsche, alt- 
fränkisch 

Chinesische Visitenkarte .... 

Chinesische Handmalereien . . 

Altertümer, Idole etc. [Eigentum 
vorbehalten] 

Bumerang 

Flöte 



Schild, Bogen, Lanzen und Pfeile 

[Eigentum vorbehalten] . . . 

Bild einer Falknerin 



II. Zoologie. 

a. Säugetiere. 
71 Otolicnus galago, Halbaffe . . . 

164 ^ Mustela putorius, Iltis 

9 I Herpestes ichneumon, Pharaons- 

I ratte 

151 , Pteromys volucella , Flughörn- 
I chen, Assapan 



Kirchensitten- 
bach 



Leinburg 



Grofsreuth bei 
Nürnberg 

Grofsreuth bei 

Nürnberg 
China 
China 

Centralamerika 
Queensland 
Insel Joma, 

Südsee 
Deutsch Neu- 

Guinea 



Afrika 
Nürnberg 



Schenker etc. 



Ägypten 



Nordamerika 



Harster,Wfln- 
burg. 

Anthropolog. 
Sektion, 
Wunder. 



desgl. 
desgl. 



Beselt. 
angekauft 

desgl. 
Kinkelin. 
Knapp. 

Knapp. 
Kinkelin. 

Kinkelin. 

Kunzmann. 
Huber. 



Markert. 
Kreutzer. 

Markert. 

Pabst. 



Digitized by VjÖOQIC 



43 



E.4ir. 


Qttmstaiid | Pundort 


Schenker etc. 


238 


Tamias Lystcri, Backenhörnchcn | Nordamerika 


Pabst. 


21 


Dasypus sexcinctus, Sechsbinden- 








Gürteltier 


Südamerika 


angekauft. 




b. Vögel. 


166 


Haliaetos albicilla, Seeadler, 9, 


Gerasmühle, 






geschossen 1864 ; Nürnberg 


Weidner. 


146 


Pandion haliaetus, Fischadler . 


Hüttenbach 


Cari Sachs. 


163 


Nashornvögel, zwei Oberschnäbel 


— 


Lang. 


79 


Anthos sp 


Veilhof b. Nürn- 
berg 








Grohmann. 


31 


Muscicapa grisola, grauer Fliegen- 








länger 





angekauft. 


32 


Accentor modularis , Hecken- 






braunelle 




angekauft. 
Lina Hammer, 


89 


Turdus memla, Amsel, jung . . 


Nürnberg 








München. 


34 


Pratincola rubicola, schwarzkeh- 








üger Wiesenschmätzer .... 


— 


angekauft. 


33 


Pratincola rubetra,Braunkehlchen 


— 


angekauft. 


183 


Corvus comix, Nebelkrähe. . . 


Veilhof b.Nüm- 








berg 


Rogg. 


166 


Trochllus, Kolibri, zwei Stück . 


Cayenne 


Weidner. 


2 


Podiceps minor, Taucherlein. . 


Kitzingen 


Buchner. 


149, 160 


Zwei Gruppen Vögel 


Nordamerika 


Jul. Pabst. 


239, 240 


Zwei Gruppen Vögel 

c. Reptilien. 
1) Eidechsen. 


Nordamerika 


Jul. Pabst. 


136 


Alligator missisipiensis (Daud.) . 


Nordamerika 


Kühlken. 


30 


Agama stellio (L.) 


Palästina 


Kinkelin. 


26 

39 

120 


Iguana tuberculata Laur 


Amerika 






- > » 


> 






127 


Ctenosaura acanthura (Shaw) . 


Mexiko 






128 


Tupinambis teguixin (L.). . . . 


Südamerika 






66 


Anolis carolinensis D. B 


Ver. Staaten 






4 


Phrynosoma comutum (Harl.) . 


Mexiko. 






38 


Varanus albogularis (Daud.) . . 


Südamerika 






64 


Atgiroides nigropunctatus (D. B.) 


Corfu 






% 


Eumeces algeriensis Pts 1 Marokko 






144 


verschiedene Reptilien .... 


' Digitized b> 


Carl 


Sac}^. 



44 



E.-Nr. 


Qegenstand 


Pandort 


Schenker etc. 




2) Schlangen. 






141 


Boa constrictor, Hautstück. . . 


Brasilien 


Kühlken. 


89 


Lioheterodon madagascariensis 








(D. B.) 


Madagaskar 


Zool. Sektion. 


108 


Zamenis constrictor (L.) .... 


Ver. Staaten 


Kinkelin. 


51 


» hippocrepis (L.). . . . 


Malaga 


> 


42 


Colubcr melanoleucus Daud. . . 


Florida 


Zool. Sektion. 


44 


Bascanium constrictor 


Ver. Staaten 


Kühlken. 


140 


» > Hautstück 


> 


» 


45 


Heterodon platyrrhinus Latr.. . 


> 


» 


123 


Elaps corallinus Wied 


Mittelamerika 


Kinkelin. 


113 


Ancistrodon piscivorus (Lasdp.) 


Ver. Staaten 


Zool. Sektion. 


41 


» contortrix (L.) . . 


> 


Kühlken. 


43 


Crotalus horridus (L.) 

d. Fische. 


Texas 


Kinkclin. 


188 


Hippocampus brevirostris, See- 








pferdchen 





Faul Hennann. 


107 


Japanischer Schleierschwanz . . 


— 


Carl Sachs. 




e. Insekten. 






91 


Melolontha ftillo, Walker. . . . 


Gostenhof, Nbg. 


Schwarz. 


72 


Vespa crabro, Hornisse .... 


Veilhof, Nbg. 


Rogg. 


46 


Sirex gigas, Holzwespe .... 


Reichswald,Nbg. 


Rogg. 


125 


Rofskastanienspinner 


Gostenhof, Nbg. 


Lechner, jun. 


241 


Locusteneier 


Südafrika 


Abelein, 






Oberstitnt. 




g. Crustaceae. 






161 


Homarus vulgaris , Hummer, 








Scheere 


Nordsee 


Lang. 


143 


Carduus maenas, Krappe . . . 


do. 


Kinkelin. 


142 


Dromia vulgaris, Krappe . . . 
h. Vermes, Würmer. 


do. 


> 


189 


Parasitaerer Rundwurm des Hä- 








rings 


do. 


Aug. Schmidt 


68 


Cysticercus cellulosae, Finne des 






Schweines 


Nürnberg 


Schwarz. 




i. Mollusca. 




122 


Puoa reliflriosa. ........ 


Cuba 

Digitized bv 


&mg\e 




^ ^mm^vm m *•* *-*-j^»^^*w ••••••••• 



46 



E,.Nr. 



OeseosUnd 



Piuidort 



Schenker etc. 



95 

93 

173 



162 



209-236 

94 
158 



110 



66 



148 
137 

112 

160 
159 

1 



196 



118 

98 

171 

121 



Diverse Muscheln 

do. do 

Lokal' Conchylien-Sammlung . 

k. Echinodermata. 
Seestern sp 



UmgebJtümbgs. 



m. Polypen. 
Grofse Serie von Korallen 



rotes Meer 



Diverse Korallen 
Zwei Korallen . . 



o. Foraminiferen. 
Comos spira (auf einem Tang) . 

p. Schwämme. 
Kiesethornschwamm , 



Ludwigskanal 



Sumatra 



Bärenschanze» 
Nürnberg 



q. Osteologie. 
Schädel von Rhinozeros indicus 
Schädel vom Reh, Cervus cap- 

reolus 

Backzähne vom Pferd, Equus 

caballus 

Säugetierschädel | 

Vogelschädel 

Skelett einer Riesenschlange, | 

P3rthon tigris 



r. Biologie. 
Parthogenetisches Ei vom Grau- 
papagei, in der Gefangenschaft > 

gelegt Kitzingen 

Hühnerei-Abnormität i Mantlach 

Getüpfeltes Hühnerei ' Nürnberg 

Alca impennis, 2 Eier, Gipsnach- > 
bildung I — 



Clitus liciatus im Espenholz 



Digitized by 



Stöhr.Würzbg. 
Frau Zeiser. 
zool. Sektion. 



Lang. 



Klunzinger, 
Prof.,Stuttgart. 
Stöhr.Würzbg. 
Lang. 



Dr. Koch, sr. 



Kaulfufs. 



Lambrecht. 
Schultheifs, 
Postassessor. 

Offtner. 
Lang, 
dto. 

angekauft. 



Büchner. 

Mayr. 

Dr. Koch, sen. 

Landauer, 

Würzburg. 
Dr. Scheide- 



46 



£.-Nr. t QesM»taiKl 

Holzwespe in gebohrtem Gang 

im Föhrenholz 

Raupengespinnste 

Oestrus pecorum , mit Tonnen 

und Eiern 

Gastrophilus haemorrhoidalis, mit 

Tonnen 

Phryganea, Larven im Gehäuse 

desgl 

III. Botanik. 

a) Zum Nürnberger Lokal- 
herbar: 
Nymphaea semiaperta 



PoiMlort 



I Schenker etc. 



47 

104 
92 

124 

82 
97 



90 
20 

76 

24 

74 

15 

8 

14 

13 

10 
25 
17 
72 

175 

182 
181 



Reichswatd,Nbg. 
Brasilien 

Pferd, Nürnberg 

Pferd, Ungarn 

Nürnberg 

Rückersdorf 



Potamogeton pusillus var. tenuis- 
simus 

Potamogeton pectinatusvar. sco- 

parius 

Potamogeton densus 

Goodyera repens 

Carex pilosa 

» Homschuchiana, var. . . 

» laevigata ? = distans -|- 

silvaticus 

Verschiedene Carex -Arten und 

Hybriden 

Verschiedene Carex-Arten . . . 
Panicum dichotomum, adventiv 
Hordeum jubatum, adventiv . . 
Diverse Gräser 

Verschiedene Phanerogamen . . 

b) zum bayerischen Herbar. 
Galium vemum 



Aster macrophyllus 



Rednitz bei 
Wolkersdorf 

Cadolzburg 

Sulzkirchen bei 

Freistadt 
Batzhausen, 

Oberpfalz 
Engelthal 
Limmersdorf 
Feucht 

Ermreut 

Steinach, etc. 
Nürnberg, etc. 
Tullnau 
Forsthof 
Nürnberg, fränk. 

Jura 
Umgegend von 

Nürnberg 



Seel. 
Graf. 

Schwarz. 

dto. 
Adalb. Rudel. 
Knapp. 



Schneider. 



Pfautsch, 
Weidenbach. 

Schwarz. 



W. Rudel, 

Kaulfufs. 

Pfautsch, 

Weidenbach. 
Schwarz. 

Fr. Schultheifs. 

Schwarz 

Fr.Schultheifs. 



Schwarz. 
Rodler. 



Gleiscnthal, Prof. Dr. Soler- 
München jeder. Erlangen. 
Fichtelgebirg | dto. 



Digitized by VjOOQ IC 



47 











1 

£.-Nr. i QesM»taiKl i 

i 


Pmdort 


Schenker etc. 


3 


Teucrium Scordimn 


Würzburg 


Landauer, 
Würzburg. 


73 


Potamogcton-Arten 


Oberfranken, 


Prf.Dr. Fischer, 






Oberbayem 


Bamberg. 


19 


Cariccs 


München, Ober- 


Kränzle, Mün- 






bayern 


chen. 


18 


Carices 


MicheIau,Staffei- 


Kaulfufs. 






stein 




176 


Phanerogamen 


Wtndsheim, | Rodler. 






Schweinfurt 




177 


Scirpus radicans 


Regensburg 


dto. 


178 


Verschiedene Phanerogamen . . 
c) zum allgemeinen Herbar. 


München, Ober- 
bayem 


dto. 


23 


Tragus racemosus 


Gries b. Botzen 


L. Grofs. 


179 


Verschied. Hochgebirgspflanzen 
d) Cryptogamen. 


Tyrol 


Rodler. 


75 


Botrychium rutaceum 


Lorenzer Wald 


W. Rudel. 


197 


Fabronia pusilla 


Gardasee 


Dr. Koch, sr. 


180 


Laubmoose u. Jungermanniaceen 


Eichstätt 


Rodler. 


187 


Baeomyces roseus 


Ziegelstein 


Buchmer, jr. 


81 


Menileus aureus auf Populus alba 


Hallerwiese 


Adalb. Rudel. 


111 


Peziza spec 


Hutberg, Fisch- 


Soph.Schwarz. 






bach 




17 


Parasitaere Pilze 


Nürnberg 


Fr.Schultheifs. 


16 


Parasitaere Pilze 

e) Frische Pflanzen, 
Früchte, etc. 


Nürnberg.fränk. 
Jura 


Schwarz. 


62 


Adonis vernalis . 


Windsheim 


Ebers, Winds- 
heim. 


101 


Ranunculus reptans 


Lindau 


Dr.Kellermann 


59 


Trollius, Culturform 


Nürnberg, kult. 


Ortmann. 


102 


Saxifraga oppositifolia 


Alpen b. Lindau 


Dr. Kellermann 


129 


Dahlia variabilis, eine Serie von 








Cultursorten 


hier gezojjen 


Ortmann. 


60 


Doronicum caucasicum .... 


> > 


> 


61 


Doronicum majus 


> > 


» 


117 


Rhododendron ferrugineum . . 


Alpen 1 Strohfeldt. 


135 


Gentiana germanica und ciliata 


Moritzberg 

Digitize 


l^Äogle 



48 











E.-Nr. 


1 

Qesenstand 


Pnndort 


Scheokeretc 


100 


Myosotis Rehsteineri 


Bodenseeufer 


Dr. Kellermann 


63 


Tulipa silvestris 


Windsheim 


Ebers, Windsh. 


200-202 


Herniaria glabra, typisch u. weit- 
kriechende armblütige u. wur- 








zelnde Form 


Nürnberg 


Adalb. Rudel. 


83 


Thesium alpinum auf Thymus 








schmarotzend 


Marienberg 


> > . 


84-86 


Trifolium pratense, filiforme und 
Lotus uliginosus, sämtliche mit 








WurzelknöUchen 


> 


» » 


87, 88 


Trifolium repens» typisch und 








Vergrünung 


> 


» » 


154 


Fruchtstände von Lyriodendron 








tulipifera .......... 


Nürnberg, gezog. 


Schwarz. 


109 


Wassernüsse 


Vogel. 
Francois Jo- 


*V7 

138 


Datteln und Oliven 


aus einem ägyp- 






tischen Grabe 


mini Avenches. 


168 


Früchte von Wallnufsarten . . . 


— 


Weidner, Ge- 
rasmühle. 


153 


Fruchtzapfen von Pinus Pumilio 


Lauf 


Schwarz. 


105 


Raphia Frucht 


Brasilien 


Graf. 


184 


CoUektion von Culturpflanzen- 








samen 


Tibet 


Hildebrand. 


185 


Collektion von Samen wilder 


M ***v^^>^* %mmm^m» 




Pflanzen 


» 


» 


134 


2 mächtige Bambusstämme. . . 


Blankmeister 


157 


Solanum tuberosum, sehr grofse 




Marie Heer- 




Knolle 


kultfränk.Jura 
kult. hier 


wagen. 
Lippacher. 


80 


Verbänderung vom Spargel . . 


119 


Zwei Hexenbesen 


Mantlach 


May r, Mantlach 


133 


Buchenholz mit sogen. Rinden- 








krebs (Pilz) 


dto. 


» » 


22 


Holz von Wespen maceriert . . 


Schmausenbuck 


Adalb. Rfldel. 


155 


3 photographische Aufnahmen 








des Latschenschlages bei . . 


Lauf 


Eckert 




IV. Qeolosie. 








a) Palaeontologie. 






139 


Ceratites nodosus, aus dem Mu- 


Rammersdorf, 






schelkalk 


Bayreut 


Goebel. 


190 


Ceratites sp. fiach, aus dem Mu- 


Richter, 




schelkalk 


Unterfranken ^ 


Schweinfurt 



Digitized 



byGoOg. 



49 











E..Nr. 


Oegeostand 


PuiMlort 


Sclienker etc. 


167 


Leptolepis sprattiformis, aus dem 




Mayr, Mant- 




obern weifsen Jura 


Solnhofen 


lach. 


106 


Leptolepis sprattiformis, aus dem 




Aug. Schmidt, 




obern weifsen Jura 


> 


Direktor. 


174 


Leptolepis sprattiformis, aus dem 








obern weifsen Jura 


» 


Leistner. 


206 


51 Objecte Oligocaenfossilien . 


Rheinebene 


Prof.Dr.Kinke- 




1 


lin, Frankfurt. 


29 


Litorinella trochilus , aus dem ; Adlerberg bei 


Schultheifs, 




Süfswasserkatk 


Nördlingen 


Assessor. 


28 


CyprisFaba, aus dem SOfswasscr- 








kallr 


9 » > 


> 


27 


Helix silvana, aus dem Süfs- 






wasserkalk 


> > > 

Heroldsberger 


> 


147 


Araucarites sp., verkieseltes Holz 


Wilhelm Lutz. 






Höhe 




57 


Löfsconchylien 


Windsheim 


Dr. Leyh. 


170 


Verschiedene Versteinerungen . 
b) Geognosie. 


Divers 


Wilh. Sachs. 


130 


Carbonische Schiefer 


Zwickau 


Knapp. 


166 


Durch Gebirgsdruck gefaltete 


Grofsbreiten- 






Schieferplatte 


bach, Thüringen 


Dr. Stadlinger. 


63. 54 


Schilfsandsteinproben 


Vach 


Schwarz. 


56 


Roter Letten der Lehrbergstufe 


> 


» 


191 


Kalkmcrgelplatte d. » 


Leutershausen 


Seel. 


50 


Stubensandstein 


Dutzendteich 


Huber. 


40 


Süfswasser-Schnecken-Kalk . . . 


Ries 


Schultheifs, 






Assessor. 


66 


Löfs 


Windsheim 


Dr. Leyh. 


58 


Löfspuppen 


> 


» » 


78 


Moosähnliche Tuffbildung . . . 


Kitzingen 


Buchner, Kitz- 


187 


Collektion von Boden- und Erd- 




ingen. 




proben 


Tibet 


Hildebrand. 




V. Mineralogie. 






11, 12 


Labrador, Katzenauge 




Seifert. 


172 


Turmalingranulit 


Vorspessart 


Landauer, 

Würzburg. 
Wilh. Sachs. 


169 


Verschiedene Mineralien .... 


Div. 


152 


Nachbildung von DiamantschlifTen 








in Glas 


Digiti. 


eVb^y'eS^^le 





50 



E.-Nr. 



Qeg^istand 

VI. Geographie. 

Karte von Peking [Eigentum vor- 
behalten] 

VII. Chemie. 

Zinkoxyd 

VIII. Technoloicle. 

Aluminium-Bleche 

Aluminium - Silber - Legierung- 
Bleche 

Aluminium-Bronce 

Querschnitte von Eisenbahn- 
Schienen 

Schleifstein aus grünem Schilf- 
sandstein 

IX. Verwaltung: der Samm- 
lunsen. 

Etiquetten zur Aufstellung der 
Sammlungen bei der Jubiläums- 
Feier 

Fichtenkranz um Prof. Spiefs 
Medaillon 



Scbenker etc. 



196 



198 



5 
6 

7 
49 

52 



193 



192 



Pecking 



hier fabriziert 



Bayern 
Zeil 



Aug. Schmidt. 
Dulon, Direkt. 

Rhau. 

> 
» 

Huber. 

Funk. 



Sebald. 
Tölke. 



Der Conservator: A. Schwarz. 



Digitized by VjOOQ IC 



51 _ 

IV. Jahresbericht der Verwaltung 1901. 

In den bisherigen Miets- und Raumverhältnissen unseres Hauses 
sind wesentliche Änderungen eingetreten. Die Nürnberger Frauen- 
arbeitsschule, welche seit Jahren den zweiten Stock des Vorder- 
hauses und das Hinterhaus inne hatte, kündigte die Wohnung, da 
die Räume für sie nicht mehr ausreichten. Wiewohl dieselbe ver- 
tragsmäfsig das Recht gehabt hätte, noch länger die Lokalitäten zu 
benützen, räumte sie selbige bedeutend früher, um der Gesellschaft 
Gelegenheit zu geben für das stattgehabte hundertjährige Jubiläum 
einschneidende bauliche Veränderungen vornehmen, sowie auch den 
zweiten Stock des Vorderhauses zu einer ausgedehnteren Sammlungs- 
aufstellung verwenden zu können. 

Die Zahlung der durch den Wegzug der Frauenarbeitsschule 
der Gesellschaft entgehenden Quartalsmiete hat der Finanzausschufs 
für die Jubiläumsfeier bereitwilligst übernommen und es konnte 
somit der zweite Stock für die Jubiläumsfeier zur Aufstellung ver- 
schiedener Sammlungen benützt werden. Vom 1. April 1902 an ist 
derselbe wieder vermietet. 

Für Rechnung des Finanzausschusses wurde ferner der Süd- 
flügel des Hauptgebäudes durch Umbau in zwei grofse Sammlungs- 
säle verwandelt, die Lokalitäten des Hintergebäudes im ersten Stock 
zu ßureau- und Sammlungsräumen der Gesellschaft umgestaltet, das 
Parterre zum Vermieten an andere Gesellschaften hergerichtet. 
Dasselbe hat z. Zt. hauptsächlich der Stenographenhort zur Be- 
nutzung. Die durch den Umbau in Wegfall kommenden Wohnräume 
des Hausmeisters wurden in das Parterre des Vorderhauses verlegt. 
Denjenigen Gesellschaften, welche von uns Räume in Miete haben, 
sei an dieser Stelle im Namen der Gesellschaft Dank ausgesprochen 
für das freundliche Entgegenkommen, welches sie uns während der 
Bauzeit durch Überlassung der ihnen zustehenden Räume entgegen- 
brachten. 

Nach Beschlufs der vorjährigen Generalversammlung wurde 
heuer an der Hypothekschuld keine Abzahlung geleistet, dagegen 
kamen 

3 Schuldscheine ä 50 Mk. und 2 Schuldscheine ä 25 Mk. 
im Gesamtbetrag von 200 Mk. zur Verlosung. 

Von diesen 200 Mk. wurden 100 Mk. geschenkt, während für 
100 Mk. der Geldbetrag erhoben wurde, an Schuldscheinen wurden 
femer noch 14 Stück im Betrage von 700 Mk. geschenkt, sodafs 
gegenwärtig die Schuld auf Scheine noch 23,225 Mk. beträgt. 

Digitized by LjOOQ IC 



52 

Yermögensstand 31. Desember 19QL 
L AeÜTa 

a) Hs.-No. 12 in der Schild- 
gasse laut Abrechnung 
V. 31. Dez. 1886 An- 
kaufispreis Ji 68,300.— 

Übernahms- und Bau- 
kosten > 20,120.75 Ji 88,420.76 

b) Mobilien 

Stand 1. Januar 1901 Jk 1145.— 
Abschreibung .... » 164. — 
Stand 1. Januar 1902 Jk 981.— 981.— 

Summa der Activa . . Jk 89,401.76 

n. PastiTa 

a) 4 Wo Hypothekenschuld 

31. Dez. 1886 . . . . Jk 54,100.— 

Abgezahlt b. 31. Dez. 1901 > 4,700.— Jk 49,400.— 

b) Ausgegebene Schuld- 
scheine Jk 31,150.— 

Geschenkt und verlost 

bis 31. Dez. 1901 . . > 7,925.— Jk 23,225.— 

Summa der Passiva . . Jk 76,626. — 
Reinvermögen . . Jk 16,776.76 

H. Sebald. 



Digitized by VjOOQIC- 



63 

V. Kassenbericht fflr 1901. 

a. lieber die Qeeeiieciiaftikasia. 

Binnahment Jk ^ 

Kassabestand 366 20 

Guthaben bei der Sparkassa (A 1421.54) — — 

Anfhahmsgebühren 63 — 

Mitgliederbeiträge 3842 65 

Beitrag vom Stadtmagistrat Nürnberg 500 — 

Beitrag vom Landrat für MitteUranken 300 — 

Beitrag vom bayerischen Staatsministerium ...... 400 — 

Freiwillige Beiträge von Mitgliedern — — 

Smnma . . 5471 85 

Avsgabent Jk ^ 

Titel la. Einrichtung des Museums 174 87 

> Ib. Unterhaltung desselben 381 34 

* Ha. Bibliothek 339 90 

» üb. Einrichtung derselben — — 

» He. Druck des Kataloges — — 

» ma. Schreibbedarf 18 — 

> nib. Porti 54 11 

» lUc. Inserate 160 60 

» ind. Gehalt des Vereinsdieners 546 56 

* nie. Feuerversicherung (1897/1902) — — 

* rv. Überzahlung zum Hauskonto 1791 10 

* V. Jahresbericht und Drucksachen 1197 28 

Via. ZuschuTs zur anthropologischen Sektion . . . 200 — 



VTb. 



botanischen Sektion 100 



Vic. » » geographischen Sektion .... 50 

Vid. > » chemischen Sektion 100 

Vie. » » zoologischen Sektion 60 

Vif. » » technologischen Sektion . . . 50 

Vlla. Fond für das 100jährige Jubiläum 100 

VTib. Abzahlung an der Hypothek — 

VHc. Verlosung von Schuldscheinen 100 

^^Tn. Reservefond — 



l 



Summa . . 5423 76 

Abschlvss: Jk ^ 

Summa der Einnahmen 5471 85 

Summa der Ausgaben 5423 76 

Kassabestand a. Bar . . 48 09 

b. 2 Sparkassabücher mit 1563 91 

c. Oberschufs aus dem Jubiläums-Fonds . 4416 60 oqIc 



64 

b. lieber die Verwaltungska8$a. 

Einnahmeiis Jk ^ 

Miets-Erträgnisse 1861 90 

Eintrittsgelder 6 50 

Erlös aus Postkarten und Vereinszeichen 83 70 

Rückvergütung vom Komit^ 65 05 

Überzahlung aus der Gesellschaftskassa 1791 10 

Summa . . 3797 26 

Ansfaben: M ^ 

Reparaturen und Bauarbeiten 122 23 

Steuern, Wasserzinse und Holzpfandgeld 432 65 

Hypothek-Zinsen 1976 — 

Ökonomie und Regie 1266 87 

Summa . . 3797 25 

Abschlnss: J(, ^ 

Summa der Einnahmen .... 3797 25 
Summa der Ausgaben .... . 3797 25 



Für die Richtigkeit: 

Nttrnberg, den 31. Dezember 1901. 

Georg Rhau. 

Die Richtigkeit vorstehender Aufstellung und die Überein- 
stimmung mit den vorliegenden Belegen bestätigen 

Nürnberg, den 27. Januar 1902. 

Gottfried Ammon. L. Kreutzer. 

J. Wächter. 



Digitized by VjOOQ IC 



66 

VI. MitgliederTerzeichnis. 

Vontandsehaii : 

Direktor : Herr Dr. August Heerwa^en, k. Gymn.-Professor. 
y. Sekretär: Herr Wilhelm Rudel, k. Pfarrer. 
11. Sekrdär: Herr Dr. Franz Küspert, k. Rcallehrcr. 
///. Sekretär: Herr Herrn. Eckert, Kaufmann. 
Bibliothekar: Herr Konrad Hörmann, Lithograph. 
CoHservator: Herr Aug. Schwarz, k. Stabsveterinär. 
Schatzmeister : Herr Georg Rhau, Fabrikbesitzer. 
Administrator: Herr Hans Sebald, Buchdruckereibesitzer. 
Bauteckniker : Herr Emil Hecht, Architekt und Gemeindebevoll- 
mächtigter. 

Kiurtodea: 

1) f^r die anatomische Sammlung: Herr Dr. Frankenburger; 

2) » » anthropologische Sammlung: Herr Wunder ; 

3) > » botanische Sammlung und zwar: 

a. für das allgemeine Herbar: Herr Fr. Schul theifs; 

b. > » Kryptogamen-Herbar : Herr Kaulfufs; 

c. > > Nürnberger Herbar: Herr Schwarz; 

d. » > bayerische Landesherbar: Herr W. Rudel; 

4) für die chemische Sammlung und zwar : 

a. fOr die anorganisch-chemische: Herr Dr. Metzger; 

b. > » organisch-chemische: Herr Wunder; 



5) fö; 

6) 

7) 

8) 

9) 
10) 
U) 
12) 



die ethnographische Sammlung: Herr Th. Obermayer; 

> mikroskopische Sammlung: Hr. Dr. Goldschmidt; 
» lokal-geognostische Sammlung: HerrSchwarz; 
» mineralogische Sammlung: Herr Dr. Zwanziger; 
» paläontologische Sammlung: Herr Spandel; 

» physikalische Sammlung: \ «, «a*-anf- 
* technologische Sammlung: / *' ^^ vacani. 

> zoologische Sammlung und zwar: 

a. für Säugetiere und Vögel: Herr Dr. Heerwagen; 

b. » Reptilien, Amphibien und Fische: Herr Kinkelin; 

c. > Weichtiere und Conchylien: Herr Knapp; 

d. » Insekten: z. Zt. vacant; 

e. » Arachniden und Myriapoden: Herr Dr. Koch sen.; 

f. > Crustaceen und niedere Tiere: Herr K i n k e 1 i n. 



A. Ehrenmitglieder. 

Sr. Kgl. Hoheit Dr. Carl Theodor, Herzog in Bayern. 
Herr Agassi z, Alexander, Professor in Cambridge. 

Arnold, Fr., k. Oberlandesgerichtsrat in München. 

Ball hörn, Hermann, Buchhändler in Würzburg. 

Dr. Blasius, R., Professor in Braunschweig. 

Dr. Blasius, W., Geh. Hofrat in Braunschweig. 

Doval-Jouve, J., Ancien Inspecteur de l'Academie de Mont- 
pellier. 

Dr. Flügel, Felix, Privatgelehrter in Leipzig. 

Dr. Günther, Sigmund, k. Professor an der techn. Hochschule 
in München. 

Knapp, Friedr., Kaufmann und k. span. Konsul. 

Dr. v. Koch, Gottlieb, Direktor des zoolog. Instituts in Darmstadt. 



56 

Herr Dr. Koch, Ludwig scn., prakt. Arrt in Nürnberg. 

Lambrecht, Fr., k. holl. Hauptmann in Hannöverisch-MQnden. 

L Otter, M., Waisenhausvater in Nürnberg. 

Dr. V. Pettenkofer, M., k. Geheimer Obermedizinalrat in 

München. 
Philippi, R. A., Professor an der Akademie in Santiago in Chille. 
Dr. von Ranke, Johannes, k. Professor in München. 
Dr. S e 1 e n k a , Emil, Professor hon. an der Universität München. 
Dr. Virchow, R., k. Geh. Rat u, Universitäts-Professor in Berlin. 
Dr. Wagner, Friedr., k. Professor in Weihenstephan. 



B. Korrespondierende Mitglieder. 

Herr Dr. Appel, Otto, Beamter am Reichsgesundheitsamt in Berlin. 

Dr. Ascherson, Paul, Professor an der Universität Berlin. 

Benda, Ernest, Kaufmann in Adelaide. 

Dr. Biehringer, Joachim, Professor am Polytechnikum xu 
Braunschweig. 

Dr. Böttgcr, Oskar, Professor in Frankfurt a. M. 

Braun, Heinrich, Naturforscher und Gemeinderat in Wien. 

Dr. Buchenau, Franz, Professor in Bremen. 

Dr. Dieudonnä, Adolf, k. Stabsarzt u. Privatdozent in Würzburg. 

V. Docoupil, Wilhelm, Direktor der k. k. Fachschule in HoHc. 

Dr. Fleischmann, Albert, Professor an der Universität in 
Erlangen. 

Gebhart, Oskar, Kaufmann in Markt Redwitz. 

Dr. Glück, Hugo, Privatdozent in Heidelberg. 

Goeringer, k. Generalmajor in Metz. 

Dr. Gordon, y de Acosta, Akademie professor in Habanna. 

Hall, J., Staatsgeolog in Jowa und Paläontolog für die Staaten 
New- York, Albany etc. 

Dr. V. Heldreich, Direktor des botan. Gartens und Direktions- 
mitglied des naturhistorischen Museums zu Athen. 

Dr. Herz, Fr. J., Konsulent fttr Molkereiwesen in Neupasing- 
München. 

Dr. Ho 11 er, Aug., k. Medizinalrat in Memmingen. 

Hornung, Heinrich, k. Reallehrer in Ansbach. 

Dr. Hartz, Kurt, Reallehrer in Kulmbach. 

L e J o 1 i s , Auguste, Direktor der Soci^t^ des sciences naturelles 
et math^matiques de Cherbourg. 

Dr. Issel, Arthur, Professor in Genua. 

Kleylein, Fabrikbesitzer in Gablonz. 

Dr. Klunzinger, Benjamin, k. Professor in Stuttgart. 

K r ä n z 1 e , Joseph, k. Korps-Stabsveterinär a. D. in München. 

Krapfenbauer, Andreas. Apotheker in Manilla. 

Dr. Kratzmann, E., prakt. Arzt in Marienbad. 

Landauer, Robert, Apotheker in Würzburg. 

Mac CO, Eduard, Kapitän. 

Dr. Magnus, Paul, k. Professor an der Universität in Berlin. 

Dr. M e h 1 i s , Christian, k. Gymnasiallehrer in Neustadt a. H. 

Dr. Müller, W., ordentlicher Professor an der Universität Jena. 

Dr. Peters, Karl, Reichskommissar a. D. 

Dr. Rehm, H., k. Medizinalrat in Regensburg. 

Dr. Reinsch, Paul, Privatgelehrter in Erlangen. 

Tempsky, Fr, Buchhändler in Prag. ^ j 

Digitized by VjOOQLC 



_57 

"^^ T c u f c 1 , Gustav, Ingenieur in München. 

* Warnstorf, Karl, Professor in Neuruppin. 
' Weidner, Gutsbesitzer in Gerasmflhte. 

* Weigel, Friedrich, Kaufmann in Ansbach. 

* Dr. Will, Privatgelehrter in Erlangen. 

' V. Wissmann, kais. Gouverneur a. D. 

* Wörlein, Gg.. k. S^hlmeister a. D. in Nymphenburg. 



2) 

3) 
4) 

s 

7) 



C. OrdentUehe HftgUeder. 

^) Herr Aischbers, Joseph, Hopfenhindler. 
Ammon, Gottfried, Kaufmann. 



S) 
10) 

16) 
16) 

17) 



18| 
19) 

20) 



23) 



26) 

27) 

28) 

29) 

30) 

31) 

32) 

33) 

34) 

36) 

36) 

37) 

38) 

39) 

40) 

41) 

42) 

43) 

44) 



Ammerbacher, Max, Postoffizial in Fürth. 

Dr. Baalfs, Hans, Veterinär. 

Bach, Leo, Fabrikbesitzer. 

Bach, Siegfried, Fabrikbesitzer. 

Bäum 1er, Joh. Konrad, Kaufmann. 

Dr. Barabo, Adam, prakt. Arzt. 

Bar b eck, Hugo, Buchhändler und Magistratsrat. 

Barth, Johannes, Kaufmann in Weigelshof 

Bart hell, Georg, Hopfenhändler. 

Dr. Bauer, Friedrich, prakt. Arzt. 

Baur, Joseph, Anton, Oberingenieur. 

Bau ri edel, Paul, Kunstmflhmesitzer. 

Beckh, August, Privatier. 

Dr. Beckh, August, prakt. Arzt. 

Beckh, Edwin, Fabrikbesitzer und Kommerzienrat. 

Beckh, Georg, Fabrikbesitzer. 

Dr. Beckh, Wilhelm, Hofrat und Oberarzt am städtischen 
Krankenhaus. 

Berlin, Max, k. Oberlandesgerichtsrat. 

Dr. Bernett, Wilhelm, prakt. Arzt. 

B e r n s t i e 1 , Charles, Kaufmann. 
0^^ DU. ^^' B e r t h o 1 d , Eugen, prakt. Arzt. 
Z4j Bibliothek, Königliche, in Berlin. 
^( "^'•«" Bing, Adolf, Kaufmann. 

Bing, Berthold, Kaufmann. 

Bing, Emil, Ingenieur. 

Bing, Heinrich, Kaufmann. 

Bing, Ignaz, Fabrikbesitzer und Kommerzienrat. 

Hing, Oskar, Kaufmann. 

H irkmann, Michael, Zimmermeister. 

H irkner, Rudolf, Bankier und Konsul der chil. Republik. 

H 1 o c h , Samuel, Privatier. 

t>r. Blödel, Georg, prakt. Arzt. 

I:>r. Blümcke, Adolf, k. Professor. 

Hock, Georg, Zahnarzt. 

H o d k y , Julius, k. Reallehrer. 

I>r. Braun, Herrn., k. Gymnasial-Professor. 

Hreitschopp, Leonh., Fabrikant. 

Hrunner, Martin, Kaufmann. 

Hrust, Max, Kaufmann und Kommerzienrat. 

X>r. Buchner, Wilhelm, prakt. Arzt. 

Bürger, Leonhard, Architekt. 

Buz, Franz, k. Greneralmajor und Brigade-Kommandeu 



58 



65) 
66) 
67) 
68) 
69) 
70) 
71) 
72) 
73) 
74) 
75) 
76) 
77) 
78) 

79) 
80) 
81) 
82) 
83) 
84) 
85) 
86) 
87) 
88) 
89) 
90) 
91) 
92) 
93) 
94) 
95) 
96) 
97) 
98) 



Cnopf, Karl, Bankier und GemeindebevoUmAchtigter. 

Dr. Cnopf, Rudolf, prakt Arzt 

Conradty, C, Fabrikbesitzer. 

Crämer, Friedrich, Prokurist. 

Crailsheimer, Hugo, Kaufmann. 

C ramer, Paul. Kaufmann. 

Denk, Hugo, Privatier. 

Dr. Deuerlein, Georg, prakt. Arzt. 

Dietz, Georg, Kaufmann und Handelsrichter. 

Diez, Gregor, Maurer- und Tünchermeister. 

Dihlmann, Adolf, Fabrikbesitzer und griech. Konsul. 

Dönneweg, Gmst, Kaufmann. 

Doerr, J. ö., Dachpappenfabrik. 

Dormitzer, Louis, Kaufmann. 

Dürr, Konrad, k. Professor an der Industrieschule. 

Dr. Eberle, Fr., k. Gymnasialprofessor. 

Dr. Eckart, Karl, Apotheker. 

Eckert, Hermann. Kaufmann. 

Ehrenbacher, Sigmund, Kaufmann und kgl. grofsbrit. 

Vize-Konsul. 
Eisenbach, Georg. Kaufmann. 
Dr. Elliesen, Paul, Privatier. 
Engelhardt, Adolf, k. Pfarrer. 
Engerer, K., kgl. Oberlandesgerichtsrat. 
Englert, Hans, Kaufmann. 
Enslin, Heinrich, Kaufmann. 
Dr. Epstein. Ernst, prakt. Arzt. 
Erdmann, Friedrich, Bankier. 
Erhard, Theodor, Apothekenbesitzer. 
Erlenbach, Max, Kaufmann. 
Ertheiler, August, Kaufmann. 
Etz, Friedrich, Kaufmann. 
Faber, Ernst, Aufsichtsrat. 
Dr. Fischer, k. Prof. und Inspektor des Naturalienkabinets 

und Lyceum, Bamberg. 
Fischer, Gottl, k. Gymnasialprofessor. 
Fischer, Karl, Privatlehrer. 
Forchheimer, H. S., Kaufmann. 
Dr. v. Forster, Sigm., prakt. Arzt und k. Hofrat. 
Dr. Frankenburger, Alex., prakt Arzt. 
Frauen feld, Emil, Kaufmann. 
Frauen feld, Karl, Kaufmann. 
Frauen feld, Moritz, Kaufmann. 
V. Frays, Freiherr, Philipp, Fabrikbesitzer. 
Dr. Friedel, Wilhelm, k. Professor. 
Friedrich, Johann, k. Reallehrer a. D. 
Füchtbauer, Gg., k. Rektor und Oberstudienrat. 
Funk, Stephan, Kaufmann. 

Gallinge r. Jakob, Kaufmann und Kommerzienrat. 
G a r e i s , Wilhelm, k. Oberregierungsrat u. Bezirksamt mann. 
Gebhardt, Ludwig, Kaufmann und Kommerzienrat. 
Gebhardt, Wilhelm, Kaufmann. 
Dr. Geifsler, Gustav, prakt. Zahnarzt. 
Gerngros, Ludwig. Kaufmann und Kommerzienrat. 
Gerngros, Wilhelm, Kaufmann und Kommerzienrat» 

Digitized by iC 



l 



59 

innl ^^" ^^' Giulini, Ferdinand, prakt. Arzt. 
*00) » Gl au n in g, Karl, kgl. Telegraphen-Abtcilungs-Ingenicur in 
ini) Bamberg. 

ino\ * Göbel, Otto, k. Veterinärarzt. 
inol * Gösch el. Ludwig, Privatier. 
i^\ * Dr. Goldschmidt, Ferdinand, prakt. Arzt. 
int\ * Gombrich, M., Institutsdirektor. 

in^l * Gonnermann, Karl, Fabrikbesitzer und Kommerzienrat. 
106) » Dr. Gottschalk, Reallehrer in Fürth. 

inll * Dr. Gramming, Karl, Rechtsanwalt. 

2rt\ * Grasser, Johannes, Fabrikbesitzer. 

10^) * Dr. Gr et her. Frdr., Apotheker. 

110) . Dr. Grimm, Ferd., prakt. Arzt. 

1^^) * Grofs, Ludwig, k. Gymnasiallehrer. 

112) » Grofskopff, Eduard, Bankier. 

113) » V. Grundherr, Benno, Kaufmann, Kommerzienrat und k. 

niederl. Konsul. 

11^) * Gütermann, Wilhelm, Kaufmann. 

11 5) ' Guldmann, Arthur, Kaufmann. 

\16) * Gutmann, Gustav, Privatier. 

\\i) ♦ Haas, Eduard, Fabrikbesitzer und Kommerzienrat. 

Utf^ » Haas, Karl, Bankier. 

119) > Haymann, Julius, Direktor des städt Gaswerks. 

120^ » Hecht, Emil, Architekt und Gemeindebevollmächtigter. 

121) > Heerdegen, Albrecht, Kaufmann und Handelsrichter. 

122) » Dr. Heer wagen, August, k. Gymnasialprofessor, 
ml * Heilin g, Christoph, Kaufmann. 

iot\ * Heim, Hermann, Kaufmann. 

J?^) » Heim, Kari, Kaufmann. 

127\ * Held, Hermann, k. Gymnasialprofessor. 

12sl * Heller, Friedrich, Fabrikbesitzer. 

129) * Heller, Hermann, Chemiker. 

130) * Heller, Louis, Kaufmann. 

131) * Hellmuth, Joseph, Rechtsanwalt und Justizrat. 

132) * Hellmuth, Karl, städt. Bezirkstierarzt. 

133) * Hellmuth, Sigmund, Magistratsrat. 

134) * Hennch, Georg, k. Eisenbahn-Betriebs-Direktor. 

135) * H e r t e 1 , Friedrich, Kaufmann. 

I36j * Hesselberger, David, Kaufmann. 

137) * Hcydolph, Georg, Buchdruckereibesitzer. 

138) * Hilpert, Christian, Fabrikdirektor. 

139) * X3r. Hirsch, Jakob, Fabrikbesitzer in Fürth. 

140) l Höhn, Max, k. Generalstabsmajor. 

141) * Hörmann, Konrad, Lithograph. 

142) ^ Dr. Hofmann, Hans, Chemiker. 
U3) ^ Hofmann , J. M., Buchhandlung. 

144) ^ Hopf, Eduard, Kaufmann. 

145) ^ Hopf, Emil, Kaufmann. 

146) ^ Hopf, Hans, Kaufmann. 

147) ^ Huber, Friedrich, Kaufmann. 

148) ^ Huber, Kari, Staatsbaupraktikant. 

149) ^ Hussong, Ludwig, Apotheker in Kempten. 
15Q\ JiinfJ. Heinrich, Kaufmann. 

\t^Yv Xann, Paul, k. Telegrapheningenieur. 

^^\ > Kann, Samuel, Privatier. 
*^fK 1 Kantenseder, Johann, Schreinermeister. (^qqqJp 



60 



153) Herr Dr. K a u f m a n n , Ludwig, Chemiker u. Fabrikbes. in Fürth. 

154) » Dr. Kaul, Hermann, Chemiker. 

155) » Kaulfufs, Joh., städt. Trichinenschauer. 

156^ > Dr. Kellermann, Rektor u. Prof. an der Kreisrealschule. 

i67j > Kempe, Karl, Fabrikdirektor. 

158) > Kiefer, Andreas, k. Hauptmann und Kompagniechef. 

159) » Kinkel in, Adolf, Apotheker. 

160) » Dr. Kirste, Wilhelm, prakt. Arzt. 

161) » Dr. Kleemann, S., Fabrikbesitzer in Fürth. 

162) > Klein, Benedikt, Kaufmann. 

163) » Dr. Kien k er, Otto, Fabrikbesitzer in Leyh. 

164) » Klünder, Gustav, Ingenieur. 

165) » Klofs, Otto Friedr., Kaufmann. 

166) > Dr. Koch, Heinrich, prakt. Arzt. 

167) * Dr. Koch, Karl, prakt. Arzt. 

168) > Körner, Theodor, Fabrikbesitzer. 

169) > Kohn, Emil, Bankier und Handelsrichter. 
V70) » Kohn, Ernst, Bankier. 

171) > Kohn, Georg, Bankier. 

172) > Krakenberger, Leopold, Kaufmann. 

173) > Krakenberger, Max, Kaufmann. 

174) » Krell, Otto, Fabrikdirektor. 

175) > Krell, Otto, jun., Oberingenieur. 
176^ > Krell, Rudolf, Oberingenieur. 

177) > Kreutzer, Ludwig, Fabrikbesitzer. 

178) » Kr om well, Karl, Kaufmann. 

179) > Dr. Küspert, Franz, kgl. Reallehrer. 

180) > Kugle r, Sal., Direktor. 

181) > Kuhlo, Richard, Generaldirektor. 

182) > Kunzmann, Georg, Kaplan. 

183) > Lambrecht, Hermann, Fabrikbesitzer u. kgl. span. Konsul. 

184) > Dr. Landmann, Joseph, Rechtsanwalt. 

185) > Dr. Landsberg, Ludwig, Fabrikbesitzer. 

186) > Lang, Bernhard, Kaufmann und k. schwed. Konsul. 

187) > Lang, Ignaz, Kaufmann. 

188) » Lang, Leopold, Kaufmann. 

189) > Langermann, Moritz, Kaufmann. 

190) > Lauer, Jean, Fabrikbesitzer und Magistratsrat. 

191) > Lauinger, Leopold, Kaufmann. 

192) » Dr. Lehnert, Wilhelm, Apotheker. 

193) > Leidig, Georg Friedrich, Optiker und k. Hoflieferant. 

194) » Lenz, Ernst, Erzgiefsereibesitzer. 

195) » Dr. Lessing, Kurt, Fabrikbesitzer. 

196) * Lessing, Walter. Techniker. 

197) » Leuchs, Georg, Chemiker und kgl. Hoflieferant. 

198) » Dr. Leuchs, Kari, Chemiker. 

199) » Lex, Hans, Apotheker. 

200) » Dr. Leyh, F., Lehrer. 

201) > Leykauf, Georg, k. Hofstahl warenfebrikant. 

202) > Dr. Limpert, L., prakt. Arzt. 

203) » Lindinger, Leonh., stud. rer nat. in Erlangen. 

204) * Lindmann, Jakob, Direktor des Gaswerks in Fürth. 

205) » Lindner, Heinrich, Kaufmann. 

206) » Lösch, Friedrich, k. Postmeister. 

207) > Dr. Maas, Markus, prakt. Arzt und k. Hofrat. 

208) » M a e r I , Georg, Baumeister. r^ ^ ^ ^T ^ 

^ DigitizedbyLjOOgle 



61 



209) Herr Mandel, Karl, Kaufmann. 

210) > Mandel, Wilhelm, Kaufmann. 

211) • Dr. Mansbach, Sigmund, prakt Art. 

212) » Mar Her, Julius, Kaufmann und Kommerzienrat 

213) > Martin, Eugen, Rechtsanwalt und Justizrat. 

214) » Marx, Georg, Ober-Ingenieur. 
216) » Dr. Mayer, M. L., prakt. Arzt. 

216) • Mayer-Dinkel, Albert, Kaufmann, 

217) • Dr. Mehl er, Heinrich, prakt. Arzt in Georgensgmünd. 

218) > Meiser, Franz, Ingenieur. 

219) > Dr. Merkel, Gottl., k. Medizinalrat u. Krankenhausdirektor. 

220) » Dr. Merkel, WilhcUn, prakt. Arzt und k. Hofrat. 

221) > Merzbacher, Joseph, Kaufmann. 

222) » Mesthaler, Joh., Fabrikbesitzer und Kommerzienrat. 

223) > Metzger, Ludwig, Kaufmann und Kommerzienrat. 

224) » Dr. Metzger, Sigmund, Fabrikbesitzer und k. Hoflieferant. 

225) • Michahelles, Georg, k. Hauptmann und Kompagniechef 

226) > Miederer, Kaufmann. 

227) > Dr. Mohr, Gustav, prakt. Arzt. 

22«) » Dr. Morgenstern, Friedrich, Fabrikbesitzer in Fürth. 

229) > Mühlberger, Karl, Gymnasialzeichnenlehrer in Kitzingen. 

230) > MfiUer, August, Kaufmann. 

231) > Mfiller, Jean, Kaufmann. 

232) • Münderlein, Johann, k. Pfarrer. 

233) > Dr. Münz, Pinkus, prakt. Arzt. 

234) • Münzinger, August, Kaufmann. 
235J • Munker, Georg, k. Professor a. D. 

236) > M unzer, Julius, Kaufmann. 

237) > Naue, Otto, Kaufmann. 

238) » Dr. Neuberger, Jos., prakt. Arzt. 

239) » Dr. Neuburger, S., Augenarzt. 

240) > Dr. N e u k i r c h , Richard, Oberarzt am städt. Krankenhaus. 

241) > Neumeyer, Hans, Direktor. 

242) > Niste r, £., Kunstanstaltsbesitzer und Kommerzienrat. 

243) > Nold jr., Kari. Fabrikbesitzer. 

244) > Nowack, Lorenz, Fabrikdirektor. 

245) • Nunhoefer, Postassistent. 

246) > Obermayer, Theodor, Kaufmann. 

247) » Dr. Oppler, Theodor, Chemiker und Beauftragter der 

chemischen Berufsgenossenschaft. 

248) » Ortmann, Albert, Kunst- und Handelsgärtner. 

249) » Ottenstein, Albert, Kaufmann. 

250) • Ottenstein, Justin, Kaufmann und Kommerzienrat. 
251^ > Ottenstein, Max, Kaufmann. 

252) » Paalzow, Richard, Kaufmann. 

253) • Pabst, Friedrich, Fabrikbesitzer. 

254) » Pabst, Julius, Fabrikbesitzer. 

255) » Dr. Pauschinger, Leonhard, prakt. Arzt. 

256) » Dr. Per et z, E., prakt. Zahnarzt. 

257) » Pfautsch, Friedr., Apotheker in Weidenbach b. Triesdorf. 

258) • Pilhofer, Joh., k. Bahnexpeditor. 

259) » Dr. Posch el, Gustav, k. Bezirksarzt in Neustadt a. A. 

260) • Popp, Adolf, Kaufmann. 

261) » Preifs, Konrad Philipp, Mechaniker. 

262) » Prell, August, k. Bsmkier. 

263) * Dr. Prior, Eugen, k. Professor und Direktor. 

Digitized by VjOOQ IC 



62 



264) Herr 

265) 

266) 

267) 

268) 

269) 

270) 

271) 

272) 

273) 

274) 

275) 

276) 

277) 

278) 

279) 

280) 

281) 
282) 
283) 
284) 
285) 
286) 
287) 
288) 
289) 
290) 
291) 
292) 
293) 
294) 
295) 
296) 
297) 
298) 

299) 
300) 



Putzin, Ludwig. Fabrikbesitzer und k. Hoflieferant. 

Raab, Karl, Fabrikbesitzer und Kommerzienrat. 

Dr. Rabus, Heinrich, prakt. Arzt. 

Ratz, Heinrich, Apotheker. 

Rau, S. £., Kaufmann. 

Dr. Raum, Wilhelm, Fabrikbesitzer. 

Rehlen, Wilhelm, Magistratsrat. 

Reif, Jean, Brauereibesitzer und Kommerzienrat. 

Reif, Zacharias, Brauereibesitzer und Kommerzienrat. 

Dr. Reitzenstein, Fritz, Privatdozent in Würzburg. 

Reizenstein, Ernst, Kaufmann. 

Reizen stein, Hugo. Kaufmann. 

Rettelbusch, Ernst, Architekt. 

Rh au, Georg, Fabrikbesitzer. 

Dr. Riedel, Heinrich, Apothekenbesitzer. 

Dr. Riegel, Wilhelm, prakt. Arzt. 

Rieppel, A., Direktor der Maschinen bau- Aktiengesellschaft 

und k. Baurat. 
Rockstroh, Gustav, Kaufmann. 
Rodler, Karl, Apothekenbesitzer. 
Rogner, Konrad, Direktor des städt. Schlachthofes. 
Dr. Rosenfeld, L., prakt. Arzt. 
Rosen feld, Sigmund, Kaufmann. 
Rudel, Albert, Gymnasialassistent. 
Rudel, Wilhelm, k. Pfarrer. 
Rupprecht, Friedrich, Privatier. 
Rupprecht, Wilhelm, Kaufmann. 
Sachs, Karl, Kaufmann und Kommerzienrat. 
Sachs, Wilhelm, Kaufmann. 
Sandner, Friedr., stud. rer. nat. in Erlangen. 
Schäfer, Jakob, k. Bezirkshauptlehrer in Fürth. 
Schafft, Emil, Fabrikant. 

Dr. Scheidemantel, Heinrich, prakt. Arzt und k. Hofrat 
Scheuermann, Ferdinand, Privatier. 
Schilling, Theodor, Grofshändler und ital. Konsul. 
Schlegel, Hans, Inspektor an der städt. Untersuchungs- 



anstalt. 

Schlegel, Hermann, Apotheker, 
von Schleich, Herm., k. Kammerjunker und Oberleutnant 

i. k. 8. Feldart.-Regiment. 
Schmidmer, Chr., Fabrikbesitzer und Kommerzienrat 
Dr. Schmidmer, E., Fabrikbesitzer. 
Schmidt, August, k. Postamtsdirektor. 
Schmidt, Rudolf, Kaufmann. 
Seh mi edel, Theodor, Fabrikbesitzer. 
Schneider, Peter, k. Veterinärarzt. 
Schönner, Geor^, jun., Reifszeug£abrikant. 
Scholler, Friedrich, Hauptagent. 

Schräg, Karl, Hofbuchhändler und k. k. österr. Konsul. 
Schreiber, Aug., Fabrikant 

Dr. Seh renk, Friedrich, prakt Arzt und II. Stadtarzt 
Schröder, Theodor, k. Gymnasialprofessor a. D. 
Dr. Schubert, Paul, prakt. Arzt. 

Dr. V. Schuh, Georg, I. Bürgermeister der Stadt Nürnberg. 
Schuh, Heinrich, Fabrikbesitzer. 
Schuh, Wilhelm, Apotheker. ^ , 

Digitized by VjOOQ IC 



63 



317) Herr 

318) 

319) 

320) 

321) 

322) 

323) 

324) 

325) 

326) 

327) 

328) 

329) 

330) 

331) 

332) 

333) 

334) 

335) 

336) 

337) 

338) 

339) 

340) 

341) 

342) 

343) 

344) 

345) 

346) 

347) 
348) 

349) 
350) 
351) 
352) 
353) 
354) 
355) 
356) 
357) 
358) 
359) 
360) 
361) 
362) 
363) 
364) 

365) 
366) 
367j 
368) 
369) 



Schultheifs, Friedrich, Apotheker. 

Schultheifs, Veit, städt. Trichinenschauer. 

Schultheifs, Oskar, k. Postassessor. 

Schwanhäufser, Gustav, Fabrikbesitzer u. Kommerzienrat. 

Dr. Schwanhäufser, August, Fabrikbesitzer. 

Schwarz, August, k. Stabsveterinär. 

Schwarztrauber, Johs., k. Stabsveterinär in Erlangen. 

Sebald, Gustav, cand. jur. 

Sebald, Hans, Buchdruckereibesitzer. 

Sebald, Karl, Kalkwerkbesitzer. 

Seel, W., Lehrer. 

Seiler, Christoph, Fabrikbesitzer. 

Dr. Seiler, Hermann, prakt. Arzt. 

Sichling, Richard, Kaufmann. 

Dr. Siebe rth, O., Zahnarzt. 

Dr. Simon, Max, prakt. Arzt. 

Sommer, Theodor, Chemiker in Fürth. 

Spandel, Erich, Buchdruckereibesitzer. 

Speckhardt, Georg, Bäckermeister. 

Dr. Spoerl, prakt. Arzt in Neumarkt i. O. 

Dr. Stadünger, Hermann, Assistent. 

Stadler, Friedrich, Zahntechniker. 

Stahl, Joh. Christ., Kaufmann. 

Stau dt, Erdmann, Fabrikbesitzer und k. Hoflieferant. 

Dr. Steinhardt, Ignaz, prakt. Arzt. 

Dr. Steinheimer, Ludwig, prakt. Arzt. 

Dr. Stich, Eduard, Oberarzt und k. Hofrat. 

Stich, Karl, Buchdruckereibesitzer. 

Stich, Robert, Buchdruckereibesitzer. 

Dr. Stockmeier, Hans, k. Professor und Vorstand der 

ehem. Abteilung des bayer. Gewerbemuseums. 
Stöhr, Aug., Sekretär a. polyt. Zentralverein in Würzburg. 
Dr. Straub, Adolf, I. Assistent an der städtischen ünter- 

suchungsanstalt. 
Straus, Simon, Kaufmann. 

Dr. St rauf s, Julius, Oberlehrer an der städt. Handelsschule. 
St r aufs, Louis, Kaufmann. 
Straufs, Willy, Kaufmann. 
Dr. Sturm, Jakob, prakt. Arzt in Mögeldorf. 
Süfs, Clemens, Apotheker. 
Tafel, Hermann, Fabrikbesitzer in St. Jobst. 
Tauber, Christ, Baumeister. 
Thurnauer, Bernhard, Fabrikbesitzer. 
Tölke, Konrad, Gemeindebevollmächtigter. 
Tuchmann, Franz, Kaufmann. 
Tuchmann, Friedrich, Kaufmann. 
Tuchmann, Max Joseph, Kaufmann. 
U h 1 , Adolf, Kaufmann. 

Ulmer, Julius, Direktor der Nürnberger Bank. 
Dr. Ullrich, August, Rektor der höheren Töchterschule 

und k. Schulinspektor. 
Versen, Max, Chef-Redakteur. 
Völker, Greorg, Kaufmann. 
Voit, Paul, Kaufmann. 
Voit, Robert, Kaufmann. 
Vollhardt, Oskar, k. Advokat und Justizrat. ^^ , 

izedbyLjOOgle 



370) Herr 

371) 
372) 
373) 

374) 
375) 
376) 
377) 
378) 
379) 
380) 
381) 

382) 
383) 
384) 
385) 
386) 
387) 
388) 
389) 
390) 
391) 
392) 
393) 
394) 
395) 



64 



Vollrath, Franz, Kaufmann und General- Agent. 

Wächter, Jos., k. Zahlmeister. 

Waydelin, W. Fr., Kaufmann. 

Weidemann, Herrn.« Apotheker und I. Direktor der 
Centralmolkerei. 

Dr. Weigel, Karl, prakt. Arzt. 

Weigle, Theodor, Apotheker. 

Weil, Philipp, Kaufmann. 

Weinberger, Max, Fabrikant. 

Weinschenk, Hermann, Kaufhiann. 

Wendriner, Ferd., Kaufmann. 

Wertheimer, Sigmund, Kaufmann. 

Dr. Wiegmann, Dietrich, I. Assistent der Brauerei- 
versuchsstation. 

Wie I and, Peter, Privatier. 

Wir sc hing, Franz, Apotheker u. Bürgermeister in Velburg. 

Wirth, Christoph, Lehrer. 

Wölfel, Konrad, Grofsfleischermeister. 

Wolf, Mathias, k. Postamtsdirektor. 

Wolffhardt , Aug., k. Gymnasialprofessor. 

Wunder, Justin, Chemiker und Fabrikbesitzer. 

Wunder, Ludwig, Fabrikbesitzer. 

Wunder, Wilhelm, Ingenieur. 

Dr. Zagelmeier, Hans, städt. Sanitätstierarzt. 

Zeltner, Johannes, Kaufmann und Kommerzienrat. 

Zeltner, Johannes, jun., Kaufmann. 

Zippelius, August, Kaufmann. 

Dr. Zwanziger, Gg., k. Professor ai) der Industrieschule. 



D. Aafserordentliche Mitglieder. 

1) Herr Clausius, Albert, Gymnasial- Assistent. 

2) » Dr. Dürr, Felix, Betriebsleiter in Fürth. 

3) > Dr. Eiselein, k. Reallehrer. 

4) > Elliesen, Max, cand. rer. nat. 

5) » Dr. Falk, Richard, Ass. a. d. Versuchsanst. für Bierbrauerei. 

6) » Frafs, Bernhard, Chemiker. 

7) » Gar eis, Wilhelm, Apotheker. 

8) » Graf, Karl, Apotheker. 

9) » Gramp, Friedr., Chemiker. 

10^ » Hof mann, Siegfried, Chemiker in Buch. 

11) > Knoesel, Christian, cand rer. nat. 

12) » König, Roderich, Ass. a. ehem. Laborat. d. bayr. Gew.-Mus. 

13) * Dr. Lauffer, Otto, Kustos am Germanischen Museum. 

14) » Dr. Leide I, L., Ass. a. ehem. Laborat d. bayr. Gew.-Mus. 

15) » Dr. Metz, August, Ass. a. ehem. Laborat. d. Industrieschule. 
16} * Oettinger jr., S., Ofenfabrikant. 

17) » Dr. Paul, Josef, Chemiker. 

18) • Reinhard, Ernst, Kaufmann. 

19) » Richter, Kunstanstaltsbesitzer. 

20) * Ritter, Ludwig, Rechtspraktikant. 

21) » Wolff, Justus, Ass am ehem. Laborat. d. bayr. Gew.-Mus. 

22) • Wolf, Lorenz, Ingenieur. 



Digitized by VjOOQ IC 



r 



66 

Vn. Jahresbericht der Sektion für Anthropologie, 
Ethnologie und Urgeschichte. 

Die Sektion zählte im Jahre 1901 33 Mitglieder. 
Es Händen sieben Sitzungen statt, in welchen nachfolgende 
Vorträge, Referate und Demonstrationen gehalten wurden: 
Herr Dr. B ernett: 

1) Ober die Ergebnisse der Schwalbe'schen Schädelmessungen 
am Neanderthaler und Pithekantropos Dubois. 
Herr Dr. v. Forster: 

1) Die Slavenfrage. 

2) Praehistorische Fischerei. 

3) Die Höhle bei Wildenberg. 

4) Virchow und die Virchow-Feier. 
6} Pithekanthropos Dubois. 

6) Nachbildungen von Fumden aus den Königsgräbem von 

Mykenae. 

7) Keramik der neoUthischen Zeit nach Goetze. 

8) Gewan^funde im Moor von Westorfif. 
Herr Justin Wunder: 

1) Eintragung von 270 Grabhügeln des Arbeitsgebietes der 

Sektion in die Katasterpläne. 

2) Einzelfunde von Leinburg und Brunn. 

3) Grabung in Weidenschlag. 

4) Grabung in der Solach. 
Herr Hörmann: 

1) Ober die Volksstämme der fränkischen Schweiz. 

2) Ober Schellenbögen. 

3) Die Festschrift der naturhistorischen Gesellschaft. 

4) Klassifizierung keramischer Funde nach dem Ornament. 
Herr Huber: 

Ober »Urgeschichte der Kultur von Hoernest. 

Die Gesellschaft liefs Herrn Geheimrat Prof. Dr. Virchow 
bei der Feier des 80jährigen Geburtstages eine von Herrn Luck- 
meyer entworfene und in vollendeter künstlerischer Art hergestellte 
Glückwunschadresse durch den Obmann Herrn Dr. v. Forst er 
überreichen. 

Bei der Säkularfeier der naturhistorischen Gesellschaft war die 
Sektion durch Arbeiten ihrer Mitglieder, welche die Veröffentlichung 
des Fundmaterials der Sektion zum Vorwurf hatten, sowie durch Über- 
gabe von (reschenken für die Bibhothek und die Sammlung beteihgt. 

Digitized bj iC 



66 

Öie Glückwünsche bei der Festfeier vrurden durch den Obmann 
der Sektion überbracht. 

Auf Antrag der Sektion ¥rurden bei der Festfeier als Ehren- 
mitglieder der naturhistorischen Gesellschaft proklamiert die Herren: 
k. Professor Dr. Naue, München, 
k. Geheimrat Dr. Vofs, Berlin, 
k. Geheimrat Dr. Grempler, Breslau, 
k. Regienmgsrat Dr. Much, Wien. 
In die Vorstandschaft fQr das Jahr 1902 wurden gewählt: 
Als Obmann: Herr Dr. v. Forster, 
Als Schriftführer: Herr J. Wunder, 
Als Kassier: Herr V. Schultheifs. 
Grabarbeiten wurden gemacht in Weidenschlag und in der 
Solach. Die Funde sind den Sammlungen einverleibt. 

Nürnberg, Dezember 1901. 

Dr. V. Forster, F. H. Huber, 

Obmann. Schriftführer. 



Vm, Jahresbericht der botanischen Sektion 
pro 1901. 

Die Sektion zählte zu Beginn des Jahres 25 Mitglieder, im 
Laufe desselben traten ihr 3 Mitglieder bei, sodafs die Zahl der- 
selben am Schlüsse des Jahres 28 betrug. 

Die Vorstandschaft bheb dieselbe wie bisher. 

An Fachzeitschriften wurden gehalten: Uhlworm, botanisches 
Zentralblatt — Leimbach, deutsche botanische Monatsschrift — 
Kneucker, allgemeine botanische Zeitschrift — Wettstein, öster- 
reichische botanische Zeitschrift — aufserdem zirkulierten noch : 
Rosenthal, biologisches Zentralblatt ; Prometheus, Wiener und Grazer 
Gartenzeitung. Neu angeschafft wurden: Brühl, Pflanzenalkaloide — 
Wettstein, Handbuch der systematischen Botanik, 1. Band — de 
Vries, Mutation und Mutationsperioden — Weifs, Schädlinge der 
Kulturpflanzen. In Fortsetzung blieb : Ascherson und Gräbner, 
Synopsis der mitteleuropäischen Flora, und Göbel, Organographie der 
Pflanzen. Geschenkt ¥rurden von Herrn Prof. Dr. Wagner: Bericht 
über die bayerische Gersten- imd Hopfenausstellung in München, 
von Herrn Spandel: mehrere Nummern des Generalanzeiger mit den 
phänologischen Notierungen des Herrn Fr. Schultkeifs.T Die 

Digitized by VjOOQIC 



&7_ 

Zugänge zum botanischen Teil der Sammlungen sind aus dem Bericht 
»Zuwachs zu den Sammlungen« ersichtlich. 

In den 17 Sitzungen wurden folgende Referate und Demon- 
strationen geUefert: 
Herr Braun: zur Flora von Nürnberg und Bayreuth. 

> Buchner, Dr. med.: über Gomphocarpus fruticosus (Nizza); 
zur Flora von Windsheim, von Sexten in Tirol, von Millstadt 
in Kärnten; über Hieracium praealtum und Prantlii; über 
Baeomyces roseus von Ziegelstein ; über eine grofse Serie durch 
Tausch erworbener meist alpiner Pflanzen. 

» £nslin: über den Alpenpflanzgarten am Schachen und über 
Schutz der Alpenpflanzen. 

» Ehrbar d: über Früchte von Pirus japonica; über Batracho- 
spermum moniUforme von Feucht, über Süfswasseralgen , 
Spirogyra etc. mit mikroskopischen Demonstrationen. 

> Höhn: zur Flora von Nürnberg und Streitberg; über Chroolepus 
ioUthus vom Fichtelgebirg. 

» Kinkelin: über Staphylaea pinnata von Neumarkt. 

> Prell: über Artemisia nitida. 

> Rodler: über Draba incana; über Sisymbriimi pannonicum 
von Fürth ; Hieracium Prantlii ; über die Veröffentlichungen des 
deutschen Lehrervereines für Naturkunde. 

> Rudel, Adalbert: über Colchicum auctumnale mit panachierten 
Blättern; über Pulsatilla vernalis; über neue Formen bei 
Herniaria glabra; über Wurzelknöllchen verschiedener wilder 
Papilionaceen ; über Specularia Speculum forma flore albo 
von der Hubirg; über Auftreten von Achillea nobilis bei Feucht; 
aus der Flora der Wetterau. 

» Rudel, Wilhelm: zur Flora des Ortlergebietes, des Nonsberges 
und des Garda-Seees. 

> Schwarz: zur Flora um Nürnberg, Pegnitz; Flora des 
Erlanger-Höchstadter Weiherbezirkes; über Galium vemum 
bei München, über Aster macrophyllus vom Fichtelgebirg, 
beides von Herrn Universitätsprofessor Dr. Solereder in Er- 
langen eingeschickt; über Hippophae rhamnoides von Augsburg; 
über adventive Gramineen ; über den geologischen Aufbau des 
Aischthales ; über von Herrn Dr. Glück gesendete Phanerogamen. 
Auch legte derselbe eine grofse Anzahl pflanzengeographischer 
Kärtchen vor und referierte über die Vereinsausflüge. 

> S c h u 1 1 h e i f 8, Friedrich teilte seine fortlaufenden phänologischen 
Beobachtungen mit, demonstrierte ein überaus hochwüchsiges 

Digitized bv ..C 



68 

Frachtexemplar von Physalis Alkekengi von Rudolstadt und 

referierte über seine diesjährigen Funde von einheimischen 

mid Adventivpflanzen. 
Herr Schultheifs, Veit demonstrierte blühende Scilla maritima. 

Wie bisher galt die Arbeit der Sektion in erster Linie der 
weiteren Durchforschung des Arbeitsgebietes. Während Herr Fr. 
Schultheifs der Adventivflora sein Hauptaugenmerk zukehrte, aber 
auch eine mehrtägige Tour dem fränkischen Jura an der Altmühl 
um Beilngries etc. widmete, besuchte Herr Schwarz die weiher- 
reiche Gegend von Herzogenaurach zur Aisch und jenseits derselben 
bis Zentbechhofen, was zur Wiederaufßndung der Najas marina 
führte. Herr Adalbert Rudel besuchte mit dem Obmann die Jura- 
thäler zwischen Streitberg und Bamberg, wobei wieder einmal nach 
langer Zeit Stachys alpinus beobachtet wurde, aufserdem durch- 
streifte Herr Rudel allein den östlichen Jura von Neuhaus über 
Königsstein und Etzelwang gegen Hohenburg, Lutzmannstein und 
Velburg und kehrte über Deining und Neumarkt zurück. Herr 
Prell setzte seine Beobachtungen über AccUmatisation von hoch- 
alpinen Pflanzen in unserem Dolomit fort. Herr Ehr bar d wendete 
sein Augenmerk den Süfswasseralgen zu. Die phänologischen Be- 
obachtungen wurden in gleich gewissenhafter Weise, wie bisher von 
Herrn Fr. Schultheifs registriert. 

Auch nach aufsen, in forensischer Beziehung, hatte die Sektion 
Gelegenheit zur Thätigkeit, indem eine Anfrage der Zollbehörde 
betreffs Klassifizienmg gewifser ausländischer Nutzhölzer durch Herrn 
Kinkel in gründlich bearbeitet wurde, welches Elaborat dem Direk- 
torium zur weitem Behandlung übergeben wurde. 

Die Sektion hat auch mit dem »deutschen Lehrerverein für 
Naturkunde« sowie mit dem »Verein zum Schutze der Alpenpflanzen € 
Verbindungen angeknüpft und ist beiden Vereinigungen beigetreten. 

An den zahlreichen Vereinsausflügen nahmen stets nicht wenige 
Mitglieder der Sektion teil. An Herrn Universitätsprofessor Magnus 
in Berlin konnte wiederum eine umfangreiche Sendung parasitärer 
Pilzvorkommnisse zur Revision beziehungsweise Bestimmung über- 
schickt werden. 

Die Umarbeitung des Nürnberger Lokalherbares wurde be- 
endet, das Merkleinische revidiert, das Bayerische Landesherbar 
wesentlich vergröfsert. 

Der briefliche Verkehr mit auswärtigen Botanikern war heuer 
ein besonders reger, indem zu den früheren Korrespondenzbezieh- 
ungen noch folgende neue hinzukamen mit den Herren^ Apotheker 

Digitized by VjC 



^J9 

Böhner in Creufsen, Pfarrer Erdner in Ried bei Neiiburg, Prof. 
Hackel in Sankt Polten, Professor Ihne und Creneralarzt Metzler 
in Dannstadt, Dr. E. Krause in Saarlouis, Apotheker Scholz in 
Bamberg, Professor V o 1 1 m a n n in München, Professor W i s 1 i c e n u s 
in Würzburg, Dr. Wolf in Dresden-Plauen, Lehrer Meyer in 
Regensburg, Professor Schuhe in Breslau. 

Das im Oktober gefeierte lOOjährige Jubiläum der Gesellschaft 
Teranlafste die Sektion die Ernennung folgender Herren zu Ehren- 
mitgliedern zu beantragen: Prof. Ascherson und Prof. Magnus 
in Berlin, Prof. Wettstein in Wien, alsdann zu korrespondierenden 
Mitgliedern: Prof. Solerederin Erlangen, Prof. Wagner in Weihen- 
stephan-Freising, Dr. Gräbner in Berlin, Dr. Poeverlein in 
Regensburg, welchen Vorschlägen einmütig stattgegeben wurde. Die 
erhebende Feier selbst erbrachte das persönHche Erscheinen heber 
früherer Mitarbeiter und neuer Freunde, so der Herrn Professor 
Solereder aus Erlangen, Kaufmann G e b h a r d aus Markt Redwitz, 
Apotheker Landauer aus Würzburg, Dr. Herz aus München, 
Apotheker Krapfenbauer aus Manila, Dr. Poeverlein aus 
Regensburg, Chemiker Gar eis aus Erlangen, Lehrer Prechtels- 
bauer, Kaufmann und Scherz er von hier. Der zahlreichen 
Glückwimschschreiben imd Telegranmie auswärtiger Mitarbeiter imd 
Freunde aus Bamberg, Creufsen, Freising, Kulmbach, München, 
Hemmingen, BerHn, Wien darf, um Wiederholimgen zu vermeiden, 
nur summarisch gedacht werden. 

Zum Schluls erübrigt noch dem Direktorium der Gesellschaft 
für gewährte finanzielle Unterstützung, dann der Redaktion des 
Generalanzeigers für unentgeltliche Bekanntgabe der Sitzungsabende 
den ergebensten Dank auszusprechen. 

A. Schwarz, W. Rudel, 

Obmann. Schriftführer. 

IX. Jahresbericht der ^^Geographischen Sektion'^ 

Die Anzahl der Mitglieder betrug am Anfang des Jahres 25 
vermehrte sich jedoch erfreulicherweise um 3 weitere Mitglieder, 
so dafs die Sektion am Ende des Jahres 28 Mitglieder zählte. 

Die Sitzungen fanden auch heuer wieder stets am dritten 
Montag im Monat statt, und zwar wurden acht Abende belegt, die 
teils diu'ch Vorträge, teils durch Berichterstattungen aus der Fach- 
litteratur ausgefüllt wurden, sowie im Oktober ein Vortragsabend in 
der Muttergesellschaft abgehalten. DigitizedbyGoOgle 



70 

Die Geschäfte der Sektion besorgten: 

als Obmann: Herr Postamtsdirektor A. Schmidt, 
als Schatzmeister: Herr Heinrich Enslin, 
als Schriftführer: Herr Th. Obermayer. 
In jeder Sitzung gab der Obmann ausführlichen Bericht über 
den oft sehr reichhaltigen Einlauf, des Weiteren fanden in denselben 
folgende Vorträge und Besprechimgen statt: 
21. Januar: Herr Schmidt: Über den Yang-tse-Kiang. 
25. März: » Dr. Heerwagen: Land und Leute in Tibet. 

15. April: » Schmidt: Khmatologie von Marokko, sowie 

Der Salzsee von Larnaka. 
Herr Knapp: Vorlage von Aquarellen aus dem Leben und 
Treiben auf Kuba. 
20. Mai: Herr Kunzmann: Vorlage einer umfangreichen Waflfen- 
sammlung aus Deutsch-Neu-Guinea. (Der gröfsere Teil hievon 
wird unter Eigentumsvorbehalt zur Aufstellimg in den Samm- 
lungen der Gesellschaft überlassen.) 
Herr Schmidt: Vorlage chinesissher Kleidungs- und Schmuck- 
gegenstände. 

17. Juni: Herr Enslin: Vortrag über »Die Philippinen und deren 

Bevölkerung«. 
Herr Schmidt: Der Stand der Arbeiten am Nil bei Assuan. 

16. Sept.: Besprechungen imd Vorschläge, die Jubiläumsfeierlich- 

keiten betreffend. 
16. Oktober (in der Mittwochsitzung der Muttergesellschaft) Herr 
Enslin: Vortrag über »Die Philippinen und deren Bewohner«. 

18. November: Herr Kunzmann: Vorlage und Besprechung einer 

grofsen Anzahl Photographieen aus Neu-Guinea. 
Hieran schlofs sich die Geschäftssitzung in der in die Vorstand- 
schaft fürs kommende Jahr die bisherigen Herren wiedergewählt wurden. 
Für die Gesellschaflsbücherei wurden aus Sektionsmitteln 
beschafft: 

Verhandlungen der Gesellschaft für Erdkimde, Berlin, 
Zeitschrift » » » » » 

Deutsch-Österr. Alpenvereinszeitung, 
Geographisches Jahrbuch XXIII. 
Als Schenkungen gingen der Bücherei zu : von Hm. Lambrecht: 
»Aus dem Reiche der Karpathen«, von Dr. Ad. Kohut, sowie 
»Califomien, Land imd Leute«, von Roh. von Schlagintweit ; von 
Herrn Obermayer: Mitteilungen des Deutsch-Österr. Alpen Vereins, 
Band 1900; von Herrn Hammerbacher: »Der Dutzendteich«. 



71 

Bei der am 27. Oktober stattgehabten Jubiläumsfeier der 
Mnttergesellschaft wirkten mehrere Mitglieder der Sektion im Aus- 
Schosse mit. Aus Sektionsmittebi wurde für die Gesellschaft als 
Geschenk das zweibändige Werk: Plofs-Bartels »Das Weib in der 
^atur- und Völkerkunde« angekauft. 
Nürnberg, Dezember 1901. 

Th. Obermayer, 
Schriftführer. 



X. Bericht aber die Thätigkeit der chemischen 

Sektion. 

Mit Jahresbeginn 1901 ging die I. Obmannschaft von Herrn 
Inspektor Schlegel auf Herrn Dr. Metzger über. Die Wahl der 
übrigen Mitglieder der Vorstandschaft fand in der Generalversamm- 
lung vom 8. Januar statt. Es wurden gewählt die Herren : 
Dr. Küspert, 11. Obmann, 
Direktor Rohn, Kassier, 
Assistent Metz, I. Schriftführer, 
Assitent Dr. Falk, ü. Schriftführer. 
Bei Beginn des Jahres zählte die Sektion 43 ordentliche und 
11 auTserordentliche Mitglieder, am Schlufs des Jahres 42 ordent- 
liche und 12 aufserordentUche. Am 19. Januar wurde das Stiftungs- 
fest im Künstlerzimmer des Restaurants »Krokodil« abgehalten und 
machten sich insbesondere die Herren Dr. Metzger, Dr. Straub 
und Dr. Raum durch verschiedene Vorträge und Aufführungen verdient, 
hl den 8 Sitzungen (im Vorjahre 8) wurden 19 Themata (im 
Vorjahre 14) behandelt. Es wurden gehalten 7 Vorträge (im V.-J. 8) 
und zwar 3 technologischen, 2 chemisch-, je 1 geologisch- imd 
physikalisch-wissenschaftlichen Inhalts, 8 Referate imd zwar 6 tech- 
nologischen (im V.-J. 4), 1 chemischen und 1 geologischen Inhalts. 
Endlich 2 Demonstrationen technischer Natur. Die Zahl der Redner 
betrug 11 (im V.-J. 11), die Zahl der Teilnehmer an den Sitzungen 
blieb die gleiche wie im Vorjahre 

142 MitgHeder (141 im V.-J.), 
86 Gäste ( 87 » » ). 
Die höchste Teilnehmerzahl war in der 4. Sitzung zu konsta- 
tieren mit 50 (im V.-J. 46), die niederste in der 1. Sitzung mit 13 
(im V.-J. 14) Mitghedem bezw. Gästen 

Vorträge, Referate und Demonstrationen verteilten sich auf die 
einzeben Sitzungsabende wie folgt: ^ i 

igi ize y g 



72 

8. Janaar: Dr. Oppler: Referate mit Demonstrationen über 
a) Thermophoren , b) Luxferprismen, Luxferscheiben, 
Elektroglas, c) ein explosivsicheres GefäTs. 
Inspektor Schlegel: Demonstration von Proben und 
und Gegenständen aus Silbronit. 
12. Februar: Dr. Kaul: Vortrag über die Specksteinbildung des 
Fichtelgcbirges. 
Dr. Oppler: Mitteilungen über Dimethylsulfat 
26. » Prof. Dr. Zwanziger: Vortrag über Aldehydsäuren. 
Inspektor Schlegel: Referat über Aeoregengas mit 

Experimenten. 
Dr. Kaul: Demonstration von Specksteinprodukten. 
26. März: Prof. Dr. Prior: Experimentalvortrag über Bier- 
färbemittel. 
22. Oktober: Dr. Guggenheimer: Vortrag über Radioactivität. 

Dr.. Metzger: Bericht über die Verhandlungen des 
Verbandstages selbständiger Chemiker zu Gera am 
30. September 1901. 
12. Novembr.: Weide mann: Experimentalvortrag über Aerogengas- 
beleuchtung. 
Inspektor Schlegel: Beschreibung eines Luftgasappa- 
rates. Referat über Trinkwasservereinigung durch Ozon. 
26. » Ingenieur Wolf: Vortrag über Neuerungen in Feuerungs- 
anlagen. 
Dr. Kaul: Referat über Kalksandsteinfabrikation. 
Dr. Stadlinger: Referat über die Genesis der Kohlen- 
säure. 
10. Dezember: Dr. Herzfeld: Vortrag über die geschichthche Ent- 
wicklung der Färberei und des Zeugdrucks. 

Der I. Schriftführer: 
August Metz. 



XI. Vierter Jahresbericht der zoologischen 
Sektion 1901. 

Die zoologische Sektion bestand im Berichtsjahre aus 18 Mit- 
gliedern. 

In 7 ordentlichen Sitzungen wurden folgende Referate, Demon- 
strationen und Vorträge erstattet: r^^^^T^ 

Digitized by V^OOQIC 



73 

I. am 18. Januar 1901. 

Herr Paalzow demonstrierte Foraminiferen aus dem Septarien- 
thon und besprach eine Abhandlung über die Gabelgeweihe bei 
Hirschen und eine weitere über die Tanzmäuse bei den Japanesen. 

Herr Dr. Heerwagen referierte über einen Artikel von 
Köhler über den Seidenschwanz. 

II. am 15. Februar 1901. 

Herr Paalzow demonstrierte Muscheln aus dem Coral Crag 
und dem Red Crag von England und berichtete über eine Arbeit 
von Wheeler über Anemotropismus und andere Tropismen bei 
Insekten, femer über einen Artikel von K ad ich über die zoologische 
Frage Nordamerikas. 

m. am 15. März 1901. 

Herr Paalzow demonstrierte Ammoniten mit anormaler Wohn- 
kammer und referierte über eine Abhandlung von Dr. Ernst Krause 
über Peripatiden. 

Herr Dr. Heei; wagen erstattete ein Referat über: »Efsbare 
Landschnecken. € 

IV. am 26. April 1901. 

Herr Paalzow demonstrierte Dreissena polymorpha und 
Congeria Brardy und verlas einen Aufsatz von Prowazek über 
> Ameisenbeobachtimgen. « 

V. am 21. Juni 1901. 
Herr Sebald zeigte abgeworfene Stangen von Rehböcken. 
Herr Paalzow demonstrierte Foraminiferen aus der oberen 
Kreide von Aachen. 

VI. am 15. November 1901. 

Herr Paalzow demonstrierte eine Anzahl zoologischer 
Präparate, als Grundlage für eine lokal-zoologische Sammlung. 

Herr Spandel berichtete über einen im Zoologischen Institute 
in Erlangen angestellten Fruktifikationsversuch zwischen Xerophila 
candidula und candicans, besprach das Vorkommen von Löfs im 
Gebiete des Rheines, der Elbe und der Donau, referierte über die 
Entwickelung der Elefantenzähne unter Vorlage eines Zahnes von 
Elephas antiquus und schilderte seinen Besuch des zoologischen 
Gartens von Hagenbeck. 

VII. am 20. Dezember 1901. 

Herr Paalzow demonstrierte Fossilien aus dem nord- 
französischen Cenoman imd referierte über eine Abhandlung von 
Dr. Schnee: .Ein Ausflug auf Ceylon.« op.ized by GoOgle 



74 

Herr Dr. Heerwagen referierte über den Jahrgang 1900 der 
omithologischen Monatsschrift. 

Zum Schlüsse sei der sehr verehrl. naturhistorischen Gesell- 
schaft für den bewilligten Zuschufs von 60 Mk., sowie Herrn Spandel 
für die unentgeltliche Aufnahme der Annoncen im General-Anzeiger 
an dieser Stelle der verbindHchste Dank ausgesprochen. 

Rieh. Paalzow, Hellmuth, 

Obmann. Schriftführer. 



Xn. Jahresbericht der technologischen Sektion. 

Die technologische Sektion zählte am Schlüsse des Berichts- 
jahres 33 Mitglieder und trat wie im Vorjahre stets am zweiten oder 
dritten Dienstag im Monat zusammen. Aufser einem Vortragsabend 
im Februar in der Muttergesellschaft wurden 7 Sitzimgen abgehalten. 
Die Geschäfte der Sektion besorgten : 

I. Obmann: Herr F. H. Huber, 
n. Obmann: » Gg. Rhau, 
Schriftführer: » Th. Obermayer, 
Kassier: > Walter Lessing. 

In jeder Sitzung berichtete der Schriftführer aus den abonnierten 
Zeitschriften und dem sonstigen litterarischen Einlauf. Umfassendere 
Vorträge und Berichterstattimgen fanden statt: 
8. Januar: Herr Obermayer: Das Lukaslicht. 
13. Februar: (in der Mutter gesellschaft) : Herr Rh au Vortrag: Alumi- 
nium und seine Gefahren. 
Herr Hub er Vortrag: Die neuesten Erzeugnisse der 
Elektrogravüre ; sowie Vorzeigung einer Reihe 
Lichtbilder aus der deutschen Marine. 
Hierauf längere Diskussion über Aluminium. 
19. März: Herr Obermayer: Fernheizwerke in Amerika. 

> Hu her: Telephonie ohne Draht mittels Bogen- 
lampe, sowie ein neues Baroscop. 
23. April: » Huber: Asbest, sowie Vorlage von 13 Tafeln 

Eisenbahnschienenproille. 
21. Mai: > Huber: Hydraulisches Hochdruckprefeverfehren. 

» Obermayer: Das Flugproblem. 
15. Oktober: » Huber: Unterseebote u. Unterwassemavigierung. 
19. Novbr.: > Huber: Haken und Nägel mit Scherfl&chen (mit 
Lichtbildern). ^ , 

Digitized by VjOOQ IC 



76 

19. Novbr.: Herr Obermayer: Benützung der Meereswellen als 

motorische Kraft. 
17. Dezbr. : » Wirt (als Gast): Nemstlampe. 
> Rhaa: Aerogengas. 

» Hub er: Formen der modernen Unterseebote. 
Hierauf fand die jährliche Geschäftssitzung statt, in der in die 
Voretandschaft die gleichen Herren gewählt wurden wie im Vorjahre. 
Die Sektion ist auf folgende acht Zeitschriften abonniert : 
Bayerisches Industrie- und Gewerbeblatt, München, 
Polytechnisches Centralblatt, Berlin, 
Kraft imd Licht, Düsseldorf, 
Journal des Inventeurs, Bruxelles, 
Technische Revue, München, 
Technisch-industrielle Rundschau, Nürnberg, 
Deutsche Techniker-Zeitung, Berlin, 
Zeitlexikon, Stuttgart. 
Anläfslich der Jubelfeier der Muttergesellschaft übergab die 
Sektion durch ihren Obmann als Festgabe das Werk »Lüger's Lexikon 
der gesamten Technik«. 

Nürnberg, Dezember 1901. 

Th. Obermayer, 
Schriftführer. 



Digitized by VjOOQ IC 



76 

Zugänge zur Bibliothek 

vom 1. Januar bis 81. Dezember 10O1. 



Periodica: 

— Archiv für Anthropologie 27. Band Heft I— III (von der 

Naturh. Gesellschaft angeschafft). 

— Zeitschrift f Ethnologie 32. Jahrg. 1900 Heft II, III, V, 

VI, 88. Jahrg. 1901 Heft I, II (von der Naturh. Ge- 
sellschaft angesch.). 

— Globus 79. u. 80. Bd. (von der Naturh. Gesellschaft an- 

geschafft). 
8270. -- Beiträges. Anthropologie u. Urgeschichte Bayerns 13. Bd.; 
14. Bd. Heft I, II (von der anthrop. Sektion angbsch.) 

— Centralblatt f Anthropologie, Ethnologie u. Urgeschichte 

in. Jahrg. HeftI, IF, IV; IV. -VI. Jahrg. 1899-1901. 
(von d. anthrop. Sektion angesch.) 

— Limesblatt Nr. 33 (von der anthrop. Sekt, angesch.). 

— Nachrichten über deutsche Altertums fun de 11. Jahrg. 1900 

Heft III; 12. Jahrg. 1901 HeftI, II. (von der anthrop. 
Sekt, angesch.) 

— Geographische Zeitschrift von Hettner VII. Jahrg. 1901 

(von der Naturh. Gesellsch. angesch.). 

— Petermanns Mitteilungen 47. Bd. 1901 (v. d. Natnrhist. 

Gesellsch. angesch.). 

— — Erg&nzungshefte Nr. 134-136 (v. d. Naturh. Gesellsch. 

angesch.). 
3257. - Geographisches Jahrbuch XXIII. Bd. 1900 2. HJÜfte XXIV. 

Bd. 1901 1. HÄlfte (v. d. geogr. Sektion angesch.) 
3260. — Deutsche Kolonialzeitung 18. Jahrg. 1901 (von d. geogr. 

Sektion angesch.). 

— ZeiUchrift d. Gesellschaft f Erdkunde su Berlin XXXV. 

Bd. Heft 5, 6; XXXVI Heft 1—3 (v. d. geogr. Sekt, 
angesch.) 

— Verhandlungen der Gesellschaft für Erdkunde eu Berlin 

XXVII. Bd. Heft 5-10; XXVIII. Bd. Heft 1-7 (v. 
der geogr. Sekt, angesch.). 

— Mitteilungen d. D. u. öster. Alpenver, 1901 Nr. 1—9; 

11—24. Jahrg. 1900 (Geschenk v. Hm. Obermeyer). 

— Prometheus Nr. 582—634. (von der Naturhist. Gesellsch. 

angesch.). 

— Naturwissenschaftliche Rundschau XVI. Jahrg. 1901 (von 

d. Natnrhist. Gesellsch. angesch.) 

— Biologisches Centralblatt XXI. Bd. 1901 (v. d. Naturhist 

Gesellsch. angesch.) ^ j 

Digitized by VjOOQ IC 



77 

Periodica: 

— Botanisches Centralblatt LXXXI. Bd. Nr. 1, 2, 4-10, 18, 

Titel ; LXXXII. Bd. ; LXXXIII. Bd. Nr. 1 - 8 ; LXXXI V. 
Bd. Nr. 4—11. (v. d. botan. Sekt, angesch.) 

— Deutsche botan. MonaUsch-ift XVIII. Jahrg. 1900 Heft 

9—12; XVIII. Jahrg. 1906 Hefte 1- 9, 12; XIX. Jahrg. 
1901 Heft 1, 2. (y. d. botan. Sekt, angesch.). 
S218. — Oesterr, botan. Zeitschrift L. Jahrg. 1900 Nr. 1—8, Titel 
a. Reg. (v. d. botan. Sekt, angesch.) 

— Allgemeine botan. Zeitschrift v. A. Kneucker 1900 Nr. 

1—6; 1901 Nr. 1-3. (v. d. botan. Sektion angesch.) 

— Der Zoologische Garten XLII. Jahrg. (v. d. zoolog. Sekt. 

angesch.) 

— 2^schrift f. anorgan. Chemie (von der ehem. Sektion 

angesch.). 
3314. — Bericht üLber die Witterungs- und Krankheitsverhältnisse 
Nürnbergs, Nov.— Dez. 1900; Jan.- Okt. 1901. (Ge- 
sehenk der meteorol. Station. 



4011. 



4007. 



4059. 



4043. Agassiz Louis, Der Schöpfnngsplan. Vorlesungen üb. d. natürl. 
Grundlagen d. Verwandtschaft u. d. Thieren. Übers, v. E. 
G. Giebel. Mit 60 Holzschn. Leipzig 1876. 8<>. XHn. 186S. 
^92. Anthropologische Notizen — , gelegentliche, ans Nordbayern: 
Pastor Grössel, z. Vorgeschichte d. Fr. Schweiz in d. Stein- 
u. Broncezeit. Frank. Kurier 1901 Nr. 478 S. 9. — Rari- 
täten^schangen „Sammler* 1901 Nr. 146 
^^- Apothekerverein, Festschrift z. 30. Hauptversammlg. d. Deutsch. 
— Hannover 1901. 8®. 90 S. 

Barteis Dr. Max, s. Ploss Dr. H. 

Batka Joh. B., Monographie der Gassien- Ghruppe Senna. Fest- 
abhandig. gew. d. F. d. lOOj. Jubil. d. Handlungshauses 
Wenzel Batka. Prag. 1866. kl. Fol. 62 S. mit einem Herbar 
von Senna-Blättern. 

Beck L. C, 8. Nürnberg, d. Dutzendteich. 

Berghaus Dr. Heinr., Vollst. Hand- Atlas d. n. Erdbeschreibg. 
u.a. Theile d. Erde in 82 Bl. hrsgbn. v. Dr. K. Sohr. 4. Aufl. 
Glogan n. Leipzig 1848. Querfolio. 

Bessel F. W., Popul. Vorlesungen üb. wissensch. Gegenstände. 
Nach d. Tode d. Verf. hrsgbn. v. H. C. Schumacher. Ham- 
burg 1848. 8®. IV u. 636 S. 

Bildertafeh, 13 Tafeln 4«. (Röteldruck) die 9 Seelen u. Personi- 
fikationen V. Tugenden u. Untugenden; 3 Tafeln 8^ „Moschus- 
beutel" ; 6 Tafeln Folio „Chinarinden". 



Digitized by VjOOQ IC 



78 

4016. Bischoff Prof. Theod., Da8 kgl. Realgymnasiiim za Nürnberg 

1864-1896. 8». 90 S. 
Boehmer L. dt Co., s. Japan. 
4005. Böhner K., Geschichtliches üb. d. Apotheke in Creufsen n. Be- 

rücksicht d. früh. MedizinaWhltn. z. Beginne des XX. Jahrh. 

gesch. Bayreuth 1901. S^. 38 S. 

4057. — , Verzeichnis d. gelegentl. kleinerer Ausflüge y. Crenssen be- 

obachteten Pflanzen. Manuskript 20 Seiten, Kanzleiformat 
4062. Buffon^ Oeuvres complätes de — , avec les Suppl^ents, augm. 
de la Classif. de G. Cuvier, et accomp. de 700 vignettes. 
Paris MDCCCXXXV. 8« Tome I 604 S.; T. II 480 S.; T. 
III 480 S.; T. IV 396 8., T. V. 388 8.: T. VI 430 S.; T. 

VII 422 S.; T. VUI 456 S.; T. IX 424 S. 
Bärkle Eich., s. Inaug.-Dissertat. a) 

4082. CancU^e Dr, E., Die Thalsperre. Trag, abenteuerl. Geschichte 
eines Insektenvöikchens. D. Französ. nacherzählt ▼. Prof. 
Dr. Wül. MarshaU. Leipzig 1901. ill. 8». 324 S. 

4046. Chinesische Aquarelle auf Reispapier 8^. ; aufgez. auf Carton in 4^. : 
ein Flufsboot; Gefangenenvorführung ; Gefangener mit der 
Halskrause, Greis, Dschunke, Schmetterlinge u. Heuschrecken. 

4039. Cohen E. S. Ali, Catalogue de la collection d'Ethnographie etc. 

etc. de M , dont la vente p. aura lieu 2 et 3 Jnillet 

1901. kl. 4^. m viel. Lichtdrucken u. 60 S. 

4002. Dieudonni Dr. A., Schutzimpfung u. Serumtherapie. Zusfass. 
Übers, üb. d. Immunitätslehre. 2. g. umg. Aufl. Leipzig 1900. 

VIII u. 192 S. 80. 

3883. ~, Sonder-Abdrücke: a. d. Ärztl. Praxis. 20 S. kl. 8*.; Über 
die Pest. (Münch. Med. Wochenschr. Nr. 42, 1900.) Ober 
d. Desinfektion m. Carboformal-Glühblocks 5 S. 8®. Immuni- 
tät u. Immunisierung. S. 197— 218 ( Würzb. Abb. a. d. G. d. 
pr. Med. I. Bd.) 8«. 
4029. Dorat Dr. Ch., Ober die Gewinnung d. Perubalsams. S.-A. a. 
N. Repert. f. Pharm. Bd. X. 8». 10 S. 
DunHnger O., s. Inaug.-Dissertat. b) 
Elliesen M., s. Inaug.-Dissertat. c) 

4058. Enslin Heinr., Material zu einem Vortrag u. d. Philippinen n. 

deren Bewohner. 2 Manuskripte. Auszüge a. Petermanns 
Mitt. (Bluraentritt) u. a. Bullet, d. Amer. Geo. Soc.Bd. XXXII ; 
1 Kartenskizze d. Phil. 1 : 3,000,000. 

4000. Erckert Eod. r., Wanderungen und Siedelungen der German. 
Stämme in Mittel- Europa v. d. ältest. Zeit b. a. Karl d. Gr. 
Auf 12 Kartenbl darg. Berlin 1901. gr. Fol. 

4090. Fleischmann Dr. Alb,, Die Descendenztheorie. Gemeinverständl. 
Vorlesungn. ü. d. Auf- u. Niedergang einer naturw. Hypo- 
these. . , , M. 124 Textabb. Leipzig 1901. 8« VI u.^ 274 S. 

Digitized by VjOOQIC 



79 

4026. FonteneUe M, Julia de^ Guide ponr les recherches et obser- 
Yations microscopiques; tradoit de la 7* ädit. anglaise de 
M. Gonld avec fig. et addit. Paris 1886. 8«. 62 8. 

4053. Ffiederici Og., Indianer o. Anglo-Amerikaner. ■ Ein geschichtl. 
Überbliek. Brannachweig 1900. kl. ^, 148 8. 

4042. Fürst Dr, X., D. chron. Nicotiniimns o. s. Verhütung. Bremen 
1900. 14 S. kl. 8«. 
G^eatme Ä. J, M^ 8. Inang.-DisBertat d) 

4076. Oeographentag, XIIL Deutsch* — in Breslau: 

a) Festschrift d. Geogr. Seminars d. Universit&t Breslau s. 
Begrüfsg. des — ; Breslaa 1901; 8<». 2 Karten, 8 Sk., 
Vorwort u. 286 S. 

b) FestgmTs d. Schi. Ges. f. ▼. Kultur. Beiträge i . Kenntn. 
d. Verbrtg. d. Gefifs-Pflanzen in Schlesien Ton Theod. 
Schübe. M. 4 Karten. 8^ 86 S. 

c) Katalog d. Ausstellg. 8^ IV, 52 u. 8 S. 

d) Prof. Dr. J. Partsch , Luftfahrten i. Dienste d. Wissen- 
schaft 80. 15 S. 

e) Breslau, Lage, Natur u. Entwickelg. Dargeb. t. Fest- 
ausschusse, m. 8^. 122 S. 

f) Plan der SUdt Breslau 1901. 
OieM E, O.^ 8. Agassiz Louis. 

4051. Olüch Dr. Hugo, Die Stipulargebilde d. Monokotyledonen. M. 
5 lith. D.-Taf. &-A. a. Verh. d. Naturh.-Med. Ver. z. Heidel- 
berg. VII. Bd. 1901. 96 S. 80. 

4048. — , Beiträge zur Erlanger Flora der Phanerogamen u. Gefilfs- 
kryptogamen. 1888-1892. 4®. Manuscript. Doppelseitig 
beschrieben, blau durchstrichen. Mit Briefen, Postkarten 
u. a. Beilagen. 

4091. (h>ethe R., Bericht d. k. Lehranstalt f. Wein-, Obst- u. Garten- 
bau zu Geisenheim a./Rh. 1901. S^. 150 S. 

4066. Ooldschmidt'Geisa M., Tabellen z. Bestimmg. d. Pteridophyten- 
Arten, -Bastarde u. -Formen Deutschlands, Österr. u. d. 
Schweiz, n. äuss. Merkmalen. Cassel 1901. 8^. 60 S. 
Oould s. FonteneUe M. Julia de — 

4(^2 a) Chrassmann Bob., Auszüge aus d . . . Moraltheologie d.h. Dr. 
Alph. M. de Liguori etc. 54. Aufl. Stettin 1900. 8®. 36 S. — 
b) Pri$ts Max Hersog zu Sachsen y Verteidigung d. Moral- 
Theologie d hl. Alph. Y. Liguori geg. die Angriffe Rob. 
Grassraanns 5. Aufl. Nürnberg 1900. 8®. 62 S. 

4065. Orimm Dr. Fr., Arztl. Beobachtgn. auf Yezo von 1887 1892. 
Ein Beitrag z. med. Geographie Ostasiens. Berlin 1900. 8®. 
ill. 107 S. 
Hagelius Dr. Art,, s. Stockholm, Nord. Museet 

4071. Heldreich Th. v., Catalogus Systematicas Herbarii J'heo. G. 

Digitized by VjOOQIC 



80 

Orphanidis Fase. I. Leguminosae Florentiae 1877. 

8». Vm u. 79 S. 

4072. Heldreich Th. «., 26 Sep.-Abdr. in deutscher, franz. o. griech. 
Sprache. 8». (4072 XII m. d. BUdnis d. Verf. s. a. Reber B.) 

3713. — , D. Flora d. Insel Thera, s. Gaertringen, Frh. Hillor, ▼. 
Hergt B, s. Weimar Thür. bot. Ver. 

4066. Hoemes M., Urgeschichte d. büd. Kunst in Europa v. d. An- 
fängen bis um 600 vor Chr. Mit 203 Abb. im Texte, 1 Farben- 
u. 35 D.-Taf. Wien 1898. gr. 8« XXII u. 709 S. 
Hortus EystetUnsis, s. Schwertschlager Dr. Jos. 

4040. Huene Dr. F. v., vorl. Bericht u. d. triassischen Dinosaurier 
d. europ. Continents. Mit 2 Taf. n. 6 Fig. Sep.-A. a. N. 
Jahrb. f. Min., Geol. u. Palaeon. 1901, II. S. 89-104. 

4081. Janson Dr. 0., Meeresforschung u. Meeresleben. Sammig. gem.- 
verst. DarstelL a. a. Oeb. d. W. 80. Bdchn. Mit 41 Fig. 
Leipzig 1901. 

4014. Japan. Blumen" u. Sämereien- Catalog von L, Boehmer A Co.y 
Yokohama: Wholesale Catalogue for 1900-1901. kl. 4^. 
41 S. m. V. Japan. lUustr.; Japanische Goniferen n. allen 
Synonymen u. Japan. Namen zusammengestellt. 

4088. Jordan Dr. Joh., Denkmal d. Freundschaft d. verewigten H. 
Job. Wolf . . . err. i. N. d. (Pegnesischen) Ordens. Nürn- 
berg 1824. 40. 18 S. 

4079. Inaug.-Dissertationen e. Dr. phii. Erlangen. 8*. 1901. a) Rieh, 
Bürkle, vgl. Unters, ü. d. innere Struktur d. Bl&tter u. a. 
Assimilationsorgane bei einig, austr. Podalyrien-Gattungen 
91 S. b) G. Dunzinger, Beiträge z. Kenntn.* d. Morphologie 
u. Anatomie d. Genera Hemionitis, Gymnogramme u. Fains- 
sonia. 78 S. c) M. Elliesen, Einflufs d. Yegetationszustan- 
des verschied. Hefen auf ihr Vermehrgs.- u. Gärvermögen. 
19 S. — d) A. J. M. Garjeanne, d. Strömg. d. Protoplasma 
in behäuteten Zellen. 61 S. — e) P. Kliem, Beitr. s. Wider- 
standsOihigk. ein. veget. Regenerationsorgane geg. Trocken- 
heit. 1900. 65 S. — f) L. Levy, Untersuchgn. ü. Blatt- und 
Achsenstructur d. Genisteen - Gattung Aspalathus. 58 S. — 
g) Fr. Rauth, Beitr. z. vgl. Anatomie einig. Genisteen-Gat- 
tungen. 58 S. — h) H. Schulze, Beiträge z. vgl. Anatomie 
d. Gattungen Lupinus u. Argyrolobium. 44 S. — i) H. V. 
Timmermann, Studien u. stomatare Transpiration. 43 S. 

4009. Keiler Ueinr., Panorama v. Rigi-Berg. J. J Scheuermann scnlp. 

Zürich 1815. 8». 

4010. — , Reise-Charte d. d. Schweiz. Zürich 1815. 
Kliem P., s. Inaug.-Dissertat. e). 

4063. Klunzinger Dr. C. Benj., Die Fische d. rothen Meeres. Eine 
kritische Revision in. Bestimmungstab. I.Teil. Acanthopteri 

Digitized by V^jOOQ . 



81 

▼eri Owen. Mit Unterst d. k. pt, Akad. d. Wisi. hertgbfi. 

Mit 18 Ml., E. T. color. Tafeln. Stnttfart 1884. Fol. IX 

u. 138 8. 
3699. KlmiBinger Dr. 0» Bar^'., Üb. d. physik., ehem. n. biol. Ursaehen 

d. Farbe q. Gew&sser. S.-A. a. Jahresb. d. V. f. t. Natark. 1901, 

Bd. 57; 3. 331—846. Stuttgart 
4006. JCmA Dr. Ludw., Agypt «. Abyssio. Aracfatüden, gesammelt 

Y. H. C. Jickeli. Nürnberg 1875. 4*. IV u. 96 S., 7 Taf. 
4087. --, Arachniden ans Sibirien n. Noraja Semlja, einges. ▼. der 

schwed. Expedition i. J. 1875. Mit 7 Taf. S.-A. a. K. S. 

Tetenskaps Akad. Handlingar B. 16 Nr. 5. Stockholm 1879. 

4». 136 S. 
4038. — , S.-A. S^: Arachnidenfanna Oaliziens. (XL!. Jahrb. d. k. k. 

Gelehrten-Oes. in Krakan.) 1870. 58 B. -^ Übersicht d. t. 

Dr. Finsch in Westsibirien ges. Arachniden. (Terhandlgn. 

d. xool.-bot Ges. in Wien. 1878.) 10 S. — Excnrsionen a. 

d. Balearen. Arachniden n. Myriapoden. 56 S. (dsbe. 1881.) 

— Beschreibgn. nener, ▼. H. Dr. Zimmermann b. Niesky 

entdeckter Arachniden. (Abbdlgn. d. Natnrf. Gesellsch. zn 

G5rlits. Bd.XYII.) S.41--71. — Kankasische Arachnoideen 

(„Isis** sn Dresden.) 36 8. -^ Arachniden. (2. deutsche Nord- 

poUrfahrt II. Bd. 8. 400--409 m. 1 Taf.) 
3998. Kohut Dr, Äd., Ans d. Belebe d. Karpathen. Ungar. Land- 
schafts-, Sitten-, Litt.- u. KuHvrbilder. Stuttgart 1887. VIll 

u. 288 8. kl. 8«. 
4008. K&rtß WÜh,, Ahes u. Neues Aber Wttlsburg. Mit lith. Plan 

u. Abbildgn. Ansbach 1869. 8*. IV u. 116 S. 
4067. Kreü im., Otto, Altrönrische Heiaungen. Mit 89 Textfig. u. 

1 Tab. Mflnehen u. Berlin 1901. 80. VI u. 117 S. 
4070. Kmffkr Karl, D. AltmAhlalp, d. h. d. AltmUhlthal m. d. Flufs- 

geWete innerhalb s. Berglandes, topogr., histor. u. landsch. 

dargeet. Mit Zeichngn. t. G. Schr5pler. Ingolstadt 1868. 

8>. 22$ S. 
4012. LmdsehitflsMderf 8 Serien ; 18 Radiergn. kl. 8*. aus Vojage 

pittor. de Naplee et Sicile; 8 Radiergn. n. Kreidezeichngn. 

kl. 8*. C5hi n. Heidelberg; 10 Ansidit«n Ton Heidelberg 

Stahlstich 12« 
Lepff L., f. Iii*ug.-I>issertat. f) 
4028. Lmdmt Dr. Ohut., Hilfsbuch f. d. Sadimeltt parasit. Pilze m. 

Berieksicht d. Nahrpilanzen u. ei. Anhang ft. d. Thier- 

parasiten. Berlin 1901. kl. ^. VI u. 90 S. 
40S6. L0Me Joh., Bayern, Württemberg u. Baden nebst betr&chtl. 

Tkeilen d. angrenzenden Staaten u. d. Leitg. d. k. bayer. u. 

färstl. Tum A Taxis. Central -Poststellen, bearb. v. Wilh. 

Mayr. 1869. (Spesialkarte v. SAdweetdeulschland) aufgez. in 4®. 

Digitized by LnOOQlC 



82 

4066. Lübeck, Das Museum zu . . . Festschrift z. ErinneruDg an d. 
lOOj&hr. Bestehen d. Sammlgn. d. Ges. z. Befördg. gemein- 
nütziger Thätigkeit. 1800-1900. 8*. 278 S. 

3484. Ludwig Prof. Dr. F., Sonder-Abdr. : aus d. botan. Centralbl. 
Nr. 10 bis 16; a. d. 39. bis 42. Jahresber. d. Ges. y. Fr. 
d. N. in Gera Nr. 17; a. d. D. B. M. Nr. 18; a. d. Boten. 
Jaarboek Gent 1899 Nr. 19; a. d. Illustr. Zeitschr. f. Ento- 
mologie Nr. 20 u. 21. 

4061. Lueger Otto, Lexikon d. gesamten Technik u. i. Hilfswissen- 
schaften. Im Verein m. Fachgen. hrsgn. Mit zahlr. Abb. 
Stuttgart u. Leipzig, gr. 8». Bd. I bis V je 800 S.; Bd. VI 
960 S.; Bd. VII 1032 S. 

4030. ManwihripU. 

Marthaü Dr. Wül, s. Gand^ze, Dr. E. 

4069. Martius Dr. C F. P. de, Nova Genera et Spedes Plante- 
quas in itinere per Brasiliam Annis MDCCCXVII -MDCCX 

colleg et descrips. Monachii. Folio. Vol. I 

II u. 158 S., 100 Taf.; Vol. II 1826 148 8., Taf. 101 - 
Vol. III 1829 198 8., Taf. 201-300. 
Max Prins Hersog zu Sachsen, s. Grassmann, Bob. 

4083. Mendel Oreg., Versuche ü. Pfianzenhybriden. 2 Abhai 
(1865 u. 1869.) Oswald's Klassiker d. exakt. Wiss. Ni 
S^. Leipzig 1901. 62 S. 

4101. Meyers KoniüersaHons- Lexikon, 5. g&nzl. neu bearb. Aufl. 
15. Bd. 1895; 1.-3. 8.— 10. 13. Bd. 1896; 11. 12. 
17. Bd. 1897; 18. Ergänzungsband u. Reg. 1898; 19. Bd.. 
Supplement 1898/1899. 

3656. MMer Sophus, Nord. Altertumskunde. II. Bd., Liefer 
(Schlufs.) Mit 189 Abb. u. 2 Taf. 324 S. 

4077. Naturforscherversammlung. (73.) Hamburg 1901 : Über d. 
Lage des Biol. Unterrichts an höh. Schulen. Jena 
43 S. M. ein. Aufruf an d. naturw. Vereine Den- 

4069. Neupert Karl, Mechanik d. Himmels u. d. Molekülf 
eines Weltsystems a. d. Äther m. Beweis d. Unri« 
Kopemikan. Anschauungen Mit 1 Taf. Bamber 

3704. Nürnberg, Anthrop. Sektion d. Naturhist. Ges., Fun« 
(je 2 Exempl.) — Justin Wunder, Nr. 9: Beric 
Ausgrabg. d. Hügels I in Beckersloh ; mit Grund 
Zeichnung. — Nr. 11: Ausgrabung 2er Triebt i 

Lind; desgl. ei. ausgeftlllten Grube ; mit GrundrisF * : 

Weidenschlag. Aug. 1901. 3 S. 1 Plan; Nr. * b. 

Leinburg. Sept 1901. 17 S. 1 Plan. — Ludwig V\w ;r, 
Nr. 8a : Bericht üb. d. Ausgrabg. d. Hügels II in Beckersloh; 
m. 2 Tafeln Fundzeichnungen u. Grundrifs. — Nr. 10 : Grab- 
hügel i. WaldteU Stöcklach b. Rückersdorf; m. Fundzeich- 

Digitized by LjOOQIC 



83 

nongen u. Grandrifs. — N^. 12 : Bericht Ob. d. Abgrabong d. 

Grabh&gelsYIllb Labernicht; m.Gnindrir8U.Sitiiation8plan. 

4056. Nümherg, Anthrop. Sektion d. Natnrhist. Gesell., Photograph. 

Mappe: 4 Aufnahmen neolith. Gr&ber. 
4022. — , Das städt. Elektrizit&tsweit -. Von Direkt Ph. Scholtes. 

Jan. 1899. ill. quer 4«. 40 S. 
4018. — , Der Dutzendteich in Natur-, Orts- u. Industri^eschichtUcher 
Beziehung. Nach e. t. L. C. Beck u. Ben&tzg. v. Quellen 
d. Firma Spaeth bearb. Studie. Nürnberg 1898. Folio. — 
Hierzu 3 Photographien 4*. a) Das Dutzendteicher Weiher- 
fischen 1897; b) der gr. DutzendteicE, aufgen. 1894; c) altes 
Herrenhaus des Dutzendteicher Mühl- u. Hammerwerkes. 
4015. — , Büdd Gg-y Verkehrs-AnUge von Ntümberg. Karte. 
W)6. — , Glauning Dr. Fr., Prinzregent Luitpold y. Bayern. (Der 
Stadtmagistrat d. Schülern.) 8*. 40 S. 
45. — , Eckert Herrn., 5 Copien Ton 4 photograph. Aufnahmen, Teil- 
nehmer des Ausfluges der Naturh. Gesellsch. am 19. Mai 
1901 nach Ostemoh. 
— , Naturhiator. GeseUschaß, Sftcular-Feier 1801—1901. Fest- 
schrift den Gönnern, Freunden u. Mitgliedern d. Gesellsch. 
als Festgabe dargebr. am 27. Okt. 1901. gr. 8<>. XLIX u. 
\ 280 S. 32 Taf. 

\ — , -— , Prefsberichte z. Jubiläum: Fr. Kurier Nr. 551, Stadtztg. 
Nr. 263, Nordb. Ztg. Nr. 263, Nümb. Anz. Nr. 299, Strafs- 
burger Post Nr. 1020. 
"-, Sehiütheiss Fr., Ph&nol. Mitteilungen der Sommerperiode 
' 1900. (Gen.-Anz.) 
, Yemeuerte Feuer-Ordnung .... 1770. kl. 8^. 71 S. 
^ feU Dr. Felix v., Studien ü. d. alt&gypt. Parasitologie. I. Tl. 

8«. S.-A. a. Extrait d. Arch. de Parasitologie. IV. 1901. S. 
481—530. 
S. '.-A. a. d. Z. f. di&t. u. phys. Ther., diät. Handbuch der 

ibliothek Sardanapals. 4^ 2 S. 
40. 7>r. Joh^ Cursus d. norm. Histologie z. EinfÜhrg. i. d. 

>r. d. Mikroskopes, sowie i. d. pract. Studium d. Gewebe- 
e. 3. Term. Aufl. Mit 108 Holzschn. Berlin 1884. 8^ 
1. 340 S. 

Vrof. Dr. /., s. Geographentag 4076 d) 
4033. Or. m. vet. Frz., Untersuchungen üb. Bacillol. S.-A. 

h. f. pr. Thierheilk. XII. Bd. Stuttg. 1901. 31 S. 8<>. 
4085. fli., Leibniz i. s. Bez. z. Chemie u. d. a. Naturwiss. 

ö.-A. a. d. Chemiker-Ztg. 1901. 25, Nr. 81. 8«. 14 S. 
4087. JPfeuferDr. K., Z. Schutze w. d. Cholera. Heidelberg 1849. 8<>. 23 S. 
40(^. Plo88 Dr. H.J Das Weib in d. Natur- u. Völkerkunde. Anthro- 
polog. Studien. 6. umg. u. st. verm. Aufl. Hrsgbn. t. Dr. 

Digitizedby (google 



84 

Max Bartels. Leipzig 1899. 8^. I. Bd. IL Bd. Mit 11 lith. 
Tafeln u. 689 Abb. YIU u. 764 S. 
Bauth Fr.j 8. Inaog.-Dlesertat g) 

4073. Reber B., Th. H. Herrn, v. Heldreich. S.^A. a. Gallerie henrorr. 
Therapentiker a. Pharmakognosten d. Gegenwart. Genf 1896. 
gr. 8« 2 S. m. Port 

8709. Beinecke Dr. P., Germanengr&ber der r(Mn. Kaiserzeit 8.-A. 
a. d. Corr. BL d. D. anthr. Ges. 1901 Nr. 5. Nr. 8 neue 
Materialien aus Bayern i. Maseom f. Völkerkunde zu Berlin. 
— , Grabftmde d. fr. Bronzezeit a. Rheinhetten. S.-Abdr. a. d. 
Korrespondenzbl. d. Westd. Zeit. f. Geach. n. Kunst XIX. 
Jahrg. 1900. 

4094. BhönclMb, Festschrift z. 25j&hr. Jubil&iuu des — , am 10., 11. 
u. 12. Aug. 1901. Fulda ^. 206 S. 

4001. Bieder Jos., Elektrograrüre. 14 8. 4^. S.-A. a. d. Elektrot- 
ehem. Z. Heft 1, 1900. 

4026. Boyle J. F., Ein Versuch ft. d. Altertum d. indisch. Medicin n. eL 

Einleitgs.-Yorlesg. z. ei. Corsus d. Materia med. u. Therapie 

im King's College. Übers, y. Dr. J. Wallach, m. Einltg. u 

Zusätzen ▼. Dr. C. F. Hensinger. Gasael 1889. 8^. XY u. 200 >. 

Büda Gff., s. Nürnberg. 

4017. Bütimeyer L, (Basel, Naturf. Ges.) Gesammelte Kleine Sehr ten 
allgem. Inhalts a. d. Geb. d. Natorw. Nebst ei. autol iogr. 
Skizze. Hrsgegbn. y. H. G. Stehlin. Basel 1898. 8®. l»d. I: 
Autobiogr., Zool. Schriften. IV u. 400 S.; Bd. II: Geo- 
graphische Schriften, Neerologe, Verz. d. Publik. 466 -8. 

3997. ScheUns Herrn., Pharmacognost Karte f. d. Arzneibfichc r Eu- 
ropas u. d. Vereinigt Staaten y. Amerika. 2. Aufl. 1899. 
1 : 46 MUlion. Wandkarte. 

8999. SchlagintweU Bob. t?., Galifomien. Land u. Leute. Mit Illust 
Cöln u. Leipzig 1871. XVI u. 382 S. kL 8. 
8cholte$ Phil., s. Nfkmberg, Elektrizitätswerk. 

4024. Schott ÄHhur, Handbuch d. Botanik. Hrsgbn. y. d. Ges. z. 
Verbrtg. ofltzl. Kenntnisse. Aus d« Engl. Mit yielen Abb. 
Stuttgart 1849. 12<'. 888 S. 
Schmbe TheotL, s. Geographentag XUI. D. b) 
Schulee H., s. Inaug.-Dissertat h) 

4021. Schwarz A., Nachtrag zu Wagensohn u. Meindl« Blort d. Amts- 
bezirkes Mitterfels. S.-A. a. d. 8. Bericht d. botan. Vereins 
Landhut. 11 S. 8». 

4004. Schwertschlaffer Dr. Joe., Der botan. Garten der FOrstbischSls 
y. EichsUtt. Mit 2 Tabellen u. 2 Taf. Biehstitt 1890. 8*. 
Vm u. 112 S. 

4044. Sein Dr. Armin, Das Regnitzthal (yon Fürth bis Bamberg). 
Erlangen 1901. 8P. VI u. 182 S. 

Digitized by VjOOQ IC 



85 

Sohr Dr. K., s. Berghaus Dr. Heinr. 
Stehlin H. G , b. Rütimeyer L. 
4047. SUergefecht.CorriddideToTOs.em Heftch. 12^. m. 12 Farbendrucken. 

4018. Stockholm Nordiska Mttseet^ 1) Dr. Artur Hazelius: Guide au 

Mus^e du Nord; trad. p. Kramer ; Stockholm 1889. S^. 66 S. — 
2) C. E. Dahlman, Earta öfver Skansen Bredablick Lejon- 
slätten och Framnäs i Kongl. Djurgärden. 2. Aufl. 1897. 
1 : 2000. — 3) L. Passarge, Das Nord. Museum u. Skansen. 
1897. kl. S^. 16 S. - 4) Wilh. Koenig, e. eigenart. Museum 
f. Natur- u. Völkerkunde. 1898. kl. 8». — 5) Vinterbilder 
fran Skansen, 50 Bildertafeln quer 49. 
Timmermann H. F., s. Inaug.-Dissert. i) 

4049. Volkskunde^ nordbayer. — , Der Flurumritt von Pfofeld, S. 7 

der Nr. 83 des „Sammler" 1901. 

4020. Wagner Prof. Dr. Friedr., Bericht über d. I. b. Gersten- u. 
Hopfenausstellung in Verbindg. m. einer brautech. Spezial- 
Ausstellg. zu München v. 29. Sept. bis einschl. 3. Okt. 1900. 
8« 106 S. 

4060. — , Lehrbuch f. d. naturwiss. u. landw. Unterricht an d. bayr. 
landw. Winterschulen .... Hrsgbn. v. Verb. bayr. Land- 
wirtschaftslehrer. Mit 214 Abbildgn. Stuttgart 1902. XVI 
u. 536 S. 8«. 
Wallach Dr. J., s. Royle J. F. 

3692. Weber Fr., Bericht ü. n. vorg. Funde in Bayern. S.-A. a. Beitr. 
z. Antbrop. u. Urg. Bayerns. 

4041. Weimar, Thüring. botan. Verein, Beilage: B. Hergt, Zweck u. 
Ziele d. Pflanzenschutzes. S.-A. a. Thür. Monatsbl. 

4019. Weismann Dr Aitg., Studien z. Descedenz-Theorie. I. Über 

d. Saison - Dimorphismus d. Schmetterlinge. Mit 2 Farben- 
druckt. Leipzig 1876. 8<>. IV u. 96 S. 

4050. Weiss Dr. J. R, Kurzgef. Lehrbuch d. Krankhtn. u. Beschä- 

digungen u. Kulturgewächse Mit 134 Abb. Stuttgart 

1901. 80. VII u. 180 S. 
4034. Wettstein Dr. Rieh, v., Handbuch d. Systemat. Botanik. I. Bd. 

Mit 762 Fig. in 128 Abb. Leipzig u. Wien 1901. 8». IV u. 202 S. 
4089. Will Dr., Reisebilder a. Borneo. S.-A. a. Weltpanorama. S. 

561 - 573. 8» 
Wunder Justin, s. Nürnberg, antbrop. Sektion. * 
Wunder Ludwig, s. Nürnberg, antbrop. Sektion. 
4078. Zander Enoch, Beiträge z. Morphologie d. männl. Geschlechts- 
anhänge d. Trichopteren. Mit 1 Taf. u. 21 Fig. S.-A. a. 

Z. f. w. Zool. LXX. 2. 1901. 8». S. 192-235. 
4092. ZüiHch, Geogr.-Ethnogr. Gesell., Festschrift. (Versig. d. schwz. 

Geogr. Ges.) 1901. 8«. nebst Jahresber. 1900/1901. 208 S. 

"~ Digitized by VjOOQ IC 



Digitized by VjOOQ IC 



■% '' 



Jahresbericht 



der 



NaturUstorischen Gesellschaft 



zu 



NürnlDerg^ 



für 



1902. 



->->#4^<- 



Nürnberg. 

Druck von U. E. Sebald. 

1903. 



Digitized by LjQQQ 1^ t 



Digitized by VjOOQ IC 



Jahresbericht 

der 

Naturhistorischen Gesellschaft 

für das Jahr 1902. 



Jbrfreulicherweisehat unsere Gesellschaft auch im abgelaufenen 
Jahre an Mitgliederzahl zugenommen, indem die Zahl der ordent- 
lichen Mitglieder von 385 zu Beginn des Jahres auf 403 am Schlufs 
stieg, und zwar teilen sich diese in 371 hiesige und 32 auswärtige. 
Aufserordentliche Mitglieder waren es 27 gegen 24 im Vorjahre. Zu 
korrespondierenden Mitghedern wurden zwei Herren ernannt, nämlich 
Herr Dr. Engel, Pfarrer in Klein-Eislingen , Württemberg und Herr 
Dr. Felix Freiherr von Oefele in Neuenahr. 

Leider haben wir auch heuer Verluste durch den Tod zu 
beklagen. Es verstarben unsew^ Ehrenmitglieder, Herr Universitäts- 
professor Dr. Selenka in München und Herr Geheimrat Professor 
Dr. Virchow in Berlin, ferner unsere korrespondierende Mitglieder, 
Herr Dr. Held reich, Direktor des botanischen Gartens in Athen und 
Herr Kaufmann Friedrich Weigel in Ansbach. Aus der Reihe der 
übrigen Mitglieder rief der Tod ab: 

Herrn Max Brust, Kaufmann und Kommerzienrat, Nürnberg, 

> C. Conrad ty, Fabrikbesitzer, Röthenbach, 

» Georg Munker, k. Professor a. D., Nürnberg, 

> Konrad Preifs, Mechaniker, » 
» Robert Stich, Buchdruckereibesitzer, » 

Den Dahingeschiedenen wird die Gesellschaft ein jederzeit 
treues Gedenken bewahren. 

Die Tätigkeit in den Mittwochssitzungen war sehr rege, indem 
an 50 Abenden 39 Vorträge, viele mit Experimenten und Demon- 
strationen, abgehalten wurden. Über diese und die nicht unbeträcht- 
liche Anzahl von Referenten und Mitteilungen geben ^die yi^*(§'(5Öölc 



folgenden Protokollauszüge Rechenschaft. Der Besuch der Sitzungen 
kann als ein erfreulicher bezeichnet werden. 

Auch in den 6 Sektionen, über deren Wirksamkeit Spezial- 
berichte folgen, liefs sich kräftig pulsierendes Leben konstatieren, 
das auf die allgemeinen Sitzungen sehr günstig einwirkte und manchen 
Vortrag und viele Referate zeitigte. 

Besonders verdient an dieser Stelle hervorgehoben zu werden, 
dafs die grofse Arbeit des Herrn Stabsveterinär Schwarz über die 
Flora von Nürnberg und Umgebung, welche 10 Jahre in 
Anspruch genommen halte, im abgelaufenen Jahr ihren Abschlufs fand. 

Wie alljährHch, so fanden auch diesmal gut besuchte Gesell- 
schaftsausflüge in die nächste Umgegend statt, wobei in gewohnter 
bewährter Weise Herr Stabsveterinär Schwarz Leitung und Belehrung 
übernommen hatte. 

Der Besuch unserer Sammlungen war infolge günstigerer Auf- 
stellung und Vermehrung durch die Spenden zum Jubiläum bedeutend 
gesteigert seitens des Gesamtpublikums sowohl wie namentlich auch 
von Seite der Schulen. Infolge dessen und wegen Unterbringung 
der Sammlungen in verschiedenen Stockwerken des Gesellsehafts- 
hauses mufste eine weitere Aufsichtsperson beigezogen werden. 

Die im verflossenen Jahre den Sammlungen, wie auch der 
Bibliothek, in grofser Zahl zugewendeten, z. T. wertvollen Geschenke, 
werden im Schenkungs- und BibHotheksbericht besonders aufgezählt 
werden. Hier obliegt dem Berichte^rstatter die angenehme Pflicht, 
namens der Gesellschaft wärmsten ^ank zum Ausdruck zu bringen. 

Besonderen Dank schuldet diese dem Hohen Staatsministerium, 
der kgl. Kreisregierung und den Hochverehrlichen städtischen Kollegien 
für die abermalige Unterstützung durch namhafte Beiträge. 

Schliefshch sei noch den Redaktionen des »Generalanzeigers« 
und des »Frank. Kurier«, welche Auszüge aus den Protokollen über 
die Mittwochs- und Sektionssitzungen in entgegenkommender W^eise 
unentgeltlich veröffenthchten, verbindHchster Dank abgestattet. 

Sehr zu bedauern ist, dafs Herr Professor Dr. Heerwagen, 
der mehrere Jahre lang die Geschäfte des Direktors mit dem besten 
Erfolg besorgte, sich gezwungen sah, gegen Ende dieses Jahres von 
diesem Posten zurückzutreten. Die Stelle des ersten Sekretärs war 
durch Wegzug des Herrn Pfarrer Rudel bereits früher in Erledigung 
gekommen. Beiden Herren gebührt für ihre Mühewaltung bei Be- 
sorgung der Vorstandsgeschäfte der innigste Dank der Gesellschaft. 

Professor Dr. Zwanzigejr. 

Digitized by IV^ 



Verzeichnis der in den Sitzungen dee Jahree 1902 gehaitenen 
Vorträge, Referate und Demonetrationen. 

1. Sitzung am 8. Januar: 

Herr Schwarz, Demonstration eines Fischadlers, Geschenk des 
Herrn Kommerzienrat Sachs, Vorlage von Corvus cornix, 
Zuwendung des Herrn Rogg; 

> Paalzow, Demonstration fossiler Schnecken und Muscheln aus 

dem Mainzer Becken, Geschenk des Herrn Prof. Kinkelin; 
» Dr. Heerwagen, Vorlage von Trilobiten- Abdrücken, Geschenk 

des Herrn Prof. Biehringer; 
* Ortmann, Demonstration und Schenkung von Schlinggewächsen 

(Medeola asparagodes L.); 

> Kuhlken, Schenkung einer King snake und Demonstration 

eines Leguan. 

2. Sitzung am 15. Januar: 

Herr Fr. H u b e r, Vortrag über Unterseebootswesen mit Demonstration ; 

> Marker t, Vorzeigung lebender Tiere: fliegende Hunde, Ich- 

neumon, Zebramanguste, Mohrenmaki; 

> Paalzow, Vorlage von Amaltheus costatus var. spinatus von 

Altdorf. 

3. Sitzung am 22. Januar: 

Herr Krapfenbauer, Schenkung zahlreicher Conchylien; 

> Kunzmann, Referat über £ingeborenenbehandlung in unseren 

Kolonien ; 

> Ortmann, über Blütenbildung bei Dahlien. 

4. Sitzung am 29. Januar: 

Im Anschlufs an die Generalversammlung: Mitgliederaufnahme. 
6. Sitzung am 5. Februar: 
Herr Seel, Vortrag über Aberglaube