(navigation image)
Home American Libraries | Canadian Libraries | Universal Library | Community Texts | Project Gutenberg | Biodiversity Heritage Library | Children's Library | Additional Collections
Search: Advanced Search
Anonymous User (login or join us)
Upload
See other formats

Full text of "Ortus sanitatis"

REOEIVED ?:']TL'MBER 




t/fo/tm/KJ/v/ ///>/// ////■ /////>////■ /////////// 
/ireje////// /y ///j ///e/i^/i 
4 //"' 
60 //>■ CP/' *.*C£>. 

sO^/Os WM/W//'/ /■" "■ 

<^/Ce?t>rip ^ysr/ys // / r vy///i<z>?1'. 

/S'6X-/M3. 

SZassn//j <•/?///* ///e/Y/e/t.enr 



1 



Fif teenth - Century Books 

(Continued from the June 1936 issue) 

STRASSBURG 

JOHANN PRUSS 

HORTUS SANITATIS. c. 1499. 

Hain ^8943. 

Printed with gothic type in folio form, have smaller margins and probably come 

in two columns, 55 lines to a column. from another copy. The title-page con- 

It has 360 leaves; the size of a leaf is tains the signature of a former owner: 

313 X 210 mm., while the text in a col- "Jaross Ponanski," in late i8th-century 

umn measures 227 X 67 mm. The last handwriting. There are numerous old 

eighteen leaves, containing the Registers, manuscript notes on the margins. 

THE Hortus Sanitatis or Ortus Sanitatis (Garden of Health) is perhaps the 
most comprehensive work on natural history produced in the Middle 
Ages. It contains all the knowledge then available on plants, beasts, fishes, 
birds, and minerals, together with their curative uses. In fact, the Hortus 
Sanitatis is first of all a medical work, and only secondarily a book on natural 
history. "A popular medicine book it might be called," Dr. Arnold Klebs 
writes, "but by 110 means in the sense we attach nowadays to this sort of liter- 
ature, for it served undoubtedly also in the technical education of the time." 
And this distinguished historian of medical science further reminds us that the 
entire structure of modern science rests on such humble beginnings. Indeed, 
the Latin language as well as the compressed style with its many references 
to ancient writers show that the work was intended much more for the phy- 
sician than for the layman. 

With woodcuts on almost every page, and printed in a handsome folio 
form, the Hortus Sanitatis is, besides, a very impressive book. The first half of 
the volume treats entirely of plants ; but even here genre-pictures and all sorts 
of fabulous designs enliven the illustrative material. Especially the woodcuts 
representing the animal kingdom of land, air, and sea display an immense 
variety. There is a distinct effort at fidelity in all these drawings; not only 
the animals but also the plants are clearly recognizable. Yet the pictures are 
quaint. They are the work of a medieval, late-gothic artist — or rather artists 
— without the slightest influence of the Renaissance. 

In all fifteenth-century editions, the title is given as Ortus; but unques- 
tionably "garden" and not "origin" or "source" is meant by the word. It has 
been suggested that the work became known as Ortus because of the circum- 
stance that in medieval manuscripts the space for the first letter was often 
left blank for the illuminator; on the other hand, we find that in many of the 
manuscripts as well as in the early printed editions the letter O is usually 
printed in a decqratiye manner. The contemporary French translation also 
calls the book Arbolayne, the equivalent of Hortus. The volume recently acquired 
by this Library is the fourth edition of the work. The original edition was 
printed at Mainz in 1491 by Jacob Meydenbach; then Johann Pruss issued 
three undated editions at Strassburg, probably in the years 1496, 1497, and 

329 



330 MORE BOOKS: A BULLETIN 

1499. The copy recently acquired by the Boston Public Library is of the third 
Strassburg edition. 

Three great varieties of herbals were printed in the latter part of the 
fifteenth century. The first, in Latin, was the Herbarius, the earliest dated editiom 
of which was produced in 1484 by Peter Schoeffer at Mainz; the second, in 
German, was the Gart der Gesundheit, also printed by Peter Schoeffer at Mainz 
in 1485 ; and the third was the Hortus Sanitatis in Latin, first published, as noted 
above, in 1491 by Jacob Meydenbach at Mainz. The Herbarius influenced the 
Gart der Gesundheit, and both influenced the Hortus Sanitatis; nevertheless, all 
three are separate works. There has been, it is true, a considerable amount of 
confusion in the bibliography of these herbals. The Gart der Gesundheit and 
the Hortus Sanitatis especially were often mistaken for each other. Dr. Ludwig 
Choulant's otherwise excellent study of the subject, published in 1857, calls 
the German work "the smaller" and the Latin work "the larger" Hortus. Un- 
f ortunately, the difference in size between the two is slight. Joseph Frank Payne, 
in his essay published in 1901, largely follows Choulanfs classification, and, if 
anything, adds to the confusion by using titles like German Hortus Saniiatis, 
smaller Hortus and Herbarius zu Teutsch almost interchangeably. Dr. Klebs has 
dcne a real service to the lore of incunabula by clearing up the matter in his 
list, which first appeared in 1917. His nomenclature has been adopted in the 
present article. 

The Hortus Sanitatis, as represented by the volume in the Library, con- 
sists of six parts. The first is a "Tractatus de herbis" (on plants) in 530 chapters; 
the second is a "Tractatus de animalibus" (on beasts) in 164 chapters; the 
third is a "Tractatus de avibus" (on birds) in 122 chapters; the fourth is a 
"Tractatus de piscibus" (on fishes) in 106 chapters; the fifth is a "Tractatus 
de lapidibus" (on minerals) in 144 chapters; and finally the sixth is a "Tracta- 
tus de urinis." There is also a Preface and a General Register. 

The author of the Hortus Sanitatis is unknown. To be sure, the Preface 
contains an intimation of his identity; but it is difficult to know just how much 
credence may be given to the statement. Both the Gart der Gesundheit and the 
Hortus Sanitatis have substantially the same Preface. That of the latter was 
supposedly written by the physician-author himself, who records that — be- 
sides his sympathy for the poor who cannot pay for the doctor and apothecary 
— he undertook the work at the persuasion of a certain nobleman, "nobilis 
dominus," who made a journey to the Holy Land, studying on his way all 
such native plants, animals, and minerals as were used for medical purposes. 
The nobleman described his own observations and also procured pictures of 
each object. The writer of the Preface, on the other hand, compiled the rest of 
the book from the works of Avicenna, Hippocrates, Galen, Serapion, Pliny, 
Dioscorides, Vincentius, and others. In the Preface to the Gart der Gesundheit 
the supposititious nobleman speaks in his own person, relating that he under- 
took his travel to the Holy Land in the company of a painter, himself making 
studies and descriptions, while the rest of the book was compiled by a physician. 

Who was this physician, and who was the traveling nobleman? For a 
long time Johann de Cube (Johannes de Cuba, or Johann Wonnecke of Caub) 
was regarded as the author, for his name is mentioned in a suggestive manner 
at the end of Chapter 76 of the Gart der Gesundheit, although it is entirely absent 
f rom the Hortus Sanitatis. After a description of the "bolus armenus" included 



BtiftxW 




Cflptmtom.rrtHi. 

^TVJfcacea greccarabiccfMltacb uuefu* 
•1 fltccbvclfiftacfj.tarincftrtica.Sera .lu 
*^ ag.c.piftocb.t'.pifcacca futttfrua9qui 
vcm'&&e*>flmafco.DYafcxa.pifcaa'cqueia 
©vna oafcunf fimtuaftrobrtttofunr. 

flpvafco.fiuftotnacbafuntatmvinobibtta 
mojfitevcncnatloccurrtif.^Kispifcaccauau^ 
ftcra7iiipa'cae.3dcocp ctiaaceomoda crcdii 
mr toari •: pulmots : tccozMri a purgarc. 
f Etidej ©aa.^iftocb.id efifhce fubftan* 
riacftfiibtiU9.afapo: aus cftfere adamari* 
tudtncmocclin48:ctvirf9ei9cc3^tfic.3mpU 
o:i is caliditariecpnuj: aucliana. 
^^3tli.6abt'o.ca.^«piTcadJ0,^ifcactcna^ 
fcunturapudalctandria incgvpto:mulro aut 
plura in bozeattfvrie .flltmcru quidcm paucift 
fimu babctia.vrilia funt ad cpatis co:robo:a 
tionetfimuUpurgarionc' infcrto?. bumomm 
f mmeatusipfiuB.Btiapant cmfub amara ct 
ftiptica qualitat e aromsuijantc 
«ff £> cim9 aut z alia mtrtta cpativtrtia ficut in 
iiegoa'ofimpU'ciumcdict'n3?oftcfume.S>foi' 
macbo aut ncqyrfcctu nccp nocumetu notabt 
UecipTsbabeoteftarijficutnccprcltriawiveV 
«risneqjfubduaiui» 



f £t ide.viu.ffm.far.ct5 ptfeKrfe.^ifcaciifA t 
fiftica.in ffria multii nafof plata bcc5ruct9ac 
ei$fubriliu£tiu e.fubamapqtf zaromarijana 
bab&.scobftruit % mudificatmajcicquidejca 
fmepar.aeacjfmto:accapulmonem 
f 2lui.t»c virito cozdis t>irit cp cofouatcou f 
^aucrroi3.v.li.£oUu3ct.c.t>cpifcacca titq? & 
confb:rat ftomacbu i cpar a rora fubftatia 
f "Rabbi moYfc8.ct>e piTca rcj e. ^Sifcacfc (ut 
mc^o7cfomiterruaib?:cozro1jo:3tftomacbu ■*' 
a epar.funtcalid« ficcc tcmpcrare, 




D 



Capitatanwaluf* 

" 3nicumfiBc'jbant'a?m.j?faacintict5 
-^anfcujinfouna auafurafimile im> 
lio .minu8 tamen co mttrir . 



f •fcanicum vctrcmagis conftipat. coquifur 
fcpecum pingucdincvelcfilaac 
f £6ftattanpanfegn(.l5>anicu3?mili£ifri.ct 
fic.funtin.ii.gradu.p3?mim'unr.fltpticafunt 
ctpani8indefact5multopluoc(tconftipatiu9 
XKinaj autcmjpuocflnr. JCum btttiro vcl lactc 
coaa funt mdio» quibns admittis bumccr -U 
tur ,a coutm ficcuas cjcpclltiur. 



A Pagc from the "Hortus Sanitatis," Printed by Priiss at Augsburg c. 1499 
Facsimile Slightly Reduced 

331 



FIFTEENTH-CENTURY BOOKS 333 

in the former work, there is a reraark that a mixture of this clay with "aurum 
vite" produces a medicine "dicke mail versuecht an vil enden von mir [often 
used by me] Meyster Johan von Cube." It is to be noted, however, that the 
passage is in contradiction to the content of the chapter itself — which may 
indicate that he was merely a proof-reader . . . As to the nobleman who per- 
suaded the physician to compile the work, it has been thought that he was 
none other than Bernhard von Breydenbach, Chamberlain to Archbishop 
Berthold of Mainz, who with several noblemen and ecclesiastics really visited 
the Holy Land in 1484, and whose Peregrinationes was published at Mainz in 
1486. Choulant, in his study, examined with great thoroughness the possi- 
bility of Breydenbach's identity with the "nobilis dominus" of the Gart der 
Gesundheit and came to an unfavorable conclusion. The Gart der Gesundheit ap- 
peared on 28 March, 1485, while the Peregrinationes was dated 21 February, 
1486. It seems impossible that within a few months after his return from the 
Holy Land Breydenbach, even before he started on his Peregrinationes, was 
able to publish the Gart der Gesundheit — unless, of course, in his absence the 
physician whom he mentions had already completed his part. Yet nowhere 
in the Peregrinationes is there any hint of the existence of the herbal, an omission 
which would have been altogether unlikely if Breydenbach had a hand in the 
work. It is true that Breydenbach was accompanied on his journey by a 
painter — Erhard Rewich, of Utrecht — but the woodcuts of the Peregrina- 
tiones, which also include eight animal pictures, are of a very different style 
from those in the Gart der Gesundheit. As Choulant justly observes, there 
were many pilgrimages to the Holy Land in those days, and thus some other 
"nobilis dominus" could easily have been the author of the herbal. 

In addition to the Pref ace, the Hortus Sanitatis — at least its first edition 

— contains also an Epilogue. Unfortunately, this does not offer any infor- 
mation about the author or authors. Jacob Meydenbach, the printer, states 
with considerable pride that the book "omni diligentia collectum et elabora- 
tum" was produced by him, without mentioning however who did the com- 
piling and elaboration. The fact that the volume extended also to the animals 
and minerals was, of course, advertised. But the printer was justified in 
pointing out that the Hortus Sanitatis was different from the Gart der Gesund- 
heit. For not only the treatises on beasts, birds, fishes, and minerals were 
new in his work, but also the section on plants was completely rewritten. Some 
chapters of the German work are lacking in the Latin; and yet the latter in- 
cludes nearly a hundred more chapters than the former. The text and the 
sequence of chapters also differ. Further, each chapter in the Hortus Sanitatis 
is divided into two parts: the first gives a description of the object and the second 

— under the title "Operationes" — mentions its medical effects. 

The woodcuts of the Mainz edition of the Hortus Sanitatis were made by an 
unknown master, probably by the same artist who illustrated the Ulm edition 
of the Vita et Fabulae of Aesop and the Speyer edition of the Spiegel Menschlicher 
Behaltnis. Some of the woodcuts of the plants were copied from the Gart der 
Gesundheit, but on a smaller scale, and even this section includes 151 additional 
illustrations. There are seven full-page woodcuts, the first representing an 
assembly of nine physicians. The woodcuts in the Strassburg editions are 
somewhat smaller than those in the first edition, and their execution is poorer. 
These Strassburg volumes contain only three full-page illustrations. In the 



\ 



334 MORE BOOKS: A BULLETIN 

third Strassburg editiori — to which the Library's copy belongs — the large 
woodcut on the reverse of the title-page shows a pharmacy, a doctor talking 
to the apothecary. The treatise on urines depicts a sick man in bed, with his 
parents and a doctor standing at his left side. Both woodcuts were borrowed 
from the Buch der Chirurgie of Hieronymus Brunschwig, printed by Johann 
Griininger at Strassburg in 1497. The page preceding the chapter on beasts 
contains four pictures: one representing land animals, the second birds, the 
third fishes, and the fourth minerals. The verso of the same page is occupied 
by the picture of a skeleton, with the headline "Homo natus de muliere brevi 
vivens tempore." 

The main interest of these woodcuts lies in the fact that it was the first 
time that the art was employed to depict natural objects, instead of religious 
and folk scenes, portraits, city views, and coats of arms. The effort at fidelity 
is the most magnificent feature of these pictures. The most amusing one lies, 
of course, in their imaginative quality. There are a few genre pictures even in the 
section dealing with plants. Thus under "Amidum" (starch) a man is pounding 
something in a mortar; under "Acetum" (vinegar) a cellar is shown with a 
row of casks; under "Aqua" (water) a fountain, with a monkey on its top, 
is playing. Sometimes the artist, indeed, needed all his ingenuity. In de- 
scribing the "ambra" (amber), for instance, the author mentions that accord- 
ing to some it is the gum of a fruit growing by the sea, while according to 
others it is the product of a fish. To reconcile these widely divergent opinions, 
the artist planted a tree right in the water, with a fish swimming by. Estheti- 
cally the most valuable are the illustrations of the treatise on minerals, especially 
on precious stones. The designer here shows all the characters dressed in Al- 
satian costumes of the period. 

There were about forty different editions of the three great herbals — 
Herbarius, Gart der Gcsundheit, and Hortus Sanitatis — during the fifteenth 
century. Besides Latin and German, they were published in French and 
Dutch. The Boston Public Library has also several rare sixteenth-century 
Spanish and English herbals. It has the first edition of Nicholas Monardes's 
Dos libros . . . de nuestras Indias Occidentales, printed at Seville in 1569, as well 
as his Primera y segunda y tercera partes de la Historia medicinal . . . de nuestros 
Indias Occidentales, printed at Seville in 1574. Monardes's work was trans- 
lated into English by John Frampton, under the title Joyfull Newes out of the 
neue founde worlde, first published in 1577 and again in 1580. The Library 
has copies of both editions. 

Bought in August 1936. 



COLOGNE * 
lRNOLD ther hoernen 



DISPUTATIO. 
generis. 



Disputation 




tae Trinitatis super redemptione humani 
c. 1477. 



Hain H278; B.M.C., p 

Printed with gothjiefType, in quarto forr 
27 lines to ajifge. It has 24 leaves, 
the first an^-fast blank. (The last blank 
leaf is mjssing.) The size of a leaf is 



/ 




210 X 140 mm.,* -whjle the text measures 
135 X 81 mm. Capitals, paragraph- 
marks, initial-strokes, and - ijnderlines 
supplied in red. ^"fe^— 



Digitized by the Internet Archive 

in 2012 with funding from 

Boston Public Library 



http://www.archive.org/details/ortussanitatisOOprss 




&eljetbi0etplanti0» 

&t animalibu0 et reptilibu0» 

£elluibu0etuolatiiibu0 

&epifcibu0etnatatiiibu0 (tte 

&e lapiDibu0imterreueni0na&i 

&eBrini0etearuiperiebu0 

CabuiameDianali^CumDireeto 

riogeneraliperomue0traetatu0 






/. f //V «^ ^ ^ 



^" 






$>rolmnium 




fjflnipotrtia 



«crntq? fcettfonue nani 
rc crcatoris op.a mtrabi 
Iiii admfrandaq?mccu? 
,) vtcibitcratl «cb:t'9p:c 
cogttido rcuolttf .0ua 
litcr a mudi cjtoidio cclo 
crcafolucidittimi8ipmeo2ni!ttcrirOcllif0ut 
bninflueclfiincrcataoia fub celovimrcdit 
?vimitc.0uomodo«iacUmentaqtmo:mi 
rointerfcmodo tifferenria er,nibilo pnkbctf 
rimo p:odutcrit o:dinc.3guem ridclicct calf* 
du ct ficcii JScrcm cslidit t bumidu .3 qua fri 
gida i burnidaXcrra ficca « frigida.£?uam 
p:op:iamvnicuiq;p:cben0natura.0ualitcr 
inftiE fummS artifer rf magifta babie: laptf 
t>flxncucrifq?anianribue^ducrie:advltfmu? 
feoi<m:cctm'eotbcrcaturi8 nobilio:e fcccrir 
atq? fo:maucrit.3c fic cuncta ?ifpofufr:vtcu 
cta fub cdo cffe vita? ac modu ba bctia . £5til 
lismcdiantito fuaio:tircuf naruraac fubfi* 
ftcnri e pmancri3,£ ffentq? in omibo cr q tf uo: 
CTitmpentib? elemeutie fiue bcrbieilaptdib? Si 
tte eria atalito qtruo: cjcmcnro^ narure.calidi 
rae.rrigfdftae.bumidifae.ficcft2fq?pcimi!Lf^ 
£t& in buanis ccttgibue in mefura ac f cpcra 
mcfo oprimo \'itc ac nature boto|ccucnicnti. 
£ttllo ftant ctcmperamcufo gfecra bo porirc 
tur fanitateOpfo vero fciffolufo perfccbfrirc 
giminie fcifloluffoncm.etim calidim vkt\ ■£ 
fijp. ccrerae crift «« nat urae frfgidif ate ityd 
lcrelabowrct.Sutcaliditatcmfrigidtras^f' 
ringu«e vclit.2>iucbo cu ino:dinatJreplcre 
tur bumorito.tlel a nantralf bumfditafe.finf 
miu esefectum rcccderetOnmagnae ftarim 
incfdcretinfinuitatce tr.o:rf app^pfnquane. , 
i:uius atratio tiffolur icie naturaru.jjn qui . 
bue bominu vita cofifiit et fanir ae.fi on vna 
f«P ^;iripl« fottt afTigna nd a/^Iunc ctcni ce 
iioccuttWencnarcinfiucrfcbcTenafureptra 
rie.>Cuncveroaerieimpurita8:fca cibus M> 
couenfene:tabo:q^fno:dinatf.3licq?c|pto* 
res a pcrfeaa l&nitafe traffercntce bcmmcm. 
0uaeenumerareomefiveltm faciliue mibi 
fo«:tarcnemarte(vtarbfrro:>cddaercncm 
•fcrofccro cu plue mille cit ^umfJcnt pcricula 
boiem.£5untq? accidenria fasfeatcbois t>t'f 
fo!ucria.3u)Lta (\dcxxi variu tnfiipt fcrc innu 
mera.jjtavtquo vere ferurusfit bofanifar$ 
aut vftc vijc vllum inomet u? iit repaibilc.S^cc 
tacftustjummecumrcuolucrcm.jeicaducrfo 
memo:abarcrearo:fefaptentfsm:qt3aabfni 
riog«ieribumanointantfe£«miconfiitut$ 
pcriculis defalubriconucnfenriq? nmcdiop 



UtVkrfcbabfefalicct flntmgnfibus ccfcrifcft m 
creaturisquitoeivirfutc indiditvt naruras • 
©iffolurasreducaentadiocbfrii fcmperamc? i 
fumarmontamT^owforie.tlna «cmmbcrt , 
ba calefarif »alr cra frigiditatcm indurir.queq? 
fm gradum fuc coplejcfonf s ct nantrcXetcrc 
cfeffccreaturemaqsfcn tcrracfle babenrito • 
ad confcruflrionevireboi8pf«uf;£rcatore . 
narorcita&ifponete.at barumvfrfute ber? 
baritcrcaturariiq?c«cra| bomoviribus t>c9 
flitut ue g primarti qualitarit tif ftcmperamcit 
ntminmtcgrlrcdircpoflitfanitafe. £t q:fn 
bacmo:t9litrafiro:f3o^viracario:eact»cftcTe 
ra bflio:e vcrc fani tatfeco:po:ie tbefaurnm i 
botcm pofiidaefit fmpofribiIc^apfcntct>i> 
ccnte ^cdia flicf jqqu^dfo: cft inquit omni 
aUro t argcto falus attic-z validft co:p9 cWcctr. 
fiw immefus.l^on cft tm ccnfue fupa ccnfu? 
falutis co:po:ie.tltfi!in e mibf fo:e oprimum 
cum coponcre Iib:um multirudincm f igurarii 
fub ccrrie p:op:rJ8 colorib? cftigiara? bcrb^ 
lapidum:anialitim: cCTcrantmq; crcarurarut 
corinenfcfpa?«iat)efcripfamvirrufcm;1^ec 
laudabiffue cfffccrc mc pofuific bocopcrctcfl 
bcneualcntibue magnfi aficrat folatfum.parf 
cnnbufcp pfcrat no modfca vt flifat ?.3dtpm 
autepaficicdu mcpmo pncfpalifliiriCCBCbari 
tae vrgcbat.qucco?fnopiemcfecitcomparf: 
quibus tcmpo:alf e no fubminfftrat facultas. 
p:o ncccflirateconduccndt medicosaapottf 
cariospecuniaeieccficicnfCRainbibuiua 
doctfina Itbriadinti:fumptibu8ad modu ejctf 
gui$concurrctito.3pft8fibiconferrevaicbuc 
p?efcruariua remcdia perfectacemcdicamina 
3d idcm aggrcgendum no minus mc mouft 
f?t£ma]rime nobilis c\uic)a t»ns quircgna ter 
rafqjvaj^spaagrandojvfddfcrtalananfaj 
3f^wam:iJvftria:SIauoni3:£roaaa:?bal 
ma«am :0rcciam:Xo:fonia;^o:caXa ndi 
am:T? bodum:£vp:fa rmZmaqnoq? fancta 
cum fua ciuitatc3bcrufalc.Sbindc paruam 
cundo 3 rabfam vcrfue montcm £5\m\3L 
montcSivnav«fuemarcrub:um 3lcavrz 
*j6abrioncm.p« alctcandiia vfq? in j£ g^ptuj 
ct c«cra t»c fcpc x>iaie b«bie:anuna hbue :Ia 
ptdibU8:c«crifq? ad eonfect ioncm mcdicimf 
ritnectffariie.7Jpfcrr9rff2tcfncognftf8.ma? 
gnam acccpftejLpcricntia:ea? virtute ccfcri* 
bene ac camm fimilftudtnes fub Ifncamenris 
coucnientfbBe:cct«ifq?colo:ito «fftga rcrc u 
raufr.0ue cria omnfa i ftngula fub t tbit te (i 
gUra:fp:ma:folo:e:erqirififoq?o:dinemp:c? 
lajri otjc ©cpicta inucnice.^ieigtrur fcucto 
gmorue Iaudsbilcbocopue tnccputafraus 
auriho.confccf q?qc p:ob9tififmie mcdicina? 
a U 



Crattatua 



cnotf#ncaio:©aapionc:1Matc2rio:lMti 
ni0:pvafcoacte;^andccra:3obanncmcfuc. 
'£>aladto:£onftantmo:Sln52nfb:cXcterifq$ 
qsplurimto non minus cFgtie.^lflcuircpvt 
o:rue fanirarie appellarcf.f piuidirur at bic 
forue hber in rractatue ocro:quO£ vnufqMqj 
fmgularc ptinet matau/fbrimv iraq? rracrat 
©c-berbis «tcrifq? q-ad vfu m mcdicinc coeur* 
ronr. jjn cj etil berbay spraefigurae copatf 
cs&fcta t>c natura c6plcrioneq3mulro:um 
atatiuVirainrariesuccntiuXcrtiuetcautf 
bu&caruq^naturie.Ouarr/tJepifcttoeariiq? 
miaanbue^ttawr^Ouiiir 1 ; ce lapidito pci 
efiecoa»q5#tutito.£>cau8 tc tifpofitionc 
vrine eiue colo:e i figmficarce.S cpnmue c 6 
rincrregiftru^factliinucnrioeegrirudinusre 
medio?^Dctauti8ctrltinr5ptinettabulafjn 
fllpb«bctio:dmc:oiamboc libzo contcra te 
mcfirante.fkrgat bic o:tue nf redolcs amc 
roffintf in vniuerfum o^exiictofqj fefe tclide 
raasrccrcct.1Z.ibi igif o crcaro: celo? tcrrcqj 
c\ ciio^bcrbie aialtto lapidrto cerxrifq? inoge 
5 ptcrie: infiujcifii ctiraritta ^cureammaae rc 
ferogfaetriirbefauf buc bacttnue fcbfccdtf 
tum mtbit>c©a$in iucc^ducaeXtbi bonoz 
ct gloua in fcctila fcmp uctm 




€aptmium.f. 

•Brbha padccra ca.tJHarc grca Sra 
nccSiricantica. Xarinc^o '&&\ ba 

-aaromvel laurue: vel ferpenr aria mi* 
no:,3bidcaaronbetba cft bsbcne foliat:a* 
gonFecftfia:fcd minoa»? plsnamovaria.biie 
virgl tua^paima?:? colo:c purpurcf?. £ui9 
fcmecolouecftcrocctVz fcbaradiccalba ba 
betebulbi romndirate jifcm tragonrce q crttf 
da i coctajniducarc porefhquia no eft valde 
amara.^oliariue pofira in falc manducanf ♦ 
i£ftca. , :lic.c6plericie.in.t.gra.virtuti8 l tnf!> 
foIuedulajLandii cjcrcnuadi.-f j5al.It.tj.tc rift 
cirea fineca .teaaron.£ft quideradr). buiua 
ptanrepfiiiseomeffacique rape.£t fi.bdtr. 
£r opowet quidcp:ib: cft ipi^cfiundcre a qua 
f jn elijLationc.tcinde in alrcra calid m intro? 
mtrrac:vr itt caulito i lcnticula t tcru cft . £ t 
idc If .vt .ltiti.far.ca .Saron fiue fcrpctaria mi* 
no:.2?ec un cf. rcrrcflr^pccflit fuba c&da.£ t 
idco abJicrfiuc virruris cft:no tn violcrer fiaic 
wagonrca :fedin calcfaciendo i ficcandb p:i 
migradue fm vtrucj;.S>cdvrtlio:ce funtra 
dicc6ipfiue.^aulU8ca.aaroncaltdc'4ftc 
ce cft coplcj-ionie imi,gra. 

tBptrattontff. 

^fpvaf.ca3aron.airru8fiueop,attoiptu8 « 
|eftinfemter2dice^foltie.SmijLrafimobtiba 
VSfeo.7 ^tbaplafmarico adbibira fodsgncis 
m«tef;f T\adtjcciue eiLrenuar pinguce fctimo i± 
rce no mcdfocrif cr.tUi ad cj.pcllcndu to:ac fs 
bumo:evrilinima cftrorababa.£r.tcnuato? 
rii bsb3 virturcfcd no fo:re ftcut twgonrca: 
Jktncalcfacir.f *Radit:ci i ;collecra rcf cnirur r 
^kut t :agonrea i cidamie, f •jbadeeta ad mc r> 
. (trua.p uocanda :fuccue ciue p pcffariu int tia 
rur.f £6tra inf ationce auriu tuburofirarcs ^, 
aaron cu ipz fcerbafcuharur in vino % o'co co ' 
muniadditoriniinofiatindecmplaP c %Z5 $ 
rracmoiroidcevclficiuibcrbaipfaa tapfue 
t)atbatuet>ecoquanturinvinovclaquatfi^ 
atfuperciecucatifma.f £ontrafrigtda apo? 45 
Jtcmata berba ipa ctl tuburoittatib cum au^ 
pigia vereri f craf :ctin tefta calida ponamr z 
fupcrponaf. f C^tra fcrofuiaenoucllae bcr D 
ba ipfat fqrlla cu aut.ugia valina vetert ftig 
ponaf.f adfactct>cpurandam2cutim fub^ 3 
riltandacictuburofitatib (uia tcftccatie fiax 
puluiefubtilifiimuenccftctafcuaquarofcril 
-etponarur ad tblem tonec aqua ej: toto pfu^ 
jnatur.^ ira f iar tcr velquater vcl ampluie:ct 
xt puluerc fblo vel confeao cu aqua tof £ ^ 
iituanirfacK843bccvocaturgcrlavclurula 






\^ 



Btijttbis 



ri.f^al'.tj.tcctbie.j£ftem i ipfiu8nummcn? 
tu bonu fi alic\s c% pecto:e et pulmone aliquid 
cjCpellereTelUtinipfiscollectoy-zfinDiromm 
ct rifcofo? bumo? ia comefta. f £>afa>efim. 
far/Radiece aaron comelk inctdur incifionc 
tcperata bumomgrofltcf c.quare ercjcerea tio 
mbu8quee]cro:ace (vmtidonce. pragomea 
vcro ad tocmagieeftidonea. 




^V 3 



Capitulunu} 

r S :o tanu gre.t la,ara bcfum*£li.ub i 
•iqci.Bbrotawieftberba iocfidi cdo? 
3> -*-ri8ctgrauie.flo:ctellatc.fio8fiuecft 
nur^-.^ous.vacuumfponte.puenit^crifur 
<aut fenwmelwecgfurculo velradice.f S>e; 
u'.2ggrc,ca.Sbrotanu3unt«'i!etucfpc8 
vnat:mafculu8ctaliafcmina:fcd fcmia cft 
ferc ficut maftHlue, et tint in boc cr ipfa cft 
planta fimilis arbuftcfcns folia a Iba.ct e pie 
na (bltje que funt fuper ramoe ciue frifla par 
ua fciffura.ficut fo.fcniculwt wfilmitate' ein« 
cft floe ad ro tundttate tcndensiurci coloua 
Bpparc8incliate.etbabctoc!o:€ bonum 015 
pauca grauedine amari fapo:i.2£ba fculue ve 
ro babct ramoe ligncfue aliqntulum ct fubti 
le8.ct eft bfis firmina parua ficut abfimbiumi 
f p¥afeo.capifcs>eabrorano.Bbrotanum 
cuiod multi eraclet m fcicunt 2 ut gliciaconon 
ttcft fcmiiMums frurcjctft cum albie foltje 



tmfnuUs tiotuifieffattcrtfto.cfrcflipfa rlo* 
res bns aurofoe:? icftare nafcenrce: i ipa cft 
odotata cu a liq grauedie gufium b? smarifit 
mu.tflle cm cft ficulu ab:oranu.f 0a.vi. finu 
far.ca.i.21b:oranueiceoe mafcul 1 ;? fcmiact 
ipiue fuba cft terrea qua fubtiliauit calo: :ct fs 
po:eiuecftamaru8.?cft mco pa?litpticira; 
tie.'ieftca.in.iq.fira.7ftc,in.tj. i ttcftcalidiu8 
abfinrbio i minSllipticii vfacei bu/z e eu qdl 
falfedinc^pterqt5cacofiomaticueft.S5ab; 
fintbiucultomaticueft:p«cipueponticum. 
f Siii.lurj.ca.tf ab:otan©.;Sb:otsnu cft ca, 
jficin.q.gra.-zdifubtilc ama?. ?in ipofunt 
tcrreitas i fubt iliatio.f -fcla.S b:oranum cft 
ca»in.i'.gra.ficin.ij.fubtilcama?^dunum. 

0pfrationra;. 

f*j!San.ca.]c.Sieicab:otanofiatci'mf:Tc]cco 
facto liicHJio caput laucf :eurar allopia'95. boc 
opcratur fimiUlter ipfa bcrba in Ujciirio bulita. 
f Semenciueinaquabulitu curat afmact 
pectousconflricTione. f Bb:otani fumigiu 
fcrpente8eiccludif,^uccu8 ciue bibitueva? 
Ietc6travenenurcptilt'u5.fj£ucatiimaejca5 
cbulitionie^ipfiusfacrii^uocatmeftrua.^pa 
fcerba cu olco rcteri trira et pauncta : frigo?a 
tipt ica fcb:ium curaif £Sa r.tn li.vts. 2 b:o* 
tanifoliactrloKsvlccrumundificatiuaajpa 
rcnt % ej:accrbatiua. quinetiam quot quot r% 
pcriodoe occupantur; It eriam fugfricaucrib 
ante inuafioneminue rigcbnnr. cy ai;te lum? 
b:uoe occidat x>ctce cft,co cy ipm eft ama? . 
f £ t clixum cuma lo cifonio. vel pane a ppcfi 
tianfanatMationeeocuIo:u:etcofertpufiu 
lis cruda ipfa berba i eujra ,f Bb^tanu x fi n 
ca.2fic,eftvirtut^plu8cpcncurbitaficcavfta 
3dem.ilc.ivIcCTibu8i»umidi8ccuenitfinein? 
flamationc^ majcime ci qui in p:epucio pude 
dicfigcrccernitur.jEticoadalopiciaeccfcrt 
cujnoleoveferi.f.anaino aut fifamino.jEft 
ctii fubtiliu part ulmo:dicartuu ct caltdum. 
f &uic«3b:ofanii aduflu ccnfcrf alcpkicp 
puecum a&ema :aut olco t>c rafanc^ t ab:o 
tanum confert adboc vtnafcaf bciba que tar 
dceft natwitatiejquido coquif cu quibufdaj 
olcitypter fua agrione.f j£t pfiringit fangtjj 
ncm gingiucet refoluit apoftcmata flcgmafi 
ca.f pvafioattcatootanuliiuim in aqua: 
autcrudum mfufuminaqua:o:fcmicic mc? 
dcfccquaifaticttopleurcticie^paraliticiscu 
betonica i pdito $af a.i Uiaticr % tifiurfejtn^ 
gularep:cfidium cft f Scra .©oluitvcntre 
citpcUit lumb:icoe et afcaridce:cf Ibluit fuper 
ftuitateeflegmaticaeabinrcftinieOllofcmi 
ns carcmue in partibueiflie. 



H 









■%$0^ 



(X-unrO 



'^ff^t^^^^ff^ 




Kmmm 




Capini!iim.tij 



r *Blimbmla.grc.abrin{fcion.ara.rarfc i 
»con.&bfintbium grecnm nomeccu* 
Hm$ babilius eft qt3 iu ponte rcgtone 
nafcif vctn et ponricu appcll2f.-jfsla.lu tefim. 
mc.3bfintbnT>uofuntgcncra.vnumponro 
mfufa rcgitmvad q: r^ricubj fapcee:co!o:e3 
b5 vtride.fapote amaru.ct talejnino:ie eft cffe 
crue.&ltudeft abfirrrbiu romann3:ermdiu8 
cp eo eltqteftrcmoru abodoicmarie.etfltS 
oiii in terrie liberien bjfolia alba Tenia % pla 
naifinevcri8coUisif.mvrr,b:ac]cficcaf:tpcr 
annij ftrusrar.&bftmbm tuas^rutcs babj 
ccorrariaspftrictmaasroirimduiefubftatic 
z pcricifaretoariua ejc r arrditatc-z amaritudi 
ne.% 0aum epta qui0lutoniimfit. Bbfin? 
tbiumq^mteepriaeb?.vna la.utiua:? altc 
1 5 liiprica^ptcr bocfi taf intnotbo nodu %V/ 
gcftio^nattriavt; fegatiiicbedicns indurat. 
vn qfibellu facir.Cttm tm la^atiua matcriaj 
mouenvrcuj cgcfticc ejcea t;et virtus fiiprica 
materia indurar tfpbibct nc moueaf quare la 
bowtnamra.0uo"catociimmatcriamo;bi 
tigcftaelt fif obedicecfgcililqj adejtcundum 
^iioto modis.ano q: vfe laj.at iua trS materi 
-atn tifiolutt.Sltao q: pontic irate fua cope* 
rimcceadiiiuat ad cjutookndumaieriamomi 
4dtmcoitcauitari& meb:o?.f j6t ^poan 



Quaaacpta.SbfinrWoncftc-aliduqnfderT!^ 
dfocriter.fuccueautnimie bcotee cckricos 
fifaeritinfutumin vinopvrina purgct. / ppter 
qtJinvetrcflegmapfiftesnibiliuuar.viiutcj 
crn ftiprica ty.i qineo eft amara virrus eft. 
f£onfbn.inli.gracuul.Bbfintbiuca.cfti.u 
gra .fic.m.tf.j£jc U.te na.rc.tmu eit genu8 ab 
iintbi} viridc mag^ ama? aliud vcro fubalbi: 
du nimis ama?.£t tii babcrc qUtatee ptrart 
a8.f.pftrictiuaetgroflitudine fubftanrie.£e 
latatiua ejc amaritudine z caU'ditate.f &uic. 
abfinrbiu cft berba fimilis foltje o:igano.ca. 
m.i.fic.m4.£txiuefuccu8fictio:cftm.iri.£ft 
mte berba amara-z ftiprica apcrirtua % acu# 
ta.^^li.U.]tpq.aWintbqgcncrafutplura. 
£>antomicu tictu agaUicciuitatc. •fbonricuj 
a ponto vbi eo pinguefcut pccora n ob id ftnc 
fcUercEiunf.t5ccdtauudpftanriu8multuq$ 
italicoeftamariu8.Sf3mcduUa pdttctoucfr 
berba faciltmatf inrcr paucaevttliiiima. 

f&perarionre* 

f 1>U' U.vr g.&bfintbinfiomacbu rcborat n 2t 
ob bo<bicfapo:rranfrerf in vina .'Rsufess 
maris arcet iri nauigattonibuc porii.f £5uc 3& 
cu8riu6lib:o8ctligna per mulfos aimoea 
vcrmibus ac murtbus femar.f Bdtigeftiof £ 
ncm etia t ftomacbii confo:tandii mtiUuj va* 
lcr:fi coquatur cu olco:? inrmganf co: ga bu£ 
manaejctoamomu moicfiiapulicuea p:e; 
firuat.^XIontraloquela amtflum opnmt.m T* 
rcmediueft.£ftagoabfinrbiu berba quide 
amarifTima:faluri bumatic ccmoda . f g! fcfo £ 
Sbfintbiu jbibet pannos a titieis^ co:mpttf 
, ©nevermiu.Ebfintbiultb:o8amunbu62ti^ 
ncis mtos rcddit. f £ctra Uimbatos fuccus $, 
abfintbtj cupuluerefccronfcc vcl centauric: rX 
perficcaricJvclnuclco¥pafico?fucconr<lfi:o 
ru folio cctur.f 3ob Jne.m.ca.t e abfin, Bb & 
fintbtu cducitcolcrajafiomaebo? mtcAmis 
•z cpatc.t cittendif opcratio eius ad vstat: et 
mnndtfttateaeab bumotecolerico-z aquofo 
i intcrdit tucit ipm e viae riinci pfa uat ^b 
finrbiu a putrrcfactione^^ne pottJ8 infufioi 
nie ipfius mvino t ecocttcte imgulie t tibus 
circircr.5a^ut.rj .vel aqua luburi^ricie eius.. 
^f£t olann ejc co factum confert t olou aur^ 3b 
jettinnimi-z furditatiitcoUuifbeacefo teco?' 
ctionie ei9 a co:tice utri: % conferr fctcii oue. 
^.t £bfin.co:robo:at flomacbu': epar. i c^ 
tat appcritum mo:mtl. -f jDpilacionte apeitt "3 
ctmo^oeopilarionfjcijrafrzvermeeintcrf^ 
lificducttpzopnecmplmibucnoc^.sbftn. 
3.u.eufo:.M'.co:uu cerui ndnfii.j.f jneriie. 
^tum mrTicit.f jCotifot eiabfin. iuitamenrii \ 



&t%mw> 



magttufcb!ifot0gif$e.?'fe.opnanonu. 
<JE j^jotjws o£flH'oBie fucci ciue aprie fuecf 
ipiue qiffirate 03 volucrie.^riein medio ve 
i-iipunficflillufmincdosnotoe.ctfflcftcca 
reinfolefcinerc. ea.in vafc vitrco/icutficcaf 
aloeef Bquaaiit fubhmationie ciuo fit.fi; 
rutftt flqufl rofaruct ftmilifl qucfiut in vafie 
fublimauonum. 




€apimtom.m% 

B£ caria grccc fciaf .? larine.f5 arabial 
rarri.Sui.U.uxa.tf accariafcicit cpeft 
fuccuefllrarri.bocatearcfajfacimus 
5cfuc -o p:unetlo^3ccatia fmquofdam eft 
fuccu8ptmuUo¥immaturo?.q latine voeani* 
acnncc.fcdflc.qtTtait^cli.flggr.Sccfltii» 
fit cjc frncm cufafda fpiriofe fli fcoaV gilmi ara 
bidxiucnoiatam0aue.j5t9fcxa.dcaccaria. 
accfltia fructue cft arborie fpinofe.que mai» 
pme nafcif focgvpto#3ic fructuevclutoliua 
fmif.etfuccu8infole(iccaf.j£(terfioopnma 
quceftleuf8etfubrufa.ainfuauitateodo:ie. 
fttbacida ct gufiii Tfllde liiptica i?ec cni ma jt# 
me t»e immaturo fructu pmiturflam nigra l 
feematurofrucfo^mmeauteaccflriafinn 
&t ctt.cficcat mmie.ct mfrigfdat foabundan 
ter ifhgida eft in fecudo gradus (icea in terrio 
^alicnueie^rjmpUciofarmacowca.tcac 



catfa. Sccatfe et tpm qutdem folium cft aecr* 
bcct fructus et fuccus qui q^dcm ct lotue dc} 
bilio::fimuletminu8 fomfteatiuum cfiicifur: 
quada aaedine in lotura abijriee. Sivct o % 
fugagatur alicui mcb:o fano :ftatim rtfod (i& 
ciue et aridiue ondif .£ t calidif at ie c^de fcn fa 
nuncpfett/rigiditatc^o novaldc vcbcmcn? 
tcrb5.*^al*ergocyfrifiiductfcrrcftrecft farf 
macfftadmijcto cria fibi quada aquofa fubfta* 
ftatia^utabif antnec fubtiliupartiu cffe.fcd 
baberc quafda parteettifperfae fubriUu parti 
um.cahdirateinlomratcccdcntc.ponafaute 
xt bmoi tcrtu qmdf gradue ficcantiu.feaindi 
vcroinfrifiidanrium:poftc$roeritlofa. 

'&pirattotu& 

f^Y fl f«^« 9 ri9ifinefac?eriinguit:ctper^ 
ntonae fanar.ptcrigia oculie tollir .vulnerifo 
ctromo:ibueoculo?mirificep:odeft.p:of!u? 
Mmmult£rieiirinfiit.ficriciefiibucnif.flu,ti;ij? 
vetrie bibita et fuppofita p:obibetcapiUoetn 
ficit.t lota ficut cadimia folct oculoui jptectio 
nibue mifeeri.f^teTuccueeius colurije mift 
cetar.£?umav;inli.t>e rvriaca^ccaria tefmtf 
Bueeiueeftff cftfommmefripriataris 




Capuu!uro.u 

^gv £ctoffl la.fire.oicilapariuj.2irflbi.bu^ 

«^fmad^cienda q_ acaofa apud Sut. 



B 



i m 



CtactattWi 






$'■* 



ixfor** 



r 



K.ii#tfo ea.£t$pud£Y^f.m;|ip:focfl.£r p. 

Sera^a.tic acctofa.3d2dtcp lappacui.tlc^ 

rfi boc nome ad acctofa coticnir^pueilU fpeci 

cilappact)^eftacctof<fapoJt8.q«ct5:fuiife 

cognitaab3uicennacumt>i]cit.£fnondrih 

^faucrtri ficttt oicut 3cctofitao,qttafi fcicar : cp 

bene noui.f Undc 3uiecnna in tj.ca.t>cacc* 

rofa vocar lappaciu acutum acctofam t&ices 

Scerofaalia w>mcfiica:aliafiludtrie.ande 

vera acctofa i Oomefticii lappaciu itt quo eft 

8cctofit98.quonia acefofa filucftris vel lappa 

tulagrcftenoeftacerofum.&idcoSwceiCp 

«•no cft in filudtri fiait oicur acerofirae r immo 

fo:fitancftinquadam epca accrofitaejquia t 

aeetofa t>omdf ica 3 lappaciii somefticum eft 

acetofitae,£tfubdit cp lappadus filueftrc vd 

acctofa filucfirieeftfomo: ittomni re-raotf 

rio:.f p^^udc6qrtuo:ticitctTc fpccics 

lappactj vt inucmcefilcgee lappaciu. pety 

buedtvnaquavocatoicilapaciu.Ucctofum 

lappaciu.t illa eftaectofa.f0yafco.capi. oc 

accrofa.2kcrofa cft t>uplet::maio:et mino^ 

maio:cftonlappadu4nto:baberfolia minitf 

ta cii ftipirepartio fcmimto plcno.^uentur in 

$mrib?:fed maio: cfficad9og8rur.3fta voca 

bulainueni66etiap.aggrc.mcafi.Scd fcicn 

M c? maio:accrofa cftqul modcmi vocauc 

acetofeUam.f *fiau.ca.© acctofj&cerofa eft 

frigida er ficca in fccundo gradu.t femcn du& 

irigidum in p:imo:ficcum in fccuncfo 

3&pfrariont0 

f 3uiccnna.*R9dij:accrofccuaccto eouctitt 
rcabidvlccrofeicicconatiottivnguie.ctqua^ 
do coquif cumviuo pucnitcmplaftruciue al 
barae 1 empctigini.f £t ca fir cmplaftru fcro 
fulie.ira c? ticff radtc ciue fufpcndsf in collo 
babenriefcrofulfleiuucfea.f Etdueticco^ 
crio eii aqua calida puenlr pwriruto fimiUrcr 
ipfamet ittbalnco eft vltima.f £ol!uitur oe 
fuccoeiuem vinoxtconuenir apoftemarib? 
quefuttt fub auribueXonucttit tcrcricieni^ 
grccumvino.^ fcdatnaufeam:-: comedirur 
< jprert>dideriuluti.ipa ctfcmen due ftringiir 
2 p:op:ie eiue qucmagna cjc co cft. SJerapio 
aucto^vaffo.^oliaaccrofequando conutf 
duntur ftringtmt venrrem.ct femc" acetole ba 
ber ftipiiatarcm manjfeftam.£?emen ciue «i 
m bibirii cum vtno et aqua.Et fimilitcr floe 
ciue conferunt vlcerariom inrcftmonMfliUUi 
antiquo er puncturc fco?ptcnie. 

, Capitulwtn.ul 




3£V£ onte.3ftdome1 n IfbJocfrmorogte 
f^rumlibu) prfj.a comeeft betba foltjf 
«f ^fimnibueYrfdie.radicibodo:ie acer 
nmi:fcd iocundi-ptoprer quod aromatica eft 
Pya fcou.aconte:td eftvenerea vtafirodifa 
er cft berba babcne folia Yrifimilia lara etot» 
longacjcalbida:in fummumtsenfa et acura ef 
fi gladiue.aurofum babct Rc«em •radicejfcij" 
fimilcm.obtouam genicularam er nodofsm: 
cjtfcriuead rubcdincm tecUnanrcm: gu/l t.jji 
acrcmctaliquatihue odo:arum.femen vcr,o> 
J>aber plant;m er fpifium cr inregrumr; ipfum 
odouefuauie^oreftquodetmcurfedittOi.^ 
4tibuecrTicacio:eftcr magte ealefecir. 
f SuiccnnainJi^anonc^aeontedtradijc 
planrcfuperquamfunt nodi ad albcdineni 
t>eclinanree:m qua eft odo: bd*ribilie: paruV 
cfcboniodo:ie.er.eftcalidu6 1 acufU6.£ijtit 
autcm £aucnue:#inmcdicina nonadmini 
.ftraror nifi radijc ciu8ij£iuf03 virrue dt.ppin? 
qua virrur i a riftologic z yre oe.mdio: eil ac<i 
ru6iUequieftfpifTio:;magiTc{5 folidmscrcuy 
cio::ae melioueodoae.lnatura caltdus c ac 
ficeueinpjincipio recundi graduea vfcgad 
medium. 

f^am^lco:u6caIidu6?ficc5infc^og^ue 
fimaitcrgladjoIuPYocarurjquinonrant^iri 



BWttW* 



t> 



Aquofietocfefeadalicefe tmarfofe crefcff. 
JEft alia fpccics gladtoli c^ f «enie&, fi lcgcs ca 

fiirutam gladiolue t>e.£> . 

i^Pfrationre. 

f jContraviriuTplcnfetepatfe acciptaruru? 
b:a v m aco:i aliquawulft triri. i maceref pcr 
tre«T>ic8inacao.poftcac0quaroradmediu 
aceii.*: coletur i colaturc addatur mel/z «terfi 
iidconfumptt'on2acctiC0quaf.3ftudautcm 
ojamclfceturcottidieinmare patienticu x>& 
cocrione acori.f 3d idcm.T\e.lb.f jueciaptj 
% pulucris etus.j.f.f aceri lB.f .olci c6fe,?.t. fe 
rapim'.3,q.pulueri8 armoniaci.j^.fimul per? 
mitre pcrnoctcm.T manc coquc vfqj ad medtf 
um.t>cinde a jponc puluercm ipfitis acoa i ej: 
tali vngnento folencimepar malarando ma 
nibusinunge. Jctftvfefacere cerotum. adde 
©ccocttoni ceram.? et taK ccrot o vnge. tlinri 
criamceroericieciusvsler adidem fcdnori 
©erur febucitantt.f £ontrabictericia coqua, 
ntr radtt acori in aqua z coleiur.-z incolatura 
coquafa'cerarubca7t>cturiu8paticnri.fum 
mum rcmcdium cft.ft fucrit fihe fe.:6alneum 
cuts ad fdcm vakf.fpKirut;* fiqute babcc 
acommfupcr fenunc$potcft incurrerefiujcu 
fansufofevdfpafmum.fiSa.&cowsputf 
uocatvanas.sfplenibusfcliracfeconfcrr.et 
abftergin fubriliat grofTictcm.co:rice mctio: 
eflfiKcuecius.fpiaf^uccusradicfecius 
claritat em ocnlouun pwfiat miriftce: que ra* 
ditea.tftc.eftvirturfe nimium i lcptomeris 
fclirofim iuuans fplenfe.? mouens v:ina po* 
tarofucco. 

f Bqua ^o'tnqua tccocta ftterit 'oiureriea 
eft.vrilfe etiam clt ct plcurctiefe/: rozacis pa f 
fionibust eparis? terminoffe z co:ruptelis 
fplcneridsvttlioieft.^ftranguirioffe.quiv:^ 
nam f adunt cum t>olo:e. £t ad mo:fum fetf 
penffeefficateft. 

f Sd melf erttm mcnftrua per fomcnrum vti 
lis cft.mifcetur eriam antidotfe % ririacfe. 
f Sdfcunaesvriuectradtce riuscum aqua 
t»cco«a ad tert&m t>abts biberc per tridu* 
um.ctv:inammirificeccduat-;ftranguiria5 
fanar. 

f He apce craminent i fugiant. berba i£am 
in vafe apum fufpende.t a venro nuncg fcdu* 
centur.becberba raro inuenitur. nec cam fci'/ 
re quispoterit.nifi cumfiofculu emiferir.Ba 
faturlocfecultfe.toMfe-zararis.lcgecameu 
fc augttfti/Ram vij: inuenitur ftnef!o:c.q: per 
flo:cmagnofatur. 

Capttulum.uij. 




ffocullu8.3fi.lib,ety.!cvrl.mAf.2[ffo? 

mllus^erba cft quilarini a calo:e a! 

buciit vocar.f DY a ^ftodiUti8 betf 
ba oib?n0ta:qua multi albucitl vocanbnsfo 
liafiatrpou9:virgull lenc.fug quabjfemeni 
gru.radicesoblogas? roriidaebalano fimtf 
lesXuiradta virnts eftcalida etvifcida. 

jOpcrationes 
f arina tKouocat.maimfe imp.ar.t>olo:ela 
terfe tollit eic coquaffionib^f Xuflietcs mcdt 
caf bibitavfqjad .5.i.curepida.leta©ic tmcir. 
mo:fitovenenarSocairrir.foliaerradit eius 
catbaplafmaritoadbibita,5lo:es a'9filr cu$ 
vtnopafceria vulnera fo:didafaluberrieeu£ 
rat.f £ttmo:e teltinz mama? tpofita fpargit 
puftulas i oriolos adx>ita ftringit: marime fi 
cii fccc vini cocta i impofita fttcrinaddiro vtf 
noi , duIco:c i mvrrba i croco i cocta fimul. 
f Oa^mapcpftatctTccfu.oolo^esauriuct 
fanies vino addtto i lib a nori et melle admt^ 
icta ©etergit.aurito tepix>9 infuf? fucc^ei^ fit>e 
ctragtfet)cn8t)oluerir.firiiftriaurtifufu8 me 
def.f £infe radicj ei9a lopicias emedar ,*Ra 
dijc cjccauata et cit olco calefacta parmonib? z 
©olo:toauriufinsrarcpftdtue4*Radi]criu8 
macfas albasi fole faaas emeoar. f *Radic 
ei9btbitacuaqvetremollir.^cmeci9'zfto«6 
ferpcnritopriucftficu vino btbifitfucric. 

Captmlum.uttj 



& 



Crart«U0 




^G\.f5*Ticwgreee etlatfe.Srabf.garic* 
J^f -pf af.Bgaric*; cft radticfungo flmilis 
^ ^ateqfifungueairfceWrcarafciccm 
arbo:fe.maicid n babflota r cl ISbardia. f uo 
riu8fuiwficncra.fcilicctmflfaihiectf«nma^i 
mdio:clL£tbjfo:m9K)tundl.tdiccaf^ fit 
albuTimue.i^afculus bj fubftatia longaj ct 
i no eadco alto.5dnia fa> l atto tatie ? fragi 
biTbnecjfda tubotofitatcefntue.Ttruftula <j 
ripo:ofa.^li,h^ri3tbo:e6Sl^cifcrcgalla'> 
ru ferur agaricu.E ft autfung w P cadidue t odo 
rattuufficajc anttdotie.in mmie artorito na? 
fcfe.nocritorclucee.f Signu 15 t&cpin u f / 
neb:ie*acrFif.3dcinli.]L)cv.2lsarifont'fn1 
guenafriftnarboatorirca bofpfcoul colo:e 
cadido,3d cfi tn gallia nafdf inftrmfr babef 
^aefpilTto:ctmaio:c)difiif.di et cspitie to* 
lo:eo factt.^cmia $o foUirio: initio cfiidcga 
l\ ue tulcto jnoj: in smarirudtc tranfit.Scra. 
Ii.agg,ca^aric9efimtli adici anuidcn fjeft 
mim> wirus a ipa fp6giofue.er putat^daq» 
firradt>bcrbe.£tquida ticuntcj' gcncratur 
cjputrtfacrioneat bo:um ficur fungue.£tta 
rcpf ue e ni£ arbo:ce fcrbin rtifi quia cftf acile 
frangtbtlie ct cebiTfo:tttcr.i cft radijc fpcgio 
famolf fubltaric.2 et>mf(pc\ msiail^H fcmt 
ita.fcd fcmia babct gdarim in fc ficntrunicae. 
2£>afcul? #o nobtebct mnicae.fcd ct pra fub 
Itanria ciue continua.ct fcmina dt ma io:4$a 
licnue feprimo fimplicium fatmaco:itm capi* 
tutosc Bgarico. Sfiaricueeft ficut ratijcj 



flutdtplantaqn9fdffuBarbo!«caKcle.tdi 
moefubnuemfuaccpofiriene.-i fu&a riuecft 
ccpofitae|cfubftatiaacrca:quam fubtiliauit 
cak>:.ncc in eo cft alic\d aquofit atie oino.-z fa 
po:e dueculccdo aliqua in primie rii obuiac 
«uftut,fccfidario fa> eft fubamar?.-: in co ap? 
parrtah'quantutoacutfatiecuftipticitafe.ct 
virt9duedtca.-:fic.j£|cqmT»oft»copofitu5 
dlfarmacumccfuoaaercatrcrrcftria colo« 
fubttlia/flcquaqlto parricepedtaquofc.ee 
iptcrca siafoKticftft f m ^rutc et grolhrid V> 
cifiuieOfte agadt ficut radir fine filfio. (5 no 
fic tura craue genera funt©uo:mafculue % f<? 
mina:mafcuhie rorudue eft in fc coUecrftma 
ioUcmina $0 pcaini e fitte c] capilhfcifcernii 
rur.radioe mtrrit cii albcdine:glauca videtur 
amboto gufftcftv nue^mo t>ulc^ poftca a* 
maricae.ftafrif inarabia 1 infamaria 1 i po 
to :d, eito eft mclio:.£ft d $tus calida 1 ftipti 
ca?T>iafo:crica.f3o.inca.t>eaga.2lgaric9 
dlcjc medicira'6 magni iuiiameti:cui9o:t9cft 
fccuearbottecjtoaccicttrcottofio t purrda* 
ctio.£t dvgcnerario cft fteutgeneratib rugo? 
rum.jprcrqo' quidaejctunuerutct; fitfungne. 
1 vidcf $ St.Ec ciciafci>crut<r fit ficut apa fa 
ctucicputrefaai6c.£iu8 aut t>uo fuf gcnera. 
fcjmafculSt fcmina.mafcul^o cllmal?. , z eft 
illc c\ cft logue % saie.% bjm fracturl fuis ficut 
ftductioeeneruo?.': di tmrue-i^cfueJSga^ 
ricue aot quefapicteelaudaucrunt cft fcmtna 
l^bce^aetateecincpbonae.-i^p^ievtfital^ 
b^lcutexvdodo^rrangtbtf-jpotome^ rai? 
rue valde.-: vtapparcar i pncipio ©ulc^ gufi9 
ci9.teindefucceott d amantudo ifiiptiafae* 
^mdio:£6toti9to^iecftfup.io:p.eipiue«a 
fttpeeriuedtn6bonv.£ltct..in4aicini}i 

!£pf rattonts. 

f -f>an.ca.]t|cc|.SdmcT!ruaj)uocacIa accipe 
fubrilifTimu pulucrcagarid^ pfice cu eucco ri 
daminie 1 olco ct calcfac ad ignecuJbofTtK* 
inrincrafuppcnaf.f £onrrafiftuy acarc fa 
lcmcoftiurartaruct ana^dfactoft^rihiTttno 
pulucrecumcUepficcctfentainungc^impo? 
nc.offa frac ta ejcrr£bit:camemaUin couodit 
cffiliulafanat.f £6tramo:feaalbI pulucre? 
falie.coPti tarrari 1 agarir upone fupmo^fcaj 
priue facta fcarifica ri6c.^pY a f'P e alro ca^ 
dentifcvriliteradbibef.bibttieobuhe tuoto 
cutn virJo:(in6 ftb:iunt. fi fcbauntcumaqua 
calida.f £patici6afnrarideet©ifiuri}eet nc 
frcricie t r \ crcrtae ma^tunu pftat efTecrum:ac; 
ccptate co.jjumalucalotem cmcndat^ifmi 
mccSicat^plcnerideriiojtimeueauriliafur, 
fBgaric^omdwerrijqajtttoiangwncsb 



a 



Btfttthiti 



fhnrt.trtgcfttoncVdcbtnr.obuluevniuecum 
aq acccprus solo:e" metidi copefcir.cpilcric; 
cu^ufca r riltra t>af /z oce cae intraneo:u fco 
low curatfm #rnteboie vcl aarie t>ar9*Ra5 
jg al^ecuaqua©2ndii8c.atr!8cuvino.fllrJ8CU5 
orimcUe.3ltje cil muira.fSc.an.gal'. Sgari 
cue rcfoluit gtce grofi"ae:a aperit opilariocs 
quc funtiucpa tci in renito.,£ rcurat mericit 

•fa sm q acctdirab optlatioecparie.f £t confcrt 
^pilentie:? curat rigo:ee feb:iu: q pringtlt &b 
Jbumo:ofirarito groflie^teonfertmoJfitotv 
ri vel alfcrt'9 atalis venenoii qii ponif ertaiuo 
loco cmpiaftri.£tbibif ©eco qnritasaurei.i. 
cu vino mijcra squa.tcmedicina lajcatiua. 

• 3 f £tideauc.*Redago:ae,ip:ieta8 aue eft ? 
ftegma amelancolia.f £t ide auc.*Raf . jin* 
ueni vir ab oito boito q- purgarbuotts noci* 

( .♦£ uoe.f £tideauc.&umaYinub.©^?riaca.et? 

pellit bitowe a neruis % cercb:o oim.ppact arc 

^ mtrabtliqeftinco.f£tidcauc.abemefuavJ5 

due^ncr ate eiacorcfl egma ,t eft priuj venc 

ni8f£tideauc.abiic,2lgaric9pursatcolera 

sjs ctflegmauli-zfomficatmediciaemagnasqn 
mifcef cueiettfacic caepenctrarc ader.trana 
cozrne.? eft priue medtcuue mouifetie qua n 
doJribi?autmifccfcuaU}8medianie.f J5aK, 
na £icpurgat opilationes quc in vifceribue; % id 
fctcricosianatqficecopilatioelabo^tepa^ 
iie.pffft au cpilcticte ob candevirtutem. 



(Tapimlum.t]E 




^CTw. 6rimonia cft baba omntto r? ora q & 
J^fcrrariamino:,£>vaf.fiKe eft in oibus 
. " -*■ agrefti papancri vd berbe ammomi; 
£>ed in boc fcifcernif q> caput fupine b? lati? 
U8 ct fcriue flo:cfcit:nec fio:e facit- ira fenieeiS 
fedcroccu/Raditcftilli rorunda t>co:fumep 
cj tnmitrir croeeu acriorie vimm'8 fuccu c\ co* 
juenic nebuli oculoj.l^afcitunn capis vclcir 
cafepes/RadijceuwjS: aipato:w greco no? 
mine.f-fMi.caxe agrimonia.3 grimonia b* 
foliaequalitcrdiuifaapumodo^aputincari 
uculopapaucrieTttoeilris radiccm byxmns 
wccu6eitcrocacolo:5acriectacutU6;'Hafci 
turareieapudnos, 

^ptrationt© 

f *fi>an.ca.t)eagrimonia Sgrimoniacalida 
c-zficca.£teftt»iuraicavalde:qucviridi8trt 
ta-rporata antracee.i.puliulaemalae fanat. 
f j£tadfcrpaumotfumrtcanteabomini8 
rabidi et cotra vencna valct.facu: t ad vcnrrj 
t>olo:em flc potata.f 3tcm vurnera cancero 
mata viridtenitaet impouta fanar. 
f3temfapehtilmo:fum.5.q^umviniciati8 
©uoto t>ata tifcutit mirifice vcncnu.f [Bd 
cutTum ferro cu acao impoiita facit icrrucas 
tollitficfimilitcr.fBdfpleni8t)olo:cincibo 
topwconfumit.fTftadijceiusinvinococta 
ct potata :paralitici8 p:odcft J3alienue lib:o 
srinamidia^captrolo #cancrot>iat ipamva 
lcre contra cancruper ps futnpta. 




21 



£ 



i 



Cwrtattts 



16 



^CTy j3rtfcltum.£5era .li^gg. cap.fada*.f. 
Jf^agrifoUu.&grffoliumdUrbo: cuiua 
•? frucrue vocatur :Rabacb. cuiue fcue 
™ntfpcciee£jna eftafrieraUaeftfcabal.fjal' 
T l nab5fpinae:fcdacurafolia:tfoliaalrcriii8 
lpccici.f.&£balfunrlamr©mndajaduear> 
%oibab5fpinaa.tnabacbc]cafrifHntpar«i« 
mclicmKjccisfuntillt q funt q: illa regfone. 
•z funt *>ulcio:ceoito alueet mcdiocrie odo:$ 
i arcmarifanro 8 comcderis ficut alia a roma 
srica.£tnsbacb ejcrabal funrmaio:c8. 
%£x idc aueOfaaceben aragiYRabacb i M 
cut fo*ainrrigiditatc:ctplu8ca in ficdtate* 
^flt:vr|/im/ar.caJoto8.i.agrifoliurn.j£ftar 
%o: ftiprica quide no multu participat quaftf 
cate:et cft fubriUuparriu et uccatiuus 

^perarfows 

f Sfaa.auc.pYaf.0n coquif agrifoliffctmi 
aqua aurcu vino f mnccctfitareeonferrflujEUt 
mam'cl:t flujeui vetrSqn fit criftere cu car: ftri 
^t racWcee capiUo^-r.pbibet cafum <x>%$>& 
cocno ferrarurcUgni ri9qn bibif et fit criftere 
aieo:pfmv4cmtoct curfui bumidiratu^na* 
trict8anti4.trubificat capiltoe.«ct ecftringie 
radtcce co?nccadat.f j£ridcaucJ?abcgue> 
fsr* Sgrifolium vd nabacb ©ulae lajrateole 
ra qcft in ftomacbo % intcflint8« rcp:imit ca 
ttdirar&f £tide aucalbafatfflabaeb ftrin* 
git vcntrc et rcpmit colcrarz cft^rauis ©igefti 
vt\\'i qfi no bn eft marotfeftinpricus ct reti> 
nct vcntrcm fcariter.-z marurus ©ulciecft mtf 
ntte Itiprio; o to a laer»; dtiue ocfcedit ab o:e 
komacbyptcr ©ulcedinc q cft in co :ftringir et 
rep:imit coUra:ct vfue cius minufrtnduat fa 
fitdium.f £tidc3 auc3faaccbenaram. 0ft 
nabacb.i.agrifoliit comedif ante cibu cft meti 
o:c£ptouocatappetirum.£t bniufmodi res 
qtiefuntiumieficcequandoinumunrburoltf 
ciitatcm in itomacbo aucin intcftfnis pmunt 
cse:et inducunt flutum ventrieXr folia eiue 
oim terurirur ct ponunf fup, apoftcmata caU> 
da mallificant ct refoluunt ca. 
f jSaUcnue.foerramrcUgno^ews adfLunt 
muUcb:c copctunttf ad vUacae ©ifpofirices 
jCoquituraute^qnc^quideiuaqija:qnq5 au* 
tcinvinoficutncccmtaeiuba:anonimmiri 
tuffolumfcdbibiRir.atuero ( peo q> fccfiucn 
tee capiUoeeainet nomo dicu ftgntt eft. quo 
jtiam liiptice quide' c5 eoq> ftccar jnodera te 
aivirtutie.Pictumcftaninfermone qui ce 
laudamo:taU'edte>opo:tet ftuiiejqtf scba 
s>i»'ncre capiltoe «ertucnt^s 




Capitttlunntf 

^V^nuscflftus.-fSlatcoit li.t»c fimpUcf 
l^Jkmcdicfnainca.t>eagno«fto.£ftfrii 
^** retin qrro caUVrffc.O mi rp.crcp.if vtf 
ridie:ctmagiein tocie aquofisjminueaut in. 
ficc^Etfuimedicine ccpetut folta mo radit.fio 
rceeriamag^oeeiuejuccariunoiafxiirgu! 
ta $o a quibufda fakceemarini oiauiFjEii» 
nacpficacecfacbcntin rcccprione poniverc 
colligunrur.ac p, annu in crTicaria multa fcr* 
uantur.T>t'citur on q: Ubidin2rcp2imer»do ca 
fium rcddit vt agn9ca.ctfic.in.ii5.gra.f % ui 
cen.li.u i ca.t>cagnocafto.£a.in.i.gra.fif.in 
U.£tcftrefoIurtuue^jbtiIiatiuue.t>ifgrcgari 
uueventofiraru.tinipfocft ap.no cii fiipticrt 
tarc./£teftrcmotiuu8!aolo»e.f©cra.Iib» 
aggrc.cap.amariKdt4.agnuecaftue^t cftar 
fco:abzae fcmcnciuscitif femen agnicafiixc 
notamrpiperclla:te^ipereunucbo?.':funtei 
fcue fpee.? t: Kiftoewq' rdigiofificrniitbac 
planta fub lectisad rdrenandu Ubidme. i no 
minaf loginfl)tcr©uriacm virga? ciue. z cft 
planta in niagnimdmc arboj.Tiafcif jpca^ 
qei loctafiiinto Jjj virgae turae ad frange 
du.i foUa aue lur lunilia folne oliuaruj r.tft qs 
funt lcQioia maio:a ctmoUio:a.iz.r.qda fpco 
■ buitie ptanrtbabaMc purpurdut quedaf 



Bt&ttbfa 



7X 



s 



•e> 



idanauc.0at'.qt5 admifirafur ccilla arhoie 
eftfemaifolia a flo:es.,£jcfemtm'e quidci ftq 
rum fubf tari a cft fubrilie valdc.£ t cft ca.tiic; 
in.m.0ra.fl*6alic.ri.fim.far^.tcagnoca* 
ftoOfdadqtfadminatrafctillaarbowinme 
dianafuntfanattfloe.Etfaturiie quide et'9 
ct ftoriefubftanna cft fubrilifltma rz in fapo:e 
cius eft.acuitae fiue acrcdo aftipticitaett vir 
wsciueeftca.ctfic.tiuiij.gradu; 

0pfrationt0 

f Xccmeejccofactuereprimttltbidinc^o* 
mentenftgenftattaaaq^ccocriwetpfine-r 
fuccue ctiam pofef.f £ontra gomo:rea flo? 
reeauevffolia^ecoquanfinacaorraddito 
caftorio catbaptafmenf goiiraUa Ualet cnim 
agnue caft9 mirabilitcr ad ttbidinie atinerio 
newanicndofpusTcofumeck) fperma.&oc 
fimtltterfacttruta;maio:ana:a'minum:cala^ 
mcntii ? anetu:fedtn boc poterio: eft agn9ca 
ftiie.funtenunca.apcririua et ettatuatiu& 
SunteriamaUaqueejmnguntltttidman tri* 
fpifiando fpcrma et cogclando:vt pfilUum: fe 
men lactuce^citruUi.inclonie^ncumcriepottu 
lacc.fcarioIa?.acetunt«agrcftafumacb.cam 
pbo:a et fimilia.f Jn fucco agni calri femiml 
teniaUi.54ij.t cfute.5.r? .coquanf .ct mane cola 
tura©efleueoflegmatt'co.vinuctia©ecoctto? 
nte agnicailimijitucofcrr. f Sgnuecaftus 
© imittaf in amurcaolci vt putrefianer addtr o 
vtnofo:tifiat©ccocriocotefur:ctaddifaccra 
ctolco fiat vnguefum,cuiue inunerio' fplenis 
©uririccidtcc3f:etciue?fumttfupcrfluitafcm 
ct ipfiue orificium anguftat.ad mcnftrus p:o 
uocandofiatfomentiimccaqtta©ecoctionie 
ipuueacentrugaUi.f £ontralirargia5 fiat 
©ecoeriocuagnoeaftoapio-z falaia inaqua 
falfa:?fo:rftan^crorejceapofteriei ge ca* 
pirie.f Scra.auc.6at3 gnus caftue abfei 
dif libidinecoitue.tmajcime qncomedirurfc 
menciMf ^t^uocatmcnftruaetrefoluita^ 
poitcmara ©ura qucfiuntin mcb:iecp:po:!; 
f pvaf.S gnue caftus pabibourmedcri fa 
penrummo:fum.3tefcm^ctuebibKubYdro/ 
pKisafplencrictemcdicatur.fXacmuliais 
jpuocat . mcft ruie imga'! .bJbitu.5.i:cu vino xti> 
tm'.ejcringwrva»acm.t>olo:cnteapirieeom 
mouer:adfcibaie fomml.fJ3alte.23gmje ai 
ftue abfcindtt libidine coirue.-r maume qn co 
meditur fcmcciuej£f agnue ca fiue a multcri 
bue arbcnienfitointecro ftanif:arep:imir U 
bicine.f Buiccna.Ouando ejc ftipinfo rius 
(iemitur fub doifojbtbapollurione a virgc 
crectione,f i £tfurr«mi0af«rinuticrcecave'/ 



lbcmene'©c(idenu adeft coftfKf Vemoucf f tt& 
f!Saa^uc.pvaf.©emen ipfiueqn fumif 
in poru :confcrt moifito venenofie.er confcrt 
ad bYdropiftmqnciceo fumufur.j.tj. cumvtf 
no.?#uocatvrinamctmcnftrua:at>ebilirat 
virtutanlpamatie.? iriditcit fodam 



B 




Capftulunnp? 

**3YXgamarina eft bcrba marie babens 
3f^foliaiongav£UJtico:rigtc.etnfo idio 
* "^mafevocafatga^aniarictcctainlit 
rorifco inuenif.f •fcli.ea.tc alga.Slga nafof 
inac^eftannco.tt3©cniq5KojTicnfumplif &\> 
algcacacwe.velcy aUtgetpedee;q cr.afia cft fc». 
tqe^qua'cicp.fefutJantibo.^Pvaf3lofacb# 
neincidce qdecft vcluri fpuma marjq paria 
infider.? rcmanaqtf noeslgam vocanuie. 

j&Pfrationro 

fpY^f^w^ri^efrfiefali.inprif^p.aifttf 

retnparalift.fctteicputrcdtnevittatieinftltt# 

ni8,aliemtatectrcufaibft.ttutcbabctftjnik5 

fatuttntroftipticam fimicricama leptinatf 

eam* 

fptiltnferirietfctattcieflnttquieconfertcri 

fterc ciue.iomcnto fimiUta vriltedt 



Crartatuis 







f0cra.auc.£Yaf.airru8foUo£aueflu?ti* 
cacft.j£ttoqnmalticanfcaratalcoU.f£tin 
fundifoecocrioauaftipcr cobuftioneignts 
ff£tqfoantainfurid£inaquaaftaraaoe< 
■zlinuinf wdecapaiifiutrubei.f £tvngueta 
qucfiuntcicca moUutt neruoe. * facit inrulj 
neribueiUudqtf facftflguiewacoie.f par. 
cbibcfpuatarione puputcct combuftiomm 
ignis^t qn coqutfin aquaKt.pnaf aquauTa 
fiipcrloalcobuftioni9.fj£ttpaadminiftrae 
injncdicim8bcrifipux.fj£tc6ucmtvUcrib:. 
teUoUquefiuntinoKpuaoaim 



^GVXcarata l3.6rc«a'p:u8.2Ucannacft 
3Tp atbuftuvndefttolcumapanu.acfttt 
& ■* Iud quod *e alcana vt appara pa co 
co:diam.fSaaJi.aggre:ca.benne.i.alcait 
na.floealcannc cftfimilie floJibusnim.nifi 
quia cftin raccniis.-z floeciue cft atb? t>ecu 7 / 
nane ad glaucedincaeuriodoae.£r idcm au 
ctoXjaf.£ftarbuftubnefolta fup:a ramoa 
fuo8(ttiafolii8oliucjnifiquiafuntlario:act 
molUo:a i viridio:a.bab tf floKm album itlcj 
*fnccboniodo:ie.fcmc n igru fife acrie. i qtf 
tcipfa adminiftraf umtfolia h fiimitatee i& 
4f •^latca.Slcanatftbctba in trar.fmatinis 
parrito i ctia m in SnciUa copiofe inucninir. 
£ftautfrigida in£mo.fiecainpnctpio fctfi. 
£tq:no vbiq?repcriripotcft:quicam babet 
puluerifant.tficpcrrcgioes^cpottat.puuiia 
qsfubntgri colo:i6cft.pcr annoe tresfcruaf 
/ttbabetvirrutcconfoUdaudi-zejitCTgcndiac. 
mudincandt.f0al:vii.fim.far.cap.t>c^ip:o 
f tn traitationcm arabica .£ipate.i.alcanna. 
buiue arboue folia i cttrcmiratee ad vrtlira* 
tcm gttenerur.fubf iantia ciue cft compofita cjc 
acutaca.cutcpcramcnto:ctfubftantiatcrrca 
frigtda ct ftcca.et fapo: cius eft fiipricue.* vir 
tue auepeficcat tinc m o: dicationcUndc vir 
tus ciu8 repacurit i t>ifloluit 



£ 




(Tapituluinjiift 



WXUumtiaucft:cocr olcat.3mb:o. 
}**m bcicamaon U.v. 2UUum tanta vim 
^ ^odoriebjvrlcoparduscumfuftinac 
novaleerfugiat.andcfi c\e alUum aUcubt co 
fricaucritJcopardiisintercfiUtjHccrcfifrit. 
^•fclira.ce bifto:ia naturali li.jiiic.3 Uium ad 
mulra rurtep:ccipucmcdicflmcnra .pdcfiecre 
dirurf 23Ypoaae in qda cpta.&Uium calidc 
dt ^rurie.jt ft auraperittuu cr abftafiuum:c6 
foUdarvlcaafraudulcra.fRabimoYfc8ca. 
©c alUo.crca ,t>cfco:dcon.i.alUt;tn agrcltecft 
caltdu i ficcu,puenicne vfq5 ad quaittitn 
$ -fcalladiue U.ij.U^cfcDanua3Uiu$; vlpi 



&tljttbi$ 



a 



s 



aimbcncrmpofcft:fcdalio alba fcrra piofi* 
cjerOdcm in li.tti/.iftenfequoqs 'F.'oucmb:i 
sUium a vlpioi .ferinir baiererra maiime atf 
ba fofia ct fubacta firrc fiera>:c.Sjtilfoetn ae 
rioopozcetfieri.efinloaealaoritefcnrina po 
ni.qturiiomgirie fer/erarajncc alttite.fofls 
eqtfref l-ircnlsda fiinr: etindc pirfefccr . & uic. 
iiu M .anonc.3itiiiHnah'udromefh'cum.aliud 
ftuicitroquod eft amaruin et UCpricuj.6 ft eti> 
am aliud quod tricitur pomitum. £ r dt rom 
pofirc v irrutie ec allio et po:ro£ft et aliud q<5 
■©icirur aUiumfcTpmtie.£fraurcmaUium ca* 
lcfaeriuum et cdiccatinuj in rcrrio vfqj ad qtf 
wm.£rfiludrrcplii8alio. f iT^feosiOesM 
2Utj gencra v>uo funr.fc$-o:riuu:>. aliud quod 
in,£gVPto nafcirunfed nonfaris fciflimilc. 
tlirtus citis dt rifcida inftarili8:fliprica:caU> 
da.f ^oniiantume.SlliumtHipu^.pomc* 
fticum ct lilucltre fcj fco:dcon tJomeflicum ca 
lidnm clt in mcdto qu arri gradueOdej in pa 
tegni.S llia calidio:a fur cepis ct ficcio:a. a cu 
tafunt:crt>olo:em capirie faciunr.quefi co'r 
qtianrur ardo: lUeamirritunporioni cjjcibo 
melio:a funrXocta magio mirriunt c& cruda 
faniratcm cultodiunt .quia naruralem ca lo:cj 
eonfo:ranr.t>igmrefacuHir. 

Bpmtionts 

^"PUnimVbioxkcCimo^llq magna vtee 

conrra aquarum cr quouimlibct loco:u5 nntf 

rarionee. 1 4 

f 0do:e fcfpenres abigir er fcoipioes odoie 

£r omniu beftiaru ictitomedetur.ac puarim 

contra cmo:roidas cum vino illinirur. 

f £ontraeahi8mo:fU6crinvulnera cu melf 

leimponitur. . 

f ©ufpiriofiecocrum.au'quicrudum.altqwi 

ct trinim iu lacte ocdcrunr. 

^ibaraf.aso:a8^t contra mo:bum regium 

vinomifcuit 

f £t conrra vlaun in olco et pnlfe fic illiniunt 

anriqut et infanicnribus Dabanr crudum 

f OYoclceauranfrcheticus cliaim. peimiij 

t>o lo:ee n tbus capittbus in accro trttie inimi 

nuif.vcl fi aqua tecoaa coUuanf? in cocaua 

tcniiumaddatur. 

f •^rvriafcs cr pmrigincs fahar porumarem^ 

cgcuin acerovelnitro rufujXompefcit tifiil 

latidnes cum lacte cocrum vcl tritum.vct a,m 

cafco m0lUpcrmijctum.0iiogcnere2 raucita 

rcut qcrcnuarXoctum vtiliU8 dtcrudo. 

f ^tneae ct animalia rcnquaimrancpf pcll ' 

utinacefomulfococrnm, ' 

f Xenafmo in pulremed erur . Xnffim cura 



fuadipcvmrflovelallacrecocru.aut fi fan? 

guieaiaeiccrcrurvelpurulenra fint. 

f facir et fomnoe ct ror um rubieundio:a rot % 

pou.ventrcquocp ftanulat.aim viridi coitt 

androrrifum. 

% -fco:ro virio rius funr:quod oculos cbetae tfib 

inftariocs facit.ftomacbum lcdit.a eopiofuto 

fumpt um fitim gignat 

f -|Slar eartite.B llium inquir groflam triflbt 'B 

uit vcntofirafcm:vcntrcm bumcfacif. lumbu* 

cos cr afcarides cjccludir:vrinarn,puocar:mos 

fumrabidicanie airar.ctocriamqiu malam 

aquam poraucrunr fubucnir. 

fl £araplafinani5 loris groflbs bumozes ba . 

baitibue txflblttir. 

| polo:cm t>cntinmt>e frigtdttatemttigaf. li *> 

tiin.pprer ftcgma coagulatum ftomacbo am 

putat fcabiemanotfeam: imperigincm: ct pu^ 

ftulae \\\ quocucj? loco fuerinr:potenter curac 

fietcoconficenfur aut caraplafmentur. 

f 'J^eftrua etvrina8;puocar.fecundinaje# IX 

pcllif fi in citis opojimate mtilicree fcdcrinr. 

4 i^ilucftrealliumvirrufcmbabcrltcur to* "R 

mefiiciKrame calidiue er ficnus eft ^5ec xxmtf 

nice infpcailo naruraliaiccnrqaibw jtusp* 

ItviXribickmpluraaUa 




Crartatus 



Capitulum.-ro 

_Xrca cftagrcftiemalua ftucmauiauf 

»feue.Sjcd altca r": co cr in alrii furgit 

L tufctie afit cr gliirmofue fir cr f^tionC 

inis.ZJirca bie malua: cuif(ue:mfl!uauifcue: 

iWaie.jjdccfi malnctrifaiefolui b^rottmda 

fiairpanie p:oan9 Pop aue rofc fimilie.radijc 

cjnufciliJgirofa.jElrccpIciiioa^calidacucq^ 

tirare. f gaf.r i.ftm.far.ca.£ uifcue fiiic alrca 

£rcft mauiafilueftrt'et>Yafo:crica cfh lararf 

«»:no vrce.£bftcrfiufl. mirigatiua. digcftiua. 

^otsirticilctJificJ.ibiliiilfDY^f.c.alrca.^ilrcfl 

folia funr cirort nda fimilia cic lamini. flo:cm 

b^rofie fimilc.biifta tuotocubirie longa:ra^ 

dir cft illimuftilaginoffl.': intffllba.? tiz alrca 

cocr furgflrmaltt;m.£uiftuequia glurinaf. 

JScraji.ag.ca.remflluautfcoiRadijtmalua 

«ifabj^fufcftiprica.trori'; bcrbcvolo fcirc* 

rc;ri!dtcie:r3mo?:f o? 1 folio?:-: ftminfi.vntf 

virruea' 1 ; cft q ttficcanvcru radijcz ftmcfunt 

w*$l tcficcaiiua:-: pfue fbriltafiua f 0al'.vq 

ftni.far.cfl.rcmaIuafSlrcaflucmaiuauifc9 

n%te tvaforctica cft cg maluaB uice\Ii.n.ca. 

*>calfea.:B Irca ca.(ftcujcqualiffltc.tlndcm 

»Pfa cfrlcnifieatto ctrefotorio:ct fcmentradijc 

•Pliue funr in virtuf e ciuc fo:tio:a p lurimther 

Plurimu ctficcariua arcfcluriua 

€>Pfraticnr0 

f *£and ccta ca.Rqc.5olia cius rrita cu arun^ 
giactaliqntulucalcfacta'z fup,pofira apofte* 
mara maturaMDuriacrclarif: mollifieat 3te 
fociba cuipa radice tccoquaf fcrcad pfilptio 
mm.£t fic appartbit^ds m v ifcof iraerq fuc^ 
ponaf ? apeftimara maturai :t>urtcce rcmol 
litsrclarjr,£jtaq arati9 addira ccra? olco 
lirtcpaeevnguafiadpttdicra. 
f3qu3fcccoat6i8ftminfiipiftmfllucvalct 
p ttiflim fkca.et pfcrr abicte.Sjtmina aia ci9 
rcrata cr in olco tccocra turititm foluunt 
f ypoirarce.tlulncratieac fitientttctcfe* 
ctu I anguinie btbcndu t cdit fucefi tc coct c ra 
dicieOpfcmto vulnaiba cumclleac rcfina. 
^dcmqtomiulfieltuatisnmtntiduetrmu 
J culie uatite arric tilie impofuir ct $ fmattci ac 
r ifiinta icie in vmo bibcndfi t cdit . 
f auic^lltcanomcutfircco tcriuflmmtcj: 
puirii.miuuamcnto:unominc.cuiuenatura 
calidacftcumcqualitafcOnipfaftintlcnifica 
t to maruraiio cr ir.ollificat to ct refotario £?# 
mtn ct radijc funr in ciue virnirc fo:rio:a pluri 
nuim cjtftccfltiua ct fubtiu'o:a 
f Xcrurur ft:g tr.o:fcs:ni a;m accto.tr ollificat 



apoftcmflfactpjcbibct ca.cr rtfoluit fcngut* 

ncctmaniratvulncra. 

f £onfcrt ar/ofltmartto inflatie:ct fcrcfulie 

ct valct ad t uricit m'matritie. 

f Scdar tolojtm iunctnrarrafl.ctpJop:te'cu 

adipcanfcrie. 

f Z^urr o:c -: infla ticcj rcfoluir q fr i palptb:t 

f <©cme £ i H8 ftifis calide confcrr.cr fatile fpu. 

rumcfticir.p:obibcrq;flutum fangumie cum 

virrurc fufl ftipri(irae.ciu8 folia conferuYapo 

ftcmatibuemammillc. 

f £ r ponif in t mplaftrie plcurcfte et paiplcu 

rr onicctii e q? gi mi finm fcdar . 

f pccocrto raditietiSbibirapfmvrtrie? fo 

rtft ino? ardo:i.ctapofttmatibo am'. 

f ^Yaf.ca.i^olotbia tumadipeaafaf ge^ 

niralipartiifuppcifirfl abo:fum facir.^nunus 

cft ftomacbo.vcnrrtm mollir. 

f 3tc vulncra recctia foIi}8ci9curaf: folia ci9 

trtra t tpofita fco:picitocrcdunf atTcrrc to^ro 
rr.£adefcmoriaIligara ftimulat invtnrrtm. 

f £adenigra lana obuolutatalligafa ma^ 

marii vicia pptfcirOte-z.idecap.lS Itcaj i e 

cmein mtilfa coctue aut vino ctt unfue t im 

polituevulnaa curat. fcrofas fpargit. 3fcm 

cicatricce vulncrfi curarc facit 

f /Clira ^ o cr ti ita addir a ajiugia po:a'na aut 

anfcrinacrrcnnamtbintina:trmo:c8ftcri* 

cos cr oftocaticce appc ffra mcdcf . 3re ch>a^ 

ruraciSr; oia facac nouir.': fccildinae cjccludit 

f ©olain aquarotra crfcmeraffl infcftiro 

mm toIo:ctcrrio ticfancbtr.l^ofipficjLpari 

ftimue ty rrira oi ajcungia vcrcriT ircpofUfl r o 

dagrsmi rcnia tfe fanat & multi titut sucro 

rce tollcctionce oce vcl t urictce quc in co:pc 

na,fcunr:tccocracfifcnugrccoctIinifcmicpci 

Iincimpofitaaufcrr. 

f®crapio.2IItcapjcbtbctapcfttmflfa:tfc 

dflttoIo:c:^ maturar curarae trm cft rccte 

ct radijt; quidtm tius •: ftmt n:q: in cis cft vfrt 

riis afcfterfiua:curat mo:fcam. 

f £tf(mcnciu8frangit lapide rcnuxt acrua 

in qua tccoquif.radir ci9 p:opf fttpritffartm 

qiiccftincavlccntoinrcftinoJfitfnjtuivcrri 

ct fpura fanguinie confcrr. 

f £r qn coquif fola arcrirurxcfcitcjirrurfe? 

apofitmatito q apparcntpoft flurca fcrofuf 

ytttcfatapcfitmantoanicalidie. 

f fialitnue.^Radijt maluauifc ietfcmf miahja 

uiki virida inrtnfiue qdc m cpaanf q fcn b a. 

crmagie abftafiuem oftcnduntvinuttmivr 

n o:tt£m £bfttrganr£rftmc tiutdatlapidcjB 

inrtmfcotonfirltntte. 

f^adiraut(m'itimnrcric^tiame;rj«r:6n 
m.ifi ionttc farguinie cfi vtilie. 



s 

X 

•H 

o; 






BflBfrbio. 




Capttu!um.jEuf 

^jwXletuia vfluvula vel pants cuculi.lnY 
J^fula berba eft acerofi fapo:is.;foliu$ci9 
3 1 -^eft paruumettripliciter fciuifum,?m 
cacuminecuiuflibetparriseftaliaincifura. 
£>cmina cius funt in vaginulis fimilit» co:ni 
culis.que cum tanguntur tempo^ manirar io 
nis cuolant ab et'8,femina funilia andacbuce 
tendenria ad rubcdinem.et vocatur 'srifolmm 
acetofum,ficut apparet in eap^mfoIiumXrt 7 / 
folium acct ofum: id eft allcluia, ponitur ada* 
mafceno invnguento Svafintcon^etvoc^fur 
ipfum trifolumV. <tf ^linius ca.bacbacl id eft 
trifolium acetofum,folia floies-z fructus funt 
frigidi et ficci.folia tamen funt bumidio:a p:e 
dictis.irucruevel feminacius mamraaliq* 
lembabent 'oulcedinem. 

^ptrationts 

H Xuvulaliueiallcluiamedef vlceriborio et 
f iftulis.ftmtlatur in virtutc acetofe filueftri.eft 
ftiptica.cofolidat vulnera et vlcera.f JS?ucc9 
eius vatet vlceribus ons antiquis et alcole 
f ^lfoi^cap,bacbaelp:opteraccfofitatem 
cril tente in ipfo valet ad alcolam:et aliae cgri 
Wdinesoris. 



CapituIumjEUiJ. 



.XkekengivelkefeenfiiJSerapiort Itf 
•b:o aggre.3lkefcengieft fpcciesfolaf 
" tri quod ©iciturl fcckcngi.quod babet 
folia'fimiliafoliJ8folatri.nifi quiafut larioza 
eiectramicfusquando elongantur ©edinat 
inferius vcrfusterra?. et babetfrucrumin cbi 
fti rotundum fimilem vcfice.-r cft fruetus ctus 
granum mbicundum.fimikm vue qucm qui* 
damktkiliumvocanr. 

&pfrariom0 

f £*rapion.kekengi quod quida nominant & 
Rakabum virruseius cft cf frucrus rius p:o* 
uocat vrina, f £t ideoladmtfcetur ifte fruet9 & 
in mulrie mcdicinis que confcriit cpat i vdice 
ct rcnito.-z bec bctba adminiftraf in medicinio 
ctnon comedifa frucnis bic mundificat ictcri 
tia -r ( puocarione vrine. f j£t idem aue.babi)C £ 
Slkckengi eft aliud montanit aliudf ilucftrc. 
et eft albu,ct eftf fimilein fo:ma folatri fuperio 
ri.f £t fuceus eius btbitus puenit apoftcma J> 
ribus tam in frinfccis cg ep- rinfecis.fjf £t qn* £ 
do lintrrfug apoftcmat a ejctrinfeca eoucnir eis 
4 £t granum cius quando bibitur conuenit 5 L 
vlceribus rcnum 1 vcfice.ct granu eiu&eft fo: 
tiuo ©omefiiio.^ «ouccus grano? atkckcgi 
^uocat vrinam Euocatione foui. 

b 



Crartatus 




CapifuIumjEuiti 

^jvXocylidonie in ubw> ef bimologia^ 
«♦CBloadtberba fucciamariffimi. 
■■#' - A -f-^latcariue.3locfitc]cfuccobcrbc 
que appcllatur eodcm nomincbccbcrba non 
foluui^rcciarcperitur ctin,3ndia ct *f>erfia 
Ucruetiam in Spulia. £s fuccue vtilie cft ad 
multa.ficutt)iceturinfra.Sloe9 tria funtge* 
nera.fepariaim^uccotrinuet £abalilnum 
^bodus autefacrionie ciuo Diuerfimode cre 
<Jimr.quidamT>ieunt qtf berba ipfatcrimret 
fuceuc ejcrrabitur i ad ignan ponfrur quouft 
c^bnliat.-rpofteafolicjtponitureteicficcatur. 
3l!ud cnim qo fuperiue colligitur p:iue ajpcl 
laturfuccotrinu.Ouodinmedtb minuepu* 
mm eft.j£paricu t>icitur.0uod in fijndo fecu 
lentum vocamr caballinum. Bliqui aflerunt 
aloee ©iucrfae mancrice tteri ejc bcrbie Diuer* 
fie.n6gcnerefcdbonitatc^]cqiHibueiiftetre9 
manerieefiunt aloee.Btij ©(terunt cr Bloee 
tribuemodieeit.Onu rubcutie quadamutf 
fuIa3ndie.q»itifSfcotra.aiiudeflniStum 
quod eft t>e perfia.Bliudcitrinu.et fit in Bra 
bia.quibue omnibue laudabiliue cft fcorrotf 
Xe.pzccipuefifucritp:clucidu.ctrubcumquali 
cot0ieparie.arocgfrangibileet odo:iferum z 



am9rifl*imum.©cd p:ima opim'o;mdfo:. t> V/ 
fcemituraurcmquodcft opfimii fuccofrinuj 
eiccitrino cotozefeumfo.£tpci?uecumfran* 
giturdugptUute.apparaquafipuluiecrocu 
etty lcnitcr frangirur nec fcridu nec va Ide ama 
rum.£paticum autem colo:i cparie JimiTat ur: 
fcilicet quod eft fubnigrum.a binoride bsbet 
fo:aminavto:a venarum.ctobmfam babct 
fubftanriamct non claratn. Csballinu autcm 
eftmgrum.etobfcurametfeculeta babet fub 
ftantiamamarifiimam.et bo:ribilcm ptendit 
odo:em.quia valde fetidnm eit. £5»ed attende 
<¥ illud quod x>e namra ftia cft aromaricu.qn 
toeftaromaticue ranfomeliue.£tquod cft 
fmdum.quatoferidiuetanro meliue eiccepto 
4loe.2umilirer omnc quod tcbet babcre altf 
qucm fapo wm,quanto in fuo fapo:e eft inten 
fiue tanto meliue accepto aloCFiam cu fttfce 
namra renim amaritudinebabenmim. quan 
to minue amarum.raro laudabiliue.£t clt fci 
cndumepquando aloe fimplicitcr ponimrp 
fuccorrino inrclligttur.licafm Blejcandrum 
inrclligamr.p cpatico Scrapion ltb:o aggre. 
capt.fabet.id d t alocBloe fit ejc plata que ba 
bct folia fimilia foltje fquillc in qmbueeji bu* 
miditae vifcofa multa ^cnacadberce manui. 
afuntlatio:afoltjefquillcparum.aquafiro 
tunda.ctinduranmretinclinanturad poftcri 
o:a.ct funt in de fpine que cgrcdiunmr ab ris 
b:cuce et rarcct babetliipitcm fimilem flipift 
9ffbdillo:u.£t tota berba babet odo:c grauc 
ctfapp:cm amarum multum.£t radijceiue e 
rm fimilie canntaiic ligneCRafcirur mutruj 
in^ndiaetinrariearabumjcfintcrrie^ia^ 
attma et in inaririniearipieainfulie quetu> 
cunrur ancaroeXrnoniblum ciuegumtr.ic 
iuuamcnti magni.fcdctiam fioe ciue. ham 
quandoteruntur aponuntur fupervulncra 
faaut ipfa adberae . £t aloee funt t>ue fpectf 
ee.quaruvna cltarcnofa.acftfec.a aliacft 
cpaaca.3o.mcfuecap\t>ealoe.Bloeet>efub 
limio:ibue mcdicinie et mclio:ibue.babene p 
rogariuam fupcr aliae medicinae/Ram qua 
cfctnrauio vniufcuiufep foluiiui fitfmplurtf 
inuint>ebilitatevirtuteeet mcmb:aque funt 
mincre virturum.bec ramen tntenrio cadit ab 
alocquianon folumnou noca.\n;oinucntf 
mr ad confo:tationcm mcmb:o:um ©ebtlium 
addac. 

0pfrattonf0 

f -jSandect a capimlo jcjcjcitj .3 foc purgat co^ 
lcr^maflegm^i.vifumtlarificat.opilauonem 
fpknie z eparie aperir ancnUrua pwuocat : (a 
pafluiPt ee circa pudeda ft fint q; f rtgtda cau 



a 



Btfyttbw 






fae^crgit •rfcabfem curat.f jCo^iwtnTcoto 
raweolfljatu reddir.£ontrafe3bienu putre 
dinempridaidsrudpmrirumtrigito^qui fit 
ejcferioribus aloecum aceto confectumcrfic 
inuijctumvaletXontraartcricamioeturami, 
mccobardane. 

fl £ontra alopiriam et cafum capillo:ii i fotf 

» riln'mobuliatacao.radi|coliueverufte? polt 

, eacoleturTincolaturaponantur twepartcs 

farinc lupinowamararu et tres aloes. que ftf 

mulconfiriantur.et addaf puluie ftafuagrie. 

. ?Jnungatur caput per ©ifcriminaua* 

^Bloeepuluisoprinicsiftempaammcmn 

vino albo ecaqua rofarummultum valct ad 

p:uritumoailo:um 

§ £>uppofif oriu f3cntm cctrifera-magna cu) 
puluCrealoc8etmafticep:ouocat menftrua 
<t ^uluie cflia cum tnelle t>atu8. lumbricoo 
oecidit.£tcwnfuccopaficarieauribufiinftrt 
latuovermee necat. 

^?>Y9fco:ide8capitulot>caloe.tlirtU8cftd 
Ittprica amcdibcriter calida.et fie nimis xea/> 
trem mollif .purgat putredincm.coler3m ztlc 
gma?>cdudt. 

4 ^aumus.Sloefanat&ffiriledrca trihbi 
uavlcer3.ap:eferrimquein anot pudendis 
cofert eria flegmoni eowrn eollectu cum aqua 
£odem quo cp modo vulncra folidat. 
^3obane8mefue.Bloefolutionecdudt co* 
laamttflegmattmundificat caputabcis et 
ftomacbu.etcofettiuuamcntu magnu fcolori 
bu8eo?.£tconfcttcriaminflationiftomacbi 
a(triett>olo:iriU8ercolera facris* 
4[£tquiafiiduaf acceptionerius oicbus co* 
rin^i8.nonvidcbituKo:potefuo.?ininftru / / 
mmusfenlimmriueegntMdmcm.quenonfit 
abilis fanari.et p:eferuat a putrcfacriocata q> 
ctiamcadaueratp^priemictumcummYrra 
Xauc id t>are tonpoubue frisoue. cjccoriat 
enim.£t folutionc edudt fanguincm.jQLu3nri 
taoquepoteftadminiftraricceo dtab aureo 
f.vfq?.?.it}.£tinfufionibii8abaurco.iddtvfi> 
cpad.5.itj» 

f fijcrapion autemiu lib:b3ggre.capitulo 
p:op:io multa t>icit t»e aloe.que omia funt t>e 
mcntepYafcoridis. 

C^alienusautemaliouibicmiplidfcvelcic^ 
plicitefacta.quarep»ptcrb«uitatcm ca bic 
poncreobmitto. 

OpituluttijEijE 




«k(jv.Xoc8Ugnum.Sloavd agalapncft 
j^arbo:fu3mfluniodo:!.Ondegrecefic 
3 -*-nominaf.2lr3biccvcrobo3b.Xatinc 
ltgnumj3loc6velI]ciloaloe8Vcl3loe8lignum« 
BIoatHcimrco q*u'gnu takaltaribus adole 
mr.repmf aureinnutgnofluminc fuperioria 
b3bYlonic.cuiconiunsimrfluuiu8p3radi(ii 
Unde quidam t>icunt q* impulfione fluuq at» 
arboribus terreftrispsradificondudf. Wul£ 
lu8tamenbuiu83rbori8 ferturvidifle origtf 
ncm.a lij oicunt <$ in cacuminibus monriuj 
fup:adicto?locpmdrcap:ediaa locacriftcn 
riHo:iamrboeugnuVnmpulfuvenriauttems* 
p6u8vctuftatec3ditin fluuium,£ftcalidum 
tt ficcum in fcamdo&adu&ed fdendum o/ 
funtalt'qm't>cccpto:c6.quiaccipiunt radieea 
camdleeinrii6ribu8am3lfie.et quoniaviden 
tur 3flimilari.v tcuqjin colo» ponderc et fapo 
recum ligno aloe.fopbifticsm ipae^oncndo 
invinocbuUitidiepulumslignialoespcrali 
quoe t>iee.quod t>eo et bominibus abomina 
bilecftquoniamcamelea tnultu lajcaciua eftv 
Xisnualoe8Vcroeftftipricii.£tcamdca t>c 
fcnullumbabctodo^.fedIisnu aloeeeftfua 
wflfimiodorie.f £afli.fe,cap, t>elisno aloea 
Xtgnu aloee tribue modie dt.Qno modo fit 
in quada rcgioe.et siof caumc. £ft a liud qtf 
fit in infuia ^ndie maio:i8.et vocarar cumarc 
Xcrriu oritur in qu3d3tnregione jmdie.? ti 
fale6.£ligendueft3utem lignu Blocequod 
nondtcoctumiuaqua.'RamariJbe6faciunc 
ipfumbulire inaqua.« illa aqtia vtuntur ad 
multac6moda.talccrgo(ignu3mifitfpirium 
b n 



Kmmw 



6 






*> 
ci 



ittpancaautnuUSbabrtopatpne.C&utee; 
Iib:o.^ca.]dbaloC8C2:Ud3cJictlficcaiitfa?o 
gradu.acftftibrac;3pmtuwopilan'on«.frait 
gitiiuTvmrofitaru. 

0pfrartonr0 

flSand«cti.ca.]c)qcn.Xt0nuaiocvaUtcpti 
rra t>cbflirare cotdie.ftomacbi.cparis ct ccrtf 
bn.fiZc^aco^i3d.?rercBrionc.mcftrtio? 
corra oee paflibnee % ©ebflitatee cotdie porif 
fime ejc frigtditarc.f Otna t>ecocrionied9 t>tf 
gcmonccofouar.^T £r ftomacbu mftigidari» 
cdefacir.£r fi abominabfle fucrir ponaf parii 
Ugni aloce tnregri in vino per noae.mane vtf 
rulcirbtbcarur.ijf€)urTumigu1cjcco factime 
ccptu infcri 1 ; a muliercpcrcmbotu,puocar me 
ftrusw fuftbcarioee marriae mcdef $£5imi 
lircr trifcra magna fompta cfi ©ecocrioe ugni 
aloce menftrua,puoear^ f umue ciue e na* 
rcsTcccptns cercbni cpnfoHat.f S>imiUrer ii 
acctpif ptluieUgnilaloee-zgariofilo? ? oflie 
oc co:dc ccrui.f £t eonficianf cu oleo t inun* 
gatur capur galUansic iUa ctnoctc non ccfla 
bit cantarcf jCafliue reujc lignu atoee cofo:* 
tat ftomacbu.et oianteb:a interwa/ufifuwj 
co:po:ie.bwntdirarem e^pcUit.maamc t>c I U 
macborentofirargt>iffouiir.opaarionc apcrit 
vmrrccof^t^joiivrincrcpugnarif S5& 
rapu>n.Xignu2lIoc8clt copetenemulru ba* 
bcribue egrirudinea in.cpatc^ ad tuTintcriaj 
j£tfcdatt>olomlatm'8ctec)cfumigq6boi0 
•z&arurfocco aureuevnuezrcmouct purrcdi 
nc a ftomacbo i fonincatipm.f £ridc}atic. 
atabari.Xignuatoeeftringitventrf.-tcoao* 
boiatvifccrajfftcrmtnc^ipricamquceftin 
eo cum aremancitarc. £r erjetr fufiftuirare bti 
mtditariico:rupra?aco^>o«.f fctidcm auc< 
•Rafie.Xignn5aloc8eftbonuftomacbo bai 
mick>.€£fidemauc.yfaacaben ara.Xignii 
aloee cl t bonu ccrebto ,z fetrtficat vifcera. £t 
cjipeUtt fuenuuateebumidae.? facitfceftfde* 
refie^aacmteoqnlctofitfurTumiganb cS 
eo.-z marimciUud rlcgma qnod gcncraf ccva 
poabue afcendcnribue a ftomacbo.? cjcpdltt 
verofiratee.qf Xignu alocercmouct fufifluita 
tce bum(ditat$.?ct>iifo:tamfcer3.?p:obibcr 
fram.f £t mafttcanb eiuefacitoae odotfbo 
nuvz confoaar neruoe.t acquirtr eie vnctuo* 
firatefubrtlem.? confcrtccrebto ratdc.t cofot 
tat co: et lcnftcat ipm.? eofowat epar.-r in ipo 
citvirmeconftringcenarura.tconfcrttfc 
rcricmdacoUce f jSfidcmfceYiribtiecojdia 
t»icircpconfowatco:. 




CapituIum.jE]E 



3<*W.V£>bia gre.larintrnuncnpaf.2(mba 
M*jrf m quofdam dt fpcrma ccripfloe.£t 
•? ^"fm quofdacftrructnearborie fub ma 
ricrcfccne.vdgummt>dmanaco: fonriefe 
mati£tfraquofdamcft icotrpifcie.£tfm 
quofda fpuma mariej£t fm aubeeft ftcrcus 
ataIieinar$/cdfaUb.qm abtageneranf in tra 
XaUda e i.tj.gdu fieeain.i.circa finciooFbtf 
fticaf aut^mb^cuUgnoaloce ftoiace cala^ 
mira ct laudano rcfolurie^ddiro mufco rcfo^ 
luro in aqtia rofaru.t atpoftra aqua in parua 
qtwrirarc.©cdcognofcif.q:fopbifticata po' 
tdt malajt.arificutcera.vcra autamb:a non. 
Scra.li.3ggrc < cap-.t?ambaridcftanib:a 
"Rafcif inmarictgcncraf infpccic fungoui^ 
gcncranf in rcrra. £t qn marc rurbaf cqcit a 
runclod^apideemagnoe.-zcnjdectjatfrn^ 
fta amb:e;£t pUirumijcc ca ingrcdif inmari 
q6 eft in tcrrie gingtbext in occidetc.? flla t>c 
fcrf auiiacayde.pcferuttmilUicboic8^ no^ 
minan£mtbcrc.t.vdocc8 qn noucriit c^mare 
eo? decir^mb:a. ^cbb: aurc qcca tft flla cj 
inuentf in infulieiUarii rcgtbnu.etin Urroub? 
iptue cu ftgura roruda colorie cdcft^OUa ^o 
q dt alba ficut 6itn ftruriaie cft mala. ? cft flla 
qitat»aio:atqmdapifcccmagnic|tiicufajcl 
4cut>cglutiur capccidunf £ib ea.ernarar (u% 
aquae.quo6vidcrc8boic8tcHngtbe ( ptjciut 



IBffijrrbis. 



fupereo8vnco8fcrr«>0.tc]araf)untipro8ioc 
maruereicrrabunr amb:amfcevenrrceo?:? e 
ambia non bonaanajcime que in vetre repenf 
i nominlt eam apotecarij j>fie maiorie madi 
, Uqrilla q reperif iuicta fpina ©o:fi. % eft pura 
€C munda multu ? bona valdc.fl Sui.li.q.ca. 
©e ambM.Smbra e cali.-r fic. £t m cp fit caltf 
ditasciue in tj.-r ficcita8inp:imo gradu. 

^prrattonra 

3 4 1Sanxa»Hcitvitj.>Conrra fincopim aceipe.j. 
umb«.t. j.i.lignialoe8.et . j.tj oflis scco:* 
de cerui.q oia rcfoluanf in aqro.er filt pillule 

£ ct^inenf.f £onrra epilcntia.pone amb:I -r 
co:nu ceruiin vafe vitreo fup. carbones et pa* 
riene fufcipiar pcr os ct nares ct mulruj valct 

£ fl^orrafaffocarionemarricisqoppimrfptf 
rirualia.ponaf fftrin vafevitreo cualqs aro* 

J> matia'8«rccipiaffumu8E08vulue^S>era. 
Smb:a pfo:tat cereb? z co:robo:at ipfum ct 
fcnfus oes erco:r: pfert fenito t frigidis com 

£ plerionito.fl 2>era Smb:a virtutej ccrcb:o 
ptfftat/z ceteris fenfitofeu co:di.adiuuat qj fe 
ncs i illos q a frigidis bumo:ibus poiTidcnf. 
4 f 3ui.Bmbw puenir ©ecrepitio fubtilitatc 
fua« pfertcerdtto * fenfibv: confertpccto:i. 
£t idcm t>c virito cowJis air.cp pfo:rar co:2U 
manfoMra.ui.ca.oc amb:a Smb:a calida elt 
£ereb:um quoqj arqj co:robufta efficic 




Capirulum.flEf 

«VTy^bwfia alias ambriavagi noioe 
*^t-0.li.li.)C)cvti.3mb:ofta circa aliaobcr 
" ^basfuiemas.viulfruriccfcmfuinra* 
mofum renue.rriu ferepalma^ bj.terria parte 
radieeb:euio:e.fota> rurccirea imueaulem* 
fcmencftvuis t>ependenribu8.odo:evinofo 
0ua9ccaufaborrt'8 a quibufcli vocafab a<* 
Iqsarrbcmifia.XIownanfilla capadoce8.ec 
vfus eius ad ea que sifcuri op9firjrfi^.etbi. 
3 mb:ofia c berba qua lariui apiu ftlua ricuin 
vocar.pequaUirgiu.air.Bmteofieqjcome^ 
©iuinu virrnrcodo^ afpirauere. ^f Pvafco. 
Bmbwfia qua mulri botrim vel arrbemffiaj 
Oicuntfrutejceftmultasbabensvirgas mto 
palmis longas.? folia inirio minura rurc fimi 
lia.v irge Qmt plene fcminc 

0prrationt0 

f 6alicn9 vi.fim.far.ca.oeamb:ofia (mapi 
um vim bj fhpticl •: repercunere.fl Owe. co: 
pousretima^bibertfarbaplafmanadbibira. 
f 3pfaqjcum vino bibirarorundos lumbri^ 
cose?.cludfr.£r.fuccu8ciu8cumlana impofi 
ra mulieris flujcum ejcringuir.fiademqj rurbo 
rcs oculis tuncra pwbibct. 




h iit 



Ctattsms 



CapttultmuEjEiJ 

*z£omu\DYaf.ca,t>eamomo.Smo 
mugenue c^do:arifli'me berbecw'9 
frnttc eft ftfis borruo: in drcuiru otf 
fa0.ibcrifrbo:i8nafce6.ramulosb3bctficcoa 
fcpufoB virguf ftfes colorie fubruffi'.rirca qs 
foliola wetat copiofaetrirfobumiofumfe* 
merodcetfibiconecuflo^albuvcluriviolc 
fotiisfifibbyonieXu^triplejc^affpee^ft 
cin qtf afpcllaf rmmcru.cereri8 melius aurofi 
coiorievclftauuodorieboni.SUudeftquod 
appellaf mediconpmo iitferiufnafcifirt locis 
foumccris^fljrercafoimainaiusatcpviridez 
lencracruXapo^o:iganibabe6.Cerriuvcrc» 
qi> appcllaf ponricu.rurfum cft t no loguatec 
THrTiafcfrangibilc:burruofo femine plcnu .et 
odo:ep.aifiMe.ideft ftipticu.£Ugendu atite 
recee er albu>irgas purpurcae babes ccpan 
fum i femieplenu.^-f>li.ca^e amomo.Smo 
f mii vocaf eo q> vcluri odo:e dnamomi iferac 
nafcif in fvria % armenia.frurej; eft borruofum 
fcmercddes fibt conecuilo:e albovcluri violc 
figura folqs fimilib? brionie,odo:e eria bono 
fomnuinritar:£r eft ea.-r fic m irj g.fl 0af,vu 
fRn.far.ca.t)eamomo.amomubocquidevi 
omirfmvirruteam'inilariacoU).mTiq'ficc9 
plus eft acouiettigeftibiUue vero amomum 
£t?>ijcit £af.in qnta ampbo:ifmo?.o/ omia 
altacalida fomcafidirareftmr fiffa.fcjin boc 
amomo.ficur ff caflia lignea.tapfue. amomti 
dnamomu.-z faciut foda.£t fifr fadut pluree 
alie ct fpecicbus q funr fubrilce % calidc. £r q 
damadmreratamomu cuplataqt>icif amo* 
midc8.eo crfimOaf amomo.mfiqa non babj 
odo:eei i ; nec talc fane.er nafcif in armenia. et 
flos cius cft fiiralis origanuS>i vie no t>edpi 
ab bacvelafififocaue aplata q enimisiuutf 
nfe.? cUgeflla aii9raraiegrediunfab vna r# 
dicc.Uirruo cius cft calcfacriua 

0pfrartont0 

B f D?af.Bmomti5 cft pftas fomnu .tumo:es 
ctia carbaplafmarib? admijctu fedar.^ifcef 
©mafis-anrirorfe ? mirfe er varue odonbus 

# grarc mifcef,^S>aap.2lmomii inducit fom 
nufc fedar foda qti ctnplaftru ol co fir fug fro* 
rem/rmarurarapara catida.-r pfcrt pucrure 
fco:pionfe:qn fit cmplaft^ cu co % osimo % po 
raf fupcr locu pucrure.^F £t ide aucbumaYm 
filrpfaac.Hmomu cil res q" meb:iat.ercm x>c 
;jp:ierare ausdtejrincb:iatafacitt>o:mire. 

P «U B ui.Bmomu marurat apara ca.£r et'9t>e 
cocrio bibif ad podagra % fedef i ea.£f eofert 
6 oiorito marrufe. i iiwrat in peflarife matrtf 



tis.i fedcf infcccocrioneaus ad fcofoie mfi 
^fatmanfo:tra.irJ4i.©eamomo.amomu5 
ca.c-rfic.qc5 ad opflarioneepar^cjcnTgidiratc 
e^ficiens.t)olo^aufertmatria8.tncapitc tfi 

graucdinci^elo^arqjfcotbomiagcncrar. 




CapimlumjEjEftl 



*^GV. 'i£coe.iSerap.li.aggrc, c jiacbana 
J>t id eft ameos.auc. pvaf,^da npiant 
* -^-ipmpouiii ambomariortadeciminii 
erbtopiu.Ueru nanira cimini abioptieft aSia 
a nanira ameos i cft noru.£ft mc$ fenCfcrc 
fife cimina erbiopio.nifi qa cft min9 co muitH 
i aU?i5t t>uri9.er in fuo fapo:e eft t>e fititudfrtc 
fapo:is origani.£r tllud q?J e degendu c% eo 
e illtf qo c reces % mildiUEr idc auc.gaf.^aj5 
gie iuuariuu qtf e cjt co e feme eius.-r in fapow 
d9 e amariwdo pauca % acm:ae,ct virtus ci9 
l q calcfacit idccat in terrio gradu. 

i>pfrattonf0 

^pY^^^erimefuaYCiriro/pnocatvri 
ni.-rfemeebonuTe^nriqs.flf^tqndus t>c^ 
cocrio ponif fuperpucrora fco^ionie at^fcrt 
t>olo:e.cr e bonii fngidirari ftomacbictcpar? 
i aufcrr opilarioneVr fedat naufea^r pcficcat 
bimitdiPtce ftoinacbi.f £ t cft bonu bumtdi 



BtSXtbie. 



taricjj eri pcctoK/z mudtftc at viae renu -r vcft 
cc;ct cjjrabtt lapidc cji cie poftcp fuerit factue 




CapituIumjEjEin) 

*<jv.2£>idu vcl amflii. ?cft fucaie frumeV 
&ff tte & amilu ab a q?5 eft fine ? meloe 
* ; "*"grcce.i.mola eo q> fine mola finvnde 
amiduTiueamilueftmeduUafrumetiqo^futt* 
dif ? tundif fcottec furfur fuutimitat . •ocnide 
cu aqua mitrff iiifpoznill.t cupifura colaf.ce 
cuinvuo vafe veuitfeic reccderit aq cffufa in 
fole ficcaf poft boc lcuit er ftringaf .f £afltu8 
fclit ca.se amflo.3midit teperate caliditarie 
eft % bumidu qtf fic fit . Jrumctu tn aqfrigida 
ponafperfcic-znoaetseTwinfcicaqremo* 
Heafquoufcpfmmetuvideafputrcfieri.tJein^ 
de aqua remota optimc rcrat ur ct cu eadc aq 
optime confectu per panu e]cpmaf.etfolief;po 
nafvtqcficccfvfcfcadaquecofumprionc.?frc- 
queter rcmoueaf aqua frigida ©onec loeatbef 
qtf rcfidet "ocficcaf z iduraf.f S3cra.li.aggm 
ca.oe ami. Smilu infrigiditat et ©cficcat plus 
cpfrumennl.^tmcliueeiccoefttluidqdnt in 
eltate.£t modue operarioie ci9 e vt accipiae 
cefrumetoj-tipmbcnepurgee^infiindeeiiv 
aq sulci •: lauee ipm cu ea i poft p:oqce aqua 
flU cu qua ipm lauifli % funde fuper ipm aqua 
alia.-z facice ita qnquiee in t»ie % fi poree i no 
ctc fitr/z qn molWtof opo:tet q» etjciae aqul 
ciue cufacilitatc fineagitarioue aliqmeeu aq 
egrediemraliqd©elaae.£rpoftcpbocfecerJ 
calca cupedito-r.pqceipam aqua.?qtf fupetf 
nataucrit fuper aqua ejcfurfurc eoUcge cu catf 
cia gfo:ata.? abi)« refiduu. poftqj vero putf 



gaturumtafurfuretcolaruponefup.latcree 
nouoe^ etpone folicalido.2 firemafefit ineo 
au'quabumidita8ponefueigneV£tfapc$ei9 
eft acetofus.-z virrue ei9 clt pauce caliditatl $ 
e copofitu ejc virtutito cotrarijo.^Ra vna e frtf 
gida^pfcr acefefttateqeinco etalia caUdaa 
caliditate ci9q elt a farina^ e in eo a caloze pu 
trefMcte.Eftautoprimuamflarecee-zcandi 
du et lcue fine vllo acere z tncytofo odo:e 

i>pftattonf0 

f Dvaf.amiuifacitad abftinenduj ratma 
oatlo:ii.altavulnera oculie repler .- afpzedine? 
oculo^ roHir.f £> anguine retjcienribue bibi 
tumfingulareptefidiue.f2lfpKdiiteearteri 
arii ©cfleuit .3ue collo lacrie mifcetur -r^pflu* 
umvenrrie itringitvalde,potcft aute leuiter 
ftringcre^pter qO m eo1Krtjelacb:vmae ftritt 
gentibue mifcetur.valet fitr ? apoltemata fyi 
riruauum et tuffim coctum in aqua o:da cum 
laaeamigdalariiadditiepenidqe. f £Tera* 
pio Bmilu confert bumo:ibue currctibue ad 
oculoetvlceribuequet>iainturfelfeolee 
f fitqndobibiturabfcindit fanpinem qut 
venit a pecto^c-z lenitafperitategutturie 
f j£tqndomifcturcumlact€ in aliuoctboB 
tdcmfacit 




*> m 



Kmmm 



6 



CapituIum^jEU 

^SV'^> l S dala &*& "omeeft.l9rincmttt 
«^flonga tf:Xuncti8arborib?po:feflo 
" -*• xc pucfiit.-: fld fercda poma arbufta: 
cetera pijenit£jcbi8 alic funt fculeee&lie ama 
rcSed agricolebuicgencrificmcderifcrum 
Z^ercbjanteiusradiceetin mcdium inferunt 
fUrcuUim arborie q pice t icif. quo facro fueci 
amarirudo fccponif.txc pfidouie. f *filini. 
li.ti.2Crbo:e8 queda primegerminar,': itcrno 
tiflTimae nudanf.vt amigdaU % frajunu fantf 
buci.cjibisncmpequeaquilabiemeoneteco 
cipifit.-^rimooimamigdalefiozentmcnfeia? 
nuario/fSomu vcro maturant mcnfcmarrio 
fierdirqj faallime frucruj ante maturitatcm 
amigdal:i.fiait etfieueet palma. £t lib:o t>c 
nam.rcru.3migdalu8 in locis caUdierrucm 
flbundar.^rigidionbue aut locis arbb: vcru* 
fta flo:c fccundif arc ncgat. 

&pmtiom$ 

f ^li.li.)qtiit!.Bmigdalcamareradiicj5cocta 
cute in faeie comgit -r colo:cm bilario:c facit. 
'Fiucee ipfe fomnu faciut ct mictitate f 3 ui, 
3rbo: amigdalaru amaramcuoptimerertf 
arqj cit accto ct olco rofacco pcrmifccf^ indc 
fit cmplaftrn fronti confert foda. T* adijc criaj 
ctiis fcccocra ct fup, pannu Unita/ouie eft me 
dicina. f £onftanrintie in lib:o gra. •Radtjc 
amigdale amare puluerifata: et cu accto tcpe 
rata:fit bonu vngucntu cotrfl lcnrigince ? im 
petigincm.omnefqj fo:dicie6 cutis. % majrime 
contramotfcam.jCujvinoporiiipatatullim 
curat.lapidemfrangit.fpY^f.coeamigda 
Ue3ibo: amigdala? tmlciu c t>cb ilioris ope 
ratioie d> amara? arbo?. amarc funt fubrili* 
atiucct pwuocatiucvrine.f 2>cra.aucto.ar 
tbigcnie ? ulces amigdale funt calide i bumi 
deinp:imo gradu. ttideaucfo.tgbefuav 
0uando eomcdunf cu co:rfcem fuo ftringiit 
gingiuas.^fcdatqtfacciditino^^terfuam 
p6ticirarc.£t qn comedunf cu juccaro fuo fce 
fccdut a ftomacbo.-: qn ficcc ro:rcfiur funt co 
ncnientio:c8 ftomacbo % augent fperma ficut 
fluellana i fiftici.f 3dem fluc.albugerig.j5u 
mi ea? adminiftraf ITcut gumi arabicu et p:u* 
na£.f0flt'.vi.fim.far.t>camig&ptilceeami 
gdaleineieeamarirudo efl?occulra quenon 
apparet fenfui:q: vicit m cie tnjlcedo. xai qn 
veterflfcunt flpparetmamfefte. XJirrus earuj 
tepcrara cft cu caudita rcp:cualcc cm in ip fie 
abftcrftua i fubtiliatiua fnbftaria .pjopr' qua 
cjcpurgat vifccra^t pulmonem et to^ccm^ 
putrionce opcrantur buomm.f "Rabbi mo v 



fe8ca.t»eam£gM8. ^utcce amtgdflte psof 
uocflnt fomnum temperatunut coquinatum 
cum cie bumectat vcntre. et fum .laudflbik* 
ctffliuantfubftanriamccrcbri* 




/Racardue pcdiculuedepbanrieab 
.imperiris medKiet>icif.qt>eftfalfuj 
fedeft rructuecuiufdaj arborie que 
vocamrpcdiculue clepbantie.f Suieeria 10 
b:o frfo.Snacarduseftfrucruetitteofltcac 
tili.t medulta ciue e" fifie meduUc nucis t>ulcf, 
inquo noeft nocumcntii.£rco:tet ipfiuscft 
rarus frangibilie:in cuiue rariffltc eft mcl^rf 
cofum babene odomn. £t funt boiee qipm 
mafticflnttnonnoccteie.^p^opriecumnucc 
caUda eft % ficca in quarro. 

i>prrancnf0 

fauicmna.£iuemeleftrIcerariuuflpoftd 
maru •: aduiliuu fanguini8: et bumoaij. £ra 
dicatverrucae.et aufertatbarfle:et cradicat 
bflrutoe.et fsnat alopfoam flegmaricamXo 
moueteriam cfllida apoficmata m interioafo 
f /Confert <rigorineruontm.ct eoaim moUtf 
ficationi^tparaltfietfomiref ^onfertco: 
ruptionimcmo^ic:cuciue confecrio noraana 
cardiuum Uimitur.Sed tflmeccmouct flUc 
uarioncm ctmelancoUam.f ©uflumfgairf 






t> 



Btftttbte 



otm cocmotfoidcG et qdteanmrjeitVr. funtf 
ma veneno:um.et addutir bumows ct tnraffr 
cir .$ £x due quidcm rirfaca cft lac racdnuj 
bitriro inde cictraao. £r olcu nuao duo frari* 
gic virrurc.loco rittsponirur qtiinruplii pow> 
dmsdusfce.badabam.erquarraponderis 
ipfmot^colco ball'iimi.arcrriapodcri8 ipius 
©enaptaalba. 




€apitulum.»uif 

^^ttettimeftbcrbapttuteitt odorifcra 
J^t^la.Sncrifcmcpunapalircr couentc 
* ^vfitomcdidne.racWcfeciindario.berba 
vcrorcrrio.^aUa.^cnfcfcbutarioaneruj 
ferimrloc^frigidie.OmneftaticeUpata:fed 
tcptdio«locaf,*Risanda:dlfifcablnncatim^ 
ber:ferenduetlrariU8.aliquifcmleui8it5ob^ 
nwr.Opinircs <r a nutla auctangaf.CS>** 
rapion.U.aggre.ca.aebct ideftanccu oibua 
notumcft.virtu8 efuseftque cakfadt fotjnc 
tertq gradu©.??cuccat mpancitfo faftf Oa 
licnue.vi/impU.far,fin rranflarione" grccanu 
Bncracalcf«rirquideadco;Cc»BCTrfa?igra^ 
ducipminrenfilpuranctoj.tdi^rcmflKanfia 
vero.i.sradu8.c(luKt?8>«iiKr.Tcl pmf.intetiK 



C/kcrffocrge eoaHfooleo fclafoteticu i iffl 
mold f u fomnicp facriuu i sigcf ttim crudozu. 
necnon indigcltom bumow criftinappwpin* 
quat vticp olcu quod ejc co apcririuis fcigrfitf 
ui8 tarmacie t>icm nih' quia paulo calidiue il 
lisctfiibriliitparuQdt£rideot>iafo:aicum, 
vftuTcro tcrtqnrgraduecalcfacriuua > (tccu4 
£t idco moUito vulncrib? appofiol pftar ope£ 
ram.ctpfmim cie quetn pudcndi8.bufiiidwe 
aut cr minuslcaUdus ridere eft ad bec. ? cucbi 
mu qUtigcfttMiueeftetfomniractuiiJ. f £c 
idcm£?crapion auc^bcnmefnay.Sneruin 
9ftcaUdu.3nt»ucirfomnu^roldieiu8cftbO^ 
num vmrofiraribus.E t femcn riue in polcri e 
pofiruminuUipUcarracquandoacdpirur (o9 
lnmtouirfpcrma.crt>cbiUrar vtfujjnarimc ni 
Ruu8Tfu8du8.f*^auui8capVDeaneft>.p^ 
cocr*o;eum'aletrtranguirion&i©iflurij8 &a 
ta.et,potrtltmc fYrupue racrue cc «ecocrione 
ciuetfjuccaro.il pUniuslibw.jcjcanerum 
rucruefroucr.cr roaiuna fcdawUtu i iftitXtf 
nis auevuam Icuat.oculo8.ct gatirura jcbe^ 
rar.f ">Sd cmo:rotdae acripc pnlucrcm vrti> 
cc.ct pulucrc anetwonficc ciunmeUcct emotf 
roidasiunge* 




%mmtw 



a 



P> 



^^13tcflo:umrclflo8vm'eflgrcftiexid 
.2^floevirifft.3defuntt>raf.ea. £nanfl 
* AumfdcftanKfloMj.vclfioeririeagre 
Itis q dt ciepcrit flb^ccolliscndi ffflozes ipi 
«ticficcadi.TaUo notevocaf vitlffta labzufta 
flozceiriueoprimercdoleYttficcflnfinvmbza; 
etintcftarc reponcdifar.ctmdi9 nafrif i fvria 

j&ptrationfo 

f prafcozicJee.airtueeftei fiiptica.rn ftbf; 
bitu fueritcuftomarfcu cft cttnurcticu. ventre 
fmngft.fangnmcmrchrienribue fubucnit.? bi 
bitu i impofitu ftomacbo fefozeoziecmudat . 
tHgeJttonc^tomacbicelcbzar.mijttuoUozace 
to wlozecaptriefomao tollit.^S>ucai8 vi^ 
ridis in catbaplafmarib? adbibitue vulnera rc 
cerfa finetttnwfc feraar.£gilopaei inirio vul 
cnrib?pzieetfitngina?vnlccft.f uulncraad 
famtatc pa durir.mdle addiro z olco rofarii-r 
crpcpirrorrbaf ^efTarije neceffarie adbibef 
ftutiue matririe pelTario faao ftringir.reuma 
oatliefufpedit.^ £fltbaplafmarfb? adbtbiru 
ftomacbijcgdhongfoluiwtmapmccupolcrt 
taarino miiouctimpofitu.f ^obultiijrcro 
in tefta cucarboito colUrqe bencmjfccf T>ana 
ricia oculozum etpterigea purgat mcllc addtf 
dito rcuma gingittarii» % vulncra curar. 




€aptturum.*jtfjE. 

«^Yl^Iifum.^lateariue.anifum quod 
jfr*f slio nomitte cimtnu oulcc -oicif :fcmJ 
12. -**cft cufufda bcrbc ffmitenomfc appcl* 
tarc. £t dt caUdu z ficrii in tcrdo gradu. Oirf 
rotcbabttt>iffolu6uYcdTumcdi. f Ovaffo. 
ca.t>e anifo.Bnifum fcrucntie cft virnirie; fo 
calidu i {iccft.t nantrc mictuaUe i fc aroticc id 
eftmceu'ue.fSaa.ubzoaggre.cflj^;8nrifin 
auc.pYafcou.Sneifinqtf tcoeft rcccne eft 
bonu.babetie groffa grana plena i non qrco 
riatur quando fricaf cjccoziarfomte ftmiUbue 
furfuri.^t babct odoze bonu fotf em.£t iUud 
quod eft cr. infula jCrctcnfi cft mcuue.£t poft 
illudcftbabYlonidi.1^vfpanicuvero cft t>crc 
riuej£r quod er planta eiue eft magienuuari 
uum cft femcn ciue. f j3aUcnue.viXimpU,far 
maxa.t>e anifo JSapozdue cftacuttw. ama 
rue modirii.£t r irtueeiue cft quc calcfarit i 
fcefiecat t tcrcio gradu.*f>zoptcrca crgo i x>ia 
rcticu eft.Ucntofttatce autc quc f m vehtrcm 
fiflit f Stuccria ltbzo.tj.ea.t»c anifo.&nifum 
cftfemefcnieuliromani acuitarie maioue 03 
nabari.£tcjccomeUuecftquod eftpdndero 
fimvrleft ca Udum ■: ficcum iii tcrdo gradu. 



f Ovafcozidee. JUftfum q:mictuaUe cftrir 
turieYctmciemcdcturXirfmtolUt bibicu re* 
ncnie ocairrir .Maripee amputat.rcntrcm 
ftringftjncnftmfeimpcrat. f XacmuUerito 
puocatitatrgctijibmircntreftimulat.iumi 
garioc nartbue adbibitu oolozc c^apirie toUit 
f auriutoolpzemcumoleb rofflruadbibiru 
mirigat.rcritofifaterftrietoUit rfpolozem . 
fOprimu ant cft dmamt.^eUide cg^prfum 
©alltcurcro mcrirffffm0.^aujuecaf>.t>cani 
fo.f ContraUuozemeftaaifubne cpntc+af 
riminu 1 anifum.-r.incozpozcnf cumcera er t ca 
Udufuperponatur. f &u#imfuhutra-auget 
lac 1 fperma apcriertdo meatue.-r mudat bu* 
niiditatem matncie.f aimanfoz teatu tcr 
cio capitulo t>c anifo.anifum cafuium cft qS 
vcntontarfe «iffoluriuunt criftene.cpatie apc 
r^o^lationcm Coeurtdipzctcrca votunt^cm 
ftfrmilat. f ^crapron UbU) aggregato? au^ 
crozitatc.pYafroziclee.Uirtue due cft cefic^ 
carfua ^calcfaetiua.£t ejcpcIUt vcHtofitatee 
a cozpozc tfcdatoolozcmgtpuocat vurtam 
1 fudoze.te6fcrt brclrdpifr. f £t abfctiidit f& 
tim q fit ab bumouto falfie qn fumif in. potu. 
f £t cl r conucnicns rcncnie 1 inflarfohibue 
crlmhsitrauTem.a abfandic bumidiratce 



a 



ti 



BttJtxbB 



K atoacaiMtricefluenfes/rptouocatUc.ffit 

cjccitat libu>incm.ct quando artrabitur odo* 

a. ratu fumigario yapo:ie ciue fcdat fodajf £t 

quand o tmt ur ? mifcetur cum olco ro. ■oifiil^ 

Uturin aurcm.airatquodintraipam accidic 

♦<rv SE ca ^ u aut P crcl! ^ lone ' e t ^at Dolo:em eiuo 

tE> f £t W«w auc.bugcri.Sperit opilarioes cpa 

tt'8.fplen is renum er matricie. £t mundificat 

vias que ab bumoribus opiruUntur. £tp:o* 

ptcr boc eonfert fcb:tbue antiquie.? baber in 

feacuitatem.ppinquamaduftioni.quarcfotf 

uit ventofitateejmajtimc cii ipfum affatur. 

"B 4Suicenna.anifumcttapcrirfUucumftupti^ 

afateparua.£teftfedariuum Doloutm.ct re 

fokttiuumventofitatu:ctp^p:ieficaffcntr.ct 

in ipfo quidcm efr acuitas qua medicmts adu 

rentibusfitvicinum. 




OvMamm 

%5VRtiu'6eftberba t>equa .fitfal aikotf 
jfr^CDvafcoudee. Duo funt cius gcncra. 
" -*"anum babet folia lenriatUs fimilia. 
Slia babet folia fimilia camepitbi-^rima ba 
bet bafiam altam t>uobuo palmis erccta? cuj 
folqemollibue/Radtjccliftli minoi ettcnuis 
•Rafcitur locie berbofie etfoUrie gultu falfa 



SfaiTda eft que folia ct baftas llmtlcs camc£ 
pirbibaber.fed afpcrio:a ctininott.ffoJcpurf 
purctt et odo:C <jrauc;radic cico:ce fimiiis 

Bptxmmte 

f 0alicnu8 fcjtto fimplicifi farmacomm cap. 
SnriUi8.£> uplec quidcm efhambcramen me 
diocritcrfi£cant.vtetvlccrafolidct.3lIterave 
ro quecamepitbeos affimuUf.plue vricgcp 
aUa fubrilium parrium cft :v t cptlcnricto confe 
rat .bcc autem et abfterfiuio: 03 altera eftf 3 1 
manfo: tractatu terrio capf.vfnen.td eft. anril 
U's calida eft et ficca que purgatet apaif epila 
rione.carnem<B co:rodit fuperfluam, vniucrs 1 
faliter autem omniu iftarum babaru bonum 
babcnriuodo:cmc£plurcecaUdefunr.nifiii* 
le cp quibue fenritur illud quod oftimus fctltf 
cet frigiditae manifelta:ficut fcntitur in aqua 
rofata et campbo:a atq? ffidaUs. 




<Captralum.]EjE# 

/RtboevelTSofmarinueqtf idcmcfh 
•f £>cra.li.a£gre.ea. laieralmarien id 
^eft antboetrtquif.£ftarbo:mari6.et: 
eftaIpinatfacct]cacola.£tt>icitaucto:ipYaf. 
£»pca'eerofmarinifimrtree.tlnaearumba 
bct femen quod nominatur faibi.£t babct fo 
lia fimilia foltje maratri. hifiquia funt U* 



£ 



•t/v 



''/m^n- 



Ccarratua 



tio:apammgrofiioia.rte!Ltc!idimrriipcrt^ 
rmdraiirirer.b.;bmsbonuodotemct lon 
girudo fuDttisciusdt vnius biacbij ctplus* 
1 1 \nbc; mnlt os ramulos fupcr cjru fummir at 
re 5 funt capirdla in quibus eft fcmcn atbum (i 
nulc lcmini plante que t>icif fpondflion mun* 
dian angulofum .acnti fapoiis. in cui9 odo:e 
dr fimitc odo:i rcfine pimV: qndo mafticatur 
moidicatlingiu/Radiic vero c&c alba mlruj 
t uiue odo: d r ficut odo: f buris.j£r eft fpecies 
alia fupiadictt.m1i quia femen dus eft latum 
mgru funilc plante fpondtlion.babens odo:2 
bona fcdmotdicat lingul.? babctradieeejcte 
riusnigram.inraiusvero albam.i£ft fpccies 
slia fimilie fupiadictcmfi quia ipfa no babet 
f -.ipitcm nec fanen nec floiem.cr nafcif libano 
' ,ris locis pdtofis % agrdhb'9.f j?fifRofmari 
liuni lanni ab eftccrm bcrba falurare vocanr. 
folia babct fciuaittfinuita atcpafpcra.et rora 
itm f crra p:oiirara4 ^ia/Rofmai iiv? e ber 
ba caiida ct ficca: cuius folia i flo:es compe^ 
tunf Tfiutncdicinc.flos aurem anfbossicirur 
v nde iic decruariu cp ucif PYantbos. 3n.lo '/ 
cie marinis crcfcit vnde ct nominaf .babct vir 
tute a ifoitandi cjc aromar idrare:t>tf1olucdt cjc 
caitditare.t7;ttrgcndi -z mfidificandi:et cofumc 
cti ejtficcit are et virrure x> iafoicticam ce caloie 
apertcnte. Ocp calida et ficca clTc t>icaf in cp 
ctihbus ab auctoiibus no t>eta minaf. berba 
ipa ttbanoridcs vcl oentrolibanu 'oicit quida 
tamafoiait cp fit frurec.ali] vcro cv berba fit 
A.um inucnitur in medicinis reccptio antbos 
vd rolitiarintocbcnt ponifloics folia vel liba 
notidis vdt>entroubani.5lo:es ad folan t>e# 
Uccari.perannunt fcruaomr in dUcaciamul* 
ta.^iirouicrafoua. 

3E>ptrattont0 

.3 if Conrra finc opiin er cardiaea paffione fcaf 
fciaiubos ctt viiio olTis t>e coide ccrui.Utl t>e 
waio ftr in v irso velaqua rofaru.ipmcp vinuj 

"6 t atuf panett f £orra frigtdirarc aut tsebiltf 
t are catkii rofmai ini t>eeocrio i vino fir. ? pa 

.C ttcstifooperro capitefamurccipif. f £on* 
n a vncbnmidirarcacetumvdYinu t>ecoaio 
nis riue gargai ifaf . f jConrra iiomacbi fntf 

P giditare?adtigd~tionemconfoitandlt>Yan 
t bos vdvtnu t eccaionis ctus.-z mafuds na* 
flimr.f £om ra i t omacbi ooloie % in rcftino 

£. rum.tjtventofttate.vinum t>ccoaionisrius. 
gc ciinini ponamr.^f £■% finonomis notandu 
cr boc nome am bos apud giecos p:o quoltf 
bc f; o:c fumirur J ed apud i ioc p:op:ic rofma 
iiuvd libiinoudis amboe tidmr. 




€apitulum.ftjrf'j 

ncufa cft bcrba aiius radirfcigifoe \$ 
mcitconrrira.©anguineiquocpcolo? 
^riseft.vndeaiampictoiibusad pur^ 
pura cffigicndam vcl cftidcndam in vfu e. £$ 
bcrbarioanaifafcuplecdt.^anam quamafi? 
fabatam vocat.alia quemaicimemeclidne ap 
ta cft.bec i terra p:dTaXpinofis foliis finc cau 
lcnafdfur.etmenfe ftbiuario legimr. 
Hf X>\& oudes.Bncufc puo fut gaiera tlna 
fiquidem babet foiia lacmce fimilia.fed acuta 
ctafpcraiinfcgra-rfpinofa.T^adiiccftdgrof 
fitudincm babcns ^igiti.coloiis fanguincian 
ciiatccigicos inficies/Rafciturinlocis cultj 
bab ens in £ g\ pt o folia fupcr t crram fparfa. 
virmtis rcdargucntis cft.radijc medcturcom 
bulttonibus: 

jE>ptrationt0 

«[fDYafcoddesXcracrolcoaddirisvulncra 
renum optime curar. f 3gncm facru cum po 
lenta ejct ginuif .maculas c oipojis et lcpiascu 
accto impofita cmundar . f iouppofira men 
ftruisimperar.aboimmfaar. f tius diram 
r a recte mulierum ftericis adbibet r Re ffeticis 
aut fpleneticie opimlaf.ct cum vino febzienri 
bus f jetusqticcpfoliaventrem fuingnrcu 
vino btbitaOpius babetecoctio mcmbmm 
arcuamm fanar. *Radicdus in olco t»eco^ 
ct a et cera facit adcombuiiionem. 

Capttulurnfttfii. 



Btfyttbte. 




appdlamr.Ucct tot a berba fic rocatur. 
f f>aUadiu8.'£taptj genere cft tpofdinon 
swuie,auraulrcriue.etoko!elin6uiol!ifclto 
ct caulc tcncro,quod nafdrur in lacunie£r pe 
trofclinon quod marimcin locis afperie. bec 
omnia gcnera poffunr baberefcOigenree ino: 
ri cnlrura.f £onltanrinue.£ftaurcmapij gc 
nus quod vulguecerefoUu^ yocat se quo fctf 
Ucctt>kimrinfcriu8. 



j^prrationta 



^^^iumAKidoais in ubto ctbtmologia* 
jpf.rum.Bptum Turinir eo cp aper id e|t 
^ ^apwt annquomjco co:onabaf.l>ac 
berbam berculco primue capire circumtulir. 
f 3uieenna Spium aliud monranu aliud fil 
ueftre aliud t>omdiic0^t aliud quod orirur in 
aqua t omeftifominu8.cuiue eft ficur t>ome^ 
ma!virtue.£ft % alia fpcriee ri9 que nominaf 
fumiurion mirwetomeftico JCrue babcne co 
catuladalbediiiemoccliue.fouiuedt rcma/ 
rutmonrann.£ft autcminpamo cahdumin 
feain^o^cum.f ^andccta capirulo quin* 
quagdtmo.^Spi} plures fuut fpce "Ram cft 
apium tomdiifum vd ottiuum.t: tcft apium 
ramnum fiue apium rifue*£r eft apium cmo: 
roidarum.£t eft spium quod t icirur cerefoltf 
um,£t dt apium campcftr^£tcft apium bp 
fpanu.£t cftapiumperficu.£t dtapiu agre* 
fte.£t cft apium mont anu.£t eft apium aqua 
ticum.£t cft apiitm rufiicu.£t eft apiujqiiod 
©icitur regalia.B pium fcomcfticum omtbue 
nbfum:q8pY fl lf<>:ideevocato»iuumquod 
calidumeftinp:mcipio rcrrti gradue.ficcum 
tn medio eiufdem cuitie fcmen maio:ieeft crfi/ 
cflrie.feeundario radijctcrtio berbaXu aurc? 
tomcdlcfoa receptio apij fimplicirerinuenirur 
femenapponcndum eft.quod a mulris fcUriu? 



f Spwmsomcfticu^ocatTriim mel 
ctrdolufcremofitare8.ctp:opriefemen i 



mcflrua % 

i eiue. 
■f £> ticcue ciue in quo fajofragia fcecocra fu B 
ct ir ftranguiriofie et ©ifmrriofis fubuenit. VX 
fatifraga . granafoUe.ftUpcndulacrlapieltf 
de coquarur in fucco aprj.er in colirura sddtf 
to 5ticcaro fiat firupuft. qui mane ©erur cum 
cilh.ii. 

f ©ucmeapqaflreftievelacerumctoleum £ 
violamm vclrofarum mifccanrur.er buliar in 
vafe virrco ad ignen*£tcum tali olen calido 
caputparicntieinunfiatur.valercontralirar^ 
giamctfrenefim^riuscapire rafo. 
f Smcais ©ecoaicie aprj et ramarifa' fple* £> 
m'ecrepati8opiIarioncm(bUjitet^uriricmf5 
p:op:ie fplenie. 

$ 2Uiud £?umarur ©ecocrio radicie aptj (d £ 
niculi petrofilini.fiar fyrupue cctra ycr eritiaj 
ec fucco aptj ct fcariolaru.-: fcerur cu ealida 
f £omra bvdropifim radijcapq tfetiiculi bu $ 
liar in fucco n:mi rerre.ctin aqua ticcoctionis 
addito3iiccaro .fiat fvrupus. miromodo cc\Y/ 
fcmit ftcgma.' . . . 

f 5iantetia.mifiilf«co fiegmatideetvpoffir 
ticalabo:amibue.*Rccipefucciaptj lib.iVfucf £> 
rifcai iolaru lb.f.maftiae.5.i.facra tccoctio^ 
ne coletur.pofimcdu ^diito juecaro fist ff ru . 
pue infineticcoctionie addatur pulucrie ditf 
le.5.q."Z pulncrie rcobarbari.5.f .manecum w> 
Udaejibibcae conrra ^mpbtmcrinam pccdst 
purgario.fccindeeoquararagaricuecumfuc 
co apu in pcmo coloquinride.vel in malo rer^ 
revacuatofeucauaro.crtccocrio talie setur 
quortdieparienti. 

% "Fi ora cj> apium nocer p:cgnamibue: q: v« 
tureluaciffoUiitrettnaculatctue i) 

CapttulumjEjfdm 



%xmw 




Jfr^f umplicium farmaco:um cspitnlo aptf 

5 ■* um ulucTtrc alq fcunumvd cquinum* 
swn vcro alejEandrinu nominat^c tockm gcne 
t*eu\£t boccum fclino z petroftlmo marecV 
itiro.ct crit qaidam felino fouiue. petrofclino 

vero t.cbtU»e4na;JlniOJimiqj tucriuunclt 
«vrinariuunu 



Capitulum^rui 



^jv *£ium ntRfatm cfi Slpteui qnod tief , 
J** mrrc£alia.ctcir berbacuiucfuccueC 
5 ^grcdirurinquadajconfecrionefldfca 
biofa vlccra in anridofario viriU' 



i&Pfratiows 



% fSptSfuucRreTtrrutcbabetinfemtnceitWi 
% f Bmcenna.S piumfilucftrc cft v lccratiuttj 
impediens et magis calefactie conucniens 
' fSputnt filncftre in cmplafiro vlecrat x eon 
fcrt fcabtci et anpaiguu.ac vulnottovfqj ad 
figsllationem 
X> f £ ti aurcm malum eptlcnrie cjcficcane csiri 
'fjtfcesquoojficgrorantin.pifcinio apio fuV 
uUiriviridirecreanrur. 

£ f jContraopflationcmfplenisrtepatisvalet 
femcn apt? filiKrmemmptum eujn vtno* 



i>ptraricnt0 



f Sucaieataradtascuaccro nicatuera* 

lct,conrra'fci;bian a ^^3^0^^.' 

f J3alicnue fejcto Jimpliciumfarmaforitcapt 

ruloiDcflrriwfiafmeapiujrufitcubabetvim 

Ilipricanrcmfiue rcpcrcutienrcm. 

f £> culie valrt rthf um cum mcUcita vt fubin 

defouesnrur. 

f £>pilationon epatis Ibluit 

f fcteftrdblutiufiinnarionfe apairM opi# 

lationis etfcdat iuum t oloutm. 



CapttuIurn.jEjEjEuj 



Btfyttbis 




•*^v •^fumcmotfoidarum.^T 6aliemm (e 
Ji^^^rofimouVuim farmaroaun capimlo 
" -* botracbion inquir. % pium emo:rotf 
darum eft cum foliis gurtaticie <n»ni8 quafi 
fangumis rndancolici.calidcct ficce cft vcbe* 
menrcr radijc.et funiliter tota berba. 



0pfrationf0 



(J Sptum emo:roi ?arum in rino cocfum ra# 

tbaplafmerurnaribu8,emo:roida8 inftaras. 

ct flcgmaticas ejccirat , 

< Cauendum tamcfleft nedsfluenfibusboc 

fiat (i (ine ftutu cum tumo:e ? aolore 7 eetcfio 

nciUarumvcnarumfiicriKtJolo^mifiganircc 

mmo:emficcat.£tbocapium emotfoidaruj 

zicitnr. 

Cft^fcabiescjlepjaseiccortcat etvngues 

lepwfos. 



W5X *£pio8 id eft camcbala nos.£ t fecnn 
Jr**dii quofdamtnVirur rafTflnusagreftt 
™ ^£rt>icofmquofda$.qnoui!amftiive 
rirarem raffanus agreftie cft Ole qui t>efcribif 
infra incapitulo TCarTanusagrcftis. ^Dvaf 
co:ides capimlo appios.Bppfos baftae ba* 
bct t>uas vel tres vifcofae et tmfr&i tt- rufae 
iblia funt ei rate fimilia oblonsa et vy vdia et 
paru3.fcmcnparuumcuiu8 rad(ceft affoduV 
lo fimm8:fcdobrotfidafimilispile lafb:rmo 
plena.ocfons mYjra intue alba/Radices cius 
fcuo funt fupcr terram. 

Bpmtionm 

% "ftadices accepte vomirum faciunt. colcri 
et ftcgmtfm crcludunr .radiceseiuo t>e firbkis 
id faount .Dmnis vero caufa 1 accepta omia 
fimilitcrfaccrcnouit. 

fliacb:Ymua'u9ficcoIligc83na'dcradicc8 
et in aquam mitte quod fupernataucritVu pe 
na colkge ficca et reponc. 
f Dv9fco:idc8.^iobuk>:wmfemirriu5mo 
dut>aram potuiper venrrem purgatibnem fa 
cit.t?erbeaufcmipfiu8fupcrio:a vomuu f&> 
aunt.et mfcrio:a venrrcm purjjanr . 



a 



£ 



Capftulmuffjraif Capindum^jron) 



c n 



Crartaaiq 




r 1^roltoa.'£U.ca.;ap:ofltlla cfl berba 
.vncostuos fiuetrce fpargir intcrra 
'rubcntee.folia babctmte fimilia.radi 
tes vt cepe fcd ampluwes qui quidi raffanu; 
flgreftevelfilueftrevocir.intu8 babct mcdul 
li caitdidi.c£tra co:rices nigroe.nafrif in mo 
ribnset afpcris aliquido et vmbwlis locie. 

Bpmtionto 

% 4-}Slini9.Bp:oliillapur^tinfcri9^fupcriu8 
25 4f£]cdrat libidinem in virie ct muuenbue. 
£ C^t^PKrbanccaufampiobibeturnumtito 




Capituluttt.jrrjnr 

^^•Rrbcrifia.^ozue.ilubtn iH^i r(! 
J,^*bcrbat>vaneafjcrib3cdfecrat2.vr,dcz 
" -*- niteupara .Dtana fiqutdcm grece ar* 
tbemie tz.<[ ^li.ltb.rgLV.Srrbcmifta cj antca 
arrbauevoeabaf ab arfbemide cogromina? 
tam.ficui quidi putant.£ rii tidf anbcmifia 
qmfic voeabaf vjlo: regl maufolri qui voluit 
cam fic vocari quc anrea ( v t inqmt i>linine ) 
artbemie vocsbatur.i funt qui ab arrbtmidc 
mbcmifiiccgnominari puur.c,fn priuarim 
medieaf fcminaru malie.f £svafco:idce.2!<r 
tbemifte tria funt gcncra.unu cft qfc vocat ur 
artbcmifia monodoe.it) dt mater bcibariiq 
eft fructic ofa ct fimtlis ^bfintbio folia maio:a 
etpinguio:a babcerz baliae longaeatafcituf 
in maritinie locis et liipidofie. ^Uuefcit aures 
eltatt8tempo:e.rlozibu8albi8 paruulis gta? 
ue olenribus amarie.S Irera artbcmifia tsgct 
tcs nominaf.quc rcnera cft.fcmcn babene mtf 
nutu et vnam baftamfolqs plcnam/fiafcit i 
locie m,edircrrancie et alrio:ibue fto:e melltnii 
attp tenucm i iocundio:c ccparatione p:to:is 
fcrene.bec a grccis vocarur rsgerce vcl tana* 
ccrum . £ t tioe in Itngua larina vocamus cant 
tbanaftam.vcl f mquofdam atbanafii.£t cft 
tcrria arrbcmifia q Upta ftlloe tsictf aiafcif rir? 
ca fofi as 1 2groe.5lofculu ciue fi c ontrittct i8 
famfuci odo:cm babcr.i ipfa atnara.i?asfpe 
cics anbcrmfie tyani ticut inucniffc ct virni 
tes ea? et medtcamina c bironi ccnt bauro tra£ 
didiffe.:2?cc berba ejc nomiet>vanc que anbcf 
mi8tirif.acccpitnomcartbcrmfta que caUia 
ciretficcat 4f J5alicnu8vi.fim.far.eap.tc atf 
t bcmiiia.Bnlxtrufta tuplejLquidctii bcrba. 
amberammcaUfaiiutmediocnren ftccar.ct 
potuf incalcfacicdo quidclecudeinficcanco 
veroprimcinrcfcvtlfcciide inctpidcsfunt cq 
mcdiotrtar fubttltum parrium 

0prrationf0 

fl pvafco:ides:&nbcmifiavirrutcm batct 
acerrimiapurgatiuam aftcnuanrem csltdam 
leprinricam.f £ Iftatura dus eaufae mulicris 
mirigar .menftniie imperar.fecundihae cjxutf 

^-dit.mo:mo8 infantce in vrero tcponir. r cfirt 
crionee mamYie refoluit.omc8 tumowe fpar 

1 git.accepf a caUulos f rangit vrinam $ uor ar. 

^ berba ipfa tilfa et in vmbilico pofita mclin.is 
imperat.^Sfuccusciuemincmittue': ma* 
m- i fuppoftriis omnia fimilirer faccre noutt 
f ^Loma dusficca bibira.5.iu.fterica8C2ufa8 
eomponit.^ S>i quis iter facicne eum fcrum 
powauerit non ienrict irinaie Iabo:tm,f $n 



33 



Btftttbte. 



gatetiajSanoniainSomopofita.^robiber. 
ai% maledicamcta % auerrit oatloe maloutm 
23 f 3tem ipfatunfa atm ajcungia i fuperpoftf 
ta pedu 'oolotcm eririnere rolUt.3 n puluerc rc 
daaa.cc cum aqua vel mulfa porui t>ata inttf 

fiinoai©olo?ctollit. 
ti f 3rtcmifia quc ragtf ee vocarur facit ad vc* 

fice t>olo:an ct ftranguii u fucco oaro cjt vino 

vnciaetwae. 
3 f icbucirlti er. aqua ca riatf t>u»e pofui t>aF 
K f 2>uccue tunfa CU5 aiungia ct accto cojta? 

©olori medicatur Ugat a vfqj m terriu ■oiein 
% ftlfinfautebilarcmfacieoincendcctfufftt^ 

migabis.aomeeiticurfionesinaloMinauer* 

tet et bilariourn facicr infante. ncruomm x>o0 

lournet tumo:cjm mta^cuj olco bcnefubacta 

mirifitefanab ' 
J& f poto:epedum grauirer vqrarie radice" cius 

da cum inclle manducarc et ita fanabif vt vt): 

credi poflct ea tanra.virtutc babere. 
" € £5ucco aue cu oleO rofa? febriee perunct9 

curaturea.l'?ancbeibamficonfricaueri8la^ 

farieodo:cmbaber. 
O f 0alienu8.3 mbefpeciee artbcmtfie conue 

nuit lapidibus in fembus erilicnribue t ad ca 

tefacrionce a ectracrionce fecundarum. 



Capimlum.0. 




r *Rifto[ogiaroninda.fy(tdoute2lri 
•ftologia fcicirur co cr mulieribue fcrts 
"oprimrilTecopzobctur.l^ampoft par 
ntmfuperfcifa.mamcanbcncnciovapouecic 
purgar.£>uiuegcncra funt tuo.Una tsicinw 
rontnda.co q baberrat>iccm rotunda.Slte? 
ra vero longam babct.cumramie etfolije lo 
gio:ibue.0ninetiam t>actiUnamvocant co 
cp radice fit robo:e x>igit ali et longa . f T>Uni. 
ub:o vittfimo quinro.Sriftologienomcnutf 
tcr nobiliminae bcrbae grauide t>cdifl'e vide^ 
tur quonia cfler arift e recufee.ftoftri materre 
vocanr .£t quatuo: ciue gcncra feruaro .vrmj 
mbenbue radicurij rotnndie foltje inter mal? 
uam et bederam nigrioribue ac molUo:ibUs* 
Slrerum mafcula radiee.quatuo: oigitoutm 
longirodine baculi camrodineXcrrium vero 
longilTimefenintarievfrienouclle cui fi'tp:c£ 
apua vie omnee colo:cbirr;eo eattlibuepar* 
uieflo:epurpureo . f ;jMarcariue.3riftolo? 
gia vtraq? calida in primo gradu.et ficca in fe 
cudo.*Rotunda mag$ compair mediane.-r ra 
dijemagie cp folia/Radit colligif in brcme an 
te p:odtict ioncm fio:um.23aber autan virtu? 
tant>ifl'olucndiconfumendiae|cpeUcdivene0 
num jpoflunt aufem pcr biennium feruari 
f £>crapion lib:o aggregaro:!capifulo aca 
nug.ideftarifiologia.£iue funtfcue fpeciee: 
mafculue ctfcmina.j£t longa eft mafcuUie;et 
rorondafcrriina/Rorondavero t>uae babet 
fpcciceiUnababetfoIia fimilia fctflbe qusfi' 
rofunda odorifcra molliaet Icnia:ct baba ra? 
muloecblongoe egrcdictce ab vna radice ec 
fio:cbsbene album inttrim rubcu fajdi odo 
rie et nulliue vtilirai t'e.a baba radicem rorix 
dam fimilcm rapcfcd longa baba folia longi 
ota cg rotunda xt virgae fubtilce Idngae cir^ 
citerpalmi mcnfuram.^os eiue cft ccftoil pur 
purci et odorie faidi:quiefl in fua opcratione 
limiUeflo:ebcrbe.que t>icitur actu.jEt babct 
radicee in longit udinc vniue palmi et plue:et 
in gromtudine tigithct q^ cftinter radicee:e 
fiintlc ligno bufluet odo: ciue cli pinguie. j£t 
di anliologta Iouga..£ftcr aUa fpcacerotun 
deqvirgaefubrilee babctfupcrquae.fut mX 
ta foUa rotunda fiTia folqe femp viue minoue 
ctflo8ciu8cft!fimili6fio:irute.aradiic ciuee 
longafubtilie.fuperquamcftcoucjtgroflus 
boniodouequa apotcgarn vmntur in;cofei> 
ctionito vngucntom a clectuariomm. 
f 2lucrroi8 Ub:o colligct .cspirolo 6 ariftolo 
c itj 



Craaatw- 



3 



5 

X 

2£> 



•H 
O 





gia.&mbefpcdeeauecaUdefuntffiaKinfe 
cundogradu. 

€>Pfratiow0« 

4 Srfifclcgia rof unda vaict cdfra afma bu 

mida Mic parrco pulucrie ariftologic.ct timi 

dia gcnfkine coficiantur cum mcllcet talc eU* 

ctuariumsemr. 

f £ontra epilenrism ariftologic ronindc cu 

foibii.ca|io:cifulp]?uri8riui.fiarcccocrioin 

oleo pcrrolco vcl mu ftcilino vcl falrcm ccmu 

ni.ct immgatur fpina a collo infcriue. 

€ 3pfe criam pulais confcctue in acct o fcabi 

cmerfanicmcurar. 

f £ontra vmmum?mo:fum vcncnaromm 

animalium tctur puluis cius cumfucco mcn 

revclvino. 

<([ •£>uluis ciuo mo:tuam carncm eo:rodit ftf 

ncfit inyulnerc fiuci fiftula.fo:mcmr liciniuj 

( ; m p:ofunditat cni eius cr mcUeinnncrij afpcr 

garur puiuere ariftologie et immirramr. 

f Bdei;pellendufaufiucviuufiuemo:ruum 

eoquamr radijc in vino i olco i fiat fomenru. 

f PYafco:ide8.*z£o:fibvcncnati8 autpo* 

rionibu8vcneuati8Cuvmoariftolofiic.ro.j4. 

©ara medetur.et.tmpofita id criam p:eftat ♦ 

fi»ccundina6t>cponit.Sbo:fumfaatbibi 

ta cupiperczmYrrbapcflario adbibita.SN^ 

mflecnectubabalongaficutrotunda. 

f £>ed rorunda plus afmaricis cofert ? fub 

glutionifo ct fh'go:ibu8 1 pleurcricis cu aqua 

bibita fmgulafitcr mederur. 

f jlnfijca eo:poricuocatvulneribU8 fadia';' 

cm i putredinem rollir.alra vulncra rcplct. 

f :z£>eiii8 et vris ilirieemijcta gingiuasffceV 

tesapurrcdinepurgat. 

f p vafcoridee.airrijs eft omnibus fpcdeto 

eiu8calidactferucn8.faciunt teniqf adpu? 

crcdincs.et purgamenta ofiium t>elpuenda. 

£f ad ffigidas fcb:c8.ct foUra tn feminis pur* 

garionem p:ouocar.pomi sata.5.i. vcl catba 

plafmatibusimpofita. 

<jf Bd vfumtamemedicineaptio:cft ro.gu* 

fiu amara.bce cnim in cmplaftrie mifla caua 

vulrierareplet. 

§ iacit ct ad viperatum mo:fum. £t ad aiia 

vcneria cjttrinfccusjJofita i ©olo:em tie vertf 

t ofitatc pingui i indigcfta cufatt adiuuat. 

fj£ria5afmatico8cumaquabibita.Hdrai^ 

mactfpafmataruperomnc medicamenvti* 

Itselt. 

fl ^rigo^cjcuftosinolcovel apjngia pozci> 

nacocracalefaar. 



f /Canainomata quc in naribue nafamfur *R]J 

cum ciptto er tragontea femina cum mcUc tri 

ta^r in naribus femcl ct if erum vcl tertio im* 

pofitapcrfccrefanat. 

f 3n fcb:ibu8accrrimi8ariftologiaj ficcam £> 

fuftumigiafagarq*t>emonia.j£tl^rio:e5fa? 

citinfantcm furTumigata. 

fRadijcciuepurgatfiftulamctad fanitatej % 

pcrdua'r.£t pot>agrici8 cum aqua Damr. 

f 23aUcnu8.&riftologia t>olo:ee qni p:op£ XX 

opilatione v4 aUquam grofficicm fpiritus in'/ 

diQcfii rorunda fanar magie cp loi tga.£t fh> 

muioecducit.et purrcfacrioncmfanar. 

fj£t fouJidamundificatvlccra.Tt>etc8tgui 36 - 

guia8clarificat3diuuatautc5 afmaricosct 

fingultiante8.j£tcpilenco8ctpoclagrico8Cttj 

aquabibita. 

f Sfcd ctrupmrisct conquaflarionftjue fug 

aliquod aUud farmacumidonca cft, ^ 




(TapituIum.0) 



Btiftxbis 



£ 



*»<^ttirtologiatonga.DYafco:idc8ca* 
J^fpitulo t>e ariftologia.Sriftologia fr 
5 •^agrecisfaalogoserapiflonXuiua 
triafuntgenera. longa rorunda.etdemattf 
rieuXonga mafculus eft.que ct fcaailis t>ictf 
tur.folia babensoblonga? virgcllas tcnucs 
longirudine ©uonim palmo:um.fio:cm pwri? 
purcump:oferr.*Raditclt illirobo:c tigifaU 
•: odoris boni.-Rotunda t>e qua fup:a t>icrii e 
appcllamrfcmina.foliababcn6cdcre fimilia 
odo:at a aim vifcirudinc obwtunda et mollia 
ct lcnia tactu.multa8 virgas babes cjc vna ra 
diceoblongasdloremalbumetrotundumba 
ber,inmcdioflo:emcroceumfed cft inurilis. 
■RadirdtilU rotundaet odorcnon ioamda* 
gufta tamcnb:amofa.t>eiUainp:ecedenti ca 
pirulo t»icta.3llaque tsicirur dcmaririsvir? 
ga8babrttcnuc8erionga6.foliaromnda ct 
flo:cm fimilem rurcftadicem oblongam i te 
nucm.co:iumbabcntemgroflumet odo:atu. 
quampigmenraru ad confccrionanoleomm 
rmfccr .cr rcUquis mcdicaminibus ficut romn 
dam. ' 02licnue fcrto fimplidum farmacaru 
capimlo seariftologia inquir.Bril tologta 16 
ga eftfubrilium parrium o/ rorimda.no tamc 
ftpfa inurilis eft.immo eft abftcrfiue? calcfacti 
ucvirturi8.etminu8quidcmcproriida abfter 
git ct cuapowt .calcfacit autcm non minus: f? 
fo^e magis.Uiidein quibus opuseftmedio^ 
crirer;abltergereIongaeftmeUo:.ficutinvlce^ 
rumincarnarionibus.^n quibus vcro volu* 
mus groflumbumo:cmfo:tiu8 fubriliarcro* 
tundecftopus. 

Bpmtioma 

f &iiiccnna.Srifiologiat>upletcft.0ueda 
cft long<3 .quedam tomnda.Opcrarfones ro* 
runde.m p:eccdajti capimlo , oicru.S>ed lon^ 
ga in nafccnrije et v lccribns «c -ignio: cl t quia 
calidio: et magie abf terfiua 
f^undificatquocppectusctpulmoneetco 
ferfooloulataie cumaqua bibira. 
C£>nndificat eria vlccra fo:dida.ct ejrco:iari 
oni generar carncm p:op:ie lcga 
f £robibcrfraude>lceriipumdo¥.£onfert 
cria pucnturefco:pi6i8 ct ad mulra,pficir. 
f •ftiareariue.Srritologia vtracpcalida ipri 
mo gradu etficca in fecundo/Rotunda mag$ 
compcrit medicine.erradiji: magis qj folia.pe 
quainp^ecedcnricapimlo^ictnmdt. 



CapttuluntjElt). 




^ 



^w^ 



•yry*Rbojglandi0.S'era4iaggrc.ca buf 
3r*Jfo8 auc.gaUc^apo:omniujp.tulbf 
p ^aitotfeftipric^etmanecoricismedrj 
»ntacrrcrio^co:rice^Ugnu.£tfiriter peUioi 
la q cft iijtafructu ctcorricefuii z noiaf.jf3dt. 
etabulo8.£trrucm6,cidcinrn'gidiratinfrigi^ 
darioepauea.? poflibiIcq»fittnr5 licutmcdi? 
dne fepidepmigradue': locficcat.fDf af^a, 
t>e arbo:c glandiu. Brbo: gladie eft totaUter 
lttptica.idcftinquocfl:maio:ftipridta8epeI 
licula cjdt intcr eo:riceetrerio:e-z Ugnu -,i firjtr 
pcllicula q dt itcr frucrii % comcc.f *J>U.U.rin; 
3rbo: glandis (iue querais in alro mari na* 
faturqucrcu8ctabt'c8 cubitaU alritudine:et 
ramis co?adbcret cocbc.Oucrcucria rfngi 
lanas rradtlt.j3lofa fug jrfaia.Ouereu aridtf 
tateconeufla ocfluurfoUa.Unde^beta jutf 
dcie.Eritieinquitvclut quercus tJcruictibue 
foliJ8.£tifcru5.Bafanbabergladifera8quer 
cusquenonbominumfedpoKouimcit eib?. 
Ondciutta propbctam.pies domini vcniet 
fupcr quercu bafan.f '^aIiadiu6.arbo:gll 
di8fiucqucrcu8^:qfiqncrnu8.putredtnecm 
©iflidlc ccdit in licco feruara.f jpfi.puercus 
fiue arbo: glandie cft ai bo: muuurh anrtofa, 
£>icut legif t>c qticrcu imb:e,fnb q babif auit 



Cra(tatU0 



a 



*6 



5 



sb:£bam quc fcrfunrfq> sd ronftanrinircgie 
uripatuiu pcrmttlra fecula pcrduraik 

&pmticnt& 

fJT^sfcoridce. jCinie qucrcire ?cum oleomi* 

j.rue ctiriunctuc mouafudo:ce.:t:occf ceteri 

p:cfrsnruficTce. fcd msgie. queranue.Xittf 

iiiaquocv eticmeri qttcrcfie ad vftte mcdicinc 

etnxactflfanacftbommibue a pccoribue quc 

tcnfioncpulmont8Vci;anf".cf quibue aliqua 

vcncnata rce obfiiiit .',6ibira nancpftatim fa^ 

wtemafTar. 

f arilieeriamcftvulnaibue bumeerie.ct in 

fiftuu'8. " -* ~ 

f £t vulnaa t iftMia ad fanandu et caUofa 

lengistanporibue fo:dida. 

f 0uotidie itacf lauanda funr.et ftc apto mc 

dicamine fananda.qnia virrue lijcinic non fa* 

natfedadfaniratcT>iu>onitvulnaa. 

f Sjaa.au.gatXuratnimiu flujtii fanguts 

maiftnio:itcrfputufangui8.£teom»enitvl*' 

ccritoinrdtino:u et fturniventrie. 

f £ridan.£tcgo quidem conguitinajrivul* 

tiue in quodam quod facrii fuit cum crife 

f XumfoJioglandiepoftcprriuiiri pctraet 

pofui fupcr vulnye in circuituciue. 

f jEtvniuerfaUtarnjcweciueeitiuniue bu* 

ius virturie. 

f £taUquaiidoadminiftrafin apoftcmarib 

(alidieuipzincipio commet tn augmcnto 



BCapituIum.jrliir 
*Rbo: vcl lignu virc paradifi. 

Bpmtimm 

f i5ancnaturalita babct virtutem.vt quicjc 
auefruerucomcdaa pcrpaua foltidratefir* 
marctur ct beara tmmo:talifat e veftircrur nul 
la infirmiratc vel amictatc vclfenb laiTirudine 
vcl imbecrtlirarefarigarcrur 
f Suguftinue fapa gcncfim.Srbo: quidem 
vcl lignum fcienric boni vel tnali aat coipo:a 
leficutarbo:eea!ieinparadifo tcrre funtricc 
obo aat notiumiocd t»ictu cft Ugrium fcien 
tie:cognofcendibonuma maUtmiquia poft,p 
bibirionem aarin illo furura rrangreflio qua 
bomo cjcpcricdo, ©ifcaacjd inra obedicnrie 
bonuainobedientiemaul intaefler. 
f 2^iaonvmue fupa laririatm. jqtvtj. faaVs 
(inquittwe) aUarese ligniefabim.tc.jEcce 
alrar* Ugna q seUgnie paradififunr igne vici 
nononacmanrurfed purio:a reddunf.-ftec 
mirum cum eriam amit bon gcnue Ugm.cjUa> 
to pluearefcirranto mundiueuiueniaf. 
f Slofa fupa tarium regu ©ccimo. 3Cina W/ 
gna iputribiUa funt a fpinofa in funilirudirie 
albefpinc.romndaquocpfuntetcandida^jc 
rie facta funt fulfra.fcilica ad fo:rinidineteni 
pUfultctacuIactomnjatnuficammftrumcta: 



S 



•£> 





BtDnbfy 



c 

p 



CaptmluuMEliifr 

Biee ©ictaco cr/p cacrie arbo:ibue 
li.ongeabcat.aw ejccelfum p:omincat 
*&uw narura eft cjcpcreterreni b& 
moaeac perindeabilisl>Jibcturet leuie. £ft 
autem (inemodo.^t ©e bae ruuir nauee. bac 
pwrrta^ozcmgallicamvocant qutcUm. 

f -fSaUfldius lib:o t>uodecimo; Sbice qnam 
vocant gaUicam vrilis eft materia.quemfi g> 
pUatur.eit leuierigida a m operibue ficcie g 
bennet>urabiiie. 

f 0tofa fuper ejecbielcm. yvh £r. abietibtis 
tabulata ceduntur.qmbus nauisrearur pio* 
pter leuiratan.iuncturafcp tsbuUrum mollt? 
bus iniricemfdcraienttum at q< mozdcmium 
f £;cub:o$enaturiererum.Bbie6 atbo:eft 
leuie.et abfcp nodofitate que tsifi icillime ccdit 
putredimvermibauremnnnce. f 'fcliniua 
Ibio duodecimo.Sbittis vmb:a fiatt ingl& 
dium qiiaamcpatrigcritelt veuenu. f &bteti 
ct ptnoi i quis •Detrflj.mt comccm fole rba urii 
vdgauinaetranfcunte.cum genripi itatim 
mojiunrur, 




CapitulumjEtu* 



/Rmoniadi.&erapton itb:o aggrejra 
.ro:ie.caFirttlo vafac.auao:irare c va* 
fcondieSrmomaajmcfi g> mn:i \ M 
re filncfrrie fimilis piJtr galbfliii in figura fea 
j£t nafcirnrinterra cicpa rcgemonie.cte{i 
in partibuo codt.±?cc bet ba grcceciurur #i'/ 
os cuiu8radu vuutcrarnr^tcgreuuur U<fc? 
mus qui colligitur a feruaatr. (cc\ aUquondo 
teipfocaditfuper tcrram.qnare admiicerur 
cum co rcrra er Upilli-r al i fo:dce.fedrrscluts 
cjccoc(tb.ibai8 odoMnbonum: in cjuonon 
funt Upidcs nec ligna.et tendcns ad albedine 
ariuefWrioneefunrfimilee rriicute olibani. 
ereft piirumfinefurdc.ereiueodo:vcrgir ad 
odo:emcafto:ci,? fapo:ciue elt amarue.t ba 
ba iu fe pinguedinem a fplendo:cm curu loltf 
ditate a illud quod eii buiufmodi fciatur cssr 
mfiima fcd illud quod continct tcrram z Upil 
los nominamr cbironU.£rccferrur te tcrra 
que tricitur monaconet eit luccue plante iimi 
lispUntegalbani 

i>ptrationf0 i 

f '/Saulue capirulo t>e armoniaco valet con? 

rraturTimanriqufimet bumtdamet afmaejtf 

grofib & vtfcofo ftegmatein gutture 

f -£ ilUle armoniac i accipiuntnr in ono fo:^ 

biuivel t>iilempercnrur tn melle a scnrur. vel 

fiunt pillule ejc eo a mcllc.tsenrur tamen ptius 

pectou:moUificatoajmt>valtcaaaUs 

f £ontra fa ofuUe in p:incipio aceipe armo 

ni.icu.fal .gemma.nitrum .fuccu? marubi? .cc r / 

rametrefoUe anno«ia».umcum acero ttvit 

mitte per noct em a pcftea refoUc cum cera cc 

aUerebueetiungc. 

f £ontra lumbacoscemr armontaaim cn$ 

fucco abfinfbt) et refolueipfnmin aceto. etftf 

at emplafirum in vmb ilico 

f Ut tientee cadant accipe armonUcu.t fuc^ 

cum iufquiami a iunge tentee et cadant . . 

f Bucrrois qtiinto coUtga.ca.t»e arm©r»iaco 

caUda dt,in terrioificca in p:imo 



Caplrulum.^yj 



a 



Zmmw 




^Sv. 2>flfetfdfl.£>cicnduin quod afa cfr 

•f-^Xgunimiquoddam quod vocarurafa. 
* -*■? buitis quedam clt odorifera. qucdaj 
ferida.]£tticimrodo:iferaquia parnum ba* 
bct fctoum vel paroum od»:em.£t t icitur fe 
ttdaquiapcrcjccclkntiam babet fcro:cm.£;t 
clifiummiberbeannnide.ctcflbaben6vcbe^ 
mcntcmigncitatcJidafa odorifera fircjtfttc* 
cb ipftue bct be babene auqualem odo:c ber* 
beprcdicte.£jerflpton ltb:o aggregaro.cflFtf 
tutoanttiden.Bnuidcnidcltp^nfacui 4 )6nmi 
cft alibif idcii afa fetida.radi,t ciue Ticirur ma 
barocb planta ciue babetfiipifcm quificirur 
maitateB ct cii fimtlie ferule. et folia ciue funt 
ftrmlifl foliie apt) et femcn eiue larom.f £alie 
nufc ■ oerauo ftmplicui farmaeoui.capitulo te 
ftlftorutbltantifl eitiscftaerea.-z virtue gilmi 
ttue quod ef t ati.i virrue ramoui? radtcum 
ctftoaeciuflcft queeaUfflcircaUfacrione fbe* 
ri?cftca/ific.intcrtio gradu-rilludquod cft 
tcipfo msiouefapoueeftgtmtmtV-iipfa pU* 
ta.eit calidio: et fubttlio: aliani3 planra? om* 
m'tim.£,r p:op tcr boc dl magie refotutiua. ct 
it a lac sliaram atboutm omntum.et eft in fine 
calidifflri8.ctcftfuMtflnricvencnofe.ntfiquia 
citpltteuVea fubitantia ignea aerea. jEridcm 
f tn aliam tranfUrione filrvi . cabdifumue qut/ 
dcm opoe quin\rr.o folia % f lipcc? radijc caic 



racit gencrofe fcnt fluf cm vcntcficUe fubfian 
tic omnia.? f m boc t ifiicilc tigefitbili9.cj.to: 
fum t£ ir.cn ce:po:i appofita opcratio:a funt, 
a majLtme ©mmiim opoe attracriue fuft icicn* 
ter etiltctte rtrturie et ccfomere carncmxr t c 
ftruerc bsfcet p:opter prcdicr am ciue complc 
jrioncm f Butccnna lib:o fecudo capirulo tc 
flfa.Bfa dt tuarum fpecicru quarum vna cft 
ferida er altera odo:ifera.nonfo:tcm babena 
odoKm.fcdcflUdio:cmimefifcrida.? eft ber 
ba v cbcmct i& igntitat te.in fe totfl ct plunnsu 
qutdcm buiue Ipcciei cft t i\ mcic i cft gumma 
almarotb.i: t ca.tn puri o.ficin fccundo 

©pfrattonra 

f £ vaff oridce cflpt'.filfium.id cft afa fetida. 

Oirtue ciue rfldicie c(t fermflntica.fiomflcbu 

mftar.rucru9tione ( puocat.tndigcftabili8cft.'Z 

vcftecccrrflriaaceepffl. 

f ^crorieirijEtaetimpofitapufiulflectfcreii £ 

faefpargir. 

f Oleo addifo liuon-e ro:po:ie limpidat, £ 

f Dleo cip:ino vcl vrino addita fciaticierrigi £> 

dumbiirro:cmficcaf.inflccfococracrcfltbfl# 

plafmaf ito impoftta ani cfluffle ccmpcrit 

f 23ibita vcnenie occurrit cufiomaca <ft £ 

f £t idcm £alafar.aino addintm alopitias f 

cmcndat.mcliue ic\ agcne fipiperct &ccm$ ac 

fcperit.fufiuftonce oculo? lirnpidat. 

f Suicenna.Bffl tifrumpit vetofifatee.cfiitf 

gat cae p:opter refolutione fuam eteft cu fcoc 

inflfltiua.etinciditetrcfoluitfanguineconge^ 

latum in ventrcconfert alopirie fUintta cu acc 

toctpipere. 

fl£t quando adminifrraf in abflrrje facit bo ft 

numlcolo«m./£t flbfcindityerrucas quc funt 

vtclaui. 

f j£ t cum inciduntur flpoftemflta fraudulcn^ -j 

tia momficatia mcir.buim.fiponatur afa fug 

caconferr. 

f j£t cfibona in cura tuballct flpparcnrium *|^ 

etoccuUom.fonfcrttmpetigtni qttsndo bibtf 

turcumflqufl granatoul./Lonfcrt ccnitioni 

laccrtouim 

f £tconfcrtto!ou'ncrao?fi'cutfcrano et pa %_ 

raUfi (i ejccipiatur ejc ea aureue i mtfceaf f*mq» 

ticitur.cuceraitegluriafautfibtbaturcum 

vinopipcrcctmenta. 

f Serapion aucto.tTflfco/Rfldtjc buiue ai tK) 

bo:ie ctt tcftccatiufl t ifiu tlie t igtf aonie. etc 

nociufl vcficcquando mifcctur cum ceroro rc 

lolutt lcrofulae cf. cj,irurae. 

f tt quaco fit ct ea cmplafiru cu 0U0 aufcrt 

liueum qui ftt (ub o t ulo.tt quando coqutf in "B 



&r2ttrb& 



jj tccto et 'mtictgpmwLttfitMecmplaflwm 

j> curar emouoidae ani. f £r quando biMeu3 
'tiriaca.dt medicamen mo:riferp:u.cr venofo* 
rum.£ripfap:cparaf cr comcdjrur falicctal 
fcmtnifoct falcctcft bona ftomacbo. £tboi) 
ncs fcindiir fiipifcm er radicem.z cgreditur in 
de laeb^mue qui colligtriir cr l tccarur. £r eft 

"P illud quod siorur afa .f j£r mdio: cr afa eft tl 
la que vergir ad rubedinan.et ei t c lara fimilis 
m^rrc babce bonum odo:an no fimilem odo 
ripo:ri.nccsdo:ebo:ribilem fubiroet quaw 
ck>rcruiircrinlundifcirorefoluirur.jetquan^ 
do tcncrur in o:c p:ouoear faliuani ciro .fo:ri9 
autcm cytn rota bacplanta didt gilmi z poft 
illud eft folium^t polt illud eft fiipce. gummi 
autem ci t acutum inflariuu quod quando mtf 
fcctur cum aceto vino cr pipercet ponitur nV/ 

W pcralopitiam:ajrateam.f aiia auteque,t># 
citScrapionfuntbicpojitafmmentetijaiV 
$ atiw auiccn.quare p^.nunc rranfco. 




<Cap!tulura.]Elut) 

S»arum.yfido«ic.3farum nafcimr 
in vmbiofie monribue.berba fiorib? 
caficfimiUbDncftcgfiociupraradice 



purpureuemqno femeu cortmietuTvuariftn 
jimile.radicibtie plunbue ac rcuuiffrmis.ct be 
neTcdolentibueiCt dtvirturefimilis nardo. 
t f pYafco:idc8.afaru6cftquammulti nar* 
dum agrdiam appdlant.babct fo lia edere ftf 
milia renuia ct romnda.fioaw iwerfohaiu* 
p a radiean purpurri coloris in fimiliradine. 
jf ufquiami femen vcro fimilc vuip. babet i m 
cicceplurimasrcnucsatcp nodofaect geni? 
culofae fimitcs agreftiiddtgramini.odo:efti 
auce ac tinguam remo:dcntce cii fcmo:e iuffi 
cicnri.f auiccnna.Bfarumdt berba babcs 
feminaplurima.cuiu8radiaim nodus cftto: 
tus ct aiTimilarur pipcriboni odoris Uriguam 
mo:dicanrie.baber fio:cm inrer folia apud ra 
dicem fuam.cuiu8 colo: cftjHirpureus fimtlia 
fio:iiufqui9mi.*f>adi]t:ciu8dl magie iuuans 
qj aliquid quod in eo fir.£t tiw virtus eft vir 
tus acou vel eo fo:tio:.£t co mclius cft o/ fub 
rilieodoasdt.lHamcaitdnmdtet ficcum in 
tcrcio gradufctsicif q; fiecitaeaueeftmaior 
caliditatetpfius.fl-jblimustibw.vTvq.Sfa? 
clibetbababen8foliaedercfimilia.ramo8to 
gos.radices numerofas. renues. oco:ariUas. 
tio8 cius aureus.granc feminc fcrrutatum. na 
fciturin moutibue. 



©prrationta 

f jConrraferpentcmicfusvaletnonfoltim 
mot>o.fed eriam linirum.f *^liniue lib:o jg& i 
3farumcffefslutareieco:i8rradifurviai8. ' 
Suigia fumpnim in cmina muWi mirri aluum 
purgat ellebo:i mofco vdropicie quoq^ddt 
ac p:ec o:due vulfie et moa?o regt'04'n mufeo 
fi addssfacit vimim vrinieetjaendirXu^fo 
lia mirririn vmb:a effodif atcfficcaf .f £ vti 
cenna.Sfai-umapcrirctredat omes tolo:c8 
ectrt'nfccu8p»p:ieq;infufio eius.ct fubtiliat 
ctrcfoluir.meirb:aq frigida cakfatir.ff X.on 
ferr ct iam fciaticc ac t oton' aurium anriquo z 
p:op:te ipfiue infufis.f £onfcrr ircrum gron> 
firudinico:nceetopilarionieparie.£iufcjitu 
ricici fplcnes vcficam ct renes.^rouocat ciuf 
cp potio ficut elicboute albuein purgaricc ve 
tri8 cum aqua meUts foluitf jicbanee mefnc 
^dius cft <$ ci mifcef ad folutioncm facten'/ 
dsm cft aqua cafci cu fpica et aqua mcltis.Eit 
quidam infundunt auquid ejceo in mttfco.ct 
conferuanntr in vafc per tres menfcs. £t el l il 
lud vinummedicinaad \dropifim et fptcncm 
f ^ubfiinct autcm sfartim tc t ecocrione •: 
cotritione rcm mcdioct e er etebowtto in cCtri 
ticc ci i ; fadtipm magisf uocariuij ^5 foluriuu 







Crattatua 



1"5 f £tc]crebue farientibne vomml. fteducft 
paventrem.£teftp:ouocatiuu3vrine. , zcdu 
cit colo:cmerfVgma.£tefte]c rebue bonie. 
3n quibue cft fpecics iuuameto? ad opilfltio 
nem cpatie ? fpjenie ct tmriciem couinu mo: 
boeopilarionu.ficur cft rdropifie? ycraitia 
ct twriciee fplenis.?,pp:ie vtnu infuftois cius 

3 quodfciumue.f £tconfcrriuuamcntumma 
gnii fcbabu8opttarionu,ctfeb:ibue antiquis 
a inungirur $o:fum a fpina ejc olco ipiue cuj 

ft laudano et facitfudare.f £t confcrt opilario 
n(feb:ium ct ptouocat vrinam. £t in fperma* 
tc augmentu facit. Pofie ctue infuft potio efl 
ab aura'&q.vfcgfld.j.iuj.et puluerie cwe.j.u 
vfcBfldaureoe.tj 




£apituumt.]E!uii? 

r £5traguloevclaftrag9lloebabflcft 
. quc folta babct longa cii incifurie mfy 
"rie.ob!iqufl circa radiccm caulcs trce 
aut quatuo: fio:cm'iactncri.radicc8 vilofas t 
plicatae rubeae fttedurae bflbar. Hafcirur m 
perrofis ct afpcrie locie. f jSalienus xufim 
pli.farma.cap.aftraguluefiucficuoterreS' 
ue glandula fruriculofueeft bflbens radices 
!;tptica€.quap:oprcrej:T)efi'ccantibueeft. 



f £alienue/Ronfc«bfliter aVatrfjatvumc* 
ra vctera.f £tverarf flucnre ftringitfi quie 

radicemciue coquenein vino .bibat.^Rafcu? 
fliifplurimflbecbcrbflinneuetcflrsbie. 




Capitulum.jElijE. 

.©pergula id cft bcrbfl mmura babef 
. foha ftipitcm i:odofum.etm quolibet 
' nodo folia in gyro pofita quincp vd 
fer, vel fepf em otdinatfl fld modum ftclle (ia\t 
berba quetiarurrubefl velfieut fllguafcc.ct 
aba'fdenodi8p:ocedutalt)rflmifimiu'modo 
ftcri cum nodieet foltjs vt fupta in figura 015 
floubus paruie albieficutfio:e8ouuaru$£ft 
enimcaudeetficcecomplecrionis 

r^pfratioufs 

€ Omncm turictem crflpoftemflta ©itmre fl 
!bluai8clt.fquandoc^putftructieabttmf S 
daconferrflpoftemflnbuearcfotottettcrio^; 
raapouemata. - s *» 



&t$)nbi8 




r> 



CapiruIum.I. 

r £riple|c.5»erapio.li. aggre. fapftulo 
.araf.2luao:t. £>Yafeo:ide8. Sraf .id 
fc eft trfple]c.0 Iu6 cft fcegenere 'ouplici^ 
ci ottiuuzaggrcfte frigidu Hcd tomeftica mf 
ro frigidio: e agrcfii.palicnS vi.fimpliciu far? 
maco:u capitulo andrafafie Sndrsfafte fiue 
amplciclTuccrifolocanafiigidectbumidcvir 
ruris c.bumidaAdcinfcdido gradu.a medtjs 
fnsida mpmo:qua^dctcptdat»Kcbant;cfic 
quau'tatequaii6etrofi6nn8$am9:niftq:no 
cftparriccp8fiipia'pti0.fcdcft aquofaetmtf , 
mmetcrreftri6»fiairmalua.fed feamduverre 
facile rranfit ficur illa jprer vifeofirate; omino 
autmodic(iqt5t>iafoKticucftct3untcriict 
oaulane tam malua cf> anfradaffe multo bu</ 
midiozeeetfrigidiojes agrefiibm?. 

^ptrationts 

f ^t3fco:idc63ndrafafi8.idcftfltrfpIc)cciS 
tb aplafmarib? adbibira cruda t cocra papnf 
impofira mcdcf.f £>cmcn co^cu mulfa bibi 
ru Yctcrico8Curat.JEtu8 vfrtuseleptmtica cii 
polcnta cat baplafmanbu8 adbita z impofita 
«olo:em capitie roilir.f :£umoute oculo:u5 
ncccffead bibcf.crfaiigationeftoma(bi impo 
fita roUiir.ii ©emcn cius ncfrctkie mcdcf .£r 



folia ctus conntfai: impofita igncm fa c mcoT 
pcfoit.f 5olia ci9comcfta tolo:c8vcficeatn . 
putant.f S>imilif ctraima ftomacbietvcn> 
tri8 > pbiba.fomcflufcb:c8acutaec]ctinguif.* 
f £t lumbucoe ronldoe cdwix. SJangiiitte? 
raicicrito^dc^.pifuntaic^comcltuauriliaf 
f £atbaplafmarito oculo?vtilitcr adbibef, 
•Ratmatiff imum inrcftinomm fi adbibcf eom 
pcfcit.po!o:c8 matricis fuppofimm mirigat 
f STerapion auctontate^afis.Sfcmchci^ 
facit vomcrc fo:rifcr£t xidi bomin2 q bibit <$. 
c0,$.<Q£t aiTtlauit vfcg adfcebilitate magnam 
f ^aliaiu8.BrripIc3ctemcfticamuIro frfgtf 
dioi cft agrcfii.quapwpter er flegmenib? ciil 
frigidis incipienrtbus qoidem ct crcfcentibus 
ac mollibue adbuc ct quafifcruenribusemtf 
lanaxie vero cwefnftaroett>ecunatiohe?irt 
durefcentibus frigefaDtibueagrefitefunt a> 
uenicnrioim^ruaue aut em rius abfterfiue $ 
turis eft.Undc ct at> Yctcricosejc opjlanoe epa 
rievtilieeultit. f &lmanfo: rracraro ,'tertio 
capirolo tearriplicc.Sriipliccs frigidefunc 
ct bumidc. quc vcntre motyficantee benenu? 
mut.3cterici8quo<|etcau'dumj?abenribw 
cparbencficiuntpwltant 



B 




Cepittitum^ 



Crartatus 



a 



r adlana jjnda fmiiliif :fi'«c 5 Itmili ma 

•nuct mufcare:nifi q: pars vna cft aliq* 
lirer actttioi.i alia c plana:ira q> pofljt 
ftarc rccta ficur alicuius cj in ludo a5t pedcs.in 
ccrcrts intus i errralnuci mufcarefilie eftvfine 
odott? finefapo:cnafcif.inclufa tnqdi lanu 
gine fifi foUici.lo fa ia.mtroriee ^cferfuifal^ 
a6fpeac0:m3jciecuciiiamomo 3 C3fiKcr*c£.o 
vidiipa^infuo folliculo cft Ifipricu valdc.t cq 
p3r3ffand3liejinrrigidirareC^a3.U'.agfire. 
ca.faufcl.i.aucllanainda.£lt'cmarbo:faufcl 
fictir arbo: hacgcl.eranittir;c3nula8iri cfttio 
itafcif taufcl (icuroactili.jSr ifta bcrba no e in 
rerrl arabii.£ r idcm auc.j;faac beiiara faufel 
cauelianaindicfl^cfructvfiusnucemufcart 
in qUrareyt cdlo:cfuo.?funfinearuge.a in 
fapo:eeiu8 cftparii ealidiraris at pauca ama 
.nnidine.ctt)efafcjcTini.etcftfrigida?fo:titir 
Jiiprica 

©pfrationts 

f S»cra.io:itficar nieb:a.-z virr9 eius Zficut 
trasfandalirubei.-rccfeitapoftcrnaricocab^ 
• die.q qn no inueuif potiif p co c£ fandato ru* 
bco.-z mediaaepcdaie cjceoriado reccnri. 
f £lt cm fomter ftipricitrz fo:rificat mcmb:a. 
C£tcboniit>oloritot)aui.cofirmat«ente8 
comoro8:tgjinsiu38fualiipticitate.erfrcpu^ 
mit caiidtrate oculi qn fit q: eo cobol aut-em* 
ptaftrum. 




CaptruIutn.Ui 

" r uma.^Uniti8capirtbfce'aueua.mje 
•vtgrecicfiilope^r)erbaeftquecrcfcit 
L wfcgeribu8CumfoU?8 truicolfimilito 
fimplicibus quidtm fed birfuris cum renui ca; 
lam ob abcnri in fummirare tribus tegminite 
flmbirum.-erqmbueflrificfimilcecapflUecjtf 
tanf.f Scrapionlib:o aggrcgaroue.captf 
rulo kufir.auaourare pfafcoudiWKurfir fi* 
uc caufir vel t>olara.id eft auena £ft baba cu 
ius folia funt f irnilia folue frumcnti. nifi quia 
funr mollttwa .1 ui fummirate calami eiue cft f< 
mmtJuabuevelmbueranicieveftirutum.eic 
qufcuecjccuwariftefiroilcecapilUe infubtiltf 
rarc 



f £alienue fcjtro fimplicium farmacouim ca 

pirulo t>e egilope.£>apo: ciue eft acutue pa* 

rum et aerie.£r virtue cius eft t>Yafotcrica.fic 

cr rcfoluit apoftcmara t>ura. 

f£tconfcrtfiftuli8quefiuntiu]ctaocutuquc 

cfiilopevocanrur. 

4 1 1 quando (u cii ea cmplaftrumcum farina 

curar fcabie er rcfottrir apoftcmara tura ,£(t 

aurcvtcucpfiipticitarc5baberi8vtat>iarrn8 

que f m ventre confaar. 

f £t idc, Iib:o p:imo fcc cibie.caplb ©e auctia 

Bucna cft cibue ftibiufialiu non bominum ju 

ftfouc alifubi famefccntee ct.tremecogitaitf 

tur cjc toc fcmine panefaccrc.£r.rra famenflu 

tcmpcraquamcliuimuomcdirurcumvuio 

duUi^utmeUeconfimilitcrc\fe>Calidiratcau 

rcm furricienrcparticipar confimiutcr illi. q& 

titenon fimilitcrilU t>uramqoftene.p:oprcr 

quodaUmcntumminueejLbibct co:j:o:i..£t 

aUreraurcmindelarabiUecft.quiaejc ipfo fic 

pantemon tamcn rcrcntiuue vcnirfe.flur p:o 

uocatiuuavtpuueXed inmcdium fccundum 

boco:dinatu8cft* 

Scmpion.^oUtt t»uritic6.£r tdco adegi; 

iopaararinaciue eatbaplafmaribueccmuta 

congruefacir. 

f Drcmciue fucaie fcniatusadmitrue fartf 

ncfcjcrari) in]panifculo8redigirur.a itcni3 ref 

tbluirur aqua in fucct.quaUrarcrn quoniam 

vfus ciueclt ncccflariue.viree aute beba lc^ 

ntrcr^rcrTicacitcrrclajcantee^tadomncstu 

ntoJeefaaenrce» 



Capitulum.jtlii) 



©fftfttfe 




^SV,ariotla murfe. Sutcenna. SuricuU 
J^murfecftbatjavirturibcrbe qvitru* 
^ ^abfta^fimilfe.iEtbocnomenabfo? 
luritefttwabc>bat>fe.qua£vnaeft quanomi 
mt&akcnVbMemaUicodotectnd babcs 
fcitritiXSUaaquanominauif Dvafa>u'.cfti 
mane c? fir fifis volob ilunili q> babet fplta mC 
noza coparata ad ipm.£t cft bcrba ejcpanfa 
ujr faac^crre.pflruoeftipirc8 babe6.domcfli 
ca bona fine odo :e,nec babee fapo:e fo:tc;flo 
rcoajuUnoobabcno^uiitsfemcairimilatur 
femirocoJiandri.£r Yrudfoesecipfo edur.£ft 
aut calida ct^pric cuiusoJigo no e aquc^pin^ 
qua.3uuamenrii ciue cft( vtait 2£>ufaiacb) 
iuuamcnrii abfintbrj. tf eftreoq noneft mon 
ftrataftinulfosuatoplawie.Ouenotacftec 
efe(tcfte0alieno)fhgidaeftct bumidaing* 
du pmo.BItcra vero cft ejc fumma mcdicinaj; 
calidarftOlnpmavero cft fupricira8.2llrera 
cft deficcatiua rubificariua. 



f £t bcrba tpfa confufa ctfupcr fvSxme Imf £ 

poftta artrabit Mtp cozpoti. 

fdaUaute.^uccusflhueberbcflegmapur * J> 

S&t pjopter eandcm caufam, 

f £t vniuerfaliter loquendo ficcariuam babj £ 

virrutem.quapJoptcreriavu)nerafoudac.et 

putttfcctttibucconferr. 




CapttuIum.luTf. 

r ?edar vcl ajederacb.cft arbo: babeno 
.fructufimilenabacb.et nominantcuj 
y -*-3udamirabolanii.£teftarbo: maa 
na.Hadic oue caUda m fecundo:cr ficca infi 
nepami.iTUCfueciuBfm plitrimiteft mabte 
ftomacbo«et fowaffe interfiat • 



M 



0pfrattonf0 

f jSaUenus.Sfpinas a fureulos errrabtf :ct 

plagasadbaerefaafXonferteptlenticbtbt^ 

ta.Xomtre quoqj fternutaridne facra ci: ca. z 

ciusfternutauo cercb:u mundtficat. 

4 S>uceuccute curat oailo:: cssliginesXon 

fmbYdropicfectcalculofieeteparicfe., 



j&pftattonrc 



filoseujeapcrttopilan^ncmccrebJi. 
CRadit eiu8 eum vfno interftctt pediculoe» 
etattget capfllos. 



Capttulum.lu 



» » 



Crawatu0 



a 




Xcft?m.©crari6lib:o «gflr.«^bal 
»anr.£flUcm'is>ubftaaa accrieft fub* 
L riKecompofifa ciccsltditarcafrigidi* 
rate,m'fiquiafTieidjtaecftsmplio:mco cp ca 
Udirae.£tt5cficcatmtcrrio§du ,jpc fincqua* 
do fuerif anriquu^t e nocM ncruie &ar.viti 
fim.far.ca.o|coe.f m traftationc greca. Ojtoe 
a.acctu mipt e fubftanric cjtiff ercfcj calidc i fri 
Cride.Su4>ab>fabftlitx> p.titc.fuperacrero ca 
UduatcfrigiditaeXiaamiflvcrofufiicientcre 
boc farmacu.v t fit tcrrij gradue iam compUri 
quandoeftfone. 

&pfrariow0 

f t^t^^ttromfrigidat-jfiqjticar.tg botifl 
ftomacbo.t^noeatappairu.tabfcindiffan* 
guine a quocucp mcb:o rutat.fi bibaf aut fiat 

& fcflto inco.f £t cocjf cu cibie.? ?uenit curfito 

£ liieftuitatu adlvenrre.f £r qn infunditur i (o 
lana no lora aut fpongia curat apoftemara in 

P pncipioipo^.f £trcftrtngitmairiclcgrcffa3 
autamJt]cenme.£tftringugin0'uamfangui 

£ nc4crita.f>£xpfertvlcertbc>h-audulcrieerbc^ 
rifipile.et foutticc^tfcabici vlcerofe^t impai* 
gtnixt cmo:roidilx».a pariaricon.£r abluunf 

& cum co vlccra fraudulcnta.f £t quadc mifce 
tur cu piiuco furfut ie ct p:epora'f tcpidum fug 



podagrac&icntt. f £tqn rcqwYaFmcllett 
linif cu co tiuo: d, fit fub oculo aufett cfi .f £ t 
qii infundif ipongia inacao q £ ue fucrit infu 
f a in olco rofa? et apponif ft onti tcucr.fr fcdc 
c]ccaIo«folie.f £tfum9aue ccuenitgrfluiiJ 
tari «udirue.t rinnituiauriu.f £tqn tiiiiuaf 
inaureocciditvameec\ftmtinca.f£tqua? 
dobibif calidupfor accipierito mcdicinaeve 
nenofae f £rqnbtbif cufaleobutatnocumc" 
to roiici.f £t qn bibtf aadtcat fanguuugas 
5 adbefcrint gurturi :. £t pucn£t"rtrtl£ antique. 
fcf qn btbif calide coucuir afmari.f £t qn fit 
gargarifmuecueo abfdnditcurfne buir,o:uj 
vcnieoriuadgurtun f £t£uenitfquinantte 
et caufui vuluc.? rolwrio o»e eu eo ca.pucnit 
©otoaoenrium.f -fSaulueca.ee acao.irica 
rioeiuecu faleeircavolaemariuuar^duva 
lct contra frcnefim et lit argiam. 




Captttilum.!uf 

,£lua.ypocr«ein lib:o$ acrctaqua 
• B qua quein alrie tociefiuc bulictirie 
^cjcurgit monrito aquaru opitrna afa? 
bibcrrima fapo:ata.ralie vcro mulra vitn pcr 
m(uieefoditfee.cftbfemccalida uftatc vcto 



3 
X 



•> 



BfSjrrftte 



frigfda.SftniltYer cj5q,pfundiufeti!p erurgfff. 
fonte.cj^ aia melio: ca q afe o:rn folie : marie 
efiwb rgeteauTit alba efpicua.afq? ;pculdu 
bio cft odO:ifera.q vero lcnra cft 2 grsuie pu* 
trcfacruia4Dpo:rcraurcmet1'earrenmarca^ 
itircs aquansm.vrporcq tiuerfcin fapo:e et 
ponderc fiinr: t ebac cm que rui btdi c\ btbcrit 
co£ virtures calidi ac rumidifiunt 

3 3&pfratiow0 

'* f £poaae.£o:p.a tnacra cubiri fpatule rcnu 

C8 timilircr facics $maric rn sd fpkne pflHcf 

w^ cogif.vn maluefanguio.pcrcaf illa no btbcn 

<* tes mulra fugabunclar comcftionc.f fcfuries 

'■-■ lUsgfatcratfltcgcrefciMfitlfimilircr.fuijio 

ra xetmm t mcdia inftanf .quap:oprcr 1 atar 

ticie fo«iueilIieTtcndu5cir.q bacegrimdinc 

r bicme etdrate ptina*accicfrt iliis aq citrina % 

*■ tnrereiit.f fiftareto t>iifinrm'aliercria lcga 

crc]ranalabo:It.qmo:binarurap.ucrrunrct 

rttutit.ain aquaeadutcinina,etkcunt iuuc 

ncs flloru pulmonis t olo^e.altieq? paflicib? 

cofmete8erurbltt)x>afflisur.fcne8acurafcf 

b:ctflrdcYie]cveMi?ltricrioe,accidcrevc)caf 

Uklierib9 apoftcmara t>e genae albi flr gma 

iis tnafcunf.neqj pcipiut vdparturiiit nifi ct» 

magna tin T icukareatcr3moUftia t co:p,fl co:uj 

magna et grofla.clto pl9 in lcgiti)die,pteduf 

tifo graalio:a fiiir jneftrna $0 iutta qtf opo: 

tet ftuiif .pueri berma viri caufoncicrurii;mc0 

vulneriteinfeftanf ,£?ed c\ buiufmodi narurc 

j^ futbi8vitaimpofitbtlceftc]ctcndi.fjin tcptfli 

w ua fenectapripiunf.f ^ulieres^o granidc 

vidcnf.cuto rp.apart^adueniilt.vfcri fetf in 

flnc8fumo:crclaranfatiufmodiparlicctcrc 

ta man ic qcucg aque citrinc coadunaricc in* 

tumcrir Ubo:ar,ad banc ira cri qua p:edi).im9 

aqulpcrtinescftetcaq acalidarcrra furgit 

£ aut fhgido metallo vcl ac fiuC argenrd ,ul 

auro fiuefulpbnreaut aluminc^ Bqisc plu 

uiales Uueect fopc^te «tc lucidifiirnc funt. 

'Ham fol qo fubtilr? atqs lcuiue inattrabcdo 

flfiumit Bque pluuialce cifo ftatrcrrr.maUlq? 

qcalar odo:c. quare cm et mulr$ccgrcgare ft 

$ acj83ckoku4?flti}8purrefccrc<)lct3cmufa 

ri.f Bqua niuatie vcl glatialie ote maia cft 

poitc|fcmelft»crir ?gelara mlqjif ftina ?ucr 

fcfnarora.ciccidcfapo^itutlatc-zcia^fuCTit 

aut puru idfotu gdu aducniete rccdfyr .qo* £0 

■0 turbkJii remalit.f £t H'cpofcrtpbare.fi cnim 

aqua i vafc fld tncfura pofita f 6 gtlu pgdari 

©imifalcuqfpgelatafuciit ifolevl'iclhb5ca 

. Kdoliqfactarcmoueaseademefuramultomi 

J '.. nu8iuenie9CH r e/iTrat]t9cgelucthiur.oi8aq 

t>e ntuccr ftuto peto: eft pmi aqua.f B q frigi 



da fctbd ©ari fcigcfta mataia. f S «iccr.ittj 3 
cfln.ca.t>ccurafe.ingenerali.Squafiigicaiu 
uar in tigcrcndo.Buiccn.codc Ii.2t qua cali 
da ctWpgclat cp lrigtda.S uiccn. f n c&tio'/ 
ne t oari a.rj ,fcn ,t\ .fnmma.i.cap.irj .% c\ fi igi 
danottbett>arifiebumo:crud9t gtoitur. K 
Suiccna te atra fe.in gencrali.aqtta frigida 
tigerirbun:o:c colcncn.Buian.codc loco. 
Bquano nur,rtrSui.i.canoncfen.q ,t octria 
tj.ca.f.vi.S»inc aq nopcr cfiecoplcmenrii rci ^ 
nutnrc.f3uictn.code loco.Bqua currcsct R 
Mcoogfa cli mclio: aq?.Buic.co6 li.^clt 
o:eaq q fug parae vadir cp q fup, luru.Btii. 
coi ii,jQuaro aq magl longaf a fuo fncipio -> 
Itito mclio:c.Buic.codeloco.Bqua q cft cfla 
t c frigida bicmc ealida e melio:.Bui.eodc loi> 
co.Bqcocra.mino:i8inftartci8«r vciocio:i8 
t>efcefici8,f Buic^od^Ioto.Bqua pluuia? 3£* 
lis •: fpccialr q in cftarc colligif 1 cii funr roni* 
trua cft inrra melioKsaquae. Buic.codc lo^ 
co.Bqua pluuialie ipeditpca^vpcc.Buic* 
coCloco.Bqncputeoftefcrio^eaqucfunr.. 
£ ode loco.0ueda aque gencrat ficgma:-: ^ - 
da colera.fi odcloco.Bq patudu ad apofte^ 
nta fplcnis ? Ydrbpifim educit;£odc ioco .B 
quc no currctcs quoolq j mo fucrint nocct fto 
matbo.f BuiC.eodeloco.Bqua calida co: *]& 
rijpit ttigcliione % no tollit fitim illico. ^ddcj 
loco»Bqua mutrii calida iuuar icolica 1 fplc^ 
rii8verofitate.SodeIoco.Bqn6nutrif.Bui 
ctti.i,canien.i.tocfria.iq.ca.iin.f Bqua t>c "R 
baejLbtberimareria ejciiteti tiigcftat virtute 
fo:ri.i3af.Yi.rerapaiee.ca.ii .Bqua rcpida fa 
(irnaufca.^uiccn.i.can.fen.ir).tocrriaj?.ca. 
viq.Bqmulrucalida ?ftringircurtm.f j£at; O 
vti.rcrapcntice.ca.il ,Bq frigtda nocertcfecrl 
^al.code loco. Bqua repida moliir co:p5ct 
mecrar-ztelccrar.^af.codcloco/Baraetin^ 
mcdaarc in aquaa luminofa ? ftringit cutim 
1 trgfpiraricee int5?ltringit.^ fi fiit fumofc gc 
naatfc.j5al.i.t>e.ac.'r mo:.ca,i. jggfljfc infri? 
gtdaaquabalneatimomti littanrccp tcmii 
vcnircr.j5ar.codcm li.ca.iti.Bquafrigida co 
uenice elt colericio rge fanitar ie % fge cgrirudi 
ni8.^ bocfi fucrint cofucti co:po:ianconfucfo 
nequaq5t>arinifip:ftj8veneritadfanr>attm. 
fi$al'.virj.rcra,Va.iiu.J©irimca8t>flreaqua . 
frigidamcoieibjcolcritie^raincofuaudinc *P 
fuadeocjnotbeastare.f Buictn.i.can.fc. ^ 
q.c9jtvi.t>ocrrina.ij.Xerrec9quefplcnercfol ** 
uunf .1 no coire voUtcs adiuuat z aerce co:ru 
ptionicomplc]Lioni8viile8e]ctltunt.Pvflfco. 
cfl.tic aqua.Bquarum cmniu narura Ingida 
cft^ bumida.Bqua quet>clapidecmanar le* 
uio: 1 iimp idto: ci t vcmrt m % ninam^turar. 
«■ - *■•. $ u}^-j 



Cractatu0 



*R f Squa q tc paludfoargiMetniiWt gufe 
c: cft cocta SalurcVo:pj£ ogaf s mlru med* 
rur.£r q: in otto infit miraub ecj c ncaflaria. 
jforeroceaqepiuuiaroptima cft.etlcuie a 
^ulciectfflctlimctigcriT^iiocrRcaUft.-rcito 

:£& infrigidar. f pc fonranie aq eligif illae,ue ad 
fo[jeo:n1fcncut^mcTidicvctrcmontocfllui6 
ejiif .^cc im#mejtpluuiau'.quc $o ?trao«i 
dcnr e < urrut \ ftpt cntrionc pcfitme funfc aquc 
petra in vcfica 2 rcmto curat.-: muliere ftcrilcj* 
facifim coigi irozpo^-z rffio^nimiumcfirua 
ftr frgunr uibtbcnf ce cfirirudini f udo:cm p:e* 
rumpcrc rcl flun;m vcrurie vcl naufcsm. 

% fpYaf.ca.scfiqntarinafmtrMarc^grcel 
Squamarina ^tutcbj vifcida? tctmaric&ct 
catoftematieu vcntre" tuibat .flcgma t cponit 

Xi %. £olera^o facta % fcmct zdbfeisa apcfte* 
marat>calto educit.fcuricice fpatfiir.oib> fcia 
fo:cftmpliat.ncrRo¥caufaeceponit.tumo:c 

£ mflnio:uccpcfcuf jnucnitctiiaquafulpbu 
rcaaluminofa; fcrrca^babctvuturc carwn 
a quibuereapiurtcnomuiariecs, 




Capitulunt.foit 

: 3rba3ouiej?fi.I«.abv.;6arba ioute 
, i£atfttcmp.viua£ccdbatba3cuie? 
ftiesdoeomnuidMt.andcc.daj air. 
Barba ioiiiefhcadoefcd fimp cr \ia& ibuis 
barba .f lMarcari$.;8atba iouiefri.in.iri.g . 
fian.ti.Er &fcmB viua:qrfcm£Viridie rcpetf 
rirur.jjraq? viridie mulrc cfti( acic c ft j£t in mc 
^icinisponi tcbcr;ciilj'ccara roo ne, airruti 
foabia' infrifiidanditalrerandi. 



f^prraticnte 

f T>laficllcinfuccociue^flcrro vclagrcfjf M 
tinctevalcnrpcalcfacnbnccpfiriecpYiimajr. 
f /Corra t o!o:ein calida caufatn fcnctpio va 
let ipa boba frtta % fuppofita. f £etra apa$ 
tacaUdavaUf aclmatcricirc^cufiionc:licj p9 
modii cbfir pfiipsdo matcria.C £ctraigni8 
vclaqucvllurae.fit vneucnruccfucco cius? 
olco rofco ac ccra f vCorra fiujtu fanfiuie c na 
rib?q<5fitcjc cbuutione fanguinie ui cpareac 
venie in iuucntb.et in cfta tc plagtlla in fuao 
cfae ac aqua tofa$ inringirur «c tronri ac tim 
poabuetfiutfurifup.ponif.facto:.eftaiit 
barba iouu» fbccfce mino: aadulc. f */& a crr 
adiuuarauditSmircpclIitcptob^atrcra 
mino: fpce cft ift i£ ba be:qua lcmp. viuam tif 
cunr.qmvirct crcirj5e.!£arba iouievuujari 
ino:evocaf.£ficrefcrt&ciaefflc^luuMa$ 
nccrronue bancp^cdicnbpofieiuuare ;c. 




Captntluin Juiijr» 

8Sr ba filuana d t plantago aquarira q 
uuta aquaenafcif .cuiue folia f unreb* 
longa in acummrendenria crwta fug 
aquam fimflie folqe plantagtnie.T(ifi quia m 

funtacolteappar^csficwplantafijni. 



35 



Bttfttbia 



%. %Xfo irt tinaintdtse fcribit £atie.ea.?>e eutfs 
& gcnitaliii valcrc ad imp:egnidu. <[[ £tfdeTn> 
cit eoo Ujdc cpaeria.cr barba fUuana e\t ccu? 
tunmuaacinca.-z ponfcurfiutcr barbaftlua* 
na in anridotario galient minori. m c\c\i mcdi 
caiuine cfi inctpit mcdicame ad pcipicndum, 




€apttuUmt,li£ 

^y Silauftia cftfloemaligranari caduc* 
Jr^qul D? af.vocat quirinii ea.e malog* 
■"V-^naro (nxH % fic.T.ij.gdu.£?era. It. ag? 
jjr*r.r a.lutfri 3.i.balaufri-i ,?cf.oe malignatu 
i c ( tmalie granatf qda funt toroefticaiqdam 
filutttria.f5fioefaucrlr^j5:b^lawjlia.q? qdl 
muentfalba.qda purpurca. , zqdamrofaee& 
BuicMt^.ca^iJfltauflta.BaUufaafloefrt 
granatifiiueftrl EfiaawcgTptq;£tipa Afa 
qfi cp e mbca.qficj* atba.i qncB rofea. £t fuc; 
(iei9natura eft ficfuccibarbe bircine.frtgida 
cftiufirtepmigradSJiccafofcSo.gafcvi fitru 
far.caJ7alauitiii. > < 6alaufriu cftftoemaltgra* 
nati fiuidtrie.qu8 t»omeftico vuin* veberaeii 
tcr aucfiipticiitgutlu.nccnc fcdiccatiuc? ftip 
tfcc$ru«dt*paiic»crdtgrofia£paiTiu fir€ 
coUntfsicta itiqrto to>gtnonuinenfo?»ajro 



ofidcbflrttforlT c ft^ticn f eTrcflrccfie i (rfcidu. 
*3RulU9auc alrcrtffaperie bjuidicium *£t icko 
ponet vttq j B aliqe (iccare ? ifhgtdarc 116 t-c* 
bilitcr.fiqdc no malc oftedcbaf a r.ob in qrto 
(x>£morwmfto£inc(Ve ftipricttatc tcrrdriib? 
•2 frtgidie eozporitD.teindei apparaia tcitari 
tur.£tdn ugatriridibn alt^vlccrib?fdan;o 
nae dtiue 6de vidcbiead cicatriccm jjcccttrc 
^incdtcmerwctwtettofangwric rtinin* 
fcrije adbucmflujciko c\ inverrc-: matrice no 
dt altqe mcduo? fcnbcnriu cnrariuum ncgo 
ciumcuino vtaturbocfarmaco, 

^ptrationfo. 

fScra.*6alauftiamc3rnat?flrigittcurat 
ta^mone.ctpfolidatvlceraintdlinop.tcc5^ 
fert fputo fanguinie % 9sxpx\ m teGino?. icon 
fert adomia ad q pfert ? pqc\ftfdoe*f 'B.nkc, 
56alauluadtpglurinatiua % vcmt oc? fiuj.il 
fanguie z gcncrat mdirolia .f £. t c fcona giti 
giuefanguinolitc.cpfoticiacplaga&vvUcra 
«nnquaxtalbocowpircufftottitii puluerija 
la ©cfuper. C £x firrroo cflttit tetcs motoe> 
% t r .pfcibcr ftunu fanguie. % rmngit fuijiu in^ 
fdtino^-i fwjtu matricis faguinc. Xoco mn 
potiif spjf et glaeduiie^ caput granat*»., 




a 



16 



Crartatus 



CapituIuraJjE 

JT> 3lfamue.DYafcoridee.ea.t>e balfa* 
jc^mo ."Bs> Ifamue ai bo: cft fimilie ticrt.ee 

^J in code? ftaru.aur piracacon.foUa ba* 
bct fimilia rure.ied paulo albio:a. no fcrcpcr 
viridia cjtfftenria.5le:ce non caduc op bsbes 
"Flafrirur foUsmin^ndia curtibuevcl locie 
bumidie.Eft emm arbo: rcnaa er afpaa ob 
tonga.fiipircm babeefunikmviri.&rbo: t>i 
cirurbalfamue:lignumMlobalfamu!r.fcmcji 
rarpobalfamum.lacvaovclfuccu6balfamt!i 
jbic vero fructue oprimueeft.qui cftrcccne 
*ftpvcbemeneodo:e fincerue lcrm»e.leuie 
mo:dene arcp mcdiocriter linguam redargu 
ene.Sdulrerarur autcm aprito oleo aut lcn* 
lifcino.aut balfamino fiuemirtino nccl mdle 
mitro.quod leuircr p:obarur.quia aqua in q 
ttummilTumfuerirolaimfupcmarane balfa? 
^mtim fundum pcrcne cfi balfamum puru.ve^ 
(!cm non maculat fupcr afpmim. cuiue tan? 
ra vi6cu*eticirur.vrftfolincanducrir inma^ 
nutenerinortpoi1Tt.p:crcrc9atbo: mmie tft 
'calida erftcca ecrcnuane.fuaue aurcm fubti 
ko: eft virrurie.Opobalfamu quod appdla* 
rur lacb^mum eft arbo:$ que co fimil malo^ 
jjranato vcl licio ramofa.ramifi tenuito et ep 
albidis.in 3ndia tanrummodo crefcir. % \xc\ 
tnt>icut-iin3ndianafci:fructubabetqftob^ 
rotudu p mediu qfi venrroftmi ad eapira vtra 
c$,x«d^cturubicundn.valdegratieetplcnu.x 
fifransif fimilemeUidt.£t fi ma/licaf fimile 
eft piperimo:dc6 et fuauiter redolcne.qtS car 
pobslf«muJJ:.t>uiueautarbo:ieUcb:\m0 
coUigiror©iebxanicularito.fm alioe^o re* 
po:c autumno.jjncidffautcm mmcuejbuiue 
arborie e loca er ramuUtpfiue.£tfic fbppo? 
nunfvaiaCvtpeefenefiguraaiborieoftcdit) ' 
quelacb:\muftuc8 rcupiar. £t ,me di opti/ 
mu recene fincerum i ctalbidum i odo:e acu 
tum.lcnitcr linguaj fubmo:dcne.fequen8 eft 
coIojc fubrufum.a quafi glurinofum.tenium 
dt rcnuium paftium valde cr eIucidu5.3Dm« i 
aurcm balfamum quod vctultatcm rec tpit fit 
rubcum et rVftnatum ct fieot .0 uod aut opttf 
mum cftfinccrttm dbquodcptn aqua munda t 
tliUarum non p:orinue tifiundir ur.fed magj < 
tdidcf & poftmodum rpratn aquam atbidaj i 
facinetlacriadmiicrum.illudifKafcum ftrutf . 
git vt coagulum.qnod enirn fincerum non cft ; 
infummo aquectfrundirurt fu£rniataf/m 
olcnm qtiafi f iiUam oftcndit . S>ciendum q> ! 
balfamue t>icirur arbo: balfami,£fllfamum i 
v&otiarorolcumvdgummi.qo mdiueeft u 
ciccrc.Ba no dt olco vere qojbatur rnukis 



crcmFUe.-ftrirno ro # vfdcmueadbercreto 
brievnlncrcm.HtfaciIctepanno eo infccfo 
teuatur.Similircr pvafcoridcetJtcitcr i aq 
iniectum perit fundunupoftrr.odum tifiolutf 
wr.et roram aquam albcm facir^tp:opterea 
vpcat ipfum lacb:ymu.3tcm lignurn ci«8 vo 
carur jttlcbalfiimum.ctfrucfue vocatur car? 
pobalfamum.^uUie modie fopbifticatur 
Ouidamvcnduntrcrpentinamp:o opobal^ 
famo.quidamadmifcentparumbalfamircr^ 
pcntinc.crirab«bcrodo:ebalfami.3k) acci 
piunt fuccum lcmonccUi vcl folio:um citri, ct 
admifccnrtcrpcntin&ct addito croco oricra^ 
UcaUfacitetoeficcatintertto gradu» 

^ptraticnfB 

% ©pobalfamf.5.f.t>atue 015 vino fugfiuffa % 
fccmatriciemudificat.fctum mo:tuu cducif. 
Tmcnftnia^uocat.bombaceintfncra-zfujpo 
fir atcuenir ^foifTurria? % ftranguiriam^t W/ 
pidcm vcficc.fi criam rucrir opilatio cp frigido 
bumo^cccrurcuvino vcl^rga pue madcfa^ 
era cjcaqua caltda ereaainf atainiciarur cu^ 
oleo muftdlino vcl nardino. 
^rontraomneepisffioncscapirieveriienfie & 
ecfrigiditatcoerurcum app:opriafo aliquo 
pafTioniconuenicnre. 

f ilonrra quartanajetcotridianlfactafius 
purgarioncocrurcumvino. £ 

f jConna tinniru auriu cf bumidtfate paru$ 
inftiUd.£6rratoIo^cenfiuecparfctolenri 1> 
aliquantuIuminauremtiliiUcrur. 
f JLo:po:a mo:mo?4'ncotf upt a cofcruaf ,q: 
qitantutifToluittannimccfumit £ 

f Sfera^ucjSaKOpiumbaUamief bonu 
et fubftantia ciue cft fubfilie.et virrue ciue cft $ 
quc calcfacuer tcficcarinfecudo gradu £a[ 
famumquoqjdi fubrftiorie virtutie c$arbb: 
0ranu?vao ciuedt maiorie fubriutarieoj 
olcum. 

f3dcmauc.pvafco.aimt6baUamicftque 5 
abflagit tcncb:ofifatc vifue.et aufcrt frigidi^ 
ratc mafricie.qn fit nafcalc cum co eumcera? 
olco et cjq: ellir fccundina 1 f cru m .1 qn fit inttn 
crio cumco p:obtba rigo«m.et mundificat 
vlcera (o:dida.>it quando bfbtfurptouocat 
vrinam.a dt bonum afmari. 
fSuiccn.^ali"amuapcriropilaf6e8'r coge i? 
nitvlcaibgroniemudiricatvlcaa.^riecit 
vrcoe.ae)Lnabitfracruraeofiium. 
f £onferrfciaricebtbirum.abibifBrciU8©c ^ 
cocriop:optafpafmum.confmvkcnbU8<a 
pitie:a mundif icar caput iplum. a conucnit 
cpilcnticavmtgthi. f&bftcf&itpan % 



BtMis 



«atfmt c&M.lignu i&i ipwe fcttie: pfcrflt 
tolori vrroaicp larerii z ftricrure anbclitue. 
f £t tolori piHmonie.? puenit femc ciSpcri? 
pUumonfcfrigidc 2 tufli x filr ipm olcum. 




€flpimlum.Itf. 

^> Marrtttaj.fifimbau.Sed ftfimb:iirt 
irvyocaf menta aqrica.? alio nofe vocat* 
^^balfamita.pYafco.ca,tefifimbab f m 
traflarione grcca fifimbrionMcardamino eo 
<p cardamo agrcfti folia b5 (tmilia. cu; folia 
riusrotudanafcanf ficutfolia cardami agre* 
fiie cii crcuerint fcindut fe ITcuteruca. airrue 
cftdca.tiurcrica.^auluscapi.tebalfzrmfa 
ca^ft •zfic.w.uj.gradu.&liud efttomcfiicuj 
aliud filuritre.fedtomefiicu nobieeft invfu 
quod omnibus eft nonmwirtutebabct tutf 
rcticam tiflbluendi z confumaidi. 

€>ptrarionf0. 

C6alfamita crudu z cooil knrigince vtdtib? 
rplUr.xmaculaecniedatfivnanoae impoftf 
rwm fueric? alfatie locue abluaf aque. ' 
fl£6fra viriupeaorlncupulfeeqifarina oif 
dri-r acj ajpofiro pulucrcei^-z t>enf paricnti. 
fl£6rrafrigidureuma folia ciVinrcflacaUfa 
ctafinelitirc^infacculopofitacapitifugpo? 
naf.vaUtvinutccocrioiedueprra tolo^cm 



ftomacbt tinfcflmo? cjcfifgicla cauTa; 

f iuopilationeeparie? fplcnie.a vrinalfum 

via?«bci ba ipa tecocra in x ino i caraplafma 

ra .loluit etii ftranguria tt tifiuriam. 

4fUfllct ctism contra \ liacu toloze. £tcon* 

tra t olo:cm facrunt cjt vcntofitatc. mcnftrua 

cducir.conccpram iuuat jnatriccm mudificar. 

fomenrariofifiarcrco. 

f ^cnaofirareedvinoleo muftcllino vel fal 

rcm ccmiini tccocrc crfupcrpofitc icktn optf 

ranrar» 




CflpituIumJriK 

8Sfilifon gariofilamm. 05tmum fcfcj 
fiuevnii fignificanr.05!'mum quodd^ 
tftgariofilarum.quoddam cft eomu* 
ncct quoddflmcft latum pluealqe: quodctf 
rrariumvocflrar.£5ftmim gariefilarum cfl 
illud quod r b auroubue laudarur. Ctymum 
ritrarium cft quod virupcramr ab omnibue* 
£ftcmojimusariofilaramc6pcfcne medioV 
nczbcrbctfcmenXumaufe fimplicirer po* 
nirur in mcdirina fcmcntcbctmf cUigi. et po* 
tiflimc in elecniar*>e.!S>ed in vhgerie? in cntf 
plafriie baba'inrclligif cftca.et fic. j£t fcrncn 
babct virrurcmconltringcdit coglurinandi. 
quod pfltet cr eo .quia fi ponat ur in aqua fla* 
rim ingroffarur t n't qucdam ccglnrinofifae* 
bctba ipa ccaromaricitatcbabctvirrarecon^ 



* 



Crarrattm 



£ 



fo:tancKecqlitatfl»fute fcufouicdf coTtmtfdi 
tablta-gc\ft7mildtficandi.fS>cra.U.aggre. 
ea.bamgcmifcJ^cftbafilicon fiuconmu gari 
ofilaru .et folia aue fift pua cjru colo: e mcdi9 
infcrrobo:cagteuccdine\i}ui9berbceodo: 
fiKsgariofilo^-zftipeoa^eftquadrangulat^ 
cutfcolo: eft ficut folio? ipv>i fcme cft minutii 
nigru/z eolligtfin menfe Jultj.£t eft ca. ct fic. 
in finc fcci gdua.f D^af.ca. o?unu.O?imum 
cni9^fut^fitpaiit9intermcdicoeoptoeincer 
fj. tta? c\ auro:c crifipo criminif .£?i ci9 vicia 
percenfcnt cpfit ftomacbo inuriue cr oculoe 
cbet at <r infanil facit .iecou obfift ar.Bddunt 
p:aaea fi tritum lapidc cont cgarur fco:pi5ce 
giguicdmanducatu.^infolcpofifUmvcrmce 
crearepediculoe cnutrire.Sfriaiam putant 
bocdfcfifuafum q> (i quie co t>ic quo Ojimuj 
fumpfcrit a lco:pione fcriatur non pofle falua 
ri4cd qui in tiuerfaetvera opinione funt.bec 
oia falla aflerucrlt.cinimo ftomatbopwdeft 
co cr inflaiioee ciae sifioluir.a facit alia iuua 
mcnta que hn ipin inferiue siceutur. 

©pfraricntfli 

f £ontra fwcopim t cardiacam paflione" fccf 
aqua rofaru x>ccoaiois berbe ipi9.flSd idej 
valavinusecocndieinqbcrbaip^ftatr pcr 
noac.3pa bcrba vakt p frigidttat cftomacbi 
15 md.sccoquaf inmulta qntitatein vinoXed 
indiuseinmufto.-zpoft^ecoctioneaddafvi 
nu albuinmulta qnritatejtalc vinne pfouari 
ufl multu a aromaficu,? vala cotra pdiaaxt 
cotra indigeftione ct frigiditate; 
^Uinuaiatjccoaoieipiusbcrbepfowat tt( 
geftione.5 flujtu vcttttf et frigiditate. £>cmcn 
o;imicummodicopuluere accatie ©ecoquaf 
in aqua pluuiali a t»aur patienri. 
q Bdmafrieemudinclda.^mcltrua .puoean 
dafiarfcccoctioaueinaqafiat fomentujet 
fujpoutouuctteneritatcipiue bcrbc £>uce9 
ipiue berbc pulueri$at9 matricc mitdificat «co 
ceptu adiuuat.a maiftrua.puoear ; 
ftJerba ipa sccocta in vino toleo tnaribrt 
ancbte cataplafmata vala ptra t cnafmonem 
* f . daltenue in U.t>e ctbie.captoe ojimo.Oji 
mu (c? no gariofilatupcfltmi quidem cbimi e 
aptoprabocinfamat quidajipm t>iccntee. 
lltrituitTimiwruroUevaaiecelerrimcgcnaat 
inpaucieoicbuefco^ioce^tmarimequldo 
in fole qute quoliba t>ic calefeceritoUam. fed 
boc quide cacocbimu eft.ct maltt ftomacbo z 
indigcftibile.Oluevero itaticcmueipmeca 
liduinfcaindo gracJu.£tb&abumiditatem 
noanaruralan. 



f Etideoctatio fimplidfifarmaco? «pP.ptf 5 
nulrimo/BafiUeen non gariofuaru qc fctfo eft 
graducalcfaacnriui>abaaut caUditatefufi* 
flul.vn nec vrileintra co:p9 affumpol*catfca* 
ptafmatu £o cjcr er(9 vtilc ad confumedu. 
f aimanfo: rractatu tertio capi. SHbefba? *> 
rogi qo ejqponif ojimu fiuebaftlicon non gari 
ontatucaU.eftb:a©oU)^en x icitcapitie":ma 
le nurrif .CHius comeftio vtentie vifura turbat 
qndo eo muUo vtif . S>perma quocp aut lac 
t>eficcat.ori ramcftomacbicoferr co:j:obowc 
entmrpfumatc^couiiauuliatur. ^ 

f ©aa.Ojimumgariofttatucofert ftoma? 3 
cbo.afadtt>igaaeabumgroiTum.a cofat :rf fa* ] 
epariacouii.aauferttrifticiama follictrudt> n ^i^,j 
neet odoafaae facit eructuationaut aperit £lv<v 
opilationecercba. ^ 



Capituutm,Irii| 




^y •Rancavrfinaberbae.ouuB foUafut 
jrlmagnaficutfoUacauU'e.fed icifa ficut 
"V-#bwnca vrti.inmedio eo? ouritr ftipes 
mcm'uecapirefummuuiflo»efpino(icocUi; 
fi.ca^fttbu.ihfa5o gradu.tlirtutan babct 
moUificandiamaturandtatemeudi. 



ft 4(f >Cotraartdifateittfb2o^triaufplcm8 fiat 
vngefn cr b:aca v:fina ptrita ? macerara •o in 
fbled ? rotarure add af cera s fiat vngerii p vi 

55 cwmatriclcicfrigidafetvcfofifatc.f^ccipe 
(uccibifcc vrfine.j Jiq4?erbc feuincfaluic nal 
uaru,maio:9ne,rofmarini.ana.^».i).gariofi^ 
lo?.5ii1.a'namomi.5.u.fpice,5.iti« cfmim.5.i. pi 
ri8grece.5.(.cerealbe.5.iiq.tburi6manic5ana 
5.uq.boli.5.i4nErealbc.5.iit}.vinigrea'.lb.itj.lar 
di fcrofcrofuIu.i.p:cdiaelxrbcpiftcnf cu lar* 
depdiao.t>rindeponanffup.ignea)mvinoT 
fucco ^diao t>oneccoquafvfcriadcofiipfoc5; 
vinut>eidecolef i irerurcfoluaf inignc? addi 
raccraeuqtapdnanffpccicepdicre^tjmitfa 
rurcoaplari^tvnsaturvctircr. 




Capituhraijdiuj. 



^^cfonica.j6al'.vn.fim/ar.ca.ccflru5(tuc 
JC\ ccftronXcftrii grecclattnc&iaumbc* 
^-^ tonica #rute Nbet incifitua\(icut cndit 
gtmHieamaraeetfubacriebec berba ficut in* 
dicat&ctdnica ca.eetfic.inf mo gradu.ciu9 
f olia pcipue viridia.ccpetunt vfui mcdicine.cjc 
Cccata etiam multa funt efTicacie.vnde cu inuc 
nitur in rccepriombuefolia pencnda fimt. 



f^era.li.aggre.ca,£flflarcm.auc.pY3fco; 
Jr3aft are.id dt bctomca bcrba e\q nafcirtir,oi 
anno babene vfrgam fubrikm.cuiue longitu 
do eft vniue b:acbu aur plue,et eft quadran* 
gulata.«r b5 folia mollia ct lcgafitia in fua ft> 
gura foltie arbo:ie gtandium in fciflurie futs 
bonum odo:cm babcntia.£tfolia qucfunt.p 
pinquatarefimrmaunaaUje/im fuir.mitate 
virgccft fcmcn collcctu in fe $c coUectioncm 
fpicefmmcnti.7 aflimilatur laturcgic.foliaci? 
colligunf-zccficcarif-zficfcruanf.l^amcFcic 
co plurimii adminiflraf funtfotia.-z babct ra* 
©icee fubriksfkutraditcllcbori. f Pyafco. 
capitulo vectonicon.Ski mtrafiatione noi 
firamvcctonia babaepmnibue nora^gaa 
babcnetenucectldga vniuecubiri,? qdrara 
folialonga et renuia obroruda ? tiiuifa % odo 
rara *R adtcce ct fotia funr a inftmp .Scmeri 
cuteevrTptcafimtle timb:i.5olia cius colle* 
ct a ficcantur ct vfui neccfiaria funr, *R a dices 
babcr rcnuce ficut clk bo:us 

i>pfrattonf0 

f 3d f olo:em capift8faerum cic frigieta cmt 

fa fiarg2rgarifmn8qccblarura&erocrdi8 bc 

tonicc cu ftafifagria i accro.fi Tia t vitio ftoma 

cbiticmr vinurfi fcccocriome beronicc. 

f £onrra t>olo:c ftomacbi t>ef fcecocrio rpffo 

uecum fucco abfintbtj cii cahda .fiat>fir vcbe 

mensconfiipatio.vt tn^liaca paflioncp:cce0 

dcnreaiftcrf. 5 , 

f fiar ide rcmcdiu ad mameemtTdificandani 

ad pcepru a diuuandu fiar fbmetu cc t>ecocria 

ncci9.fiat etia fuppofiroriii.Pef cm elecrua? 

riu confcctu ec pulucrc ipfiu8 ct mclle. 

f Sjcrapion auctoritatc 0alkni.;6cfonica 

innditt sbftergir bumo:ee groflbe.fragit W/ 

pidcmremim;ctm6dtftcatcffibftcrgifpuImo 

ncmct ( puocar mcnfinia.?conferrcpikntie.ct 

curar ctcatricce ncruo:ii ct laccrrorii. 

f pYafcoridee Hfidkceciue acccprcinpoJ 

ru ctim vdromclIc.haufea5 p:ouoc«r.fotia ci9 

canruradconquaffationc8ert>caltoeadatf 

tibue mctcnrur. 

f jEt oftbcarioncs ftericae foluunttwgmaB 

vna.^ajmmulfaaccepta^otfusvcnenaf 

tosciim vino bibita.falubcmmcairat 

f j&pv lentKfe cii aqua bibita matimii pfidiuj 

dt.^tpaticie ct fplcnctictcu oMmcIk t>wgmaf 

vnaacccpta % cftcctufanitatlc]ibtbcr,t>igclticc5 

cckb:ar, 

f 3n fructura capftlbcrba ptufa i fup. caput 

\ bi Eoiflto cft impofita vulnue mira cclcrita^ 

te glurinat£t id mctiuefit fi trita rcces ipona 

tur j£ftat hbi v»e xsm vt ofla fracta cictrabil 



a 



n 



Crattatua 



a 



s 




CapiruIumljEu 

<f°y £ckguarfiuefpinaalbaSwVen.lib?o 
J("\q.ca.bedeguar::8cdegu8r eft fpina al* 
:>< ba.et eftfifteeameleonte albe.vcbcme; 
riu8eftalba,etbabetloiigiott8fpina8/unilI 
turcpcius fpinc foli?8amomi.Terutamen funt 
fubriub:e8.ervebemenri9cftalba.cteiii8 c\ic 
Hipcs euentt vfcp ad suoecubitoeri cius ftoe 
cftpurpurcu8.£tfcmcnctU8cftficutfcmccar 
tami.veriiramecft vebemenrio;ie rotundira* 
rie.er wradiceipfiuscftfofrigidario etejcficca 
rio cu refolurione quadam.Scmen vere citia 
eft calidum ct fubfilc.£t sijcerut c\dam g> tota 
cftcalidavaldcjEtinipfa cftvirtus rdbluri/ 
t»actapeririua.etp:opa'einfemineau8.£tin 
ca eft retenrio flujcuc fanguinis.ct ciue rctettf 
tio eft equalis. -jbli.ca de acanrifleucci. bedcjt 
guar eteftcardus cumaculcis infolns albis 
et frigidis in pmo gradu % medius intcr butm 
ditatemetliccitatem. 

j^Pfrationta 

f Bedcguar confert flurui ventriaef fcebittf 
tariftomacbi^t abfctdit flojcu fanguie; £t ap 
ponifejctcri9ficutemplafi?x©eftrUitapoftc^ 
mata mollia.f £t qn fit coUurio oriecuaqua 
fius in qua coquif.pfat t>oloaacriu.£>cd fe 
inie ei9 fubftaria eft fubriUe^ct cSfcrr bnnbus 



fpafmuquipmbtbif.f£t?fettfpufofan0u^ 
nis.-z t olori ftomacbu fiuj:ui antiq\-z,puocat 
vrina.? 'ocler apoftcmata ftegmarica.f £t qn 
bibiffcmeci5ccfcrtpucrlbnnb3fpafmumj£t 
qnfiH'pcdiffitp.aialiavenchofaamittutto!tii? 
cu .« £ Yflf/Radijc cf$ bibita emoptoict^dcft 
fciatic^ ftomariclfertope.£fio:e8 oeeica* 
taplafmarito fpargir.f £lijtarura eiuesetiuj 
ccpeftit t»olo:es. £>cme ci9 btbitu corracrbs 
fofires falubcrrie curat: mo:fi to vcnenatl oc9 
currit.f £t c\ ea incoUo poitaueritincurlu V, 
pctu non rimet.'Radi)i©eficcatmcdiocrif.£t 
fiiprica cft:etf6 ciliacos et ftomaticoeuiuat. 
fanguinis cducrione refrmit.et tumo:es vice 
cat aplafmatis fpargit .f Semecius leptome 
ri8Ctcaltdee$nui6.£tputrefact$m&H8iitf 
uat potatu et fiuo:e fanguinio mcdctur.ct ftc 
intr anco? rcumarifmu .<jf 3tefifubmbue qe 
greci eucat ifma vocat.ftuo:ee matricl abftrin 
git.eataplafmatibusmifccfcoftrictiBemede^ 
tibus.f£aU:£cdeguarc5fCTtiliacS2lioma? 
tici8.emtfiionecl5 fanguie cobibet .tuo«8 ettf 
amcatbaplafmara corrabM 3uuat eriafce 
testsolcteefigargarijafoecocrioeSkmevc 
ro fubtiliupartiuctcalidevirtuti8o.quarc ct 
fpafmantee bibitu iuuat. <H 3ui.£xmcn ci9 
ctfertinfantib?qnbibunt|ptcrco;ruprioBcm 
uimorfibuslaccrtomm. 



£ 
S 

£> 
j 




f Captfulum.lori. 
£Uiriri.©era.U.ag.ca.bcllig5.'£dUg5 
jrs .i.bcllirici^luttf gncmirabolano? )ft? 
fri :.'i u>. i fi.iii. gra.a ejtringiir aaiirate 5 
fanguis ct calidiratc colcre.boc ide mirabola 
ni emblia.vr bf in ca.embUa 3o .mcfue.ca.tje 
minbolais/BeUiriri fiiteic mediris bndicris 
ccpcaaf cm g eos ?fo:tario :mclto:c8 fiit groi 
fipoderofi-zt»enltcom'ci6.fri.futin.uficin.q. 
3 n co^ ogarioito zff>iietm\x> filt ficut embU> 
ci.Obifcieducrmirabolaiuentblicietbellirici 
fitnt ev alio arbo:e,pducri c# alic fpgo mirabo 
bno?:fiait apparet i ca.mira.£t io h t>efmi> 
naf tf ifl^.pfn ca.^o mirabolantoetcrmiaf t>e 
aUjsfpecietomirabolano?. f Dp_ari6e8 

-g ^f BelUrici bnt,jp:iaaredcnigradi capillos -r 
,pbib&cafueo£??faStanoiroidito:rtipittt 

£ mefcut inaq.^f £t ?diti ec eie facitit ogarioes 
rnirabolano? no ?dito£:niii q:fur ©ebilioies 
ris:a in bcUiric^ Ynaio: eft^rietao i acumine 

£ cp in embUcj.fl" 3£>irabolani embUci beUirid 
et kebuli mioicu^lcojamigdula^tmlrium:? 

p dimeUetisatcapiUofcolo:enigrof 3o.mef. 
jBclliricieducBtfolutoefiegma^funteicreb 
v aldc c6fo:rarito cereb? et neruos:et auget in 

£ tdlecrii.f £t cofo:rat co::et conferut trcmori 
co:dis i mudificat ftomacbu a purrcfacrioe:? 
cofo:tar $ iri:i fedit feruo:e in eo :et aufcrut fi 

$ ri.£taddunnapperiru:?fedatvomiruif5ide$ 

£ f adur cmblici.f £>era.:&eUirid auferiit (irim 
fua frtgidirare et jjparit ftomacbu.puocat ap 
petitu.etftringntventrem ( tptereom5ftiptici. 



Bf2jfrbi0 




Capitulum IjEuii 

^> £lvd^el.£?erapi6,U.aggrc.ca,bd* 
Iv\auc.j?faacbenaram. ,6eleftrironium 
^-^indu.etcftfructusrotudusficut aucl* 
tana.no biis co:ticefuR fe inc] eft femen fimi* 
le odo:e.ct eft illud ofi x>e ipfo admiftraf ,x pff 
du8eficuttt9jin5iberl.ca.init}.g.tbu.in.i. 

0ptrationt0 

^Serapi6. v £d.©ubriliatebirno8groflba 
f £tcorcrt tniriciri neruorit.fl Etvalet vero 
fitari emo:roida?.^£t augmeru facir in fper? 
mare.etvalaficurfcl. fl Brbo: dusvocarur 
t>o:fifaba:vt apparet in ca.granati filueftris. 




£apitulum.l]EUHV 

^> £bcmi5era.tf.aggr.ca.#ebem.:8e 
Mf\ bem rpedes ciue funt oucf.rubea i al 
^- , ba*£tfunt ambevenein magnitudic 
radidspaftinace paruejquaru quedamfunt 
ro:tuofe:t>eferunf ab armenia:odo:earum eft 
bonu8:crcftinei8vifcofita8 qucdamjambe 
fpeciee funt cs.ct bu.&ui.li.rj.c.bebem;£ebe 
funtrruftaafpera que funt radices ejcliccate 
conrraam funt ouarum fpecierum:quarum 
vna eft alba et altera rubea: eft caUda et bul 
tmdatn«tj.gradu. 

BptmtiontQ 



D 



'& f Bui.UxtecimpinguariuurtccfoMatco: 
valdaa cefat trcmori co:dier: manifcfte au? 
gmetatfpama:loc6 ciue ponunf cptu ipm di 
fcctudaiftmediaas pondcrie lingue auie. 




€apitulum.ljEije; . 

W*> £nvdbalanu8.pYaf.fmtranftario* 
J<"\nenfam ca.balanu8.i£cn:eftfcmear* 
^ v -" r borisfimilisarbori miriec:nucesbaf 
bens abinrusjqe aim t>igit* pfricauat. bumo 
ree eqciur: q ^fecricito miris z nobflib? multt, 
mifccf p*o oleo/Rafcif $o in £riopbia ct in 
arabia'etinloc!indie.3pfefuccu8meliozeC| 
«ft recee et odore plcttfa alte.fl S5aa.li.ag* 
gre.ca.babe\auc.^af.£5aben. i.granu bcn: 
et di frurcjc arboris fimiTramarifco:cf cft fntf 
ftiis fiitiilie audlanie.medulla cius aprimif fi" 
<utamigdale:?cgrediroraliquidIoeo old,£t 
irafctf bccarbo: inrcrr*.bababc6? inbab? lo 
ftiactin bcfeflrsbuxt&i terrfe palduneque 
nominaf nitra.£t mdio: cc eo e nou9 plcm; al 
bu8faa'li8C]cco:iaiiai6.£tidcmauc.0alieni. 
t&ecmedicina fcefcrf ad noe ec tcrr* arabum: 
ctpigmcnrarii vtunf fucco medulleciue ioco 
olct.£recplafo cimdt calida.Oleueiuee*; 
trabirur ficur olcum s>e amigdalie. 



j&paationtf 

% ^afcEic co.;.i.bibira cu pufta fple ficcat 
cu vrie vliriea miioS-z incataplafmanbus po 
fit&tmulfa fldbibita T>olo:ee podagrieoe mi 
rigar.f Bcaoaurmiwuekpweet maculae 
crpuftulasco^ieroIlir.^Bccepn^foIurio^ 
ne vcntri facile p:eftar.,£itpffu8 fucaie a'S vri 
Jie eft vt afjwedinSer puirigineco:p,ie mirifice 
purger.f £>aa.'.6cn ccfcrtcmpaiginiet lcn 
tiginibue que funt in facie: fcabiu ct p:urituf: 
a egrirudtni cu qua cutS eleuarur m acao. 
f £tattenuat 'ouricieepariea fplentsfi efe 
fuEponaf cii aliquo far.ejcacficcaritc.fed i wc 
co ciueeft paru ftipticitatie.f 3o.mef.'£eri g 
vomif u i b vcnrreeducit rl egma crudu z grof 
fum.j6tdtmcdicina mirabilie ad colicamet 
ftegmaricazvauofam.faui.li.ii.ca.^ebcn. 
*,6en cft mundificatiuu ?#>:ie eiue medulla z 
fncifiuu bumidarii grofiaru;.£t agir cu acao 
etaqua opilatioee vifee?.£t inarbo:e ipfius 
eamarinvoo afiiptuirae^a^tal? cin ipa£ 
rus cauraijatiua n cius co:r qc dt ftipticSplus 
f£rotcaipuienoeuacuaf a )tiptiatate:et in 
ipfo raro citabftcrfto ainafio.f S>cmc cim 
confcrt ientiginibus magnie.f/z p,uie:a pano 
etmo:fee ct vdhgue vlceru:et fimifr ciue olot 
4*£t confert apoltcmatibus cwrie omnibus 
cum ponif in emplaftrieavnguenrie. 







Btfyttbis 



Capittilura.ljEjE. 

^% Xeta.3ff:8letavclbctaaliaeandfda 
JCVlia nigra alia fflueftrif.3f egrea ?uo 
^--'genera faefutmigra-rcandida^qua &> 
fcrut par ciffimi femis ajpdlat « foclom et eft 
blcta agreftf8:q cft blcta lata cj faeta <ft fiait 
cllcbotfaltwvt arparetg p?af.cap;DccUcbo 
ro albomfta vocaf bUrie.-rUcct pvaf.faaat 
fcmotimca.iocblcta z t)c bcta. erro: fcrfpto* 
ri8fuitveltranflato:i0.'Ramickmdiamtct 
tcbcnt continuari illa ca. 

f 5aUri.fim.farxa4?ietu.6lctueft olusco 
mcftibilc fri.z bu.c6plctiofs in fcd a maffone a 
tfiata abftantia.^.£tideU'.ii.t)ea'bi8 ca.tc 
beta.SuccusbetccftmcdioCTiter abfterfiu9 
quf x vcntre md egeft fone ctcirar: z ftomacbu 
aUqnmojdiattfmapeulo? qufctinq* facfle 
pafiibficm i fenfibilebntipm:^ter Diptn elt 
cdulium malu ftomacbo ampUus comejtum. 
f SUmcnru aur ab fpa modicu magis idone 
um eft $in alua ad opilatides q f m.cpar.ad? 
buc afit magisqn cu fthapi aut oino cu aceto 
comedif:? fplcnetfciseodan^modo comefra 
funrbona medicina magis cp aUmcntum. 
fl £?cra.U'.aggre.ca.t>cbUta. £jcea eft alba 
i nf gra:? infapoze e& eft nfrrofftas:? $>r9ei? 
eftqabftergifzrefoluifzerpcllitfupfiuttatcs 
caliditatis:quado oi ea ntftemutatonum. 
f Stqnblcta coquif :egredif ecca rifiofftas 
t acnicasrz fit virtfa'9 q .pbfbct generatfocm 
apoftanatT:ucroluftrcfolurioepauca.jnal 
bavcro eit^evirtutcabftcrffua-j rcfoluriua. 
3n nigra eft rcs Itiprica :i$>iie m rius radiec. 
f £r idcm auc.0aUc.in. U/oe cibisOfn ea cp 
iftirbumidiras abltafiuaablterffoe fempera 
ta n ajm tlla bumidf rarc latat ventrc:-: moUtf 
ffcat itjfctfina-: Itomacbu^macfe aimfuerit 
bonilcnfu8.«![ jbtioaccidito^blaa cft maU 
ftomacbo :tt $>iic fllf quf ei l ficut ri.tuquado 
vfus etfeit nimtt?:et nutrfmctu a'9 cft paucum 
ffait nutrimef u aliau berba?. *3>ed blcra qui 
dan eft magUuuariua 03 melocbia in aperien 
doopflatfocseparis. ^'Rigra attte Itringic 
vcntreficutlcn8:ct matime qfi coqmf radit 
cf 9cit pl9 Itiprica oftrfcrfua vcnrr?: 1 alia fpes 
cMo\nit'ycntrc.$ £tambc Ade fpesetffunt 
rnnlf cbfmf $tev nitrofitatccj elt in a'p.£t ii o 
qnfit fternurarouu cufuccoaus-zmcUcmu* 
dificatcerebw et pfcrt $olo:i auriu. f j£tqn 
c.c •occocridcblcfci radicfs a%bUuf caput au 
fcrr lcndines ct mundiftcat ipm a furfunbus. 
$ j£t qfi pjoijcif fup. fctfwrasq ffut a frfgo:c 



confert cte: ct cn coquif ciT foltjs a'9 curatbo 
tar.^f £t valet ad cobuftione ignis et berifipi 
lam.£tidcmauc.abmmefuaY:qncoquirur* 
comedifur cum fabis tiigcrit cito. 



1£> 




CapfmluraJm 

^y pelUii.tln fcfcndu cp bdeUfum quod> 
Jr^da cft fudafcfi: etcftgumicuiufdam ar 
^--^bousq vocamrmeleaU'end.et iUudeft 
bdellfu iudaicu.et arabicu q^ nafcitur i india 
t arabia .£t eftauud bdelliu f m S»era . U\ag. 
ca.*^elk.qd ti bdelUu te melka qtJ cft ejc ar 
bo:c noiara melk que oaf fn.meka:q arbo: eft: 
faris ftiprica:ajiu8rrtictu8maturaf iu meka 
ct comccif ©ulcis:fed in bvfpania non matu^ 
rat ur :fed eft fo:tio: poticus paucc aquofitat^ 
ct afper.et talis arbo:et eiue gummi vocatur 
T>emeka.£tebdelUu qdfcribifinpncipio 0c 
nefisca .q.q6 eftin paradifo voUiptar^: cuius 
frucrus far$ eft oulcf e. £c t>e ffto bdcllfo f^dt 
2fui.fur%. ptra rluruiii erbica circa fincm vbi 
ponir euras p fintbomaca fupcruenicntia abi 
ce.£t ilfud bddliu eft frfgidu ct ficcum.£tco^ 
ftringit venrrcJSfcdbdelllij iudaicum cft ca? 
Udum in fctio et bumidu in p:imo .tlij Je quia 
tn rcceprisfnucnif bdcluu conftringere etrela 
jtarc ct calcfaccre crinfrigidare ic. 0nando 



23frbi0 



a 



3 



K 



2£> 



voltim9 ap.ire mdUifiearc er rcfotucrnc.pona 
jiir bdclliii iudaicu.qn vcro volumue! pftrin* 
gcrc cr infrigidareponaf bdelliu t>e :gbeka. ? 
talcbdclluJeftceleianuj.i.coloasceleiiinured 
bdclliu iudaicu eft fubnigru fiuc fubalbidunn 
verusmtiq noftri caretee bdellio t>c mefca lo* 
co eius ponebar quanda aquofitafepgloba* 
taq^iuaiifinvefciculievlmi.f ^U'iu'9ca.T>c 
bdclUo.^dellifi eft caUduin.q.gradu.bnmidu 
tn p;into;f S unanfo: tractatu.itj.cd.tc bdel 
Uo.#dcllium iudaicu ealidu eft.bdeUium ra* 
m en t>e meka frigidu eft et ficcum. 

jDptrationta 

f Sur apion auctoritate £aliem'.£dcUium 
ftn'ij^'tvcntrcetfo:rificatftomacbum:t>iiTol^ 
mtapoftemaraqfiuiitin ranna pulmonie*et 
rumozcm i\ fit in creparura int eftinali:qn tnft 
foUuf cumfaUua bominie ieiuni t»onec fiat fitf 
aitvngucmvet smplaftrfjrfrangit lapidc re* 
mjm:qtffumifinpotu.puocatvrinactWotf 
uit apoftcmata crudagroffa vcntofitates ncr 
uonl.Cj6atic.vi.fim.fer. ca. bdeUio. 0uidaj 
autcm co vrunf cr mape arabicc in bzonrun^ 
lolie:idcft foefiitje inreftinalib? ieiuna faUua 
madcfacietireejtonecpmicniatadCofiftairi* 
am cmplaftri.f Brabtcu verorrlapidce qui 
funt inrenib?fringcrc bibitu: nec non v:inae 
^uocarc- ct tifcnrfue indigefiibiliu fpirituum 
fenarc:ncenonlarerut>clo:c6erruprurae. 
f 3 lmanfo:.;8dclUu iudaicu fcura tiffoluee 
ijpoftemafaemo:roiditovrilciudicaf.BdelU' 
umtctncKavmn;cftringif.f Suif.^dclii^ 
um refowit fanguinc pgclarii % eft liniriiium x 
mantrariuii tifrijpit venrofitatee. f £t m> 
bfalcftficcuseonifi recaie.ctrefbluir apoftc 
matatmra cf$>:ie ttffoUitum cum faliua ieiu 
rii.et fifr rcfo tuit reliqua frigida.f £x mecbii 
c\t> noncftcrfriicru palmarumfilucftrium cft 
I ttprtcum, '.fidelltij iudairii rcfoluit fcrofulae: 
ct bibif tecoctum ad apoftemara tura q funt 
mtrinfccuset linif cuacefo fug fabafari. 
f £onfert!tionniftonilacerto:um ctfpafmo z 
•onricki nertio? ct pgtlationiipfoju^.f £t te 
jnckactia eriliimaucrurqripm pzouocenfed 
not>ubifat c\n ipm ftringiretfrangit lapidej 
f £deUiu to arabicu clarujrnbeu qii rcrif cc 
co qntitas tsuo:uaurco:u:ctbibinjreii aqua 
mcUisminuifficsma.fHtbdclliuvtriimcprc 
fcluit ramicc5 aque et apcrit os matriae clau 
Ufm.£fcduutfaumetmiindificatnjatriccm 
fjEtrcfoUjitapoftcmataamctfefticuloiiim. 
fyt conferrmo:futvciiciiofo:iim 

CapituIum.l0n 




8crbm'e.3ui.U'.q .ca.T>ebcrbcrie.£r ec» 
cft rotundu et rubeu capcftrctet aliud e 
nigrulongumarenofum aut monta* 
rium.cteftfo^tuisfTi^ficanfi^tcrfrigradue 
-r cft vihcee colcra valde.0af.virj.fim. far. ca* 
opacanrij.i'?ccarbo:eftftti'Bvirtufcctfpccic 
arbori arebandi.i.piro?f&?cftriu:nifiquia ar 
bo:piro?eftftipricaftipriritatcfo:ri:fcdinfra 
ctuciue aim fliptiatatc eft ree incidcne fubri 
UfmfSerapionauc.^vaf.lib:o.aggre.ca. 
3mibeibm'e.£teftrubueacbifta:et$ictum 
acunim.et acfa:ct cft ©icnim fpina acnnta eftr 
iUa quefacitfrucru c\ j>:3abucbfiue jatracb. 
cf eft amiberberie ct ©cfetf a co:afcem'.cteft 
9rbo:fttiearbo:ipiroriifilueftiiu quc ©icinir 
abbimiefiueabaraenifiq:cft mino::ct ba^ 
bamultaefpinae.£tbabctfmctufitcm gra^ 
nomirn:nifi q: cft maio: et rubcue facuefran* 
fiibiiis}efb3mtmu6grana.ctb5radicebabe 
tem multae radiculas infipcae tmc. 

&ptmtimt$ 

f ©cra.iructue aue qii bibif aut cna comc 
dtf.abfanditfiuri! antiquumer bumiditarce 
sntiquaeqtiefiuutamatiice.f£tqnfitem^ 
plaltru cii co rrifo attriibit fagutae quc funt 
wfijtecajiujetafcellaeafpuwectaUafjiriilia 



Btfbttbi* 



$£t qil gcurif veYer mttlteris pjjnanrfs cu ra 
dicebm'u8terrc.autfitimmctio oiea ejcpcllit 
fetu.j£t cft fri/z fic in.ij .gra ..pbibet 2 incidit li 
| rim calida.tfoirificatftomaebu-zcpar. 
ffit^paetas eius cftcp confert apoftema* 
ribus calidi8.£tbec aui&bcn ^cmar. 
fl£t ideauc.2lrmafi06. jrucms e& rctinctz 
.pbibet oes egrirudines q fulr a flu]cu vctris. 
f Bmc.irucrusbcrbcrispfcrt apoftcmitri? 
bus calidis eje as emplaftru fup.pofitu.? coW/ 
fbttat.ltomacbu % epar. 1 abfcindit fitim val* 
dcct cofett rafure % flujcui fanguie inferiue. 




Capimlum.IjE£U). 

JH% a^eidenfimtradicesalbcfSeraptV 
lCvpnli.aggre.caplb bu5ciden.elt ftmtle 
^-^bcbemalbo. zeftmedicina indic qua 
no8pa?vrimur.£tquida vero oetnlcrt ipaj. 
ad nos.i vidimus cam fepc £t meU9 ec eo eft 
quod eft albu.baben8 Itgnu grofliim 1 mltaa 
virgas.^llud vero quod cft mbtilc lignu W/ 
bcns fuperficiem lene paruc albedinis cft non 
bonumernuUiusiiuwmeti. 

©perartoim 

<!T c 5erap.anc.babi]c.t:abi,c pirit q> aSiima* 
mentum eft (iait iuuamenrutri berdomaa ilo 



rum rcmouendum $olo:em tuncturatu .ct po 
ditgrclajcat aquam citringm. 




€apitulum.IjE]E«t). 

Y^^fumeiudaicultucafpaltit.ct&bttu? 
■Cvnen iudaicu eo cp in iudea inuenif .f.m 
^-^tmgno qd mare momw fcicif . in q M 
gredif flumeiozdancenpfum eft fpee naptc 
fcd no napta.qm napta cft pcrroloivcl ftcrc9 
pemonu qo* ide-eft tcft ficut oleu liquidum vt 
babcf inferrvintracta.ioe lapidito pcious ca. 
perroleii.£>ed bitumen iudaicii vel afpaltu . 
velbjafalcndiqidcmfunt. eft©u?vtcucB qt5 
pot pulucrifari.fed no refoluif.t b5 vt cucb fe* 
ro:c naptcvt pt5p. «oera .tp. <?coidii $>\tf. 
ca.afpalni.afpaurieftbimme iudaial. etei9 
alittd cft aridii aliud liquidii.vn birume iudai 
cu qd fit in lacujudee c\ 6: alffriden.coagula* 
tio ci9 g ripa iplms lacus inuenif .% naute na^ 
aimfcafa.:? ficdeowgut? fiecct ctvendtmt. 
HUud gcn9cj t qtf ncc&ferro nec& aqua rrimpi 
potcit.ntfitm menltruo muliep.aut fanguie 
birco^fir fi volueris ritperc fic ntmpc cow> 
ge vinit t>c lana 1 inringe ipfum in fanguinc '% 
ficinctde.Eftautebitumcnfummupurpureu 
odozts sram'o:i8.reparabilc aut nig? elr. "Re 
pcrif aut babilonicu bitumealbu feu nigrum. 
longo interuallo rapics ad fe ignc O rii c vero 
bitumeb5 virtutc malaaica % iivftfi»crici. ei 



tCvamtm 



a 



bswcsTfltidtaoatfricadto-rctopirato. 

0prrationr0 

f DYafeo:tdee;6irorricntume:c8 reprimir. 
OrTocariomtoftcrici60ccurrir£adcnrce ma 
mceefublenarnsmigando.f £pilcnticoem 
mue ciu8 ptouocat cu eaftotco. menftruie im 
pcrar.mfltmrcdar.farmfltico8ctdirnoico8 
adranitatc^aducit.f*^:fttevotcnari8oc 
cumt:rciarici8p«ftolflf.rciliaci8taturinmo 
dti carapuae er majtime pJdrat dfccrthco agu 
lamranguinccuacao rcroluK.tuflinrcrict. cu 
fttcco prirancfupporit um curar.f £ararrum 
fuflumigarione cdpdcir.Bcntiuj t>olo:em ap* 
pofitti mtrigar, podagricoccr artetieoeeum 
nirro ct ccra v rmalagma imporitum curat. 




Capitulum.IpjEti 

J~y *Rtonia.£Yafc.capit.ampdeoelcukL 
J<^iddlbriotHa/iucYflartmvtr;alba:ba 
^^ftafi^folia/tmfliababctwri noftrcf? 
afprra et mirio:a caprioUfimilee fanr impiica 
tce fc.femcn ipfi vue limileeft i borruofum ra 
nimctfuluum.f £aUenuefcjaofimplicium 
rarmacoaun.capimlo ampeleos Icufcijdcft 
■ritioalba.quamquidamib:ioniamcrpfilo^ 
munvocaro.uifummtt3fe auecft itipricitas 



ct amatirudo pauca ct aotirae. rt tpfccomc^ 
dumur in pancipio fuc riatiuitatie f m confuc 
rudmcin ct in ronpo:e verie:quia funr iuuan* 
tce ftomacbump:optcr co:um ftipriararcm. 
fttbamaram aurcmerlcuircracrcjbabct ftip 
ricitatcm. f S*rapionUb:o aggregafo:i 8 
eaptrulo vcfcra.icfcra rxrba tft q babcr fo> 
lia ctcatrtioloeinfimiUrudinem viriecommu 
nie.mfiquiafunrarpm'ow.rtramirtcap:to* 
li adbcrcnr.implicanrc8 fe quibufciicg appjojc 
imanr cjc arborib? alue ct farpendunt: ciecum 
captiolie fuie.ct babanwwmfimflcm racc* 
morubco. 



iDprrauortes 

f fialienue.&rioniavrinam mcdiomrct^ 
uocar.*Radijtvcro abftafiuamquandam a 
ficcariuam rubtilium partium babct virtutcm 
nccnon mcdtocrircr calidam p:optcr qua fplc 
nce atrcnuar.f £>diraroeranar.a;rmue ap 
poliracumficubue:fcabicmcr lepiam fanar. 
botruofus aurcm frucrue in poUpirtjecft vri? 
lie.f ©crapionaucro:irare *Rafie. Oirru6 
ciueeftque calcfacit mcdiocrircrct abftcrgit 
ct fnbtili j t ct t>iflbtoft twicicm rplenie quan 
do ruperponintr cmplaftrum cjc ca cutn ficttto 
£t atrat rcabiem et cgritudincm mm qua dc 
uaruratrie.Sjcd fnicructusvmnmr coria* 
minarii/Ftam aim cie abwdtumir pilt coao? 
nim.fjEtidcmSaapion.airruefoltoatm. 
a fruotueerradiciedtcaUda cr acura.£rid" 
quandofircmplaftrutnaimaeer fale cdfert 
vlccribue quct>icuwgranira.ailUeqiu:t>i? 
cunturfagcdduea.curarfuTuraelabioMj 
f *Radit ciue mijcra cum o:obo cr finugrcco 
quando cum iie abluirur curiemundifieat z 
«bftcrgir eam.£t a ufm pannuj ct vefiigia ni 
gra a borbo: ct cicarrices vlccrum. £ t confi;; 
cirurcuolcot>onccfiarlicurccra:crfcdatt>o> 
lo:cmcrfiftulamani.£tquando mifcctur cu 
olco tonccturToUtarunconucnir ad boc? c% 
pdlir liuo:em qui fit fub oeulo J£t quando fit 
ct co cmpiaftrum cum vino fcdar panaricium 
ct rrfoluir apoftcmara ct apcrir ea.£r cmpla '/ 
ftrum facrum cnm ca cjctrabit ofla: tngrcditur 
inconfeaionibiievngucnromm cotrodcurtf 
umcarncm.£r porarur©eea.j.i.ad epilctittf 
am: ct conuenir appoplctic fic admuwltrata z 
optlarioni.£tquandobibuturc]cca.5.ti^on^ 
fmmo:fibuetvrietoccidit fctum. £tqu!do 
ctrrabttur faccue a ftipitibue ciue ct acapuur 
cumrrumento cocrojpwwxar lac 



BtfbttbB 



£ 




ctibifontm fptWae.TCafaYurinlode 
algofie q" caraplafmaribue adbtb it a :ommb> 
nilncribueimpofiraetquoridie mucaramtf 
dcrur. 



Capiruutm.l#u^ 

^"* T*icfanica.pvafcoridc*ca.'£:iaani* 
jr^cabctbacftbabcnofoliaftmilifl lappa 
^Aioagrcflufcd paulo nigriota lanofa 
guftuftiprica.t?arramvcro babctlongamx 
radiccmpjruamcrrcnucm:foltactu8 etficei* 
runfucato ciue collecrue in folc ponirur cr ftc 
caruncreftillivirtue fiiprica. 

&prrartonf0 

f 0Yafco:idee.£>uccueauefia:arue infoi? 

le p:oddt vulneribwelcancrieoriect fauciu 

atm vino er bie qui prifim itKurrur.quida$ c t 

cunr qp eft lappacium acurum. 

C pYafco:ideecapirulob:io.idcft bricrantt. 

ca bcrba eft suowm cubironimlonga: £gae 

mttttaectrcnucebabenein quibuefolia m'/ 

fcunrur leptde fimilia molha er albarer tn funi 

mo virgarum p:ofcrr femcn fio:em album ba 

beno. 

f pvafco-airrusciuaeft quecumfucco pttf 

fanceocra;?acapadocuecomcdirurp:oprcr 

frigidirarcm ftomacbi:er fcmcn ctue p:o pipe^ 

re vwnrur mifccnree in cocrurie.Blq mtmo '* 

rant banccmpcrigince mcdcri: 

f pYafeo:ide8capuuIob:icro:i8.ideft W 

cranica bcrba dtawe radfc afpcra ct ftricra 

st fibi cobercne guftuisulcie; facir baftae t u 




CapiruIum.ItfuiJ 



60rrie.t>vafco:idc8 captrulo &orrfe 
cftberbafrucricofa rora fpanfa fuper 
rcrram.colotem mclliratm babcne g 
inrcrualla furcar a.virgc eiue in omib? ramie 
femine pIenc:foIia babj fimilia in cibo agrcfiC 
cummaumo odo:ca bono:noninucnirur itt 
parribue rioftrie.mulrip:o fuauirare odoil ntf 
bue alijeeam adiuhgunc.nafdrurin loct.au> 
ris er pafcuofie.capadoci vero cam ambzoftf 
anam picunr:ak} artbcmifiam. 



0pfrartonf0 



f vafXum vino btbita artbonoicte;pdefh 
fuccue ciuebibirueih balnco vertticie colo? 
rcmrcddir.S5ednorandum ep plurce bcrbc 
noninucniuntnr m parttbue nofirie; £r idco 
nofiro vdcomarc nonpoilutunominari. 

c irij 



S 



Kmmw 



a 



» 




£apituIum.IjE]Euif> 

^3 £:ago.yfi.li.abimo.;6o:agocal.cft 
Jrv ccbu.inp:imo gradu. *|Marea.2$o:a 
a-J go folia bsbet afperaet vfridia funt.f> 
cipuccompetuntvfirimcdidnc^cficcafonon 
fecundario faninata;£ofta.£o:ago cft cali^ 
dact bumidain pumo gradu. 3rembo:ago 
bab a eft faris nota calida et bumida c in me* 
dio p:imi gradue.2?abet enim virtutcm gcn« 
tandibonosbumoKs 

f&pfrationfo 

f 3faac.£o:3gb in vino porui x>m lcritil 
gencrar.a co: confq:tat.p:oinde antiqui mif 
c eb ant cam nkdit inis cardiacc vafettbue paf 
fioni.^0uccriieum aquacocta,etcumelle 
aurjucearo potuixjafacannalcspulmomst 
Siitturieoptimemundanf^llSlafcariHsXo 
ualcfccntibus ejccgritudinc valet fvncopifan 
tibuscardiads eommefta cum camtbusvel 
tondira cum fahguincJScmeciUs per fcuos 
amios in multa cmcafia fcraatur. 
f ftadi]cnoncompctirvfuimedicine.:£>aba 
aiamcrudaromclfa.bonum fanguinem ge* 
ncrarXonrra ycrcricia j cocta cum camito co 



iricdmtr.f jConftarttinueViSoiago colcrsm t 
rubcam purgar.cardiaci8 fubUcnir. cjc colcra 
nigrapaticnribue.f 3nvinomiiTaetpotui $ 
©ara laiciamgcncrat^ £iufcjj> apojima euj 
meUectjuccarobibirum.ct contra gutturis 
afpcrirarcm ct pulmonts ac pcct d:is valcr. 
f Oalct fm pvafco .conualefcenrib us ? fvn ti 
copifanribU8.cardiacie.mclacolici8.comclia 
cum carnft)U8 .f£onrra fYneopim fiat fvtu* 3 
pus cp fucco ciuo ct juccaro fiat fiir.ittter coitf 
traeardiacampalfioncm.addito pijluerc ofr 
fis ©e couk cerui.f Ualctfimiiitcrcontra me "K 
lancoliam. 




Capiturom.Ir*ijE 

^ry ombajcvclcotum.©erapionlib:oag 
IC\ grccapirulo gown.i.botfbajr. pijce? 
^S rant quidam mediei ©e kelbc.o/ cotuj 
nafcitur irtrer eos in arbbnbus.que funt ficut 
arbo:c8anripcrfico:um.a t>urant annisvtf 
ginmaeftcjceo cp omri anno feminarur.£t 
idemaucto:ifate aben mcfuav.melius cft ejc 
co nouum.EtquodcftpUntatumannofuo: 

0pfrationf0 



©fSjrrbis 



f ^erapton.Succu8 folfo^cfue conucnfe 

flutui venrris qui aceiditinfannbuo 

f £tfemenciu8comtenitniiri.£t eft bonum 

pccro:i:eteftcalidaa bttmida 

f « olcttm eiue confert lenriginibus facici ct 

puftults calidie que fiunt tn facie:et facit aug* 

mcnrumfpennafe. 

f Dvafcoridee ca .cozomid eft bombajc. me* 

dnlla faninisaus calefactona elt mollificat 

pcctus.f £tp:odeltad tuffim. 

f Sutccue vcro folioutm eius potati!6 mV/ 

jnimventrt8infanriumfiftif.j£telk«lida?bu 

midacomplejtforo>« 




4§£ 

^^j 

^S^ 




CapituIum.ljEjE)E 

^y dglofla .3fido.luctvim.£ugIofTbs 
JC^ agreci8dtt>icta:eo tfafporima fo^ 
^J liainmodumlinguebouie babeanr. 
0ue miru modit ob fapientiam numcdam a 
vaeribusinftmdenda vino memo:af.-jMi.ltf 
bw>.!txv:6ugloiro8 fblia babet bouis lingue 
fiimilia fuper rerra fparfa z afpcra z magna ct 
mino:a.Buicenna.Xingua bouiseft berba 
lata babens folia.£t canna eius cft plana:cu 
iuerami func vcpedcs locuftarum:acolo;eft 



eyviridiactmno.&dmfnffirada aufan cfl in 
medicina illa quegrcflababa folta fuper c\, 
rum facicfuntpuncfa:qucfuntradice8 fpino 
rum aut pilo:u ejceuntittm ab ea. Tfbrojcima eft: 
cqualitateincalo:e.ad csilidirateini paruam 
t>cclinar.£r cft in fine p:tmi grad ue in bumidi 
tate.Qucautffccacftaninorie cft bumidira* 
ti83erapionli.aggre.capr.Xcdcnalcbaur 
aucto:itafcpYafco:idi8Xedcnalcbaur.ideft 
linguabouis fiuebuglolTa:acft planta que 
aflimilatur bcrbc que t icif caromae;et babet 
folia verfus tcrra afpera et nigra: a aflimilar: 
in figura fua lingue bouie. 

€>pfrattonf0 

f •fcunius lib:o vt fupza.^uglofla virto mV/ 

[«aanimivoluptafesaugenetvocafeuptoa* 

iTnumfluitioes^quaegreci rbaumatifmoe x>i 

cuntfedat.etfciatici8cum aquabibita fingu 

lare p:efidiumtrtbuit. 

f Buiccnna.BuglofTa ftcca ct adufta alco* 

laqucfimtininfamibU8remouet:etinflafio^ 

nan orisfcdat 

f £taiam lcnificatmd pectotisiet confo:rari 

mcozdie. 

f 'Bona mclancolieeic folicifudineac trernori 

co:dt8 in vino -z tnfpofttiomb? metancoucisV 

f Ouidamtnpotu tribuunt eam adrrerno* , 

ranco;disealidann 

£onfert af am tuffi % afpcritati canne p:opric 

que cocta cum juccaro et Ydromclle. 

f £>erapion aucto:itatealcau3i..6uglofla 

cft frigida ;a qfi flos cius ccburitur conuenic 

fluMbilitati t>cnrium:a singimrui et ad alcof 

lam^:iequeacaditino:epuaoriim;aomni* 

businfirmitaribus quefiuntin o:e. 

f £6uenir cardtace qtte fiit a colaa. £t quaf 

do aliquievult cam fumcre: fumatcum bote 

armeno. 

fj5alicrju8octauofimpliciufarmacorucapi 

tulo t>e buglofla fm tfanflarioneara. 

Uirtue ati8 cft calida paru a bumida.£t coi> 

uenittulTientibuseicafpattafe canne pulmo:' 

ni6.£tcoctacum mclliaato autp:oiecta in 

vinoinducitlaiciam. 

f £t idan codcm lib:o a ca.ftn tranftarione 

ara.UMiglofla foumida et calidsi eftcomplejttf 

onis.ande i vno potaf a;Iaitia caufatiua cxe'/ 

diturcfle, 

f £onuemt out aas qui p:opta afpcritatej 

gutturis tufitunt m mellicraro cocta. 

f &ui.t>e virib? co:di8t>icit q confo:rat co: 

Capftulum,lirm 







Crattamg 



iujcta muroeciuitflrieKt ilfovocaf oculusbo 
uisvetcoruta no fcrida.ett>eiltababa eTtt> 
veritao clare foatcnrib?:qua latine inuenies in 
ca-uifcriueaeoculobowio* iftwe egaucie» 




^~w atalmo8bcrbaeftaiiu8flo8& oat? 
jCynsbouisvelracce.jEtbabctflozesnt 
•vJ^firosf manriquam tranftarionem 

©fftttprionro. 

f £>Yaf.ca j8utalmo8.cj tranflario comtpta 
eJt:qmfera^c^bi8C>Y a ^ mau3tr5ftafl oe5 
p Yaf.ctcit cp babet flo:es ritrinos fites fioU / / 
bus camomillaa 5 vcru eft.f &ur almos ba 
Ifcam eucit molle .folia maratri fifia flo*e melU 
nubne.oculobouisfilcrn.vn-znomeaccepit 
'flafof in ciuirarib? tc.f S>ed f" m rrafiaricej 
noilra p yaf.^utalmoe baba suaejpecice, 
%jm c q bab3 folia ftlia mararro.? flove Jimi 
lcef lorito camomille,j£t ifla vocaf cotula fe* 
rida:ttlarineS:pucida.j£tpY fl fc*oeatcam 
parrcmoi J.3 lia cli que b? folia fitia coaadro 
tt flo:es cirrinocnafccns iujtta muroe ciuira* 
rie.ct voeaf eotula no fcrida^t latine ticif ocu 
Iusbotit8.et0reccfimitrira fonar Sutalmos 
£5cdara,voc*fbibar.i.oculu8vaccc.a idco 
eicit ad Ifam.f *,6ultaImo8 c(t baba mollie 
anrimo fulfe.lajee cinittce rirfoe.t folia tcnui 
taftiflaet molliariifia maraircflozescitrtf 
no 8 fites flonto camomillcttifta p* m voirare 
cft cortila faida q alio noic voeaf pucida , 
f £ t fiibo tt:cft aiia butalmos caul mollie;fo. 
co:i5dro fitta:flo:c8 cininos babcne: nafcce 



Capttulurn.IftjEfr 

^3 XJaimeftnomcn grccum.a lariroe cje 
Jc^ partccomiptum, 

i>paationf0 

f iMicoeem^pudgTecoearbozfjjvircne cff 
appellata :et lcuitate marerie elcmenro? apict 
bus apra.On fcriptura JS>cribeincitbu)to ar 
b out.&ujcue cjtpmendis elemcto? apictte vr i 
lis leuitnaraia info:mat vfummanuepuertT. 
£5imul ein smoucr te ipfa mareriaque fg vi? 
ramecvncp fuiecjtuif folije nevncp fpa rue 
?iflimilarioncvcndcri8:fedfcmpcrribiperfi^ 
dem gamincr fpce falutie. 
$ 1>liniu8 li.jLvi.^otes amantilcjcabunje 
itacpbujaispirencisaccitaue mottto pUin> 
ma . baecintbio tractu crafiiffima in eo:fica 
flo:cnofcrcdo.0ueca smartrudinis mdlie. 
S>tmai tlltus ctlcris inuifum aniannfc>.2?ec 
in olimpomaccdcnicgrauUo: cftfcd buuie. 
23 mat irigida aprica.jfn igne qucqj quc fa* 



BiMttbii 



ro fcuricia :ne<$ carbone vrilfe nc$ Aarna, 
C6 up foita eecaua funtet non ?>ecidut.bec 
aibozinplurcsramosTnfpcrfa ficut 2 locboa 
tr anfmartna.S»pilTi(rimavero ec omni ma* 
reria: et ideo grauiifima iudicatur. 
f "Sunieficutctkbenusnamra gracflis et 
neutrafluiratinaquis 
f t^ujcue et comus et olea medulla ct apidib 
atcp co:nrie.cara:iwniinuq? -: fanguis babct 
f£aricm veruftatemcftbujaienou fcntit:? ri 
mam fuTuricp fponte oon captt. 
f£ifiaitinctp:eflbtcrcdincenafa'pwbibct 
tamaritudojficcttmricia inbujio. "Srida cm 
latuie cgvtrida fcrrisccdutpzcter robur:-zbn 
icumq perrinaciue refifitont: ferratucp -oenfes 
inertiequautatcrcplcnf:fc5quldo laminefe* 
ctileeet cie fuinr, 

f jldc ujli.jcvq,-fbrouciiiut bttri tenufllimis 
quinie fenifqj virguli eoUiffaris ©epacri ; 
«tf Bcto*.£u;eu8cftarbozoitonofa.23i{M3 
ramie vrimur in vie palmarii vicc palmarum 
qualcs oliuarii funt qtie in regioc nf a no abu^ 
dant . t)i\& eria lisntjpter fui foltditate kntf 
taremcp act>cco:e ad fab:icandas tabctj.fs z 
cocliaria atq*. manubzia etalios pl taos vfus 
aptimmu imienifc$£ji autem arbo: b-in \ii'z 
renuis.neq?enim mulriigrofecflir. pe buius 
atitem narora nibil penims in libiio metiico'* 
reperiffemememinw 




CflptobinMM 



eTWaisomnibusnoros^aulus au 
*oe b:ufco;folia eiuo funt folia mirri cu 
cttrcmitaribuefpinofts.fadcns plu? 
resftipites cum fructu rubco ficut fructus cef 
rafi^etcfttemperaricoloue-vtYpocrasetjSa 
licnusrcftantur. 



tbpmtionts 



C 'fwaSSocaiB fouo:u cutseicpzdriisino^ 

rcnme o:is viria emendst. 

f-jbrodeft ftomacbo ct ooloa vcnrrie a coltf 

ra £ cmperafus cu? lactc x inunctue viria ocu 

iozunumendat. 

f -jbotatuscum juccaro emoptoicoefanat 

jEtpetramfrangit •* 

4 ^ucctieauecoctuset bibitus coleranu 

menftrua ejcpellif /fbuluis radicis eius vutoc-* 

rabcncfanat. 



j»aiv--vjNM| /§ 


gff^^\ i 


^^^^= 


mj 


itiiiEi 



€mmm 



& 



& 



3 



CapimluraJfiEjEttt! 

^y ariramabuando:idcfrp:ofiindendo 
Jc^eft tiemm:vtt»'at3fido:ue.S5ua cm 
^-'vnauofitateet bumidirarebaba \m'/ 
buercr.pmndcrccoiBa q coringir.flam buti 
tiieftfloe lacriemulrii babcns calidirarisct 
Ixtmiditariseum tominio aerirarie: rattonc 
onu&babctmulrii vnauofitaris £ft cnim bu 
rirofa fubnaruralirer calida et bumida vifco? 
fact vnctuofa:bumane completfoniviana; 
vtt>icit3faac. 

€>prrartonr0 

CSurirufcpeeomeftuftomacbiifruseftbu* 
meerariuu:vcnrriefoluriuum majrime ftrcees 
fuerir.£r ideo antiqui vr ©icir jffaac alTimila^ 
ucrurburirumotcomiictupmguemdini dicen 
tce:cp (i qnis acceperit vala fcrearuit>c pecro 
rest>epumionemaumeftibifamtapoftcma 
quia p:op:ie eft maniratiuum cr bumom t>ift 
foUmuutmafupafluoai peaoue mundifiea 
tiuum:majcimeficumellevel5uccarocomcda 
nir.^Snibdeneibide, Butiru rcpuguat xt f / 
neni8:mcmb:a bumcctar:afperirare oculomj 
ciuelorura molltficarct emundanapoftcma 
t>ifibluitcrmaturat 

f aulnerapulmomsfiutrurletpecto^mire 
fanar:raiumerinrcftino:um motfurae miri* 
garmauoe indignaroe acorracroe feu fpafo 
maros mollificar arc^ lajcar. 
f auiccnnaXontravcnenabutirumtntcri9 
fumpta fingtilare p:cftdui cft.^iintoncatU8 
butirummlaaeeaudorefoUirii bibttin ma? 
gna quantitare.^Ram vncruofirare fua opilat 
meant8neadco:afccndat fubirovie vcneni. 
p:ercreavenenofirarcmroram ad ferrabir a 
ipfaminuifcatper vomitum euacuatfce eo:* 
ge cr cducit:vt ticit idcm. 
<|t£>alitur aurc aUquantuUi butirii vr mcUus 
conferueruna vt cius porcnrialie bumiditas 
ficcirarefaliercmpactur.jinfupavr riue fa* 
po:ofira8 augmcnrerur. 
^I 'Ratn guftui infapo:e cft magie grarii: qii 
mcdioaircr cft falitum. quando nimis antiq* 
tur:ciii6 fapo: ciitn odo:c t>iminuirur:ain p 
ucm odo:em cr fapoum guliui bo:ribile rrafJ 
mutanincr riic non valcr ad cibaria condieda 
^[ tialaramcnadvaria medicamina avn* 
guenra:quia fcpe aaidit id quod non conue; 
nir gulc :congruit ramenntbilominue medtct> 
neattciii 



CapttuIum.IflEjEU 




/rySmomflla. Snfcmna. JCamomflla l 
f - fcnoraiocdaliacftcuiueRoeeftcirrtf 
VLAnus.£raHacuiii8flo6cft purpureue, 
Bltacuiu8cftalbue.inp:imo gradu cft cali. 
afieca.jEtfm23alienum#foqvfrturirofefo 
fubtiliatione fua :fcd cl t in modtl olri cctrciuc? 
racaltd3.£ftaurapeririua:fubtiUatiua:mol 
Itficfltiua^refoluriua.pYafc.^amomiUaivcl 
antumios baba c:qul altj crranreTridevo* 
canrao <? vcmo rge flo:efcar a ad vfum colU' 
gaf.3 lt) vero camc!ionc:co q b;; t car cdo:es 
malimaciani fimile,l;uisbabctria funrge? 
naafciftaaiaeinflo:eb2bcria,baftefuntve| 
tuarupalmarujfruticofeqrrmuIoemuUos 
cuvimimbomultiac tcmute gcncrattcncraqj 
parua et angufta foUa.Sjupct iue f o capitcl 
lum babctcuqdarotundirarc.babenetteutf 
rueflotfaureu quiregifcjtreriSalfco? aurmd 
linivcl purpurcicolo:ie obiectionc foUoaim 
magnitudine rimi fimiliii.TI afcif in lotf afpe* 
rie vel circa fcmirae vcl viaeXolUgif aur rgc 
verno majrie vittueclt riradici? f o:i omrucp 
frurici vcrnarica er.lcpromcrica Saa.U.agg, 
ca.btbomigJi.c£mcmtUa.£ui6liJttrcefpee; 
ctt>ifccrnuntfmcoIo:cefio:iifolu.a ipla <ft 



BfUrtbi'0 



bcrba babee virgaeloftflaecircitcr palmum 
vnu rruricofoe bnree ramuloe er folia parua 
itiinura gracilia cr capirclla roruda parua ali* 
qutbue quozu rlozee albtettn aliqbue aurci 
colozie.cr floeq 1 appafetfub capircllo cflro^ 
rondue bne circuqua q? fi ofculee fitee flotita 
rnre.ercolo:ipo:u cfi cirrinueaut purpurcue 
a nafdrur in locie afpcrie:cr fupcr rftarc colli 
girur in;Vere, £r opowet <y rcponaniw folia 
ct flo:ee poftc£ rerirur quofclibct ©e pcr fe ? & 
anrindcrrocifci.f^aiicnuorctrofimpliciu^ 
farmacorum captfulo autumuead cft camo* 
miUa.tsicrum qmdemcft in tcrtto rracratu tse 
bac berba lartue.&icaruraurcm ct nunc funtf 
maric o/ calcfacit ct t cficcar fccundum p«imu 
gradu.£ft aurem ct fubrtuumparriujr: p:op 
rcrca>Yafo:cticanccnonctrarcfacriua ct lajc 
abtlievirnme. ' 



3 f 3mecnna.£amomiUa fcdat apoftemafa 
calidamollificando ctrcfoIucdo'ipa:et lcnifi 
£ catt>uraquendfunrftrictavalde.f £rbibfr 
rur,aj>rer apoftcmatavifeerum fpiffa. inolUTi> 
car rcranumr: pfotrar meb:a neruofa omnia; 
£i cft er, mediciriie plue pferenribue Ujcitudi 
rit cprdiquajquonilcalidiraeeiue cft fimilie 

£ cattditari animalie.f £ft eonfottatiua ecrtf 
bri coferenefode frigidc cr a d euacuandl ma 
teriae capirte:quonil rcfoluir abfcp arrracrio 

p nc.j£rbccdlciue^):icr3e.fj£rc6ferrpuftu-; 
Ueorie;fanat algarab fciftempcraraet mo:e 
cjnplaftri fupcrpofira.allettiatfpumm .aufeft 
ycrmciam.pzouocarvrinam,e<^edifacitla:5 
pfdcm:er,nsicquee|ceacft purpufei coUwe; 
tcumcamomilla qutdcm euapo:afur vefica 

£ Jprer tfolo:ee frigidoe. f £t ptouocat men? 
ttrua bibita ct fedendb in aqua ipfiue £t cdtt 

f citcmbrioncmcrXccundinl.f^rconfcrt^lia 
ceerftr inunerio cjtokocfaeinfcbzfbue pcrio 
dicie.crbibimrp:oprer fcb:ee anriquae inh> 
occaru:ctcoufcrtomnifcb:i abftfcfom aeutf 
tate:cfi non eft apoftcma catidum invifccrito 

f> f£tquandocpconfertapoftcmatt:cumnon 
cft calidurz eft eiue maturatio .loco ipliue po 

. nimr inconfo:tarioneccrcb:i etiuuamcto qzJ 

*> confcrrinfodabcrcngefif.f ©erapioft auc* 
jorirarc£Jalieni.Uirmacamomillccftquerc 
foluitctflujcamcmbwfOnfo:tat.ctlaffitudt> 
niconfertplueomniaUa medicinafedar W* 
~ to«e:etmoIlificatmeb:ax>urarzlenitfpiffiru^ 
J dincmcuriepaucam.f£rcjcpcltofcb:eeque 
fiunt ab bumotfbue colericie.j£r / fprer fpiflim 



ctfocmcutfe quade trt vtTecrfb no cft apofic* 
ma caltdu ;et iam facra cft fcigcli io.Sxd ct fe* 
b:ce qucuur aflcgmate^ melamolia: sur p: 
prcr apoftcmara q in vifccribuefiirttquiindo 
ctbibctur:iUuat iuuamcnt o marafcflo mulril 
f £r idco ccrigit qp ipfa eft vna £e foztiottto 
medfcinte in fcdando ©olo:eecr tsc mdiozita 
mollifica tiuie cjc mcdicinie conucnictibue me 
b:ie inrcrio:tbue quc funr poft mif acb. 
f £tipfaetolctimtiueconfcrunt fodc frfgi^ 
dc.t^am curat bumiditatce quc funt m capi^ 
pitc pcr rcfolurioncm finc atrf acrionc.£r bcc 
Opcrario cft fibi magteptopjia cp Silicni alrc^ 
ri mcdicinc.f £r quando fir cmplaftrum cum 
ca curar fcabicmoculict palpcb:arum:?co8 
fo:tatccrcb:um. 




(TnpinilimUttM 

yr^%Mpie(ii\ccambumad(iMitudm£ 
f l»canncvocamfcrunt.vclab crb\;molo 
^iAgiagreca.quoniam canabum illita^ 
nabint>icunt. f ^liniueUtoOfcccimonono* 
Utiliffima funibne canabiefe r tut afauoneo 
quo t»entio:cft co tcncrio^Sfcmcneiue qul 
do mamru cft ab cqumoerio aurumni ^efrin 



% 



®> 



Crsrtatus 



gftutctfolevdvenfo vdfiimo ficeaf. Jpfacfc 
canabispottvindcmiamvelliraraclueubw* 
fionibuetccotticara purgarur.Oprima eft 
fll5bandica.p:ecipne plagarum vfibus.jdg 
mlib-oviccfimoXanapienaracft primumi 
fitui8.folio nigriomafperioz. 
f auicen.©cfecdcngi;cft(uncncanabi.j£t 
aliud ouidem cf t omUanum. 3 liud capcllrc. 
f 2*niriiavm tijtir ep arbo: campcfir* f m cubi 
ri qnrirarc in t cferris cgrcdirurKt tiipcr folia 
riijealbcdo tomirwtur.j£iufcfcfrncru6 pipe* 
peri ergramim'ammtlaw£.Bafuracft caUdii 
tt ficcumin rcrrio.Siuccueeiue eonftricrio* 
nem foluiriac folurione rl cgm a ct colera^ edu 

CjC 

^*|!Sfllladiu8libtorciTio.2Jnftb:uariomen^ 
fe vltimo .ca nabum coucnir fcri rcrra pingui 
ftcrco:ara t igua vcl piana i bumida er alrius 
utbflcra.3dcminlib:oqrro3nmenfequoq5 
^arriovfq? ad cc\nocflum vemum ranrii po 
rcltfcnamibum 

€>pfrarioflf0 

^a ^'jSliniue lib:o viccfimo.2>emen cius viro? 

geniruram qtringuere ticiruriouccttecjceo 

yxrmiculos aurium i quicqu td inrraucrir crjtf 

cit. 

f Sfcdcum to!o:ecapiri8tanta vi8 cft civt 
•a aqucinfufacoagularecam ticarur.3dcoq5 

tumenrowm aluo fuccu rrir porara in aqua . 

•Radijc ciue cetracroe arriculos cmoliir m a q 

cocra,3demqj podagrae i fitce impetue. 
r f auicennaXanapiscampcfirisrcfoluic 

vetofirarcset ejticcac fomrercbumo^cp ciue 

paucuecftermalue. 

C£t ciu8 radice tecocra fir cmplafiru apo* 
»^ ftcmatibue ealidie.3n locisturieinquibus 
w cbimivifcofi.fedarq5caadftarcmctfoluit tu. 

ricicm. 

*^£]ticcarfpcrma:fbrurionc ficgmaeducit ct 
£ colcram.Uifum obrcncb:ar.fiomacbo nocct . 

iSuccus cius t ifitllatur ad t olo:e auris opi 

latiuum.jEr ad ciue bumidirarcm; fimiliter ct 

olcum ipfiue Jolia vero ciue cradicant furW 

rceineapitc. 

^3de.j£tt>ccocn'onccflnapifiluc(Iri8fircm^ 
5 ,pi£!ftnsm berifipileer apoltcmatibue calidie. 

Jtiue granatifiictlielunrdigcfiionie: tfto* 

matbomalaXunq5plurimumeicco:ruibu8 

« ius fumtcur inrcrfccar fpet ma 

CapiruliiuiJrrttii) 




G-Sptluievcnerjtictu c.fuieq- dapfos 
■ poft alopic iam capillos recrcct:liuc ep 
■ eapiUo:umrluo«8 coerccr.Qd q* fit^ 
gulie ragrie lcnibus cu fplcndotcquafieapil? 
ItVFIa fcirur aut ein aquolis locie; f fblatea, 
in hb:o tc fimplici medicma.£ apillue vcncr* 
frig&ne et ficcue dhrcmpcrate rame e% fubri? 
lifubftanria.tturcbaber diurerica. "Reccns 
mulrecfiicatieefifcd paru feruaripor<ft:quia 
bcrba fubrilis cft £ !t bcitarioXapiUu vcne* 
08 btrba vidclicetqueer polirricos ticirur: 
tnparierib^vidcliccrnafcimrJjfibetfoliaco^ 
riadro fit'ia.caulcnig?:fcd nccrlo:cbsb5: n« 
fcmcn.f yConftannueXapilIue vcneris tcflc 
^af.intcrcalidiicrrrigidu cft mcdiocris 

i>pfraricnf0 

<*^lateari9Xcrracalcfacrionccpati6tarur 
aq t ecocticis ciue.vtl t c aq iUa i uicearo fit 
frrup$.£5i ctia fir virifi fplcnie alidjd addirur 
calidu tiurericihct plageUctn hcco ciue inti 
crefupponaf.vclctia baba prrira.f £onfla. 
£iue apofima valct banc wuofie.lapt'defra!J 
giwii vino bibirus vcncno rclifiiri bud:ite a 
l'omacbofiuaib:.mcftrua ( *:uocar.tolo*fpc 
crons i puitr.om'6 mitigat.f £t vrticurc^da 
cc ftomai bo i itiftinie i poir colcra rubea*a^ 
Iopicicvalcrcaraplafmi6.j£tfcropbiecuac} 
t#cj?capirecjcco loro pufiulaeaia? purrcta? 



T 
[ - ' 

Q 









(Lw- ^iM^ o 



r 



cffonemudificaf .f Da fo oleo fcccoct a facft 
ad rnfie? capilloo nurriedoo.sccocrio ci9 po* 
tataYctcrico87co6C\vn'na9iificilefaducad 
wiianmeftrua mouet;r etrie ftujJ& fiftMT £a* 
piHoectiacadctcscdtinetfi cuvinoct lijouio 
coquaf:ctcucodebumo:ecaput9bluarur; 
% 3tccuvino apponrafiomacbop:ocarb9? 
plafmarcmotfuicanisac ferperium mcdctur 
^iusaufcmradijccft rnlie» 







CapitulumJjEjEjEuit^ 



ardobcnedict9.*j^h'.caXardo bcnc 
fcictue ?5:q:vcri8fEcfencf(it.7cber; 
^^ba tcrifiagufpccics-rcuniollicic C9ultf 
culis fubrubicudie.TBafcifin regufr in muris 
tiome|5greciioedcrutfcnio'on:q:^ecanefcit 
caputei9.nucrofat>iuidiflani)gincqli8c(tf|H 
wc intertiuifuraecitptc.f #9r>i.fim.far.c9. 
t>ecar.bn.j£rigo:onfiueca:dobcnedictuevf 
bcrbabuuietftutebj infiariua-z mediocritcr 
*>Vafo:eric9.fPv9l.c9.©edu.i.cardobn.cft 
berba quafcninonrocar/Rafcif intcct^ in 
pctr^foIiabjTirida^ccnfafitiaqucrculcifcd 
^olTio:a^Finfiuio:9^riu?fubrufumcapircl 
lu in fumitatc tvrii bne in rnodH riricclle lanu 
grnofii.Uirce bj ftringentee et refrigeratce ct 
e" pftatcc q? pl9tago.folia frigida funr , 

0pftarionts 



£tn< 



f ibliaciuecuflo^fcatbaplafmatitecuvt 21 n *&Z3 
nosuUifacrasuwfitaiflaroee tcfticlb? tol* ^hM^ 

lir.f £t aniplagae fanat.ad ncrup? incifio* *&* xC 

ncecuaccto faatncatbaplafmarito impoftf Sjjr-rV 



& 



T: 



fcOpfe vero porui t>ata ofTocariocsfaot. 




V$3 












r^5L 







CapitulumJ0iE!]^l3^a^ 

cardonisfilucftr^clcardijebjplures^^oc *^*-tWfc f** 



ardue^cicnducrcamcloneftrpcb [>§ 
cardonisfilucftrl :4 cardusbjplures ^, jq 
fpee intcr ft Wffcrac8.^iffcrt a camc a , ( 



tcontqiinfolusndbjaculcoe.^li.ca.tccan^ 

£ardo$n:ofutgna.rni»frucruofiu8 9lfco» ' 









Slrc?vnicalecr9Wi9.tltricpfoli9fpiofamuri <^ '^^Mrfo 
c9t5c9cumite:fj9ltc?flo:epurpurcumittirin p^— i 
rcrmedtos gculcoscclcriff gncfcae'? abcurcj 
cu9ura.ftouincTgrc.rocaf.3tcc9r^^ fouai^ - 
caulce fpinofae lanuginee bj.^t cin antbo:a 
Icuc9cu8et)ictufpin99lb9.£itat9li9t>mtia 9-ttfc 

cpc^dainbismrticauliaramofacpfiutvtcar / J 

due.tlno at caulcncc r^mofo ncccnctos qdl 
cacumte tm fptnc fa fut r t n ■ingil *&. m cftatc 
fo^trttcrr9fctcli]tene8fcoIimo6^c. 

JDptrarionte 

^£5af.rij.fi.far.c9.ffolimi.Scoltmoc.f.c9r^ 
du8fil.cuiu9 radic mlrirudine rrinarii cducrt 
fcridgrufiquisinrinocoquceeabibgt.T^rcr 
bocfcruudinc&curatsltelUirum «a 

f £t toriue c6:po;ie purfi9riuo boc farmaco 

•f Q> *&**<* 



n 




5rvh47*^^ 



iSzZTtCcZ, 



^KX^^It^kr^ ^* J ^ s*a 






Kmmm 



& ro talts btforte ejc t ota fubftatia afftcrc: q f o 
fmqlitateencrgia ^d€ ca4n.iii .g.vcl fertio in 
cipiete indicat boc farmacu . ficcu aur in ij. 

£ f*fMi.ca.eamdconreaibc.i.f»cbaavt , eardu8 
altoȣu paffo mijtta vrinl mouet;JjYdropirii 
seficcar :Ulb:icoe occidit /Ra illa q nigra e fa* 
citadmalignavulncraq grecivoeat cacian? 

p culae;et lcnrigimsaufen.CjftatXameleon* 
tc nigre radijc bj qd&ehcrxriofum. vn^rrinfe 
cus e vfus ciS> ad fcdbie -r cmpctigiHe' i alfos z 
oino oia q abfteruoecgetttmolhtiuie?>Ya 
fo:cticiemifceffoimaciectfagedeniacavlce* 

£ rafanatcatbaplaf.f Slba#o cametcotera* 
dijc ad lubricoe rotudoe taf inqnf itate otifo 
bicuvino auftcro.3fferijtauteactYaerici8: 
fifem cjcnte radtci.magis atrn amario: illacft. 

*f f ©era.*rx3ditei$pfennujajimmio matric* 
•z pfert oitocsritudib? in c\to pfert bcdcguar. 
£t fruct9 aS> % radijc pfcrw apati vulue % aparf 
ani.et radir cius incarnat vlccra:q: inipfa eft 

P $>ni8pfolidatiua cii tgameto.f £t ide aucto* 
©YafXardus ebetba.? bmcf betba Pm cp cj: 
rimo e,fpe naturajbcdeguar/ze ftiptica;etfc* 
meci9dtfowi9iatt.'zpfcrtrclaf:arioinvulueef 
nttribilirari aniat glurinat vlcera .qrn.Jnprici 7 / 
cas riue cft pauca fincfujjfluitate.-z radijc ciuo 
couenit curfui bumiditatu anttquaro matririi 
stfiujcui nimio menftnwwffl. . 




Capitutum.jEc. 

OSmedreoe. *f>liniu8]capinjlo cs m# 
dfcoedi berbaquclatiequercuia ttf 
amr.i ab auqtubue tri5aoga.fou'a ba 
bet magna mente fimilia -z fciuifa vt quercur. 
ftozcrxnepiirpurco^liqiuipfainfctracajti^ 
cuntrz abipfa fcrram inucntam effe.f £5era 
pton ltb:o aggrcgaroiis capitulo £amedre? 
08 auctouratc £> \tfceiidieXamc dreoe no 
minamr quercus terrCRafcixur in lorie pe* 
trofis i afpcris.£r cft berba parua longir udi 
ne vniuspalmebsibens folia pania ftmitia in 
figuraminomifuo foliis qucrcue.fos eius 
cft colo*ispurpurcipanju8.£ t tempus cotli 
gcndieftqusndo fcmeneft marunm.? colttf 
genda cft cum fuo femine. f p \a(c oiicke ea 
pitulocamcdreoe.fiafcimr in locie farofe 
i afpcrie.irurejc eft bipalmis cu feltie minut* 
ctmentefimiltbus-z amarie^eum babetpur 
purcum i minttmimfed coliigenda cft cum kf 
me marurum cft. f J3alienus ocrauo fimpti^ 
cium farmacomm cap.camcdrcoe.£a mcdre. 
08 ponit eamquis in tcrcio graduficcitatis z 
cau'ditati8:i plus in eo in ficdtafe 03 in calidi^ 
fatcvnde folta eius funt fimilia folqs querc9. 
£tidcolatiniipfam querculamvocant. 

j©ptrationf0. 

4 Pytfcoiicks capitulo cameropa f m tranf 
lationcmnoftra.£amcropa:id clt camcdrei? 
osviridisificcabibifacnm aqua csnquaf^ 
farionibus? tufltcnnbus valet.Tfplenis t>uri 
ciesfolucndo mcdicarur. f 3n initie xdro'/ 
pifi8 iuuaf 4Jjenftnji8 impcrar:abo:ftim ejcdn 
dmcum aceto bibita fplenem ficcar/^jo^ 
bu8venenat is occunit cum vino bibita.-z cm 
t baplafntsnbus adbtbita omnia fimiliter fa? 
cerc potcft^nelle addito :antiqua vnlnera pur 
igar:trita -: oleo mina caliginee oculommipie 
tcrgit.Omni cozpou trita'* pcruncra calefa^ 
crioncm p*eftat .f l^alicuue.Pamedrcosp^ 
dominantcmbabctamarumfapo*cm.cft an 
f em •: acre quodammodo ej:;quibu8 videlicct 
fplenemliqucfacir^vrinas^mcftruamoueri 
1 groffidem bumouun incidit * ea 8 quein vi> 
fceribusobftructionee ejcpurgarv 
^f ©erapibn auctoritatc Blbngcri , fitfyru? 
pusejceaadtufiimanriquamx adcozruptio 
uem fcigeftionis 1 m pnncipio tdropifisrz ad 
jpafmum.zquanto fyrupusduecritvetufti^ 
o: tanr erit maioris virtutis ad ea que xhb'; 
mue. ^F Erbcrba ipfacontrita confmfinW 
iis lacb:tmalium.£t cm sccbcrio confcrt 
fcteridenigre. 




&t#)txbw 

♦ potujnuWicatflpjttabftcrgif mcb:a intcrio 
ra qmcft berba ficca i? tncarnat qiicft reeee:? 
pfert fup_ ocm mcdicma bntib? \cterimxt vfr 
omib? bnrib? opilationecpat$:et ( puocat mcn 
ftrua qn bibifcum mcllci-qn fit naftale.^ £t 
jiuocat vrina creoquiif cu mcllicrafo ct bibir: 
ct pfert ftranguirie.C £t qn e reces b^tutcm 
mtcapgUmnadi? tncarnadivulnerama&et 
curat plagas. ct foluit suric ice mamilla? 
f pYflf.ftadijcctfbibicaieco feptc. Yctericfe 
mcdef :t)teb?.jqc)c4)ibitfl fciatict, fert ope matic 
ciimulfa.cpaticl-itilTuricisctjtcfratc^pftat 
jrTccrij.tottiditofubucnif.bacctnmapcrnmf 
Cnporo.f £ur^turfleiS>fcafprravimaconi* 
ti carbaplafmarib? adbibita cit poletfl» clt)ca^ 
t ura ci l ) mitta oifl filr facere pt trit a cu caricis 
•:t>uriiinmoducarapucievcufrcmollir.curc 
fina tepidaimpofica foutida vulncra purgac 
mcllcaddito cae matriciecoponer. Puricics 
vulnerafouiitetparacolefimpltat.j5flr'.i:a^ 
mepifbeo6inguftuc\defo:tio^ b5fapo:e cp 
acre.in 



Capttulumatf 

>fv /k flmcpi'rbeo8 greee interpt flf infima pfr 
fcs I.nu8acflmeetpirbco8qtf cftpimt6:co 
\»Acy ftnomc8fuifpe8odo:cb5 pini. £t 
fciedu <v camepitbcos et camedrcos vna et ea 
debnt ^tuteetcoplcr4one.£tfunt ca.ct fierin 
iq.g.0atViu.fi.fflrfn.£flmcpitbco8eint>cfic 
cado tcttq gdusun efllcfaciedo $o fctnf S>e 
ra.ti^0.ca.t5atnepitbi6.uflmedrco8eft ^er 
ba q nafcifoi arotorr t>ilataf ei9o:igo fup. fa* 
cieterrevndi03£tfuntei9tre8 fpee.Unaea? 
fo:tio:altJ8.ctb5foliafitia.fot«8fEuiue:nilt 
€f funt mio:a eis et b5 fuebuiditate tenace. et 
Intpflofa^etfuntfoliafllacircaraitiosfpiffa-j 
odo:ci9cftficutrefintpmi.£tb5flo:c8mtnw 
to8gtaucoe:ctradicc6fite8radicitobcrbct>i 
ctc pico:ion;et femen et9 e nigru:cui9 odo: elt 
ficutodo:refinepint.ct ramiei9funt aliqnntf 
luldgietcuruarificutramibcrbeq^:bacafa. 
Secuda fpe* eft q b5.£sae logirudtnc vniua 
biacbtj z ramuloe fubrilee.folia fbo z rl o:c8 ttt 
odo:efifiafup:adiae.etfcmea9cntgru.z:er^ 
ria fo fpee q i,x mafculue b5 folia fubtitia mtf 
Itttta albida pilofa ,ct b5 $G* afpera alba z flo 
realbuminufufuB ramulo8:ct odo: ciuedt 
ficutodo:p:imc 

0pn:atfonrc 



lcfaciatjptcrcflin artetic^otno cito obftruu 
rur facttr epata bonu efarmaeu. pucir aut et 
meftruabibitnzcumcUeappofitu:e^ottiu 
rcricufarmacu.cida tot>atfciaric^coquetc8 t 
mellicraro.f Oirtusvero buiue beibema* 
gna vlcera fanare potcft: et puiridofa vlcera 
lanattturiciefcg mamtUie t>y afiwat . 




M 



'£> 



i ® 



CapirulunnjKft 



Crawatuo 



a 



% 



G2lrut :*£>larcsriueXarut appcllaf fc* 
mccr lxrbain.itj.g.cvz ftcjin rrafma 
rim'8 gtito et in ficitia rcpjf in qntttare 
mutta p. annoe a,n<g feruari pr.nirrurciDiurc 
rtca ett>rafo:cric5 b?. rOpcrarioncs 
f tmdc viml eceocrois ci9pfcrtftraguirieac 
t>imim'c.pului0 cria ci9 in ctbie fumpt^ tigc^ 
fiione pfoaanv&ofitafeetcludit ctpofiw? in 
falfamet* appetitu qcritatXonftaf inS in ti.g? 
dtw.>Carm'cca.ctfic.init},5.vctofirarc:inrla 
ttone©iftoluit:fiomacbuq?co:robo:3t;li3b:^ 
co0occtdit;titg(ftiua^tntepfo:faf:vrinap:o 
uocat.f SuiXarui c^imu tifpofitionito 
amfi.ca.cft'ific.inu.£jcpcllitvefofifatc8'ZC)c 
cim:? nc cin fubtiliafoecyjnimXctfcrtfemo 
ri co:di8.£ft borm tfmito.inrerficit cm cos 
f *£li.li.ju'rXarcu gcnt* fue nomic appcllatil 
in qcuq? f cira fcri vulf eadercne q olus acru 
latidattfiimutnincariatpjiimuinfTifiia. 
fpYaf.£areo8fcmeoitonomvinu8cftilti 
calidaavncniah'8anifofit'i8cufioma(ba:mi 
fccmrq? antidot* ctojcipo:u8.*Radijc ciue cce 
difcoctaficutpaftmaeaXonftatmSvbifup. 
Silueflrc cami qb* *5: eardumcm vatct cpilcn 
iicist»iuq3tumcnnto:fciaticT:nefrcric!:ftrapi 
rioft'8acrcprilwmo:fito. f £o:tionemvcn? 
trifq? t>olo:et>e grofla vcnrofiratc ac vifcofo 
flegmarecurar.euaecfo impofiru fcabicmith 
pctiginem alopicia fanar.tequo c\ ft.migar; 
iuau fttidozcmcip:ouocabit« 




Capimlum.jKih 

©ardamoirtim.fcme cfirici naflurcti 
qt3 in arcbia nafctf tt alrjs Iocie.© cd 
clcgcrducTragilc.flauuplcniigraucdi 
ncer quafilentu:fcdn6rugofum (laulum .? fi 
frangflfurpulucrofu?:gufluq5fiibfimarucale 
fa(ic8odo:cfu£tuictgraui.£ft ailt calidevir 
tntis alic^d brle s-mariiudinie.f *£latcaXar 
d£mcmucftfru(t5v(Ipoti9fcm(ncuiufdaar 
bo:i8.i c ca.ct fic.in.r>.g.mai$ mclius e.£t b? 
aliqntuluacummiG^ fculecdinciir;mijtfa.p. an 
no8.jLv.ptfuan'.virfuteb?pfo:fadiejcaroma!J 
ticitaicdiffolucndietpfiimcndiqcqlitattbu8 

Bptxmwnw 

f *JMatcaXardamomii vatet? fincopfmct 
eardiaea paffione cjcfrigida ca et ad txbtlit s * 
teflcma(bi4'a'ndigcfttonepfo:randa:adap^ 
petitu.puocsdihz p vomifti cjc frigida ca: ron. 
traq?t>(bilt'tatcmccrib:i.f £jccpra)?pocra. 
£ardamomiiealida-*?turcbab?:?ahcjdama 
r itudts:q: lib:ico8 occiditxf fcsbice fouiter 
fanat.f 0yaf. £ardamomu' tiibncos latos 
occidit .ctl acctobtbitu fcabie? fanat et crpur^ 
gar.cii acj t<?o cahda^pdcft epilctic^fftm mir» 
gar.fSciatic08Curat:paratt'tico8fanat.£t 
qm alicjd b? caufticc $?fut*.cr qucadmodilfr* 
napi8rclataf.3dcoq?vctri6fo:rioncctinfla 
t ionc relarie fanat.vi in a ct mcftrua ,r uocafc 
f *£ofatuq?pai tii c-.pcllif;aiatia vctris cjlcui 
dit.ferpentium mo:ftbU8 occurrit 
f £ii vino ncufrcf tcos adiuuar 3cfofq?fco: 
pionuvelfcrpctiuoiinfalub:ifcrcurat.vcfice 
lapideefrafit.mcftruafumigadotcponit. 
f Sui.£ardamomu quodda cmagbu ftcut 
ciccr nigrii.quod cumfrangif inreriue bsbct 
granii album mo:dican8linguafi(utcubcbc 
£r alind cftparuum fieur lcne:ciuim sroma* 
ricii .calidu ift ct ftecnm in tcrtio gradu. £r in 
ipfocftcumcalcfacrioneftipti(ita0.^5p:icq?in. 
ato quodbabetcaputct#:ieincapife ipfins 
£onfcrt naufee ac vomuui cu maflicie aqua 
vrriufq?granatf.f £onftantinue inIib:o g* 
ctuumXardamcmi tuo funtgcncra: maius 
ct minus.vtruq? tn p:itr,o gradu calidu? \\C/ 
ctim.Scd maius cft rntn o:ie ( olo:* ac poEti 
citatie ct magis odoafcrii. 
f *3to ftcmacbuccfo:rar:ct tigcfiionead^ 
iuuaf.Ucmitucolericuarcetciimlignoalocs 
maflice acfucco mcnte pofatum ejctinguit flcg 
tna.majctrncfnie co:ti(ibu8 bibitu.£o:rcjtci 
liipti(io:eftctflomacbiconfo:tantto:. 

€apitulurn.3ffl!if 



a 



% 



t> 



BfBntfe 




^V&rtamS.jfotfee mcfuc cfce eartamo . 
•r Jr£arta mue t>uo:um modomj cft. £ft 
M^em fcomcfticue et filueftrie,£t ©ifcrut 
cjda cv nil e t>e fpccieb? cartami et elogari funt 
jCartam9t>eclbicloctmureft fcomefticue et 
melio: ge plarc ipiue c femc.£t poft illud fl oe 
cim.i mcli9 funeeiue eqo* e albu planu plenu 
i grofiiim.aiius mcdulia evnctuofa pinguis 
ct co:tejc tenuis.£t mclio: floect'9ec\ eficutpi 
li croci.Bt eft cali.in p:imo gradu.uc.in.u.fcc 
rloo eius e miir? ca.fzt filueftr$ e calidio: et fic 
cio:.£t in co eft virtue lacririniouim rcmifla . 
£ft aitt cartam9 apeririuue. abfterfiu9: ?t ur* 
bariuue facicne naufei.3ui.li.ca.t>ccartamo 
/ZartamuoaliusefttJomcfticusctaliuscftfil 
ueftri8.c\ filueftrieca^ftin.tj.gradu.fic.in ter 
rio.ct tomeflicue ca .111 pmo gradu.fic in.ij . 
PYaf.ca.cincufmtranftationenfamcincu.i. 
carramuefoliabsbetoblongaet tutrifa? afr 
pcra et fpinofa.tvrfumbaber longu fpinofum 
in q funt capitclla obrotuda cum flo:e crocco 
fcmcn album babene obrufum et oblogrT? an 
gulofum.flo:eeeiuemuuieiriccairr.Scrapi> 
on U.aggre.ca.tJe cartamo aucto. pyafcoii'/ 
dis £artamue,eft ejc eo t>omefiicue et filucflr J 
pomcfticue babct folia ionga: afpera: alta: 
fpinofa : tiuifa : et babet flipitee longoe t» uot 
rwncubirow fpinolbe.cr fuper eos fant capt? 



tella inmagnitudineoliuemaiorie incibue 2 
floe croceue fimilie croco:et babct .fcmen ah 
bum ct oblongum angulofum. 

j£pfrarionf0 

f 3obannee mefue aucto:itatc pauli. %cc\ / > 

pe medulle ciue.j.r .co:dumeni.j.i:f\fac ejc cie 

grana fiairciccrcula.j.v.foluirem furTicierer. 

f £t Ticit etia liga ejc medulla quanritatefuft 

firienre tn panno:? fufpende in orimcllequan 

docoquifamrfoluriuu.ctpwpriefifueritojci 

mdfquilliricum. 

f £tidem auctoritate aligafelie.Scriperiue 

meduIleaureo6.jqai.penideaureoe.iiij.co^ri 

mcni^injibcrie ana aureu aggregenf oia cum 

melle:etfiatfomiefiattnucee.ett>a vbiopo: 

tetvn9mvelt>u36.f£tideaucto./3af.£oq$ 

furmedulla cinsin iure gallinevel gallicum 

fpeiriebue er,fl?incrur vbi opo:tet. 

f£tt>iutetiafiatejcinedulli6eiueetpondei»? 

tcrria ipfiue cjc amigdali8:er fetra ejc pineie cc 

aggrcgentur omnia cii mcllc ct t>ecoquanrur 

ciiiucco fqtnUeerfiarbecmirabilie iuuamcni 

tiadeaquet)iccmu6. 

f £jcrrabif em ab ea olaim iuuamcnroanec 

cius opcrarioeftficut olei t>e ben:etolrie t>e 

amigdali6.£t folutioneeducic flegma g vc** 

miru fifr ct aquolttare. er valet ad egritudinej 

ecrieficutcjtcoltca etcriftaijatur. 

f £tmundi&catpccrueerpulmoncmef,tt>:ie 

locb p:cdicti:ct clarificat voce et fimtTr oleum 

ipfiU6.f £tvfucciu6in fpermare augmcnru 

facir.jPloe vero ciue cu aqua mcllie remouet 

Ycrerici^fSuiccn.Oleumriueeft^pinquum 

olcov;rice:vcrunrame tKbiuue^crefteceie q 

cafeanr lac^t nurrimcnru cius cft multc pami 

tatiejct mundificatpccrueet clariratevocem 

et eftmalueftomacboMt cafeatlacin ftoma^ 

cboctaufertcolice. 

f £>Yafco:ide8.£>cmcn ciuefcarumcumul* 

fa venrrem purgat.-cacoftomaricu eft i xuilce 

mulrum:eripftim ventre ticponit amigdalia 

ct nitro mijriu et anifo cum mclle cocto aece* 

prc anrc ccna t>ue vel rrce vclut nucee vcnrre" 

molltntrigefiioncm p:cflat. 

f S^craoipn auc.p vaf.Ouando tcrunf c& f / 

pilli cart ami filucftris aut fioe tt bibunf m pi 

pcreetvinoconferuntpuncrurefcoHJionie 

f £r cjda putaucrunt q? fi quie p.cu(Tue a fco: 

pioetenuertt radiceciueinmanu fuanofcnri 

ett>olo:eeiu6.etqn,pi}citcamruncfenricr. 

Capimlum.jEn» 

f iiij 



P 



X 

2£> 



SCrarratus 




f £cfert occulmici fangurs moimbz $niti 
omlaccrrof.crapoffcmatitpatta ficmado 
ac tufli.V9let ctia ad tumo:c; abftcrgit viftm: 
apata refoluit.mcb:a ciptuTteierjuo ' ai £t cii 
fcmincaptKofcrtrctiifoflc tnftuTationi ruine 
vanc.fiCcftatinS-inli.eduuXfllamvcfiibtif 
dtrini colo:T:cocau9:t>cficca riuue;a facillime 
rupif.t>igft^pftrict9.in india crgfia nafcif :fcd 
laudabiliotcindic^ftatca.-tficinu.firadtt 
valctq? ad * olo:c ftomflcbict cpatt potui t>a 
roe.2£beftrua rjuocar.-z vercri tufli^dcft fi fuf 
famigwindefiat.adftrigeducfc fanguis flu 
Kiivakt.f •^la. / £alam9aromati«j8ca.cct 
ficX^uidarcBifinEfiac^citrinuscXtcopbi 
fici no vtunf ^B li9in india $ fubalbtdusc^ co 
vtunf .£ft aut radtt cuiufda frutic?, va Ide aro* 
marica:calamo fitis:q: pcaua cftXu tm t ol* 
ligif 4dda lignu qo irciiue c ewra bif j£ ligcn? 
duo c flut calamue fubfllbidi colo HA cit fragi 
rur no fflcilc pulucujaf^ rrce annoe fcruatur 
i?abct #tutc eonfo:t andi. *£ului8 ciue valct 
cotra t>olo:e ftomacbi ct frigiditatc vcl vento 
fitare.3dt>igeftioneftomacbieonfo:tanda5 
tatU8pului8au6cu5puIucrccinflmpmi.boc 
ctiamvalcrconrratflrdifltam. 



aaiamu8aromaric99 utitudiccfllamt' 
vfuali8vocaf.0ignifinindiamulri8 
nodis gentculat5fulu9 fragrane fpus 
fuauttaf c.0ut ci» fragif in multae fites fit fcif 
fili8.fimila6guftucafiam'culcniagrtmoiarc^ 
mo:dcfc.-vt^t3fi.inIi.crf.DTa.£alam9aro 
maric5inincttanflfaT.?eoptim9colo:cruru8 
cunodis fpiftie^cufrangif fnnrirct arcnofus 
flpp.et^cmlu9:odo« fuauiguftu? Yirito ftip* 
tico atqj glurinofo.-£Ii.3uncu8 odowtue ni 
bil t>iftcrut acetcr$ fui genert, 9fpcctu.£»5 C9* 
lam?octo:at9pftario:e.Odo:eftflrideIdgm 
4muitatnnoUioit9cru:mclio:q5^mirr?fragi 
bif.£t q: folo fe pori9 03 cj rapbanimo fragif. 
3nelt4tfihulearaneuqt5Yocantflo:e.2luiCi 
Xalam^aromfltic5>c9lidu8clicc9vfq5fld fctfj 
!$>clio:eiUcct ciaancrim'coIo:!#incl8bn8 
nodos:q tnpunw fruftrafragif:acui9c9nna 
plen9 re fifi tde 9r9ncc. ct i m9ftic9ticc cius e 
9cuit98,£r ci9?tritu cboni odo:t, ,j£ t e tccli 
nas ad cimnif9feet 9lbedine.£it at fubriliafi 
uu8.3n ipo eft f ub9 fubrifcficut in pipercct ci 
namotfo^cr4iq> fpeto bmoi.jjnipfo elt fttf 
pticitae pauca cum acredinc . £t in ciue fub f 
Ifanria funt terreitas ctaquaitfl8.ctcftbonc 
ccmijctois adcqualitatem pcrtincns, fcdciue 
criccatio maio:cft. 

^ptrarionra 




fiTflpituIuin.jEnjf 

aaiamus agrcfiie fiucflquatictJ8.;3c* 
to:.£alamu8tftflrundo vcl flrodind 



&tl)nb\Q 



gmcrie.Scdeftctiflmcalamu8arcm3ricu8 
3fup;apinmocapitulo.3fi.U'.?.vi.3nfiflgiii8 
indicl arundinee calauucp ticuni naf ci.ci; % 
nidiatocicpteftumfuauiiHmu fuccum bibunr 
3ndittnde?aano.3ndicanomagm1w at* 
bo« crcfiit arondo Oluus et lcnr ie p:c mif ra 
dicib? bumo:.pt;Uia cui nequeat fucco come 
dcrcmcUa.iSlofa fa% £faiam.|cij. £alamue 
t>e 4 carra fit mcdulla babcrc vidcrur:et nd ef 
fc vacuue fed gius cft ct ciro maredlir. ande 
fcriprocft.fcalamu8criuncu8 marcefcir 

i>prrarionf0 

$ D?flfco.£alamu8agrcflieinaio:eftin oV/ 
bus agaricis.&ue (i comcdcrinr ataUa: at& 
mferrur mottem.': majricille c\ nafciturw ba* 
bflone ctin parnafo«i?aftae babet muUaej 
foUacdcrcfimilia.flo8ciu8atto i odo:ariu5: 
fcmcn vero minurO cr bonu/Radifes quincg 
velicc babcr albae cr longas ct t ukce vnius 
fcigiri groiT irudincm babcnrce 
fj£tciu8cU]carnrac6fiaifmcdicamcnrumqj5 
toUitcaligineeoculom 
C£ Ucarura radicie ciue ranru pofcft quantu 
ctradip 

flSFcmeciu8tiurcrfcucft.'Raufcam ( p«ocat 
vcweftringir.in£iciUanafcirur:qbouf W/ 
pinguat H ruairviriduscomcfta. 




CapituIuui.Fcxitf 

aSpflrie fiuc'capflnj€.3fido:ue fn UV 
b:o ei\mologtsrihjcvr;.£apar^ ici vi 
deturu:o cy bfibcar in fiimiratibue ro* 
runda queda fcminueapirclla.^Uniueutoo 
t»ccimo nono.pirimue inrcr percgi inaefru? 
tiae tecaparo non vrcndil rranfmai ino W, 
noccntiuecftitalicuj.fcrunt illoeq quoridie 
cc\m paralifi no pcriclitari:nec licnis :tolo:ib 
'f>lareariu8.,Oparie fiuc capante. £Mba e 
vclfrurejcin tranfmariwe pambueifuius co: 
tct. pzccipue conucnir vfui mcdicinc. 3n ptm^ 
cipio vcrie colligirur cr teficcarur.pcr fejc aitf 
nos in multa cfticacia fcniaf Xlcgondueaute 
cit Co:rcc qui cu frangif nc pulucnfaf:? qui a(i 
quanrulum fub:ufue cft er fttba marue. fi o:es 
cnim adbuc rubero fi colligit>ibenr:q: iaui ti 
larari non valcnrXum fale vcl accro condiri 
femanrurXonftanrinue in lib:o graduuXa 
pan funt in fecundo gradu calidi cr fiai&o'/ 
rumradftctfrondeeetpomaer fcmcn intrat 
mcdicina.^agie tfi cibo poraa et frondce. 
radijc vcro mcdicinc pcnincr. 

S0pfrationf0 

% t5yafco:idee.£apari8f<birofrin fp(cni8 

fug omia medicamina iuuar/rurcr ciiis fptno 

laiupcrrcnafparfa::vncrioncplcnaJ?aben8 

foliacYdoiHcfimilia.femenaurcm (icm oliua 

•Radiceemagnaect mulrae.locie aridis ct 

marimc in muris nafcimr 

f 5Semcn ciue vcnrrgmollir. £omcftii aurtj 

cacoftomacbum cft/Radfc cr femcn a»? vino 

fcibira fplenem arrenuanr:v:inam p:ouocant 

fanguine teponunr.fciaricie er paraliticie biV 

biramiriU'ccp:odcJhmenftnueimperaw.i£re 

mcn ciuscocnimcumaccto et o:e rcrcnrum: 

«olo^t>cntiummirigar.radi;ciii8rriratimi? 

pofira turicias ct fcrofa8Tpargir.©rtccSeiuf 

dem &mi infufue vcrmec occidit. 

fl^faacXaparifunrcrradircrfrondcs^tru 

crueciueomncecaUdi in fccundo graduqt» 

tcftanircommpontictrae acumcncr amar^ 

tudo. 

f 3ldco mc idunr crtiiToluuret mudificJt fto 

macbum a fuperfiuie bumo:ibu8. 

f ppilarioncm fplcnis ac eparte apcriunt j 

ct turiciam foUmnr.vrina m i mcnftma p:o^ 

uocanr. 

€ ^>cUo«8fimtfmmcdicina$fmcibumj 

qmillaudabilisnutrimcnriruntjvrpofccolc^ 

ricinigriqfan5ui80cncratiui:ncruo8eriam 

ftomacjbiimpcdiumcr pcrcwitmt afltttfacti. 



Crarrama 



vndeopo:rctcoeeUrx>rinar:emcari:flblaraqj 
cc:umaquacddtroscum oteocr acao.0t»i 
fi c u earne vd alio ccmedanf ;no iibfqj coria* 
dro manducand i funncuws narura rcpcnctn 
mi!gnamriep:cftar 
' ^larcanup. / Opa:iYriturebflbcnrina'rldt 
appctiru J?iimo:cm in o:e ficmacbi eitificntej 
t igcrcndi ftomacbu confo:ranr: infrigidatuj 
cakfaciunr:(ibuecnimfunretm,cdicina. 

23 f X.ontra vicium fpienfeetturiciccpatis va 
lctviniiteeocrioniscaparis 

jf f £5uccue loliow ciue aurito imminus vetf 
mee nccar.valcc cria bci ba bec ad \ liacaj pa f> 

' lionemetarreticam; 




€apttulum.3Enjnt. 

^»VSmpbo:aca .^lareariue.£ampbo* 
1 •' Jpracaeli babacwuefuccuscftdpbo* 
^^r^muuipltcirervrilie in medicina:u> 
cut vtdeUcet in ilio capirulo baberur:2?ccbcr 
ba noftre campbowce l imiUe eff . 3n ftne vc* 
rie coUigitur ac rairur.1 tndc fuccue ciue ejcf '# 
mirur.jQujod feculcntum cft refider ct sbrjcif . 
quodliquidiueacpnriusretinri.fooUapo* 
nirurerejticcst^cccficcataincampbowmre 
ducif ur.Didem £amp bo:a eli iu rtrtio gradu 
frigida « ficca.t icunt quidamifcd falio gum* 
ira riicjcum fit fuccue bcrbe tuiufdaj(tcUe ty 



afco:idemultitfd:alri6^ctbaqjtpfatkrfc5 
pbo:a capirulo.vrin principio buiue capitu* 
U'tijtiXampbo:acligcnda eft albact luctda 
"Fiam rurbulcnra no cft acko bona.£t admi 
jrioncautcm vcrnicie fopbifiicaf tt. m inrcr 
ipfiuecampbo:e:et cjcat mijttone fimilie eff in 
odo:c.t>ifcernifur aure quia vcrnijt folida bj 
fubltantiam et dtfticile frangimr. Xampbo:a 
vcro ciro.ct fi rracrcrur in manib9:te facdi pul 
ucrifaturXampl:o:anifi arrificiofe feruerur 
tefaiihperdirur./£ ftenimaromariea:et omc 
aroiqaricumcftfumofum.3dcoqjinfumou> 
taremfoluimr .S>cruari aurcm porcft in vafc 
mar mo:co ;et mcUue in alabaff ro. feruaturqj 
in cfficatia mulra in pftUio vcl in Uni fcminc vf 
miliopcrannoeU. 



f Conrraralefaatbnemcparispuluis eras 

cu lolarri (ucco conficif:in quod plageUe intin 

ere fcptuecpatifup.ponuntur. 

f Corraflujcu fanguiscnarftofiunt magda 

lioneeet puuicre tpiue:ct ejc pulucre fcmie xV 

ricc vfti arqj ccfecti cum fttcco fanguiriarie et 

imponunf narito.fi vero fiat rlujcue ejc cbulirio 

ne fanguinie vcl ejc epare:puluie cius cipbo« 

cu aqua frigtda coficiaf :ct plagdlethfufe irot 

ti ct rimpo:tbue i gule er cpari fupcrponanf 

f ^onrra macnlaocuUconncimr puluie ci9 

cumaqua rofaruatddtro fcnicuU fucco in va* 

fcponaturcneo. 

f ^otuTafaeiapannuetadfacte" darifican* 

da cdficif.confi(iturquoqjcw aqua rolarum 

addito alboarqjinimcifltmo. 

f /Lonrra Ubidincodottf ccmpbo:a p. narce 

•fcimiacmactione frigidirarie fpfie mfpiffat 

co:pueinfrigidatctUbidincmftringit.vndc: 

£ar bo:a p. narce caftrat odoic marce. 

f 1~,ora ep fatie copetcrer ponirorinfrrupis 

conrra acurae cgritudinee.' 

f 3n frenefi copercnrcr jjuocat ficmurarcTcs 

fi puluie cim t iftttnpcretur cum olco rofaruj 

ctpennainrincrapernarceinringuatunctin 

altjefe^cune.quta non augmentarcoloum 

necnamram. 

f auicenna.tlfus campbo:cfacit caniacm 

sj btber apoiicmara caUda.£r cu aceto & bi't 

ber rlujcii fanguinis narium.aut cu ejcpuiuonc 

tactilomm cti aqua mirti. 

f fct conlertiodecflUde.£t rcmouetrigilias 

ttconio:ratUnfu8caUtacto:umJttcoiif£Tt 

alcolevcbementcr.ttcvtertmn.cduini£ob^ 

talnuecaUde. 



t> 



T> 



BtUjttbB 



numctveficc 
X ^tftringitflupimvcntriecolcricum. 




CflpttuIum.)Eri)e 

aamficcaut(iccn.Pv fl f f oudc0capim 
lo camfice.&altas babct longae t> jgi 
totumquarro: interra pzotecnis la* 
cb:Ymopleme.fouafuntetee lenriaile fimtf 
tiafcdminoiacr. rcnuiota.fcnicnbabcrfub fo 
Iqe rotundum ficut pcplam.ct cii fine fio:c.ra 
cbjc eit illi tcnera ct inutilia 

j0pfrattonf0 

4 Pt afcoridee.;ba(f a ciue rrita cum vino ct 
vt peflarium fuppofira t oloum matriae mtf 
rigarXatbaplafmarito adbibita ruo:cs [par 
gitxlauoe co:po:te tollit anirmiccae mundat 
cocrcctcomcftcvaitrcmfoluunr.3dcmfuc* 
cue ipfiue faccrc potcft\fuccue ipc pcrunetue 
tcrue fco:ptonum mitigat jfttflitiionco ct cali* 
gfoeeorolomjaddifomellecurflt.ftafcitur 
vcro fajcofi8loci8ct afperio 

€apitulum.r. 



aataptwia.3(ido.ti.cttmoXatapucCc 
oucfuntfpccic8.'^>aio:videlicctmi^ 
no:. # z£)aio: cft ficut arbo: fic9 licct mi 
no:.folia aue funt iicut folia pjafani. £>emtf 
na eiusftantin arbo:efiairvuc. ^ino: ba* 
bct baftamtuo?palmo:u?inane.folia fimi 
lia amitfdalis fcd longiota.fancaue incacuf 
minc vtrge rorundu .tcfo:ie nigru.t cinms aW 
bum.Sttnt<mambeqfi ciufde eoplcrionie 
?virturie.funtcm ca^n rcrrto.'? bu.in £mo 
virmre baber purga ndiflcgma p:incipalitcr 
fcaindario colcm melancoliam. S>erapion 
li.3gGrc.ca.carbua:idcitcatapuciaauc.tYaG 
Xarapucia maio:q rocatur catbua: carboz 
tn magnirudk ficue babce folia fimilia dnlb. 
nifi q: funr maio:a knio lai nigt io:a : fiipirce 
i rami ciue funt conca ui ficut ct canna:tf ba* 
bct fcmcn vclut in ramie afpqt.ct qtt [er.co:ta* 
tur fcmcn aue efi ftmilc K\ram cc co cjipumi; 
turolcumtckaua.^uicacftplanta quam 
mulri ecpuatr int cr lacticiniout fpecicebabct 
fiipirc vniue b:acbq lonsirudinebabcnrcrm? 
cocauum in grofi irudinc vniue t tgitict tn fit 
mitatcfuputsramommfimtramuliparuttet 
ct, folrja qucda funr fupcr Jtipircnua qucdtf m 
fup.illoeramnloe.fcdfoliac]funr fup. fiipitc? 
uint longio:a fimilia fotas amigdalc;nifi quia 



fExamtm 



a 



£> 



ti 



funt latfoia i lcntota tfed folia q (iitfup. romtt 
loe fu£ioK6 fuftt mino:a foU»e fiipirie % funt 
ftmilia tolqe anfiologic lon. apopinquatia 
fimilirudini folio? ederc.? babct fructu in fum 
miratforamulo^mangulatu^veuitrofun* 
du licut grana capari^inter i|m fut fcmta q 
tiuidunf e parieree quefunr in eo que femina 
funt in magnitudine o:obi:ejtfcriue fubnignl 
bflbcnriacolo^.fcdqnc]Cfo:ianffuntalba:ct 
babctfapojeculcc^babetradiccfubtikmin 
qua nuliu dtiuiiamcru.0alie.vrj.fim.far. ca. 
dm.uaf apuciefrticr9cj ptirgar. Sbllafiua 
1 tvafomic&baba virrure.iraaijf? ftoe fcd 
oino ncbilio:e.olcum vero c\f> ejcfiwfu efhelt 
calidiuetfubriUuerz t>vafo:erif um . 



impolitu manilac limpicfat.folia tiwtritacS , 
polcnta tumcuee oculorii fpargunt fcuriciea , 
omneemamaru x rumo:ee ccpefcuftt. jfgne? 
facrum fola ejt ringuut ipm cum accto n .iwa 



f^eraXarapuciamaiotbabetnrfuteque 
abltcrgtt 1 refoluir. £ t virt ue folio? ttebilio: 
cftvittUKgrano?.fedoleumciuecft calidiue 
ct fubnliue olco oliua^^ter fSrefoluir plue 
eo.£]c femine aue fif oleum quod non admi* 
niliratur tn cibte:fcd in uirernie: 2 ponitur in 
vngenri6.f £t quadoejcco^anturepgranie 
cias^.i tcnintur^ bibuntuVpurgat colcrl 
•zflegma •: bumidifate0aquoiae: , z comonet 
vomitu?fiu]cuvcntrie.£rgrana quide eius 
funr grana T>ura Jacant ftomacbum lata rio> 
nefotfi^puorantmufeam? vomitum. 
f £t quado grana due terunf t fit emplaft? 
cum 08 mudificatcthpetisine. f £t quando 
fit Umtiofuolcoaue tolffaut cu aceto fedat 
apoftcmatamammilla?. f £rtempu8 quan 
do fcebet fieri illud olcumeft qii cadut grana 
a cottice fuo.qc oleum ccfcrr fcabiei -z olcei \'> 
bua bumidie que funtincapife: e apoftcmat i 
buecoi^coarrationiotiematricie^cicatri 
citofedie q remanent poft foUdatione clauo? 
2t>oIori'auriuqn mifccntcu aliquo vngento 
fo:t ificantcopcrationeteiue.f £t quidocp la 
|catvaitre.£t;cjtpcIIitIub:icoe.£tidcauc.be 
digowe.-Jbzoprictaegrano? eiuecjtp/ »ifs> 
foluunt.fubtiliant? fo:rifiicantmcjmb:a 3 inci 
durit fuEfiuitate.£t,coferunt lepie.£t fimiltf 
tcroleomco^fpYafcoridee.Oirtuecarapu 
puciemino:ieclt;cararrica.feprcm grana ac 
cepraaut noueficut carapodia comelia . ct ftf 
militer ca.aquaaccepta ftegma 1 coleram t>e* 
ponir.f ©uccue ejc co factue ficut t>e titimal 
lo omuia fimilirer facere porcft folia ciue cum 
galiina aut iuicdlo accepra ventrcm foluunr. 
f £5ed catapnciemaiorie:fi.]C]C]C.grana pur* 
garafucrinracccpra :colera? ftegmavcntrie 
©tponunr.rominjm pzouocant guftu no bo 
no bcc purga t io ftomac bii lcdir. f X.cti irii et 




£apttulum4 

O&UUeOfidomeinU.crbymoXauUg 
cftgencralircr berbaruvelolerum me 
diue fruratci vulgo ttrfue «icif :eo q> 
atcrrafurfumpfcedar.£ic ct©ai«atiicft vt 
fpeaalitcr quodda gen9 olc^ caulie tJiccrerur 
q: rvrfue ciue plue ceter! oito cdalcfe it.i. cxc r / 
fcir.SuicXaulVo^pue namralirer cft bumi^ 
diefolrje.faucftrieautfcft caIidio:et ficcio:: 
ipfe totue e calidue in pmoiliccue in fecundo. 
£aulte fiquide aliue cft tomcfiicue:alius fft^ 
udtrie:aliuemarinue ctaliue cauraquc.^ii 
ucftrie cft amaiio: tacutio:et a cibo rcmori^ 
ofc£ ft aiit groflinutrimcnti trigroiTa ne fan^ 
guine.£ tinflat ct facit co^/ t>oIo:ofuj.'i?ba 
turjat iuue e aut ct kmflicatiuue.x teltccatiuus 
,|p:ie qn tsecoquif et ab eo-pma aqua crrundiit 
tiufcpnummcntii cftparuum , z bumiciue mi 
trimenro lentiumXtfanguiriejfacit maU.m. 
£um ergo cii carne pingui ct gaUinie tsccoci^ 
rur parum bonue cftu itur.^allaTi. U.i'r. 3n 
mcfcfcb:uario caulcefcruturqui et toioano 
feri pofi unt Jblu pingue er farie fub a ctum c ili 
gunr.SrgtUam cr glacte timcnt J£»abulcc et 



BttftxW. 



p 
s 






arenfs no t>c'ee t anf nifi pbenis vnda fuccur? 
rarOmnc ftatu celiparif caulis frigidu mag$ 
prra aultriipofiriatiusferurXcftra feptetrfo 
nc feruis.fed 15 -zfapo:e caultsvincir? robo* 
rc cimispelecraf .£r ideo ponende funt plare 
j> btilbino8area£.fiaudafterco:ect fareour 
rione/Rarius pofitf pualefcit. eelertf coquif: 
viro:c fcruaf.fi oum elt trium vel quarruo: fo 
lto:um.mrramtritucribelloioe[up.fparfa8ec 
"' winecancnrisimmirrerur. 

Bpmnonw 

f 3uicenna.£aulis babet $>a'ctate infcda^ 

fiohc $oIo:u ftipricus eft rius cinie i (oitie ejc 

licicarioni s.£>ilueftrfs i marinus % -oomeft tf 

atstnaniranrflegtnonesjatcptujricias: 

f jMcm cauusconfolidac etp:obtbet frattdu 

lenri8ambularionem.ponimrq5Cum;albugi* 

nc oui fttper aduftionem 

f Z>emo:ic6fcrrcu fenugreco cmb:acaf (uf> 

podagra,riufo3t>ecocrio fup ©olo:es ulctura 

ru.3re?ei9t>ecoctioacfemetardateb:ierate5 

f ^onrcrteria^rtuntoritcaputpmgui cym 

fucco cuts.Et eius^iaaribrfitctficcarfb lin 

gue:facied3fomniu.7obtentb:arvifum. 

f £um (ucco eiue aur ©ecoaione ipfius cum 

olco fifamino fitgargarifinu8eotrap:cfocas» 

rione.£triu8 comeftio.clarificat voce. elt aut 

malusftomaebo. 

fS^uccusriuscuvino^epaflispfertfplent 

t YCtericie.puocat vrina et mcnftrua .eiufcg fe 

men^mes intetficit eu lupino? : aqua. 

f £inis radtcislapidefragitXaulis marin9 

ttcctinat ad fatfedinc ? amaritudinc.et ideo le 

nitnaturam.foluitcp.tpMecum pingui camc. 

^iusfoliafuntficut ariftologie:que onurur 

ce vna radice.Siuccus eius cuj vino ^onfett 

mo:fibue aiam canis rabibfi'. 

f P?afco:idesXauUculi o:tiui eliri x no val 

dcpcoai ventremmolUunr.*Bamcauli8tvr^ 

fusfifoMruseli-^rurvenrrem abftincr:etma* 

jcime fi in' calido cinerc cbquatur. 

f0uinafeunfwegiptoamarifunr,Tficome 

fti fuerinc caligics oeib? t>crergut.tvpic^fut 

crudi comeiti:eb:ief ate in puiuio no admtttut 

f yfaacXaulis ficcus eft et frtgidus in pmo 

gradu.£urbidum ct melancolicum getterac 

fanguinem odo:an©anrem. 

f £aules eltiui vftio:efanguwegenerlr.colo 

recmvfteviartifuntetmundificatiui. 

f 2bYemale8^onotantiacuminisfunt:fed 

viseo^ventrebumectatetvrinampwuocat 

*t?o^iusbibitu ventrefoluir.etfineiuri come 

fti eude ?ftipat.co:pU8em eo?ficcu eft. vnde 



et coftipariuu.3deoa) ab co? noaimento tb 
percturelijcenrurietaquapwiecta in slia co^ 
quanmrcumlpinguifltma camepecudis vel 
fuie* 




te 

Capitultmui) 



/ry^toda eqttina.Suicenna lib:o feemtf 
I - f»docapitulofcecauda equinaXauda 
XalAequina eltplanra nafccns in locis co / / 
cauisetinvaUito.babens ftipires concauos 
adrubedmemt>ecltnare8.afperos:t>uros.no 
dofa cum nodisinrrantibu8.etad nodos ffic 
ficutfplia fqm"nantimint:rafpifla.ct adberet 
arbo:f cuiapp:opinquar .t>cinde gcneranrur 
eccaeriremitatesplurcsficut cauda equina 
erbaba radicctn t>uram eftfrigidain p:imo 
ficca in fccundo.efttprica:a ( pp:iefuccu8eme e 
vcbenterS cjtficcatois fine mo:dicatione 
f £alienu8 ferto fimplicium farntacbrum ca 
pimlodecauda cquina.airtusbuius plante 
eftftiptica cfiamarirudinepauca^^pprer boc 
t>eficcat viotentercu mo:dicarioiie..£ ft frigi^ 
dainp:imoficcainfeamdo.f -jbaulus capi; 
tulo t e cauda cc\na..£ ft qt;eda cauda mt o: q 
6 



Cwtatus 



0kc vocmr coi Na babmeftipitem fub 
rnfnm % folia fuperio:a minoja.f P vafcont*. 
capfrulol^fpparis fiuc anabafis. jbippans 
a.caudacqirinaaiitanjlbafis.lRafafurinlo 
oe bumidis et in monumenris. babct baltae 
rufas et afperas et nodofae quc baftc quicqd 
vicinumbabentlalliganranquitofblia funr i 
fumirate acuta ct tenera et iunco umilw.? fpif 
fa furfum afccndcnria . t>ec cria ali quoticna 
©eparictcpcndctcomiff.plcna abundanriua 
ct nigrie fiait caudcradicce funt ci lignofc z 
ture.virtue cft d fiiprica. 

g>ptrationf0 

m fBuiccnnaXauda cquina cft valdeuiuartl 
ua ad flunimfanguintexonfoudat vulncra i 
vlcera mirabilirer.£rfi inae funt nerui ccfo 
lidat etunuXonfcrt quando linirur ant fit ejc 
ca cmpiaftnim inrcftinieXonfcrtaiam apo 
ftcmaribus calidie ftomacbt ct epatts ct ydro 
ptfi.ctccrera. 

33 f Salienue.aulncra marima qnimmo ct eo" 
tra emiflionem fanguinie i fliijLii mulub:cm* 
£tcontrafciflinrcriaeaiamacaaoeveme 
flurue.ixcbcrbafarmacum validumcft ctl 
aqua ct vino .©cnbunr aure quidam bac v& 
ficenccnonmbtilium int<fiino:um vulnue fa 
narc 

X <(f Sfaous autc cine emo:rofagrl8 quc ec na 
ribue conferr.ct flutdispaflionibuovcntr^cu 
aliquo vfoo poticobibita.vcteumaquafi co 
ringanrfcbaciranrce. 

p ^f •jkaulueXauda cquina minor cnrar ? ttf 
lct antracem fiimpra i emplaUrata. 
flpYafco:i3uccueefoenaribUGfanguine 
pwfluenrcm abftina.piffintcricie cu vino bi 
bitamedicanrr.vrinam p:ouocat.foIia oiue V/ 
pofira vulnetibue reccnnbue paratolcfim fa* 
ciunt.ct radir i berbaciue tuflicntibue i ouo 
noicie mcdicanmr.conquaflar ionibue opini 
lanrurvBicirur vcro incifionce vcficc ct inrcfli 
noaunfolidare, 
< C©aapionauao:itareOvafco:i.0uflnc , o 
foliaciue pifcanrur ctfttcnm cieemplaftrum 
SSWtinatvkerarcceria.crfifintneruiicifico 
foftoar coe.£r*>ccocrio rsdicie i folio? citie 
quando tatur tn potu confcrr rufli a nriquc z 
conrracrioni anbclirue ,£rfiporcnra rrita 
tc ficca idcm faciunr. £ t quando fit cmplalt? 
mn\ riercccnnbueconfertartiitionilaccrro^ 

Cflpitulum.riij 




aaflia fiftula.^obance mcfuc.£anta 
fiftula e ec mcdieinie in quibue eltdu* 
ctaiuuamcnfo?j£rcftfinc nocumcrc» 
carcne acnitare amo:dificariek3 omni cjLcef^ 
fu lcdcrcqucporcft ejibiberi in prrii letarc.irace 
pucrie cf p:cgnif ibueXonfiat flutc ciue d^ 
ctioinfcr^uctaribue.vt cp duo arundo fit 
grofla plcna fplendcne mulrf pohdcrie.ct fit 
pulpa eiue fplendce i pinguicct bafta c% arii 
dine i pfcruata in vafis virrcar ieccqualte co 
plcitiome ad latue calidirar ie tcdinane.tcft 
bumida inp:imo.crclcniriua ctrefoluriuacta 
rificatuiafanguinis.nocct tcbilibue babcn^ 
tibue vifcaa lubrica.rcmoucf cb ca bccnoat 
mcnrum in pcrmijcrionc mirabolanom.? reu^ 
barbari craqua malhoeafpica ct quadoeg 
nccefTariumcft addercbb:icirar<m.-i p:oprie 
in tcficcat io nc r ifcc rujqu arc mifccrur ci olcu 
t e amigdalie oulcibue^t tiuretica faciur ea$ 
©cclinarc ad viae vanc.quarc neccflc di com 
pcimijirio quando opo:rcrmcmb:ie fccundc 
cjtpulfionie confaTe.*: ipfa cft tcrardcz tcbi 
lit er folurioncm fac icntibue.p:opra quod 
mifccnda funraimeaccrcbus fcbcnttfcacu 
iratcm:fiuc albafcecr Yfopueacm vigoiant 
ri^ocarionc.-zmaglfldbuc fi cuquibufdlejc 
vcntrcm foluctibue mifccatur.iipfa cu aqua 



Btfyttbte. 



tafri eft nobilis oparioie.f Sera 4$ .aggre. 
ca.cl^iir5amberb4delka(fiafiltul!3.?fotCi3n 
nc pcaue.quarum coloi cft rubcus ad nigre? 
diijcmoecIuHe.-ziurcripaefunttamineciccar 
ncnigra tparietestiiuideUfesinrcreas.s in%~ 
rralaminaefuntgranafieutgrana jrilocara 
cfe tciufdemagmftidirtis.fapomuscft tuV/ 
cie.tcolozquscftinfcrglauccdin^truboje. 
jaffcrturababitonia ejcterra aliemcn. j£tvir 
nteciuecft qripa eftcquaUscomplrtionisee 
dccra.£jt ilUi cltq ef i in cannafua tnrerius n0 
s gra gratiis': lncida.,j£tqtf tseipa vrimur plu 
rimueft caro.Ucct ctiam cctft ice aU'quado;j£c 
Cde aucto JSlben 2£>efuav. &irt5> eiue cft quc 
rcfftuitrcjBiuguif acuitatefanguinie., 

&iuratfom& 

ja f 3obanncsmefuc.£alTiafiftula mndiftcat 
fanguinem.-r remouaacuirarem duo^fcdat 
fuim.ap:op:iecnmfticcotndiitte aut felratf 
fcepurarofinarrcm. 

"«6 f £t ipfa quidemmudificar ftomarbu: i ed» 
cit coleriim zfiegma.'? illud opcratur ftne«o> 
cumenro.-z caret mo:dicarionc. 

C f Hfipfaquidcmlcmtgurrur-zpccnio, 

V> <ff£trcfoU«t ar}ata acura tas.-z pferrcalcfa£ 
cnoirenu fiipta cit tuurotae i infufice ttqrie; ■ 

£ <ffj6f,pbibctgenerarionelapidi8icie.Tpfcrt 
fcb:ito colcrtcT. j£t tsofieci 1 ; fin Scrapi. au* 
cfo:irafcBbenmefuaYcfta.5.vi.vfa53d.?.r.' 

f f S»erapion auao:irate$baimcfuay. £af; 
fia fiftula ejctinguir acuitarcm fangumie.': k 7 / 
dat apoftcmata tmra quefiuntcjc co. ia refoi* 
uitapoftematafcura quc mmt ingm^tnoet 
gutture quando fiunt cum co gargarifmaca 
cum aqua arbou'8 vulpie z paffulie. 

$ f£tconferticter(cie2?>oIo:iepari6.Cfpur^ 
gatcbleramaduftam.imoUificatvcnrrcmc^ 
diocri moUificatione.-z mundificat neruoe. 

%> f Bui«i]naU.^ap.tecfliTiafiftula.j£;arTia 
fiftula eftequa Ug in calidir ate et frigidrrarc ct 
bumiditatcct eft refoluriua et lenif iua.ct con 
fert apoftcmaiibue esttdie.': vifecnbue $pii£ 
tt gurrurijquando ejc ea ik gsrgarifmue cum 
aqua folatri.s linimr fuper apoftcmata tura 
ct confcrt cie.et tiniuntur et ea podagra •% iun 
ctureS)olo:ofc.quando DiuoUutur mantbj in 
aqua cojiandri bumidi cum fpum a pfiiltji t>c 
inckutc^cagargarifmtisconfcrtpiiocanoni 
i mundiucatcpar.-z eonferr vaericie.'? fcolon 
cparia? eftienfoua venrrie.ct edncit coleram 
adultam i ffegma ,a foUiif finc nocnmcnro ct 
abfcpmo:dicationc adeo q> ip(a eli ecuenies 
p:cgnatito,afoluitea6 .loco w ponif mediu 
ipfiv t>e tcrcmabin % friplu pocki is eiS 1 e car ? 



nepanularu4^c*auuponderi8ipfi'u8t>etur 
bit.rtqucp.poniflocopalTularuUquiricia. 




Capttulum.rinT 

OSfiia Ugnca.0ar.viq.ltm/ar.cap7. cc 
£afita lignea^ubftaria caflie Ugnec 
cft muUum inbt^iext fapo: eiue ef t a* 
cutusctftiptiafatepauca.tvirtuQeiuecftca 
lida et ficca in t errio gradu.f S>erapion lib; 
flggrcgaroriscapirtb ^clocbaa eac.£>tofr 
coadie.©i1t ctue mulre fpccice.-r nafcunrur f 
terrie arabum \ bi nafcunmr fpcaee aUe a fo'/ 
mariccJ?aber fiipitcm grofium aco:ricem.fo 
lia eui8 funr fimtlia folijs vreoe nigra purpu^ 
rca.ctbaberodo:cmfimilcodo:irofe.j£rl?cc 
fpeciescftinpuma bonifate*zfect7da.potl bac 
inbonitatccft illacui9coIo:eftltcutcoIo: co 
raUi.a eft fubrili8.lcuiaIonga. grofli ca lami 
ctpUncmo:dican6U'ngufl5cumllipticifarc2 
acuirarepauca.bontl odo^babes participl 
tcm aliqsododoris vini^eetsuc fpcnes mt 
vtilee in medtctna .alte vcro non funt admini 
ltrande:rtcgovoIuiea8rcmemo:artvrnon 
adminiltrcnrunfcd abticianmr.^rclt t>eeia 
qucdsmquccftnigrababens odo^ malum 
acowiccmfubtikm^trcperiturreequcda^fi 
milis cafiicUgneectnoncft cafiia Ugnca, j£t 
6 ti 



Ctattams 



B 



% 



fomiorctoirpfap62c.qmti5eftnaitinapoJ!: 
nec cdo:ifera.?co:rej:cv;e adberce igno.i 
r<»tffilraddbnflcalamfllawlcnemoUcafpqi 
toclwcminufl mala cpmmc ©iaa.fcdpcio: 
oibaiacftcuiu8colo:calto.todorfiri8pdo 
rt'pom.ncbn6calamfl8romnnfedfiibttlcm. 

i^pfrattoneo 

^af.tlirrue cwcq rcfoUiirctinadit? foutft 
car mcb:a.?,puocat menllrua quc rctinentur 
caufa grofio? bumo^ et \ ifcofomm. ^ 
ff<©era.£alTiaUgiiea bjf lutc^iqtw qna 
moniocalefacitettcficcatet,puocatvrmam 
•z ilipricat lcui ftipticitatca adminiftraf cum 
medianie acuftito vifunm qn admifccf cum 
melle a UntfbKmidirae lacte quc apparct in 
facieauferteam 

4 £rp:ouocatmcnfiruaxt conuenitycneno 
t^rt qusndo fumitur inpotu. i 
^£tapoftemaritocalidiointrir.feclquando 
btbitunecoolori renu facto fomcto ctim ca: ct 
tHlattoHimatricisqnfiteucarifma.i.fumigiu 
rii oecoctioncciuczpoml loco c^namomti 
ccfectionibosupUcato ponderccpea. 
f£cide5auc.^efaac.5o:tificatftomacbu 
x epar . ct e^pcllit fetu cfl fo:titttdt'ne.Bu(,r e ri 
rito co:dis t>icit q confowat co*. 



Capitulum.tu 




/^YBflanea.3fido.lib:o ab\moIogiarii 
i • §'£aftaiieawitureo#fructuetiii6£e 
M-^miniinmodtim fefticuUmm rotundt 
funt.qui^umetjciunturquafi caftranf.£5cc 
arbo:fimtil vr ejxua rucrir.tanq$ filua ejpuU* 
larcconfucuir. 

jE>pfratiom0 

f iMint.K.flXaftancasfligir monrcssval* 
lce:ficutroburt Qbice.VxCC smataquofa W* 
ca cvp«fft i eaftanccfed funt ficcanee. Cafta 
nea e a cerie mode crifpa a eaiam cidem frc* 
mifaefpifla.^taqj cariemvetufiattmq? fcn? 
tit rardimme.3n vereafit pcipiiit caftarica tc 
rcbinrbue et aquifoUum 
«Odern Li.stvq .Semen ipfa facre fcoarit na t 
rora :cum eecidene viuifceret tcrra qcecptumi 
'RecaUfcrpwucuiunttn glandce arqseafta? 
necquibue cft p:o ftmine fructue ipfc £a fla 
neam infauir £ oulliue cquce romanue fuo* 
mcripfo fnrculo inagro neapolitatio: 
^ 2?ccinfcrlaudaro8abeanomcnaecepffc 
•fcoflmodum bace eiufdtm libafueeo:rtlUa 
nam inferuit.i:cc eft intcr itlae fctfferentia.cy 
iUa copiofto:.becco:reUia«a mclio:;£tmpu8 
vero ftaruriicaftance acpincefacndi cft fepti 
mokalendaeS&arcu. 

C£aftanea pedamer.tieomnibpufcrtur fa 
cilitatc tracf at ue perduradi pcrnicatia rcger 
minatidne ccdua. S>alicc qticq* laio: nterit 
faale folumjiectn arettofu^.marimeq? fsbu 
]ja btimidu aut carbuncuut vd cofi etia farutl 
. quamlibetopacofcpKntriotialiqstp:cfigida 
fifu.veloia-oecUui. 

^ "Rccufateadcm^aUinarubttcamcrcfam: 
omncmcp terrefecunditafQqua fcrinucce c# 
pmu64e4 non pH)ttenir.nm marimieinec n# 
fi quiuie aceruatim fatte^erfringi (bUtm tcf 
bet fijp:a ermenfe Inouembuin ^cbuiariff. 
quo folufcfpofcctarbo:ecacJuntafcgfubnaf 
fcunrurOnteruaUa pedalia fint vndicp fuleo; 
£jc bocfcminario n-anuetunfurinaUudWpc 
daliinteruaUo pUtebicnrao.Smnt? tsopa* 
gince nuUi quidemfaalioKe/fludara fiqutf 
demtotaTadiccinfulco.pftemituMtunccjca 
cumine fup:a terramreliao aUaquocpab ra^ 
dicercnafcifur.fedtranflata nefcit bofpirari; 
patter c$ nouitarebicnnio fcrc poftea jjfrtic. 



Cflpituluttnmf. 



BtiftxbiQ 



i 




^^£h'donfe.3(ido:9ihttb:ovbi futsa. 
l§*l»£cUdonia t>icif.veleo cp aduenru vrii 
^•**»dimi crumpcrcvideaturXleico c? pul 
tovrandM fiocuUauferanrurrnarres COU13 
fllio q, bac berba mcdcri ©icantur.f •piinws 
lib:o viccfimoquinro .3 nimalia berbae t nuc 
ncruminp:imifcpcclidoniam.t5accnim vrii 
dinesoculispoUozumin nido vifum rcRiru? 
unt.vt quidatrieril volunr erutie ocuue £ ius 
gmeraduofunt.maio:fructicofa caulc folio 
paftinace errariccipfa ampUo:e.t>uo:um cW/ 
bitouun akirudincflos albicane. floe lutcus 
^ino:afoUafunrbcdcrcrorundio:aminu8 
candida.£>uccu8 crocimoulapfcmcn papa* 
ucri8.flo:enr Yrundinum aduenru.marccfcut 
t>ifccflu.flo:enribu8 illis fuccus ejqprimirur et 
in vafe creo cum addiro mcttc lenircr cincre fcr 
ucnri T>ccoqutrur, 

f •^latcarius.Cclidonia eftcaltda ctiicca in 
rcrfio grao\cuiuet>uplejE c(t modue.videlicet 
indica .quc maieue «It eflicacie. £t comunis 
qucin noftrie rcgionibue inuenitur. ctcft mi 
no:ie clficatie.ana tamcn poreft ponip:o al> 
t cra.3ndica cirfinam radiccm babcr.£ t in rc 
ceprione non berba fed radir. poni t>cbcr. quc 
pcrannostrcsmcfficatismultafcruarivalet 
£jc qualirarc fua virtutcm babct sifiolucndi 



ct attrabendietconfumcndi.f Pvafco.Cett 
donia maio: virgam babct vnine cubiri lon* 
gam ct ampUus reneraj ac renuem.0ue in gv 
ro babet foliaplura bbrracio fimtlia kd mol 
Uo:aetfubalbidio:a.fto:cmaurofump:ofert 
fuccumcroccum babcn8.virtU8ciu8 eft /9ifci 
damouieneeramaramonboniodoris.tea* 
dict>cfo:fumcftvna ©efubtuepuires 

©prratiom0 

f Iblatearius.yCeUdonia contra co!o:c5©m 
rium in frigida caufa valct radijc bcc aUquan* 
ruuimrrira.vaktetadcaputpurgandum.£t 
vuam ejc frigidis bumoubus repleram. 
f £ontra coUcam paflioncm berba trit&zin 
vino ©ecocta fupponitur. 
C £f ad cancrum orisaut ncniouim puluie 
radiciscujpulucrerofarumconficirur.-zatm 
acetot>eeoquirur. 

f 3 d fiftulam riuo pufofs cQ capirdlo conn> 
citur cr oufiftule cum meUcimmittitur. 
f fVaUenueoctauo fimpUcium farmacorum 
capituio t>e jCdidonia abfterftue foutfiime et 
caUdc virturi8.quinimo ct fuccus eius ad aujj 
mentarioncmvifu8cftvtili'8.inquibu8ccrntl 
groflum quid fm pupilla m ct d fafo:a re indtf 
genr.Ufiverorueruntquidajradice^adcoa 
qtiiobftrucriorJccparisetYCtcriaam pariunf 
\n vino albo oantcebibercSimiUter autem 
mafticata vrilis eft in tsoioribus ©cntiu.*fcar 
uum vcro celtdonium acrum cjciftcne magna 
vlccra cintTfmecuricatbaplafmariietvnguea 
lepzofiscucit . ejtpurgar vero fuccuaeiue pcr 
nares fufticienrer scrie ctf ftcns. 
f Pvafcoudc8capirulo©c ceUdonia.£>uc? 
cu8 celidonie maioiie mcUe addira inccrrami 
nc coctus fuper carbonee oculoymaatlae vc 
fcrgir.ioUa ctradijct virga in vmb:a cftare 
nccanrur.ctficutcroeuec6ponunrur.T?ad!jc 
ciu8 anifo mijcra ct vino aibo bibira vctericia 
opttulantur.ioUa cttis cu xinoct eatbaplaf> 
mata adbibita maculae fcctergunr. maftica^ 
t a t>olo:cm ©cntium pu>bibcnt. 
f jCclidonie minorievirtuseft vifcida.vutf 
ncrat cutimjfcabicm toerrabir.vnguce lcp:o* 
fo8crcUidit.fuccu8ciu8radici8 mclle addiro 
naribusinrufuscaput purgat.£adcm t>icit 
©crapioncapirulo p:op:io aucrontarc py 
tfeoridieUicapcraliavitfcav*-^ .-. ■. ., 



t> 



Capitubun«ori) 



6 m 



fTrarrams 




OSdnicT^f aftca .rcwue £cdrS arbo? 
cvttdct*crcdriafit.mi$feinia funrg* 
ua at cp fpinofa .friicrui iunipcri fit ia r* 
roirrc.2Uiacm toqabaliquibueccdrMara 
«ppdlaftructufetp^ifimtlle^fcdm^ 
q tamcdt rocabifl,oma( bo^tcffcructirfbj 
*irraf£/ocquanrccdria.£ftaitf ccdria jba* 
t>iUs<z vtiTquc e fpffla? limpida? in odou foi 
fii imaanc) cu t igtru mrinjtcr^ ping^cdic lua 
raru;p©rfuit3rclcrpinji.rcdruc.-; dtarbo* 
«uiue 0umi egumiccdru abifta arbo:ccma 
«tar piriccdria vd cedrtna.? c pu, hc)da q ara 
1»' evocatur bicraiur dt gcnue abictis 
^-^ti. a.t>cccdro.j£lh'ncitrcdrue maio* tf 
miHo:.^>inoti8t)nofunt0cncra/c3licca « 
fcnirc^Pih%utfolianiq$t>crogatubftr fpt 
nofumiO]»ccdrooYocatramofa?niro» infc 
Jta.alfera odotcpTtar/rucrufcriit mirriinma 
^nitudic^uUcJaf o:ctlirc.£tmfl»ri8 t>uo 
ffurgaiaa.unuqrftour^notofriicTuJaii 
lid frucrtfcm no toutAin co antcccdcte Intf 
«ru.occupat nouu8.fcmcd9 qtstfio fucfj qtf 
ccdrolcterocatcnbacFdina laudatifuma nt 
jjtealtbi intcr arbo:c8<jtopij: fit icdrv gi ofu 
0: quuta putat cr ftr tumpcme licct falfo 

0rjtratitmf0 

1 ff^9r.tUrWdf^uVcatuiaiKCitil|!fttftA 
cLfftcr wnuuarc cplo^ftupdlstv.uioa vric 



ct ftccflt/ah'ginc8oaito?t)cfctfiif .gta ucoma 
tacr cicarruesinuncra hmpidar.fl£uaccro 
mifla crinrufarcrmc8auriuo'-cidir.cu5 vfopi 
fucco mfyta fbnoe auriu toUMPSK mif ta in 
fo:aminc oetiii vbi oolo:co8 creparcfatit tfi 
t>iuin 0« nrintf totote^enrifi amittit xjifcac 
adcoiru venie8.f SiindcrcrccgTJijDcrisgc^ 
^tiratialtringit intmvtfihoefacercwpofite. 
^^»quinaritotucaufa6curatfaucc8.Kvn^ 
xerie t> cmtue rumoxe tolht* 
€£tpediculo6? lcndinccguncta nccatjnot 
iibuefcrpctirucumfale ct t>ulco«bibira o0 
currif.pmuftumlef oriemariritriad fanita? 
tcm fiducit.f £»t omatide vntta medcf . vutf 
iTcrapulmotueoprimcairar. _ 

^UcTmc8?afcaridcecliftcriadditaocddit. ■** 
3ferji toxAax cc r cdria t>ucoo,i odug cu pcn 
tia • oUigat ficur olcu picie.i (cabicttpcdituh 
atalul^t^dtvumcnlDvntradbibciJTuivfiim^ •* 
jm.rAqriructpic^urcOcpotuirata»n f Ar ~^ Jft* 
ciariqiuitarcvlcusfluidupuhncic^actaf.fit/ ^. ^ 
it olcu aatbotc vt te pice.f £it ar oleu romt ■■* 
iimleptometamolleecanweabfqjtohneio ; 1 

fuie.Durae atlogo tgcct ntgra t o:^a x tficl . I 

cat.^Xatbf|mu|;«arbo:ieciufdcvif«icict - 
«ffic aiitcr 1 cuveficaroc rctrigerat \ liringir* f A,* ^,- 
ivam mc4tuoul rccochta m ai botccadca rabcy ' ^Ctrwh 
»dcncitt.vttdcctmoJttto? vita vocawr % WC&/W 



D 

i 

t> 







Jb^^, 



4& 






& 



If 



Btfbnbw 



Capftulutn,ron) Cfipiro!utn.njE 



/■»v.,£refoliutnvulgo ttcjdda gcnue aptj 
■ v|»caluul intmio gradmficffi in tj. £ vaf 
V*AcoXcrefoltb vieignca cftiaccrrima 
£ic fccrbarioXercfcIinnafcitur tn locte culrj 
in mcnfc fcbroario.loaefrietdiepoft \duefe 
riturccrcrbliu .quod agrum t didcrat lcntum 
bumidum tierawarurm 

^ptrationta 

^faacOndietie particulartbjtetncflpftulo 

fcc apio;£crcfou'um potuitatum cum mctttt 

cratc vrinam etrncnftrua p:ouocat4atcru;ac 

t olotfm rcnum ct vefice plaear. 

fiJTCknt rie folutioncm tegrclTa vcntofttatc 

mfrigat. 

CSremacbt veut ofitafcm et omnium vifcc* 

rum «u1blutt:ct opila rionc apcrit 

<5 pf afXcrcfoliu cummcllc additb medcrur 

twerafielatcrietoloumbauilum qc vino 

rnitifiarevfdetur. 

^f£taqua mulfa pftuitate rcfoluit.£jcaceto 

lubrico e ct tineae £imit:vrina ct meflrua tm 

pcllitof Omncmq3tumo:emfoluir. - ; 

Cg^acer.£ft cacfolio vie acra i ignca val* 

dcSppofitu cancrie trfrii cu mcllc mcdctur^ 

£u vino bibitfi laterfefcdare t olcic. Sxpe 

rolcttrftamfincctae tcfupcr bctbam.£Km 

tnulfa biPttumptroite nejna foluir *c 




0£FcDvaf.fflp.<oulbue.i.repe.£ttr9 
fpccice fnnt t ue Una e q fcflbet ruftitn 
buibu q bonwe cft ct tcrra pingui icol 
lccniect'ficmaticuee.®liacltfpeebulbipI9 
fflo cnfiomflricue.£cecfn bulbtcflli. i vifci; 
difunr.^lini.ca.ccpe.£<pcvirfufebflfcetin£ 
<ifiu«m.cf cblonga plue elt laptica ct rotwtf 
da:ctquccclo:erufumb£bcntcXiucqaIbum 
2>icccat vtfc tdic:ce fiit c?> viridce.-: <tudc£ t 
crudcplu8tifcideq1cocte,©cra.li.aer,cap. 
!6affll.i.ccpc£afalIongccic<cptiefunraajri 
ctce <$ r orondccr plue liipt iec£ t tlle qnc ftlt 
rubci eolorie ftint acutioue cg albc? ftccc q$ 
rcccntce.? cnidc cgflfiarcfifit.vi^ftm.far.ca. 
teccpaXcpccjcquarto grcdu clt calcfactM 
fubftaria vero ciue grollaru parctu eft 



f pTaf.Sulfcicotmfitaigut lingua? faucce 

crafpcranr.ficma cjairri infi ant. 

4|f£ afbflplafmatibueadbibirilajrarionibue^ 

t olonl» iuncturaru.ctjJodflgricie majumum 

p:cftflnterTecfumXo:fo:iinfi)ca<uocant.fo 

li et mclle fl ddtto id faccre pofTunt; 

flZmotce^ropiciefculbueimpofitffpar 

gitXsnfnie mo:fibue fi bucnit .B ddito mcl* 

lcfroma(bitolo:e ccmpcfcit. 

*J £tfurfurceiflcowe nitroaddifcpurgaf. 

XiuoKeefmaculaetollit.^cdtoouiflddi« 

ro ctaccto ct mcllclcnrigineeco^o^cmedat. 

^f yConquaUarionibue auriu i vnguiij cn po 

Icnta bcncadbibcfXoaueijn cinerecalido cr. 

polenta addita i capttib? mino? pifciu nigrie 

ticatricibue rcddunt coloum. 

<H£octttcomcllitoIo^lafcrieppefcuf.€rj 

rto mulrii ccmcdendifunt.quta neruie contra 

rn funt-z liccatiuevirtutte 

f*£li.£cpe e omcfte inflatcee plr amiefiiditl 

(ollfit.ntimp:ouocat.mbllute:Sftfc^eufio 

maricefunt.£mo:roidaeimpofitej:bft)cnf4 

^Sfnccne citte foimiflu6 nflritocaput pur i, 

gflt.^o:fitocflninte occurritmclleet ruta % 

fflle addttoXumfcpoealltnatio anriu tolo 

rcmctfupcrrluoefonoecompefcitiefadvlcc 

rationceauruimp:odeft* 

^>Cauda \o frfcataalopinae emcndat /fcufc 

uieciu8comciT$tolo^capit!r<mouet.^uc 

cuedueopttmccaputpurfiat.liflribSfifna 

critecolcricSprieflegmaticievtiiee funt. 

fJt3alicnueXepecmo:ro(dieaperirappolt; 

ta.3utcu;acctoillinitainfoleaIt!06 afcftcr 

git .£t fricata ui atopttiiecinue i| altionii p 

nocatcapilloe, 

6 iu) 



'£ 







& 



Crarratus 



» 



n 







■f STivcro fetttraiieiftqufcfucaimeuiefota' 
q?miefircfiduufuf?iactt8 fcrrdtrie fubftan* 
tie"3pic flut fuecueaquofe et acrcc e caUdita* 
ae.traatafumYosaabUopinarospttgrof;? 
ficic bumouim iuuat vnctue. 
f ^bmufmodi autc coplcjcione ro m cepa m 
fiariuadtcomdta.a.jpfaca quacucpficciota 
funt c^plqrioneminuevcnrofa.£»oc idc auc. 
pvafeoudiein ea.vi.bulbue. 
f jbulbucccmdriiuisfriGiduncftbulbo vo* 
miriuo ? firoiTi.nccnon vifcofi bumo:ie eft gc 
naatiuue/Ra^ sifncile a&cftibiUe dt •: infta 
tiuue % libidmofie fupcrplafmaroe. £ o aute 
cy aimrwudinisatqjftipricitarie griecpe cft 
ablfcrfmusctfoUdaruiueerTicifetAaariuue. 
f ©ftcnfumcftemcyamflruequide fapo:in 
abl tcriiute fubftantije cft .ftipricirae f o in (o 
Iidaturie.ficcifa8 vcro cftmvtraqy. 
f £t idein U.tfctbie.£epa calefadt coutf i Aj 
riiiatinipfo grofioebuotfea icidit vifcofoe. 
f £radaacoaapauciffimut>atco:pi nutri 
mcntu.nocctcolcriae.fedbieA flcgmaricum 
bumo^ a crudu grofliun ? vifcofum collccrii 
babuerint idcoca taliacduIo:um funt. 




Capitulunnt* 



f f*\ȣmQcbX*w(xa.ZtfaionJI6dt'cc& 

• fnaacb.SpUnonfoUa baba fcolope? 
>»>^drKvmer»fcfimilia.1Hafcitttrtn locj 
fa]tofi8velpariaibU8e)clapidefab:icarie.fo^ 
Iiflauef0tmulta^;vn9radiccafccdata.t>^ 
uifa ficut poUpodium fubrue rufa aafpcraa 
u«)avirida.feftvcrolind>9ita.nncflo«i-zfi 
ncreminc.0ar.vi.6m.fflr.ca3pIcftonJ&ub 



riUumpartfum quidein.i»ntamencaKdc vfr 
turieeftbcrba. 

i>prrationf0 

f Dvafcoadce.ibjia caerflcbdijcacumacc? 

to i bibif ajacjr.mcb fplene. ficcant. 3tcm fo* 

lia ipfiue vino addiro a carbaplafma tmpoftf 

taslpknifingularcp^fidium cft. 

f 3fopt foUacuapIenonfoltjetritaculcuuTt 

mavinibibirionefplcncmpfumuv 

f ©tranguiruea fubgwrionitect yctcrfcfe 

p:odcft.fiibifa calculoe frangit. 

fpicifcffoliacufplimcmuUcolIofufpcnra 

mulia2gcnaarenonlmit.fanenocrc fufpcn* 

dcnddacft.aobferuadumncluccatIuna aut 

ccdicfufoendc^tfibomo^muUerccandifa 

tcruvtauiraUueci ©ieaf: mdc fodire vt dla 

no gcnacr ail boc oicirur ptoddTe. 

f £>alienue.£aaacb lapidcm frangit a fplc 

ncmfubriUfltvdattcnuflt. 



& 




Capitulunntft 

! /tyt>curiJSfaaiItb.9gflrc.cap.£bctirf. 

»"-|»auc.pYafcoridie^tplantanota ba* 
! ^^bcnetuicriitareiufpcacfuaatiucr^ 

litatcflowmcognofcifur.*Ham queda flowi 



BtUttbis. 



afcmqda pnrpural.et qda citrmu.£ r cj fo f o 
rcm citrwu melio: clt -z a pxioi in mcdicia . «3* 
«!jdamtH'cuntcpcberifuntflo:cefilc8violara' 
nointriefedinnocrcreddenriu.quommodo: 
e vt odo: violarii.ct verii tucunt.,£ t idcm auc. 
£ar.£iu8flo:i8fubfrantia cft fubtilis aquo 
faiiptieficca qccfl.-z fap oMiiiecanKrucv: f> 
rus cius cft quecalefacit? ©cficcat abftcrgir; 
•zfubttltat. 

i&prrationf0 

f «oeraiSnibritiar macuUe groffas q fut in 

oculis.-i acj tJecoetois ti^uoat mefi rua ? c£ 

pcllir fecundina.er fcrii motruu qn fedei in ca. 

ct qn btbifcu aq aut alia re couunip itfctuin. 

f£t.curat apollcmata mistriris quando fup 

ponif cis.^ie anriqua t>ura . tiirrusfcmis 

ciuseftficurtpfiusflos. 

f £onfmfiltulisqnt>cficcatur cr pulnemflC 

Cn et'8.1 pfcrf omni apoflemat it>uro putrcfa* 

cro.rt babcnscolo^irrinuad ota cftfouio: 

f£beri fto^s funt fimiUsviolis iii odo:e. 

quo^alqfunralbi^Uifurslauctinnocrcpo^ 

ttlTiinc redolenre6.ct co? berbaa lio nomte vo 

caf bdba gallica vcl ftoKS cipu. 

f £r aUj fur colous purpurei.c] berba a roma 

m6vbcafpfoUda,licetiiKosrae:tsrimeaute 

©uefpesfcj cirrina et albafunrfpesvtolef m 

pYafco:tde,vtapparainc9.aiola. 




Capitulunurif. 

a£ ntaurea. $5 yoft o:ides. £cnfaure« 
fm rr "^flnrioncm nofira. £ cnraurea 
mafojquam mnlrinarcamaut gcnrtf 
anam fcicunt tc.fed falfo ,qm in If a gcntiflna 
©icir cp fuccns cenraurcc efTicir ficur fncc 1 ; gg 
rianeXrgoeCT.ratircanoeftgentiana.vrmfe 
riciciJr.SimilircrlDYafcoudcefacirfcmorii 
eapirulumtjecatraurca acapimlo x>c gcmia 
na.crgo nonftmtidem.£tcir autem DYafco 
rideeXcnraureaabudatinXiciasSrcba? 
dia.folia bj fimilianuciregaU viridia:?ob? 
longa ficur caulicuU/z rotunda ? ferrarim c0 
reri9 incih ficur rres t igiri.s $ga fimilelapp* 
tio cuo^ veltriii cubito? lcga.radi|teilUm# 
taevirgasbabens.inclteeapira funr fiiro% 
miconio •: tcga cii ^oic purpuraltro er rtifo* 
•Radir eft grofla i grauis er fo:tt accrrime fuc 
culenria.cifuccusRiptic^ivffciduseriibctcc» 
loris.Xocie nafdnir pinguio:ibu8 ct fo lanis 
cuius fuccus ejtficcaf x coquif ficnt gcntianas 
£entaurea mino: quam muUilinoliam t>icuc 
fo:rirer ©cftccat abfq? alia mo:dicatione. 'Ro 
minarur eria ab alns elUborirts fiue a marar? 
vclfcbnfugia/flaforur inlocis aquofis. \pe 
riconi atcjj o:igano fimflie.virgam babene g 
longam anguk>fam.flo:cm purpurcum.folia 
minura etoblonga ficutrura,femcn fiatt trV/ 
ticu.radijc cit ci oblonga % inurilie.guftu am« 
ra.^alicnusfeprimo fimpliciu far.ca/oecettf 
taurea.*^>agna ra dii ficut in gufiu qua lira? 
tcs contrarias babet.ita vt in vtilttate opcra 
rtonie^edfmguftumaeriefimuUflipricaap 
parctcumquadam b:eui t>nUedine.Fm ope^ 
ratioes vero acredo qucdamcalidirarieoga. 
oftendir./Cenrauree parue radijc quidem omni 
fortaminoperauuaefJ,*Rami^oa'u8-zma)Li 
me frondcs qui in cis •: floKs vn liflurti.tomi; 
natur aute in ae amara qtw lira &.modica Wi9 
pticitare partt'cipan8.erp-opter banc coplejtt 
onemfomrermuUumeubocfartnaaB sbfq> 
uio*dicarione.quoniam autem omta raUa xti 
Ua funtmuUoricnetictum eft. 
fS»eraawggre.capi.Sntoa'on.ideft/Ccn; 
taurea^ucrourare pYafco*tdt8. £cnraurca 
maioubaberfolia fimtUa nuciregak longaz 
virtoia ficur folia cauliuinfummirare grada? 
rim incifa J?abet virgam fimiie vtrge aeer ofe* 
cuius longirudo el t t>uo? aur rrium b:acbio; 
rumbabcnsramulos pwrco egredienresab 
vnaradice/uperquos funtcapitclla fimilia 
eapirib? papaucrisnigri roruda redetia ad lo 
ijitudine.ct babet flowm ct»iu8 coto: e fimilw 



ji 



tfiff^O 



f*X 



*4h.J**' 



fkrr 






£taaant0 









T* 1 c 



!wlb,etf£iiin)flrt:il£C9rtflniointcrfl^««8 
ttfloeciufefrtfimilietanczbflbctpadiccgra 
ucm.cutftongitudo tft^uouib^cbiom^fct 
nafdfinTcrr^lblieitpofitieiTnontoaibotofis 
*intcrra pt'ngui3£>ino: t° eetaurcanafcif i 
aquofielocte ? eli fimitie bctbe tpericon aut 
piilcgio monrancubabet virgaj vniue palme 
duadrap:flo:cmrubeumrcrgcnteadpurpu 
reir^tcm.ct babetfoliaparua oblogfl ficutfo 
lia mtc.i fcme ficutgranu frtimeri.et babet ra 
diednpaniamincj nululeft inuamcnru.et in 
fapotfri^vmritamarirudo plue cpaliud.-z tft 
ineo fripticitaepauca.t vfrrue eiue eft que tf 
ficeatuncmo:dicariorie.^u.ca.T>ecentaurca 
% lia maio::aua mino:.funt ambe calicte i fic 
cccoplerionieinfccundogradu. 

£>pfraticw0 

f piafco:idee.£ent9urea maio: virce bab$ 
cum aliqua ejcafperationerelaicantte.vnde to 
mmventrcmpurgat 

f*Radiic autriue eft candcne fiott ignie mol 
lie fragilie cumfucco fubrufo i acro t u mag* 
naamaritudine. 

ff £)ec radic coquaflarionite vtflie cft.pleure 
ticietfctfnoictematfine ^ddf .tuffim anttcp 
copcfciMfinaticiectcmoptoiae fingulare p 
fttrinm eftnon febaenrito cu vtno .?.ij .se radi 
ce eiue^af febacntito cuaqua to:tcnito ? cau 
fis llericie fimaiter ©ata p:odeft . 
f ^cnftrui6tmEat.abbnl5m facit inmoda 
collirqfuppofita.namacredinefua pdicru fa 
cit.etfetummoMuuef:peHit.et vinii co:rumptc 
cteprabitOnbocautc cy ftiprica eftplagas 
glunnat.9dreumataiuuat. 
% Smccueomnia facereiUanoutt4na]rime 
vulrteribuecicatriccm inducir: 
^3racolefimfacif4carnib>inctfie^ tn foco 
pofit^addira rnemoiat tycarne tnfe roagula 
rc facfcuctj jnodo erikcat ?,p licio iilavendut 
«TJ £ent our ea mino: tofa er impofita viridi» 
viUiurapurgarparacoMimpKiftar. 
f Cicamcce vutneritD recenubue et veterito 
uiducit. 

f £ltsarura etebibitaeokTadjuoxepTguc* 
t>ipor<if.fciaticieanofuppofirafanguinep:o 
.fuctSctfmctleao' 
.aboaumfacits 
ncruie t olentib fomcto pftar auulium 
C£>atXeraurea magnajpuocat tneftruaj£t 
ej^emb:ionc8mo:moe.eucltee ctvtuoe 1 01$ 
r i^ rupene educ tne.Ufpricirae $o ca q funt groif 
fc partf, ct fcrrefirie frigidttat$in glutinando 
vulnera eriuuado e©6 c\ ipuunt fanguintjn 



fDanfauf^teea.^xfecicTec\ftb5iu«tcn) 
aqua .tte i\ funt fineftb:c cum vino. 
f £E>ccun«u aut virturc quec]c cmniteqnali* 
f ar tbue infiffionito ctvulficiltect tiftcis i an 
tiquirarie conferr ruflibraio cm euacuare folii 
opo:rct in bte qucd eftpt erna turam.fed * r« 
bo:arcctvigo:3requc«jGpurgarafuntadca 
©eigif vriliecftqueacerrima.qnno fola ncc 
fincera criftat fcd vcl tulcedini alicui pmifccf 
velnon ommno amarifudini.foaitudine^o 
•zviolcmiinonbabcbitpmijcta eialiqua fub 
ftantiaeuaa ta.talie enjm eft quet>ulcie.2ld 
confo:tandamautcm ct coneregandaj fiipfi 
ataecftneceffaria. 

% j£t centaurea ifiiror minorfmagrta vulncra 
consluunanwr cum catbaplafmatur ipa bcr 
ba adbucrcccnritf mamtiifttrile congturi? 
nabitia vlecracefoltdar co modo vtenrib?. ep 
iccatautcmcum confitutinatiutei ftccatiuto 
gmifcettn-virmtito.qucrijcBcmctnftuIaecu 
rare natefunt et t)uriciee antiquae motltftcac 
i mala moUgcrara vlcera fanat. 
^Serapion li.aggre^a.^npno vc ccntaurea 
maiou ct minoa.todcm t>ictt auctcUrate p f 
afco:idiect£?aticm.qiic bicticta funt: Ucec 
peraUavcrba. 



^VrwA^c»? ^wifr wecati©olo:eati9mitigat.fut 
STw^ -^-A~V O^fJ | difocau'gihe5ocuu8t>efergit:! 







3F 



A^pfl 



Btfbttbte 



CajH'tutom.g$. 

^^ErafitmeftfrUcrusXerafuse arboj* 
■ 'M»£tc(tfriictU0 qoi arabice votar ur, ccf 
Vi/% rfln v c.grcccaUrineccrafar.et>liqvd 
canrea grana regii. Scra.uVaggrc.ca.ccra* 
fic4.ccrafj.£tt>iciiccf fint grana magna Ri 
maiapwms.tfuwiuorienteetcftgranumrc 
gum.£teftawdquodeftaptidnos..£tauct. 
£af.©mitccei8t>ulcia.poricact;accfofa ftf 
cut inueniunfmalagranata crpoma.£r ipo 
ntmquecun$nedummaturarafunf.queda$ 
quidam fufftrienrcr poriea funr^ucdam aure 
acida fimaia funr moa'p.1 cd in moiis quidem 
nonmarorisaadaquaurastiominarurpott 
nca tn ccrafie vero non fcmpcr. 

iE>prrariont0 

f ©crapion.Pulcta oefccndur a ftomaebo 
ot o.t tmiamenrum quod infcrunr ftomacbo 
paucu c.rporica facirirpriu nus. 
% Bccrofa $o ©eficcar ftegmata cr fiip.fluita 
fce fiomacbiplue c| ponrica/z caufa butiu? l 
qrin eiecres fnridene.cr conferutftomacbo 
flcgmjrico etplcno fuperfluiraribus 
^Dnarborito^o gumiicois.virtusoitovi 
fcofie z i mo:darito farmactjc^prcrea in co < 
^roemcdicinaruHUjifc4riufincmo:dtcarioc* 
i io pferut afgatois pulmoi.? c in covirrus ($ 
filians.-r idco conferur lapidi qn bibunrur. 
f O vaf.ca.t>c ceraf isEcrafum vindepomuj 
verrem bumc ctat er,puocar.aridu ficcar ■: t>c 
tincr ftomacbo viridc c6rrariu.©icrii(incp) 
vrilc accipirur.2?ocquida cftimar vrina mo* 
ucreanonpauci6auroutorradif.fi mane re? 
cenria cum fuie nudei8t>cuo:ara funr ajuum 
tam copiofc ftuere vr ejc eadccaufa criam mo: 
bopedc8implicatilibercnnir.fire]cci8t>Yace^ 
rafion.quodommbus cftnotum 
f jSalieno placetnon vna inoibus ccrafcis 
pomis cffe virrote.TOn djbufda auftcrue fa 
po:« in cjbufdi calidue.? in qbnfda twlc$ ap 
parer.ctvultauftcraadl5valcre er/ vcnrrere* 
Itringanrjftomacbu^o ccfirmenr.Bcida in f / 
dtcar ftegmate abundanrito ftomacbis opttf 
ma.na magie ficcant ct grofiuudinf t>cfio:i6 
bumo:i focicumtmlcialtomacbo aducrfa p:o 
mmcianr .ciriue rn per tnrcff ina tkflucre; 
f 0umi qtf rruncue illacrimar. crafperirae 
arterias oprime lenir.ft in vino vercri^erur in 
folurionc rcfoluro fimili modo fcaru: fafitdit»5 
ftomacbi naufcanris aucrrir. 
f £r t>e facilcfedirarepalkttieercludir riimc 
ro bauftu calculos qutbue eria vcfice- cannaf 
©bfiniirorinarenepulucrimfoluit. \ 




aT^etanu«.pYaf^ai/Crctan9(rnftjD l 
bcrbe^uosramoe baberis in vnit» 
cubuilongiradinc^tnafcimrinlocia 
farofie cr maririnis cum folue albie x pinguif 
busfinuubiteandragncUtionbttecroblon^ 
gis.flo:cmbJber albumet fcmcn libanbrido 
ftmilcmagf8roomdumerodo:anl.quod©cF 
ficcarmvrtririaim;*Radicc6trc8 aurqnatnf 
o: babcr tigiti grofiimdine.odoae fuauifli^ 
mi plenum,Baiienu6 fcprimo fim.far.capirof 
lo t>e crcranoXraanum fa Ifum quodammo 
do ct cum gufiarur fimul cum b:eui qualitafe 
quocirca cftvimieeiueabftcrfiua chfimuU 
c]Lficcariua.t»tbilto:aurcmci:fmyrrafq5cm8 
rilongimdinc 

f0prrationf0 

qppboiidce.folb ctfcmcneiueetracta 
coctecumvino et bibite vrina p:ouocant^cr 4 
rine mcdicanmr oncnllnue imperanr. crudc 
cr clitrccomcdi pofiunr.-z tnfale compofire ml 
dDcannir.foIiariueingirftufattcanda funt 
< •jbaulueca.^ccrcfanoXreranu8caIid?c 
ct ficc9 in terrio gradu^nba ili que in lotie 
maririniercpcrirur.virturcmbabctvald^^i? 
urcticamcjcfiibtilifubrtanria. 



£mmw 



f £orora ©ffiun ia ftan gtriria ctruiulapidie 
z\liacam patTionebeiba ipfalnniulta quati 
tst c buliat tn aqua faifa vinocf olep : ct in ca 
fedtatpaticne vfq^advmbiUcum 
f 3um conrra f liaca m pafiione ponarur in 
«Iriucri ^ 




% 



CapitulunujEU* 

Ocuta.^era.U.9ggre.ca.fuccaravcl 
•conifaauc.fDYafXftplanta babene 
'itiptite pcauu in cj fut multi nodofi:ftf 
cunfodi fcnicuu'.? cft tnulru ms io: fcnituto .ct 
btfotiaftna folne fcrulc babetia graueodo:e 
2ftipifeer9cftco:onain q fff ouealbutcfe 
me fimiie femini anifi.mfi quia eft atbiu6.ct b j 
radiccnon multum inffcam tcrre.q cft rrigida 
valdc, bcc radit occidtt fua frigiditare.£auf 
lus capuulo 3e cicura.cft platira cuius tcmen 
frigiditate fuacftinterimene.fed virio puro et 
calido cius nocumento fubuenitur.£>aUerui8 
viq.ftm.farmacorumxa.coiTium.id eft cicuta 
quor.ia5fummecfunfrigiditatiuevirtutlom 
ncsfciunr. 

Bptxmonm 

f Sera.jLoionabuiu8plsreaccipif cutoto 
fcuiwc anreet cefuceut tertf et ctp tnif fucc9 
tl^caf iniole.ctadminiUrsf in coUirrjecj ftf 
unr ad fcdados tolowo octb^ e optimu in B 



f £t quando ftt cmpla finim cum co fcda t ca 
liditatcm^bertfipilam^foMtcam. - 
f £ t quando tcritur bec planta cuiuJue fe> 
mineautciimfolqesfir.cmplalirwmcumeai 
iupcrtcfticutoe abfctndir poUutioncm? q& 
mo?rc2m.ififiatcmplflfirumci;mca fup. m 
gflm p:obibet crectioncm. 
fjttqufldocmplsftranfcucamsmillemoltc 
rum^bibet ab ctg iac.£f quscJo ponif fug t ti 
fticuloe pucro? fitiit ccie augcri. 
f £t qn ponif fup. im millae puclla? nopmit 
ritcae magmficari.mcUo:at cr, bac ptanra eft 
illa q nafcif in crcte infula.tn cbia i in arica. 
§ ^liniueconija.idcftcicuta que cmnibue 
itota cftXuius folia vipcrae ct ferpcntee cffu 
ganr.t clt frfgida frigiditate mo:tali. 
f "JMafeariue. £icura no vtimur thterionb?. 
quta vcnenofa cfih in fubftatia % tn qua Urari 
bti6 Ontanrum ctn tifioUiif.cj fpue inaniun 
vx.i ejt boc mcmb:a monificantur . oirturej 
babet potifiimam f m radiccm.fccundo f m fo 
lia.mujo^fmlcme.andefcmeeiueqncfpo^ 
nut i mcdictnie.ctejt ca vngcntu potifitmu (it 
contra arr eticam ct podagram. 
f 3u'do:9Xicuta v:ina '* mcnfirua fiocats 
augmciitat.Ziimbacoeet afcaridce nccat . 
Sjciaticos i arteticoe tc grofio fi cgtnare iu* 
uat.fi in ci9 apofimate laucf aur porcf . £ roit 
fam inrefiino? ventofttate fc ifioliiit .£ oUcsm 
pafiionetTlq toIo:ecurar.pcct9i pulmone 
fc< vifcofo i groffo flcgmate purgar. 
<| *fbUniue 1 Iib:o.!LvXicuta vcncnum cft pub 
Uca quada atbcnicnfiu pcna inuifa. ad mulra 
tn vfus no omiftendi. Scmen babet noiiium 
Xlaulie autcllviridis.i v:it plcruq5 ftcut i pf a 
ranie.lcnie bic i gcnicularus vt calami nigri? 
cans.3 Uio:fepe binis ctibiti6.3n eacumintf 
buoramofue.babcrfolia couandri tcnuio:a 
graui odo:atu. 3nifo crafiiue.radice pcaua 
nulliu8vfu8.^cmini^ foUjsincftvis rcfn> 
gaato:ia.qficnecat:inciptutaugcri ab ertrc 
mttatito co:p.i8.*Rcmcdiu aurcft ptiue o} gue 
niat ad vttalta .natura vini et caitfact o:ia ac i 
vino potata irremediabilte ejciTtimaf . JSucf 
cu8 ejtpnmitur foltjs at cp flo:tbu8. tunc enim 
manime eft tanpcftiuue ct tnclio:. 
f ©cminc trito ejtp:cffu8 et fole t enfatue tn 
poiitlIoe:nccatfanguicmfpilTando.bec aUe^ 
ra visOdcocp fic necatomm in co:po:ito ap^ 
parenttnacnle. 

f 3d t ifiolucda medicamcta vtunf flto g aq 
i adrctrigeracu liomacbufitetco malagian. 
valctadcobibcda8cp\lo:a8efiuia8.oculoJ 
nlcp tolo:es ledados circultnifiif ^ifccf col 
Iira.8.fj£talto8ome8cobibetrcumatifmo8 



Btftttbi*. 



folia quoc$ftimo?emomnc;acfcolo:cet cpfc 
fo:amfedanr. 



a 




CaptmlmtwjEu^ 

a3co:ea.£lateartu8.£t'eo:caq etfpo 
fafoUs.tfolfequiumctmrubafctarur* 
frigida a bumidaeft in fccundo gradu 
f iConftantinus in libzo sraduum.£ico:ea fi 
uefponfafoUs frigida cftetficcaj'np:imo gra 
du. 

f ^ltnius li.iqc.3nft)bumcrratictimapud 
nos quidamet ambugtam appellaucrc.^n 
£gvptovocant cvcbo:ium; 
f 3dcm iu Ubio viccfimoptimo £Ycotiu poft 
vergilias nafcitur.flo:&cpparricule ciue. *Ra 
dic elt et'0 lenta qua vrunrur ad vtnorla. 
4B cro:.23ec berba fc5 que vulgo tncif ar vf/ 
con'um;ipfactia5 altjs nominib>p:erer fupja* 
dicta t>ia'turclYtropiu3 ett>vonifia.undct)€ 
ipfa quocg fcicerur inferfos in capirtb ,£\\txoi 
piumt>e.£ 

0ptrationf0 . 

(tf-jblarear, incaXvawea.loerba ipfa comc^ 
Ita valet p vcncnu Sfuccus eiue valet ad opi 
larione fplero'8 ct epatis ec calida caufa si con 
tra calefacttoneeiufdem.l5ec berba virtdis c 
ctmulteefFicaticficca^onulUusvel paruc, 
f £-ocfa etcomefta valcropilanoni fplcnist 
cpatie,; p calefactfoni epa tic-,Succu8 cpati 



fup.ponitur vcl catbaplafmatur* ' 

f £tquia virtutcmbabct reftringcndivene? 

num: atalia qucdaa venenofisanimaUtolcfa 

buiusberbe tacru fanantur 

f £onftan.li*vr fup:a. confo:rat ftomacbuj 

crvalcrconrrafco:pione8.aUo:uq$repriUum 

motfujcumvrrba mu;ra.et mulieri fuppofita. 

p:ouoeatmenftrua. 

f 'tMinius li.)qc.ca Ofnt ubum.^d rcfrigcrat i 

cibo fumptu.et coUecriones fanat ilhtu.£5uc 

ai8t>ecoctU8ventrcmfoU4it.*Renibu8etiio^ 

macbopjoficit. 

f 3" ^to seeoct um vrine to:menta x>i(aii 

ritOtancp mo:bum regium cum mulft (i ftnc 

feb:e fitrefecat et adiuuar.^uUeru purgartf 

onibus in aqua secocru adco pncft vt mo:t« 

os trabatparroe. 




Capiru(um.tTEUtK 

a 3nogloffa 3ft'd.in U'.erbvmologiaru$ 
Cinoglofla elt berba qua lingua canii 
vocanr.21 cinoe q*5 e canie.? gloflba 
qtfcitlingua.jjnde rinoglofla.id cft lingua 
Cante.fireli beibafimilis amogloflc:nifiq: 
funt a cofte apparct co in folr,s auc. fcd func 
leuia fatio ct cft in ets bo:ra apparcns 



fExmtm* 



!E»pfratio!tf0 

% ^cdcturvlccribueo:! ct afuevlccrih? frau* 
disldifiefriGidcetficccc6pkjiioi8.7curar atf 
c ol3.balncu tccocricie riue curat fiomoarl 

5S ^linuli.jocvXinoglofioe.camna imitans 
lingtta t opiarije ojgitodt grariflima. 

3C € Siunrqjca^treertrfoefemmiecmirtat. 
j£iu6radiccpofat3ccaquap:ockflc9dtmia 
nae.quequattuo: ad quarranae. 

p f j£ I i i & lia fimilis ct q lappae fcrat minutas 
cuiue radijcpota cjc aqua ranie? ferpcnnbus 
aduerfarur. 




Capfailum.rfuit| 

^*V3fonia. pyafco:idee.£it onia vd civ 
I Jhtomu8cftarbo:mato:ucitomoiui?u 
^ x/y 'iu8foliarirfutemb::bentmcdianaIe5 
f -ji>alladiue lib:o fccundo.^efe^anuario 
tubcrceinferunfcifomoOdemli.iqXitonqs 
fercdis plcriq? tempo:a fciuerfa siccrur ta me 
mibivfu comperrudi.3n3ralia circa vrbcj 
menfc fcbutario vcl incboarc 'zJbarao plan> 
rasciromouimradicaraeinpaitinaro folo tc 
Jiwflcadeo vdocirer vtfcpc iequeti anno ( vc 



frugi)gaudcra3dcmmcnfe5cb:nariocifo^ 

foniainfcrunturmcliueintrunco q>m coaice- 

"Rcciptuntinfeiurculoejpe omnte gcncrie. 

punici foJbf.omnulq5 malo? qucmclto:a p:o 

ducunt. Jnfcra nrur aut c noucllc ai t o:ce qut 

busfuccue in comce cfr.£5imaio: cft arca ra 

dic cmmdiue infcrct ur v t i co:tejc 1 Itgnum bc 

ncficio foliadbcrcntiebumdcir. C iSalicuua 

fceundoltb:o , oecibie.2£>ala ipfanon ftmc 

babcntia vnam naruraimquod clt.quia qdl 

cr cie funr dukia.qucdam pent ica. cr qucdaj 

fiiptica.ctquedamaccrofa.Tqiicdajiniirtda. 

£tintulciteefl fubftariria aquofa rcmp cra* 

ra .£jc pontica xincit in cis frigidutn terreiim. 

£>cd in fiipticiebec cfrcadun fubfiantia cv$ 

aquofafubltatia t>ulci.3ri acctofie aiitefuW 

flantia frigida.-tvirfuepontifom 2liiptico:ti 

ctacetofo^dtvirfuequeincarnat^ccfilu^ 

tinat vulncra .j£ t f pbibct illud qo" currir ad y/ 

poltcmara inpnctpio co?.i fomficar oe fio? 

macbfz Itomacbu lajcu ct flujcu.majcic ^o q ffc 

fiipticio:aejt:ci6accrofio:a.©cdilludqtivm 

cit fuper nar uram infipido? cfi squa.£t f om 

pleuo co:umeftbumidio: et frigidfo:.,£ r ipa 

admiitrarur in mcdianieapoltcmaru inpw/ 

cipiocof^inaugmcnro.trniucrfalircrinma 

Jiecbumidiraemulra.? fucjflnirarce fiigtda. 

i idco ©cikuinirwccueco^et arcfaf.focnia 

t ur tamcn quando coquunmreum mdte.t fit 

tnderobXrfcruantureodcmmodo cironia - 

ipfa aim mclle ficut cr fucci coritXitoma ma> 

to:a vocanrur faruminia.? funt maioris uiia 

menri cp alia. •Remcmcttie crgo illo? quecftf 

qjpoma llipacantfaaenigidum-zterrdiran 

cbfmubabere.quecuqjautej acctofa vident:. 

nigidumquidon.IcdwbtmTieparrim.mcdic 

^ocompleLtonieciTe que tulda adcalidius 

t>eclinarevic^ir,uatrqucperfccfcapoYa4'cf 

dlnne quaiif a re? valde aquofa ad f> igtciiid 

mdinara .Orarie ergo ipfie f m p^domtnan? 

tium bumoa virtur ee m ufia is aut pomie 6\ 9 

danquandop^pterbumidifarcmmulramst 

f otiuo .id dt finc vigo:e vcntcr ejcrifatf :pomis> 

w aurcm quando fuftiaentcrcjccrcuair tm 

iufir.odi.Bccrofis^oqn cfiimaucrie inipfo 

groffunibumo:eeollectucflcnonvaldealicidf 

frigidum tancp frigtdiue quidcmno acetofis 

fed nimcie indtsa.©iccant aute ambo grof 

firicm bunio?accrofa etdrtmca. tMficruntat 

bec inboc cr bcc quidcm cu infrtgtdflridcaUa 

vero cii calidirarc opa^nf .palam aurcnujc ii 

^icrisfcpco/liiptica cpidc fn^faioe fcaflus 

rcfiringnnt.accfofa bim: oum qnidc grcfiunt 

inucntenria invcnrretiuiduntfcunc.lubciUi> 

iUfqjfkrcue.i^ter ^bocfcumecfit eccliiccg, 



WWfoto 



ptirvm mcm inucmcntta vaurcm rcfhin gi?c 
ipfummagis 

©pctationre. 

21 f3tu'cennaub.rUap.tecironne.0uando 
flbltiiuir cinis -<: folio? eiue funt (icut tut bia* «z 
rob pomo? eiue arefcir,fl>rer illud qd eft i ipo 
fccbuimdirarcaquearrigida.saflanicftmdi 
uexmflgtspfcrens/zeine quidcm aflatioftt 
quandocrjcB.cauaf % eqciunf grana eiue,? po 
nirur in ipo mel s hnif luto eiue coup?.? poftea 
ponif in cinere.frigida eft in pumo 2 in ftne.et 
ftcea tnpuncipio fecudi.£teft fhprial ccfc:ta 
tim fouirer/t fi oe aas cft ftipndo: .£t fimiltf 
tcr oletl ipfiue 1 t>ulcc.eft minue ftipticu .et W/ 
mcn riueeft leniriuu fine fiipticit are, 

g <tf £r j3bibet curfum fuEftuitatu ad vifccra. et 

*^ retinetwdo^olcueiuspfertfcifluriefrifio^ 
rie et fo:mice.et eft vtilevlccTibpfcabiorie.^t 
multitudo etfgenerar t>olo:eneruo:g.? sfiata 
ponif fuj> apoftemata ocutieatida. 

£ fj£teiu8fuccu6pfertWlatioianbcIir5etaft 
mati.t ^bibet fputu fanguims/z feme eiue co" 
fmafperitatiguttur*.? lenit cannapulmcie* 
etmufnl«0oci?etiabumectattpamcanHa. 

T} ^£tpfertvomirui-zeb:ierari,tfedatfitim.et 
pfo:rat ftomacbii rccipienre fugfiuitatee. 

£ € S> trup9 que 2 ipfi? (nfufio. 7 qtf pe eo eltf 
icarum eft er. ipo vruntur mulri in fecuda meitf 
fa fupcrvinum.^bibetcbnetatcm. 

f <(* J?t nt cjceo fvrupue confo:tans ajpetiru x>c 
iectuvalde 1 mo:tuu.t confouat ftomaebu. 

£ f £r pwbibetvomirum fiegmaticum.? eftp 
uocatiuum % iam tictum cft o/ illud cft per ac 
cidene.£r tllud quod cum mclle clijcatum eft 
eft majcime proupcatiuum. 

t> f acrijtameu quadofoluit vemre % no ftrin* 
git % gencrar colica % voloic ventrie pungirtf 
uiinu cofert cnturrie.-z retinet ftujcu meftruo* 
rum.eccofertarfure vrirte qn fciftillaf fuccus 
eiue aut oleum ipfiue in virga.ct cofcrt elcum 
eiusrenibueetvefice. 

<ff£r: qoando mmimr poft dbum foiutt adco 
<? quando plui 'imS e*r eo fiimirur ejtt ra bir cp 
bum antecigeftione.ct crifterifaturt>ecocrio 
cius ad eminentiam ani-z manicie. 
f ttsbbt '^soYfee. Drpnia a p:egnannbu.e 
comclta gcncrant filioe bilares . er comcftio 
ipl b:um afio:um poft cibu gcnerar gaudiu. 
fl©erapionltb:o aggregaro^caputo £afa 
aucroutate p Yafco2idi6: Brbe: citpmozum 
ct malo^ folia fimiliter z f oe-z fumiraree fttnt 
ftiprice.ctp:opue arbo:ieotomouim.et fru^ 
ctueunmjturuecftftipticue, 
m f *^>aU m illa q colligunf inycregcnerant 



fokramcitrina.tfncTucwntfnrirmaffpnetro 

centneruietiuncturifiimcmbjieqtieuinttie 

gct7erenerue:u, 

«[[£?; eitpnia funtbpna.tfi aftaTif funtmdi 

01& bmtto fluitu antiquu. 1 vlcera intefiinoul 

-2 fputu fanguinie.tcoltirtca pafitone. 

f jttula qsicunfmcllcmclla molliur renrrc 

erejcpcllurlumbucoe.ctftjnt mata ftcmacbo 

ctinfiatiuaipfiue. 

^S? ttla q nominanf inlatuto arnicata fut 

bona ftomacbo:'z ftringunt ventre.tjpuocat 

vrina.nifi quia funt tcbilio:! virtutis ep citot 

nia.i ifta funtitla q vocanf at\roripa /£t. fimi 

lia ejc riefunt ftmilia mahe in vcre nafccnnb? 

inftipriciratc. 

f £t opo:tet.o;admtniftrenf ctronia in cgritu 

diniboin qutDueopouetiiipticarcantcc^ ad 

ntaturariPncm pcrucmant. 



B 




y^5ptcfltie3fi'de:ue. £faefiusgrec* 
V' ~h T>icitur cp q> caput ciue a rprunditare 
^AAiUcacutnencrigilf.vnde ctconon vof? 
caf .id cft alr*rorundirae.l:inc et fructue ti9 
c onoe ©iriturrq: ronlditae efue con u imitaf. 
tt:uiue lignu cedro pcne p:orima babet virtu 
rcm.^cmplouiquoc^trabibneaptum impe 
b 9 



Ktm&tm 



wmhfii fblidifate tnwci oticri cdtit.&ntiQ 
vatnoecipzifiipzopcrogum conftituerc fole? 
tjanr.vr odo:isruitof udif arccadaucru odo# 
rcm t>« vrercnrur oppjitncrcr.25cc «rfeoz apo" 
paganoe mozruie cenfecrara tlrxotj" iivmo* 
ckim bcminie euifa non pullula r 
f BmbzofiueJC-ipzcfiue-z pinuein alra feca 
cumina ctnikrunr.mancfcrpzcrcgarif}a cipf» 
fe.vrnnllieaevcnri bczroze fate tifpolicnt 
cozonie.2?cfaibozlacunarib?cftvrilie.rcin 
rcendandifcfcfaftigqe.tindcin eanrfcie *>icit 
rtil. Xacunaria nofira eipzcilina ,f -^alladi 
<ue libzo tuodeciiiu).£$zefiue ad fab:iee ma 
teria eftcgregia.f ^h'Bi.li..tpp 3n cboo mfu 
Umki crcdunf cipzclh .fiozcm imbztb tccutf 
fum rcrrc aliru awmanre. 
f lMareariue,£ipzclueeftcaHda in pzimo 
^radu.ficcain feeundo. £uiue4rbo:ie foka 
lignuj? poma copctuntyfoiincdicuic.Scd 
poma fiiprica funr et confoIid*riua.Zigni;m 
i iolia fciuretica funr.f £alicnuefcprio fim. 
f Ar.c<u>e cipuffo fm rranfkitioncmgrecam 
£ ipzeffi gcrmina % fofei % b a ccc que iuucnee 
molleemagtiozuvutocriJin cozpoztfoiMirJ 
funt congkmnat iue ejc qijibue manifcfi um cft 
cpn ficcariucfunt viitutie.nonbaberce appa 
renrgacrcdinetcatidirareficcuttsitfiuetelta 
rur.Spparet cin in ea mod tca quickj «rrcdo. 
plunma autcamarirudci mulroplurima eft 
fonricirae q m tota platauanta r ero cft acrc? 
<Joct<alidita&quanta $ucitquidcm ronrici 
tare ad pzofunda.f S*ra.u .aggregarozl ca* 
^afia^uctozitarcj6alicni.Ctuodci:cvp^) 
(o adminifirat funtfblia ejtt rercitareect tna 
cee c t ue.er in fa poze eiue eft a cuirae et punc^ 
rio paraa? amaruudofati£.erpuncrio eft fo: 
tiozam^rirudine.fcd&eamarfrudineetacui* 
tareinelt quasrirae ranra-q? facir ea pentrraP 
« ad pzotundu cozgie ftnc cakfacnbne % jno x 
«iicaticnc£fvirfU6*ftqueT>cficcatin qua fl 
sfi acuitae ■Muozdicario apparcntcr. et quari 
ta&qae elt u<fiicicne ad pcner randu.£teft ca 
lide ttlicce compkjLionie. 
f 'jMiniue ca.cc cipzcfto.&rboz omnibue no 
ja.quea crccienomcnfumpfir.eo q> babct tn 
lummitanto rotunda icmiriumcapira que 5* 
ouuur.£aUecv.pzifle 

BvmtwmQ 

fPvafcozidcec3pitlbfcecvtM;o.£ftarBbj 
ommfo nota cozu.111 icmcn cr iolta am tulco 
rc bibita urni mvrrba ii.cdu* vefic* rcunaui 
tnumcompclflri 



f piiftirrif irccVftit.hnVc (Imc vfrWc.vdpl 3& 
ra ciuebibira cmoproicie mcdcnrur. Min* 
terkie ct ciliacic mat ime p:odcft JiifTi et c:ro* 
noicie p floIatur.£iue ciijcr ura tantu pzodcft 
quantum fuplc fcmen ciue quod ih acoo co* 
crumidfacerenouir. 

f £rm puluere lupini admirtt! m cntcrocelli £ 
cae ficcar vt caibaplafma 9 p: ofitu folia ciue 
fimiknvbabent virtufcm. 
W ^mue eiue cutn fcmtnc in t crr pofttue r> 
tonopce vel jinjalae fugat.2>cc folia vt ca^ 
tbaplafma adbibita rccetiaviilnei-a curar. 
f 3nacefo cocta €t mfttla capOloe dificiunf. & 
•Jbolenterrita ctadmi)ctaigmm iaetwncepe 
fcunf.vuincribuemcdcnir. 
f^aibunculieorifulanfur.fumozcstifuto? f 
rumccpzimunr.jLcroneKebtlibue mifccn& 
£t conrbzranr Rcmacbtl.-z fanguineftringut 
f 3 uicenna libzo fceundo capirulo cecipzeft & 
fo.£alideeompIct.ionie cft in pzimogradt^ 
fiae m fccundo.jEtquidamticuntCf cftfri? 
giduevakJcet quKia iudicaucrunt cr cli vir^ 
«eeiueccJpouta.-zcalidiraeci^cftfmquan; 
ffratcm quc facirpenerrarc fiipticitarcit^rict 
tae pzofundatur ctperucnitad mcmbza.5o^ 
lia 1 nutcuiefunt ftiptica.ct in ipfa cft rriolu; 
rio ctrefoluirbumiditatce. 
f JEtnurquidemriuo fozribzeft ibttmtrc S » 
folia ipfiue.£ t mipfa cfi vie faciendiacberc* 
rcfflnguinemata cr rcmoucrputrcdine quan 
do tecoquirur cii aceto 1 liipinie.? linitur fu^ 
per vngucmKt rcmouct ciue veftigia. 

fj£tciuefoliatcIentmozfcam.foliaciuerQ? 
ccntiacr nu]t ipfiue confolidar vulncra qae 
funr in mcmbzisaurie cu fecrint rccentcr tob 
lccta. 

f^tconfcruntrbmnVcat^rifiptle.^pzopzie 
cum farina^KJei.^Ruic-zfoliaciuebonafunt 
<ollo.cum qceieftt emplaftrum eonfcrnnt.ct 
tum fanna ozckifut«rpofita4?crifipilc. 
f ^tconfoztatneruoe.tcttinguit ramiccm 
^nozc cmplaflri fupcrpoura^t robozantniol^ 
lificanbncm. 
f ^rfiringuntctfa quando'fcrinirnu|ctn?«l 3^ 
fi multum cumftctibue. £ t ponitur fcecie lict 
nitiminnarcm.etfanarcarncwadditatB. 
f fcr tecoctio ciuecuaccro fcdattsotezeTtcn 19 
•tiu.£tt>af ad bibcdu nujc eiuecu vuio ad n)n^ 
^tum fanguinie.ctad?sifiiciilrarcm arjjeluue: 
etaditilhrnanriqua.tfimikrerciuetsccocrio 
f fcrbibuni folia aScu vinonplcrut titiuul & 
tatitningcdu curfu fiifjfluitatu ad vcfic^ nn 
fttconfcrureriamvkeitbuequcfunrinitMJ' -^ 
tcfiime.Xoco eiue ponitur rccdiriaecpfld* 
rieciue^efarcptpUarubc^ 



®t$)ttbi& 




CapimIura.f3fjE 

O3paieDY3rXYt>:9cftarbo:babcn0 
folia oliuc fimt lia:fed Y>iridio:a i pan> 
logroulo:a.Sjcmemg¥rzfio:ealbn5 
cu germine ct odo:c bono.filofa fuper eariea 
/apwoeft arbo: aromatica in egiptotfcmie 
anclido ct odorifero.qui cdqutf in olco i qip'/ 
inifvngucturcsalecldi5:apcrue.f •JMi.inli. 
»:u.£ip:u0rft arbo.:incgipto 3i3ififolr)efcmi 
nceo:iaridricandido etodo:ato; 

0pfratiom0 

f t>?af. i?uius folia mafticata tumotfdaa 
cdpefcunt.q:virnifiecoberenriefunt.fedce* 
tera dufdearbouecatbapbfmata bumotte 
1 tumo:ce calidos toluint.&arii ctia clicatui 
ra fomcnt o cdbuRis mcdctur 
fj£adcc]5fuccoftmrtjmijtaficaputafll'due 
fom&cscapiUoeinficiet.floe ci9cu aceto ca* 
tbaplafmaribadbibir9t»olo^capit*foluif. 
^f *f>lint'ue li.vf sJbec iu olco eo qtiif ct poft* 
ca p:etcrt't id qd cYperue tacffpptimum e in 
canopica uiripi8nYlinata.ii7Ci5m afcalone 
CudecXcrrium cfltto infula :odo:ie fuauitarc 
&uidam banc t>ieunt cfJe arbo:em q in jfra* 
lia uguftrumyocerar.j£tia alcanna appclllt 



vt fupja^eca capitulo ttedccjmo. Stlcanaj 
4^tcm *£linrae.in Iwritj.f c c*ip:o fitolcum: 
cuiuenatura calcfacit neruoe % emo(tir.5olia 
ftomacboflliniunf.tvulueconciratefiiccus 
tom apponif.iblia quoqj cdmartdueata rc* 
cenha medenrarvlrcribtiein capire manantt 
bti8 et o:ie collecriembue 
f pecocrit earu ambuirie etiurattpdcft/Rti 
fantcapillumtufaadiecto ftrucq niali fucco. 
5be capifjjs s»oIo:c8 fcdat cit aceto iltiruo. 
^fXJkera putrefcenria p. fercl cu3 mcllc fatwt 
£>do: aift flo:is olcnq fomimfacit 



t> 




Capitulunuj^ 

a3peru0.tD Yaf.ca.?>e £ipero .Cipei^ 
ftucTtal^ctiTccperon.folia bsbcr liV 
mUiapo:ro.fcdoblongattet:era.taf 
ccnditt>ercrra cubiro vno et fcrni8,bafla3 ba 
beno angulofam fimilcm fottco. que bafta in 
capit e femen gcncrar/Radfcce fub ferra ba "> 
berrorddaetobldgaelicuroliua ntgra qvrX 
tet?iunctenafcunf.coIo:enigro i edo:efua 
ni.guftufubamaro/Rafciturin!oc^aquofio 
cx tn p:ctt8ct tn paludil».3n bis radtV ito ca 
nobilto: cft que grattio: etturio: 7 grofi tc: fti 
eruvr no frangib t lt'o:JTed afpcrio:/: oco:c plt' 
nio:vicifii'tudineodo:iebabcne.taliafigna 
b ii) 



Craftfltus 



25 



&ftct£flenueant 0vriatica.airee babct 
^alefaficndict^diccandiabfqjmo^icatioiic 
^crapionli.ag.ca.foabade.awio:itare 

Pv a ^® a ba df ' ,£,c ^ ci P eru€j ' abrtfi: ' ll ' a '^ 
miuafolqepo:rt^niltquiafuntlongio:a ciez 

fitbrflio:a et T>urio:3.ct babcr ftipite longiru* 

dinc vnuis b:acbti et plue.fcd non rectum. i» 

^o cft romtofirae.er ett quadrane fimuie fti; 

plirifqtuBanri.-zuifrafumiraresfitntfoliap^ 

ua.^fancnaradijccwscftfimlisoliuc.-rque 

<lam craeeft tonga rr qucdam rotuuda/z cft 

«igra. flafriturin loast^mclticis z aquofis 

£r eli alia Tpecies apri in 3ndia quc cli fimtf 

lis5itccaro infapo:cfuo,ctquando nafcirur 

ctuscolo:eftfiaircolo: croceus.«quado fii 

carur fuper cutcm a»:po:is facir pilos ftatim 

<fldere:i£>euo:auti«ne]c cvpero eftilUquie 

pUutts granis etgroflua fcurus, tiflfciU fran 

0bttis4?.ibcit6 odoum b o num tii pauco acu 

minej£r quodadmuriftrafoc cvpero c radfc 

tpfiue.cr odo: cius elt bonus,ct in fapo:e citts 

cftaaiirascumpauca Itipriutarcct cakfacit 

a vtiiccit finc mo:dicatione 

©ptrarionra 

f l^rafcoridee mctetitxe 3bcnme1uaf . eft 

ciili da cr ficca in fcctmdo facit augmenrum m 

fenfu.etconfowatftomacbum. 

f £ r mclio:ac coIo:em.': cft bonus cmo:oidi 

bue.cr cftirir o:ie odo:em bonnm, 

f Etquandobtbirurcumoleo Unftfici caltf 

facitrejtce, 

fStcofeKtngidirariveucetotftiiUrionivn* 

ne et addir in languinem calefariendo ipm.q* 

re rimentr nc vrens fi ar Up:ofus 

f j6auaiu8.vr).fim.far.ca.sc cipcro. £ipcri 

vrilco majamc ftmr radiccs caUfa cicnrce et(k 

cantcefinemo:dicarione. 

«fiande vUera quep:oprer bumiditat cm mul 

tam funr*otmcilecicarrif3bilia mirabilireriu* 

uar.babcr aurcm quid et liipricum 

4T £t,fl?rerea vlccribtts quc in ou: funt idone? 

uejac vcro et inriliua mquandam ^rure" bab$ 

•arrcndcndii cm cft:quia Upidepatientibus 

ccuentt.et mcnftrua ct vrina8 raoucr. 

f 3rc P\af.ca^ccipcro.uire6babcr caUfa 

ciendi erteficcandiabfcp mcttdicarionctm 

mulritinfulavlceraq-wfticilecicatrifanfmira 

bilircrcurar. taabct criam ali^d ftipriciiin fe 

crdttiiircrica.£rb5ccfumedivimperquam 

lapidre inrcnito gateraroe cominuir. 

<(1 Orina cr mcnfirua ,puoca r.addif er malagi 

»^tl»calidisacof€cn^m'tooko«Hn.!Dktf 



crfamtn^nclfac-tpmimR^dftimTc jucttw 
cr cumaUic afcolo:e troccum facit 
f£tb^cficapaUetraiectumcritcadutaco^ fc 
pie muttim pcanrtonito mederur , £octu fcfli 
onitofacit.Bui^€vuH» ©icit q coiom (»t 




€apituIum.t]EjEt)f 

>^3namomif.^limJi.iri'.£inariiorliii) 
1 - Jhfrutejreft t>uo:u alritudine eubiromm 
^^^ampltmmusrpalmictj minim9 qrruo: 
fcigironl craiTirudinie ftatim a terra fcjt ©igitj 
furculofus arido fimilie cum viret no odo:a? 
tusozgam filio .ficcitare gaudce* 3mb:e ftc^ 
rilt02.fat t irc narure.i^ignitur quidcm in pla 
nie.fcd ocnfilTimie in vepubue.rubifcp "ouftf 
ctlteVoltecrii ."Hon merirurmift tcuepcrmife 
rir.^ccanre,lbli8o:ru3velpoftoccafiimme 
rerelica.Scimcnra quondam faccrdos ba* 
ftatiuidibar.t»eocp3ouipatrcmrcponcbatj 
iRcliqua vero partcm mcrcato:inmaiTas co^ 
dir.£itcraltatamacum fole tiutdi rrinafqj 
parree fieri.trinde fowegcrmia titcemiQdf 
jq ibli ccdci irrclinquuacfporccoflagrflre. 
f£lcli.tcna.rcXinamomiaito:aridefiri8 
ccu vircr t f o:cr ficcirare gauda.^raq; ftcr<r 
imb;efu.fectindio:aiJtint'aifit1imievcp:ib> 



&t®txbm 



tt ac pjoucnif.&tnYcimaXinartiomum aW 
dum er ficcuin i\\ temo gradu .'^cliufcp cft tl 
ludquodeliboniodorieraam fororie fine 
mo:dcarione:colo:iepurinoneon>miiri . £t 
vt&&Yflf.!gbelni8<ft nigrtmtad igncita* 
f cm i rjibedincm t>cclinane.*fi lanum nmoe 
babenep:opinqisoeftibrilce.in quo fimmtl 
cedo ? fakedor: mo:dieatib paruamecfval? 
defrangibileXjrciuequidem bonirare citn 
vincatomnemtolo:unp:ctcrfuuin , z ndfcn 
tiatarcumcoXltautcmvlrimu tn fubriha* 
tioncactracriiium:apcritmummrifideontf 
riem putrcfactioncm crvirturem eotrupram. 
lp leum ciue calidum eft i valde refolutiuum 
Uqucfamuum.^tarcariueXinamcmuinca 
Kduraeftintercio:ficcumtnfecundo.£ligen^ 
dum eft illud.quod fubrile cftacufum . babcs 
odo:emt>ulcedirami]itum cummult a aroma 
ncitarcsfub:umm.0uodaurem fubalbidirj 
sft aut nigrum abtj cicdum: per ©cecm annoe 
poteftfmiari«PYaf.fmtranflattonc5 noftra 
copttulo t»e ctnamomo . £inamomi gencra 
rcutta iunt.fed melio:eftomnibue que cft W, 
tnitie caflie maifotttce:qui recee fucrit t niger 
colo:e.tquimi0usinTino foluatfc.virgtae 
babene tcncrae i Umee i nodie plenae i cum 
edoK pleno vctuti rure aeer arcp mo:dajc gitf 
ftuinfimturttdirtenafturctj femmiecumqua* 
damfalfedme'<feruo:e'Z paroa vifcirudine.eu 
iue bafle cum frcgmecmutilt pulucrcs odo? 
reomnia vincctceJjaefcaJUeciia tcrractiul 
fert6:radtce6earimdcfcquunf.t?cccftp:oba 
riobptimicmamomiXftctiamalfcnlgcnus 
cinamomimonfanutactu afpcriue bocgroO 
fiuecft et fubttifum colo:e.z;crtium gcnue eft 
fimite cafiie mafclKotice fub nigcllum colo:c 
tactulene i nonmultoe babcne.Ouarum ge 
mi8cftcel<»catbo:tacru molle:fimile caflie. 
forobote groffum et fragile et radictbue ma* 
ius.Ouf nrumgenne el t odo:e fimite coffie co 
loie fubeufum ct co:io csfhc funile. baftam in 
fc babene fo:tio:cm cumradicibue grofliori? 
b ue fimilibue libanoridort multae baftae re 
tinee ftmttee mirtetcsffie:fcdnon tifuodo* 
replcnum.,£ugcndum cft autemcinamomit 
p:imigenaie eolotf fubitigrum fcabiofum.et 
femenbabenefimrte piperi i lenc tigntncuuie 
r«dij.inutiii6eft.©cjttumgcnuecltcmamo^ 
mi.quod ajpcUaf lot oe ct motostfcd ncc vir r > 
tutan ncc odorem babet.S»eprimum gcnue 
cftquodagrecienominatur jtilocinamomu . 
& elt Ugnum cinamomi.radiccm bibene ma* 
Kwematfbfliue nodofie fimililibue cinamo:? 
mo m in odotcnonluaucbpc tiainr * uq me 
fetiecfiecmamoitiOo 



J^pfrarionfs 



f Scraauc.j5af.£mbflanf ia cmamomt cft SL 

ft5bfilie.avirrueciusefrcatida intcrno ? no 

cfraliqua mcdicuw cahdaeuiue Scficcario c 

licut scficcario <iue#>f cr fubfiantia fue fub* 

ltanrie.£>cdilla fpcequesiaf fccifcclkina 

momu quafi t>cb ilcX t funt quidam c\ nomt 

nantincinamomumjo:. 

f £tt>i«t£>arinli.t>e cibie:cp cinamcmum ^ t 

aromati^at ftomacbu.x confcrtfrigidiratt i& 

crfrigiditaiicpafie. 

f£tfacitcucnircfommi.etapcritoptIatioe8 £ t 

etp:ouocatmenfiruaurtabftergit obfcurira? \ 

tcmvifue, 

^f £toeficrat43umo:cec\ funt incapiteetin ^ 

fiomatbo J£ t cqpaefttc rdiscius ctt cp vf9 

comef iionio cft ccfcrco obfcuritafl vifue que 

acdditgbbtimonbue 

ty~tidcm auc.?DYafXinamomu fngrcditur % 

ccifecrioncmcdicinarij cdorifcran; bonarum 

«t cfi majtiim' lunamcnti. ct teiit ct coficir ctim 

vinobono.erfiuuiinde troeifct. c| ■odiecanf 

et rcponunf t n vmb:a et fic virf ue ciue ciutt9 

feruartporcft 

€ Pvaf.oirtueomictnaitromo eftcatidact % 

tiureticaetmalacticaetlcptintica. 

^Etpotatucuaquafccundinaemutic^citcbi t* 

dir .er menftma p:ouocar.^cliue bie rcbus 

opitulaffimirrcfueritmtjLtu.m. . 

f Oencnatie motfito occurrit vcl veneno po ® 

tato:caligineeoculo?©efergif.cujnmcllem 

tfi maculae vellcntigincesDetaciepurgat . 

f Zltifim (edat,catarrum mitigar .ydropicis J 

medetur; 

fFiefrcride vtilifcr t>af.^5ifcefetiacofecrio «^ 

nib occullarrjs er inonlibp vtilio:ce tucnitur 

virce babenes guftum acrcm ejttenfa firtngit 

j£ t in antidorie p«cifum cft. 

f0atv^.fim.far.ca.t>ecinamomo < £inamo ^ 

mu fumme clt fubf ilium partiummon tamen *~ 

fummc calida Xcdin tertio gradu.jt>eftcc*fio 

ouec4tficutcatcfacrioipfiue|pfcrfubtilirate 

fubftantie fue.S>ed canctla cmamomu clicjft 

cmamomu t>cbilc.j£t qtudajetia calrion vo^ 

cantcinamon.uXtquida funtqui iwminat 

cimmomum ajet. 

fauicen.li.tj^a.t>ccinamomoXinamomu «^v 

vtrimu cltinfubrilitafc.attractiuil.aperitiuu5 *" 

rectificaneomncputrcf actienc: etomncm $>f 

turcm co:ruptam« omncm fanioftrat embu^ 

mo:alcm 

f j£t ideminliteo CevinbU8Co:die sat^co ^a 

iomtcou 

b m 



Crattatua 




CapttuhmnfjEjEU}* 



Gjmiinum quoddamcftquod tiricur 
ciminum catmcni;m.quo ddam quod 
tieicur ciminum rcgaloquoddam qtf 
ticituraminttm album.quoddam ciminii ro 
fiico?.quodda ciminum ctbiopium.quodda$ 
ciminii bafihrum.quodda ciminu £ giptium. 
qnoddam ciminum tulccquoddam eiminuj 
agreftoquoddamquodticimrciminilplato 
mcumXiminum carmcnum id cft fifelcoe. 
jCiminum atbum id cm quod fupza. jCiminu 
£nlce idcm quod fup:a Ximinum rufiicomm 
idcnv quod fup:a fimilitcrXiminum ctbiopi* 
timcliquoddam fcme fimilcsmcoectcftgif: 
itcut apparer infra in capitulo JSinteg.jC imi 
numbafilicon idcm qt> fupwXiminu cgipti 
«m cii cimiml vfnslcXiminu agrcfte eft illud 
cfi per pf afcoridcjmulra in capitulo ifro te 
fct ibitur.fSlatociminu.id eftfifclcoeXiminii 
vfoale eftftmcn bcrbciti multa quantitate na 
fcoie pcifc vc pfenefigura if U9 capituli often* 
dit.virtutem bsbctwurctica.t fubtiliandi fu# 
mofitatee.£ftealidactficcain tcrrio gradu. 
£ t qutdain ticunr o/ clt ficca in fccundo.Sa 
licnus vti.fim.fai ma. cap.tc £imino. JCimt? 
nifcmincmiVjLimcvtitur ficutanificc leuifiki 



et carui ec pcti oftlmi. JE ft afft catefacttuc vtr* 
tutl ftcut tUoyu finguhi et tiurctirc: et t cftntf 
criuevccofiracl.te tcrtio gdu 'euftce calefatie 
rium.pYafco»cap\tejCimirto.fmtranflario* 
nemnoftr'4m.£iminum quoddam cftvfua* 
lcquodaam £g?prium.et quoddam oritur 
in al$6 partibu8.ct iftud^ft ciminum nofiruj 
quodcommunitcrbabemucinvfumcteufio 
miiticum cft.Sed plue illo quod orif in j£ gy 
pto quod ypobafflicumvocac. tindecale eif 
minumvfualcin omnibue p:ouincn8 inucni 
turioed ciminum agrefle nafcitur in £ alce* 
donia etrtoYfpania.virgam bsbet t uate pal 
mis longam.f n qua foha nafcuntur quatntf 
oi auc quinq?.ct tenuiftima ct t iuifa ftcut ginl 
gidium.inquavirgafurocapirellaqufoc£aut 
fccrotundaecmollia.in quibueeft fcjnchq* 
figulhiiapphcauerievifcidiotdtnofiro.lHa 
fcimr locie btimectie:£iminum noftrum vfit 
alc b abet virtutem fcranticam et ferucntcm z 
micntalcm etftipticam.£»erapion libzo ag> 
grcgaro:ieca.camin.auao.!DYafco.;Camin 
id eft ciminum nolirum quod vocatur £g\p 
rium.£lt t ahitd £iminum quod ticitur car 
menuj.£r eft a liudqo ticif agrefic.£t dt qtf 
dam cr eo boni fapo:ie.cft p:op:iecarmcnum 
ct ipiue crpofitio eft regalc.£ t poft ipm efl ba 
bilonieij.£tidem aucto.j5alicni.cj:eo cftto* 
mefticu et agrefte.pomef iieit vero eft qt maf 
gfeadminilirafermaiimefcmcnfieutadmtf 
niftratur femen anifi cr icuifiici ct caruicta prj 
matani.vittueciuecftcalidaintertio gradu 

^pfrarionts 

f pYafcorideeXiminunoftru rottionibus 

i (nflaticibue in olco coctu ? futjpofttu medrf 

catbaplafmafitemifcef.o:fonioaecujpufca 

ncceiTarie tacur morittovcncnatie cii vino 

opimlacur. 

f x;umo:em ceftium admijtta pollina fabct 

vuc paflc ct ccrotie impofitujmcdicacur. aee 

romijLCummcnnruaabltinersccfaneuincna^ 

riii.pimeitrcficftriHgic.poruitatujfiueinun^ 

cnimpaUozcmfacit. 

f j£ r quia caliditTimu cft t o lo:cm vcfice pla^ 

cac:cccalculoeiuuac. 

4 £>emcn cimim'agrcfiteco:ftoncecc infiaiJ 

rionee aquc murii falubcrrime curar. £ tl acc 

ro f o fubgtti t ict ito opuulaf .acnaiie occur^ 

rir.volo:cmfiomacbicompcfcic. 

f ^afticacum , r impofitum hi<o:ee tctcrgit 

^dleaddifotvuapafia ommaiimilitcr fa 

ccrcnouifOnbocfioe naftirurnigcr vihiti 

feme qui btbitue fimilie cft melantio. *^.o:fi 



H 



Bt$)tibis 



baavcncnatt9oaum*t«Srtranguir9«toato 
ribiis vcfiee p:efter dfccrum* 

f ^f £teoagaUitu fangumepvrtnf rmngtfad* 
^ajttmcru)golarcp:cfidiiicftfibtbitHif«crit 
cuclijuaruraapq. 

£ f &uicenna liij .ea.©c cimtno.£imtnum 'fcj 
itoitrii vd v faale ejtpellit venrofiraree z refol? 
uir.ctinipfo cftmrinWericeatto.atnipo cft 
fttptictt as cum lauflwr fadee cjc aq ipftus da 
riftcatam.crfiimilirerc(ueacccpriotvfu6ip 
fiuecummenfuracwenancp nimiuevfue fa 

t? ciemritrinar* 

f £i adminiftrarur eu cerot» autbleo ? metf 
lc confelidac vulnerapwpHcfiludtrc.j£utus 
fcmcn dtftMefctnuKbm.cumcjc coimplctir 
vulnera. 

3 ^Cumtcrt^cfmthumciimacctoctfitodow 
mcnrumer co abfcinditflurum fangutmcna 
rinm^ftniiltrer cumcr co intromirritur Jiriro* 
uminnaribus 

!& ^jCrqncpmafiKaturetrttiTccmrcnmolcodl' 
fcifhlUrur fupcr vngulam er fuper coagulatuj 
fanguinem fuper oculo cr conf ert 

& 4ff fcrqncgmaJticarurcumfalcertiltfllaffptt 
wmfut^rfcabicmetfdjcletvnfiuyabfcifam 
crpwbibet9clberenril.erfucciififtlucfiit6 ab 
fterfiitvifum^rartrabitlactoYmae^tnomia 

_ turfirccefumuc 

BO <j£ripfumcri3mponitur»nMutert)6cuulfi> 
onispiloaimiuoailoctnonafcifofcf quan? 
dobibirur cu^acctorniicrocumaquaconfcit 
Tiftiajltarianbclirae:arrcmorico:dt6 frifitf 
do. 

** f£tfldmt*nmVflturcumolcofupcrapoftcma 
tatefiiajUXtquandoq? adminiftratur cum 
olco ctfarinsfabaromtftfrangit lapidctmct 
V:op:iefiludtre, 

Ol f£tconfmtiftuBtionivrinectmicttsifanJ 
fiuini6iert)olo:ipungirtuovcnrri8:ctinftatio 
ni .% fuccue filucfirie rriri cum aqua mcUie fol 
ttirvcJJtrcm 

«t> ^3nquitT^rim6.pmtnumnabariumfoluit 
Yentrem.carmettUVcro rjonfoUw;immoftrin 

fiit. 
& fettbcitai^icflricpttjuocatcokraminv:! 
ita;et satur tn potucum vino ad moaum vcr 

i, i iumTcncr t ofou?m.ctp»p:tcftludtrccutU8 
luncn dt umikfaront Unt, 



C0pttulum.tmif| 




^^5mtHr».3fa9cfnt>fetie parrienlartf 
• rbueJ.i^a.cect^lUe.Sunrfrigtd» 
^^^ozeeetgrauioJcecucummWrtgidtf 
faecnim co:umcftin finc tercij sradue. 

f^ptrittont0 

f©"cr9.!i,afifir^fl^abera^ttc.if59t'Xirrtll9 
f rigidio: cft cucumere cr ficncrar cbimu vifc o 
fu5'ibuo«8crudo8tnvcm6:etacctcJut ejc cfa 
ri9fcb:csantiqmak.ncc0p»uocarvruwm 
ficurmelom 

^Ernocctflomacboquflrcopottet qmvult 
vtide vtvtflturamcoenififtomacboctuefit 
valdecsltdue* 

^£tttlefluc^abt!C.Squccttrttlb' etarcumc 
riepfattnftsmatctbuefcbrium z fcctat fttirn 
f,£rlaj:atvcntr€lapti«ebonflftncr«3amc 
tofllicj^^tbetbulliricujuccaro atborj non. 
opotrercp ©cf bntttenarura tJttraad mcitcnl 
4untmi8;cmia.iltoaquancnfe£bcttantavirf 
tuteq; laratfiaturS turaVz fi ipfafaarcrmo 
ram Inftomacbo fo:fitan induccrct U.fc cum 
crnotumcmum stnflaiionetv 
^abt^0![fc6.j£itrulW6ct^ctttsSDigifito 
Mrdflturfi£ncratfcutno:eevcnerjoio€i 
^3faacm«Dicti6 pnatlartte lum&.i> citrul 
Ue^untfrtfitdiouecr grattioKe? tmrs.p 
«ndegroiTujgcncratrlcgmatrnaKolttetiiio 
«tacbima^tei.ocajtajaiiKiiti^o 






Crattatiio 



CftwfoWtffuam waitiati&fngiditati 
fuwgrofibfbuo?gencratiui.q6cmifKarur. 

quitruUiinlicuuicbomottfacienfcevcneno 
lo:u comuJtionefulxunt buow./utralli ma 
gie itomacbo noccut:meduUa tn eo?perfeai 
o:an£eneraccbimum. 




Cap!tulutn.tEEu 

^V3trum.auicen.l»4.ca.©c£irf0iJtiV 
mt Jhftumomnitoeftnotu^tokn ipfiuefa 
jrraH?? ctum ejc co et cp ctttdiab? riue cft fo:te. 
ctfactumetfioJcipfiueeftDcbiliueomialio. 
£o:tcieeiu6eft calida in pmo.fieca infinc fetu 
di.£t ciueYaro cft calida m £ mo.et bnmtda 
fofecundo.0uida ar sir.erunt cj* dt fri. ifpnU 
i n kcundo.i ciue fri;mfigiecft.et ipfiue aceto 
(itaefri.ctftc.crt in rmio.iriue frmen cali.in 
^mo.ficcutn(comdo.!3dcm.jCo:rcicciuecft 
t emperattje tn cau'cirate.et tft c a .tnprio gra* 
du.iiccainfccundo.Scitieciuecli c.sltda.avj 
fote fiecifate/fciijpa due frigida ct bt; mida. 
£>aIienuefcptio iimplicutm f armac omyraj^ 
©e £ itro f m tranllationtm grecan \ '£> tlia Vt 
dica.ideft atrumbuiue fructue sb cmnifcue 
ncminat eitrttm.tn fcmine quide arida quali 
tae ctftccatiua ccminsnit tfctifit gdue fic^ 
catiuuiintrigid8tiuu.in coaicctfct ticcatiwa 
j?ar«opst ccplcjLicncnc ir.odufire t^mcn ba 



bcne acedincm .qtjo drca i Gccat bk co a cjc fe 
cundu tertiugradum.non tamcn eft frigidtue 
fed v4c6inoderare velinfra.£aro vero cius 
grouarompartiura eftetflcgnwtica z frigida, 
3pfaitac0comcdiffk:utetco:tei:ciuecfibilie 
cft.etbumtdum qutd babet acidum.t>equQ 
pjitis locutue fui. j£ t quidcm in co inuenitur 
quod vere eft fememamamm a utcm ;et eft pa 
lam quonia3 t>vafo:erice eft ctficcatiu e ^tutj 
fnfecundoverogradurecedeneaccmocicra* 
tis i folta funt ctficcariue ct t> vn foictice v irr u 
tis.Et idcmin codem Ubzo et eodem capitulo 
f m tranflationcm ara.i^arro.ud eft citru ct 
ett pomum aquccou c% eiue non cft frigidues 
imo eft aut cq lie complerionie. aut minue 
qualieparum etqtficcatquantuMi eft &e vtr? 
tuteetcoplcjcioncfuacfficcarioncbabcnrca^ 
jcuitatcmnonpaucam. jetideoetficcatio ri9 
t»emiu'tadfea»Hdumgradum.S>cmen ficcu 
4nfccundogradu.5clium eft duidcmvirtutj 
cjtficcatiu<ct refoluriuc.f pfafcoridee captf 
tulo^e^CirroXitrinoinpartibueomnibus 
vie vna eft eadcm natura vcl virrue. fta me* 
dullcfciue vbi df fcmen adclam potcftatcm ac 
per boc ftipticam incffe mamfcf ium eft. 3de* 
^atrumjbabet fcmen fimile femini pironjtn 



jE>ptrattont0 

f Suiccnnalifoo vtfup» yCarociuetnffar.t 

foUa eiue fcdant infl ar iorte.ct due rloe cft fub 

nUoide.etciueacctofitae cft ftipt ica frangce 

coUramrubeam. 

f fct due fcmeh ct co:rcjc in pannier tobibct 

rineae.-zeiueodojrectificatco^upteemaer^ 

et peftilentiam.ct^cctofifae ciueabflergit ce? 

lcram rubcam. 

4f j£ t aufcrt pannum quod eft ejc coUice cms 

aduftumcftbonuinalbarae hnitnm. £tte; 

coctio ciue cfiicit odo^bonu o:ie. ^t cftim^ 

pt'nguatiuaco:po:ie. 

f £tco:ter.ciuerccentteino:codo:cmon'e 

cfficitbonum.eteiuececocrio fimilctur cum 

rctincf in o:e.et accrofitae ciue vald impaigi 

niiiltnira. 

fg iue olcum valet mollifica tioni nmio:um 

1 no fiat nifi ejcco:riccciue.cf puenit paralili 

1 ipfiueacaoliraecftmala neruie. 

f£cnfcrtro:rtjrco:t$«ulfrccU]inumc)caccfo 

lirareaue.tr rcmoutr vc tcrictem ocult .'.£ 11. e 

acetofttaefctat trcmo:ej i oxiie caltdi.£t nu 

fntucltbonumgurrunctpum-ioni. <|S»cd 

dueacctofttaecmalapctiou » mcdbUa atti 



mm$M 



tiwetGXipotatqiemcSiiettetfcariatiinfy 
fiatfanguifugaetraTgturitas-zeduciteae: ca. 
roipiuscmala ftomacbo inflatiua.tardct>tf 
gtfiionie.qrc opo:ta vtcomedafcfi almuri. 

ti f jet ftTr nutrica cij mclle c fanio: ct magie rc 
apicne ©igefhone z nififit plurima. 

3f ; ; f £ tciufdcm quidefolia cofo:rant lioinacbu 
2 vifcera/rppftca ftoe ipfute t.cq^cp citi ponif 
mdbarne.fiaitfcminaque.pcondunenrppp 
nnntur^tcr fuitmricicm 

fo f £tipfiue t>ecoaio fcdat vomimm colcriaf: 
etfacitappairum.£r opo:rcr qiudcm ncrir? 
comcdarur fingulsriracr non mifeeatur ctba 
antefc etpoftfe. 

* f £ iue caro facir vtcntem'fcpo(Tickre colicl. 
ipfiue a caolirae raina vaitrc.? pfcrr folttt V/ 
oni colcricctciue fcmcpnaiitanozroiditc.* 
in riue fanine c virrue folunu a 
f £r mcareacaofirarie due fedatin infirmtf 
tatc fcia t ica m mulierum. 
fS^emisciuspodtie.j.ii.euvmo-rcbilem-z 
aq calida illinmimrefifiitvencnieoito.^ne 
fcorpionisbibitu aut lintru .et cius coztcjt c vi? 
cinue illie. f £t idct>e virito coidis air.cp cor 
tejc eius pfoztat co:.? c tvriaca prra renena. % 
ad boc rala aeaofirae ciue fimtlirer. 
f pfaf.£jtritpgnanntofafiidio labo:lrib? 
eiut tsaru fiomacbu z naufca mudat.Citr? ec 
in potione rinit>arii medcf qncrclie icco:ie. 
f £t aqua tritu \ in fparfum bumidie rutn* 
rito adbibcfat parmonibue ec ea ftngulare p> 
fidiii cit.£ otftci auf tcrio: natura coccffa. qtte 
qntuj r aleat aia de ipfo odo:c teftaf modieo 
fumptue.aut porioni calide vintine in menfe 
bnficiunamrcoigeiitonieopaatur. 
f 'fcautue ca.tie £irroXo:rct ciS zigcfiione 
pfo:tat.-iralctcontracardiaca.mcdiafubftl 
m cv) male t>igaif T5 inraiou. accrofa ecpe? 
t:t r fui mcdicirrc.a ppaim cdfoitm.t v alcrcc* 
tra fctece pcltiferae.Scmia ci'^ fut t iuretica. 
f *Ragi',g£pYlc8rbi loquitur secitro t>icit s 
c^cotfcce tUri valentf cnrra egritudinceTro\ 
ma(N.creg)cltunrmauciamiiMftniiciunt.ct 
acaofirae aue confo:rat fpirirue. 
fBuerroiefap^cArroXoircjiciuebabct 
manifcfium iuuamcnrum f? ornacbo crepat u J 
t^cdulta cirri curarc£bufttonei?ignie.acu; 
rat mirabiuter ramiccm pucrouua potifime 
ficjc ca fiat vnguentiim illo tr.odo .B cttpc me 
dulla citri fubtitiratncifam i buliatin atviM 
£i3 poui rcecti/rpoffea cokf pa paia/z irait 
ycponaruradiQncm.iinfinc mifccaf mafiijc 
oltbanumetccraalba.etcrifopttmumrngue 
tumcitrinura. 



f Sed atfcndcndu ty qn aliqtf vnguctitu vel 
cmplaftru fir eiccttro.ccbetfierfeic ctiro bcnc^ 
mat uro/R ■- i m P m qc ticit % uiccnna. Diaa'^ 
t ru a cyiicfiunt cfcirrot>cbtnt ftcri qc attb fc» 
le cjtiftftc m cap:ico:no.id cft amcdio ^«cb:5 
vfcg admcdiumDsmiarq. 




Capitumnwjtut 

G3no(batnmj'd dt afglcntricum.f^Y^ 
afco.^ulri roeanr £tricant a.£acft 
arbo: nimTUm fpinofa cu radiccalra,,z 
i'n plnr ima e parree t iiufa .^rucul bsbcr mir 
tefimikm:fcdpaulo maiorcm.riibeiiin cjLtai^ 
ue cum rcncrit sc\ maturiratoac tcintue la^ 
nm afpcrrima,i©ancn cim ficcum (inc Wt 
na.-filini.lt.tredecinio.3u egiptoclt caparis 
frutcjcftriniojieugniliminifcpaccibirulgfltu 
caulcquocE,rnapIurtmucpt5eccrpro.3dc5li. 
riccfimocjuarro.£mobaron:qua alu £mo? 
bafronialql^curofbaRonvocar.bsbcrfoiiii 
bomini8rclitgiofimilc.fertruiimnigri;m.tn 
cuiueacino babaurncruuevndcct ncruus 
pa fi ue t>icimr.3 lia cft caparim jqu s m meci? 
ci c\nofbatpnappcllauaunt. 



^^^^ vv ' 



fCtactatM 



<» f D?afXvnofbaru vcnrrcm ftringit .qr #tu'/ 
rie eft cobcrcria.medcf criain c tbo ct pom sa 
n:m.fanarcpimo:ee ac fcmuicum flujtnm. 

53 ^£iuevcroradi£acrio:ievitturieeft.1^m 
appofira carbaplafrnartbue euocar e co:po:e- 
llirpee.ioUa eriam eiue appofita car baplaft 
maribue occurrunt apoftcmaribue: Scmcn 
ctuegranarumeft 

£ f •jMtXaucda funt eiuegenera £egrina.£>i 
qdearcibicij pciiilce.arTricu gigtute inimkuj 
^armaricu vuhrie?oiminftaridib?.2lpu* 

, lucpvomituefatir.ftomacbu etaluumouet, 

T> % 3de.£>uiufcp t vrfue ad remedia fplcnie et 
inftaridee mandif ctaceto cddit^cruueciS 
e ummafticc ebva manducatue oe purgat 

£ C3temPYaf.caparaquamulricYnofbaton 
vet caprion appcllaucre ejt luctantib? cdpomf 
jfrturibue.babetcp p:oqcere ac purgareer ciek 
nuare et euentare acrcdinee fimulcp adduce* 
re z conftringcrc.Jtlt cm ftipriea /jldcoqjftbi 
rofi fplenie fupcr oia iuuat medicamina ficut 
vidclicet iam sictumcit fup:a 




0*Rifputa ii bcrba cancrf ih vngucnro 
marciaronpontf in antidotarto gatie 
niminori.£rcbctba alba-.minura ba 
bcne folia crifpa .^rueciue eftcalida i ficca 

©Pfrarionre 

CzMcturTsolo:eeercgrirodmcefrigidae* & 
£hmala ftomacbo:et opilatcitoct inducic 
ftupotem. 




Capttulum.r#otfl 

^»yRifocolla.pfafXrifofollaarifttn5 
1 h & £ga.cft berba f m pYaf.eap.cnfo? 
^ A eolla arifiin in q cft capiretlum file Yfc* 
po.radk cft illiafpcracrrenuiefimmectUbo* 
ronigro.gnftu babeecTpuiTifubdulce^ mf 
fterum.Bafcirurlocierub^ofieetfajcofie. 

©prrarionra 

fDrafcondce.tlirtuecfleitermanfifactfli 
prka.ftadijc ciue pcrftlcumomacie apra eft, 
^Sccipif vero inmulfa coctaimpurgandni? 
-bue fiericie majtimttmcrTecfum babet 

CapitulurmrjrjttJft; Capituumt.r]tjEijE 



M)Olri0» 



s 




a 



'£> 



atttfegonfam cflwVtum femcn aurcuj 
vel r oma aurca.Eft cntm crifogoniuj 
f m £>vaff oadem bcrba:cuiue cft vir* 
ga rccra ct alba.folia babee angufta in ciroJi 
iuficur3broranu.ercomain fummo:erin sy 
roaurofam:inquacftcapitcUum obrorundu 
radijccuistcnuiecfi.Bafcirurinlocioafpcrl. 



0ptrationt0 



f £> vafXoma ritte bibita <5 vino fctfcu> 
ct mo:fibue venenarte falutarcp:cfidiumdt 
fSciariciecrcoquaffariombuemcdrimeii 

Itrutetmpcrat 

fioagulatufangiiincvciirrie-zvcfkefolmt 
vinoautoiimcllcbibitacatamimabiuncf.5. 
i,cum vino albo appofira» tb i ; turaecaea ti? 
ncafcruat. 



CapittilunwjEr* 




O»0!ubana.pfaf.ca.tctfasotca.uf» 
'lubana.Dragorcafiucvra&afcUpi? 
•ae.folia bjaaron fttia;fcdplura mino 
ra.eutue virga vcl bai^tmotecuDit^loga* 
i ipfa varia fimius fcr pettrit lttto:ce .i. macu? 
laepurpurcaebnefoltdaevtwgitueinqua 
fcmcn eft fimile borruo. pmo colo:ie viridie : 
poft maturitatc vcro colottjcft ci fimilie cro 
co.ct cft guftu mo:dar.radiie duebuUib? rorii 
dirarcfimilcaaroncuco:torrtiui.'Rafcifvm{? 
b:ofie locfe cr bome.^craai.ag.cutrT.i. d:a 
eSrca fiueeolub:inaȣtemaie: i mino:.tJbi 
fcicdu cr mato:cq vocarferpentaria.-z tUa cft 
fcnefolia crifpa q pomTbicfjminoJgiUa qvo 
cafaaron^rdrillabnetoiiaplana.^toqte; 
gc ca .aaron i cft temu tft o:dinc.£ar.vi,f(m; 
far.ca.fccfcrpaaria.©ubftariaracuciecfcft? 
rilit» e fubftaria radicjaaron.? in ffipo:c eiS e* 
aaiira87amarirudo?fiipriciraepauca,£t 
rirt^ci 1 ; cft ca.i fie.in,i.gra.<fi' ^obsnce me* 
fuc ca.fce luff.X uffcft plara quc i5: ccllu fc:a* 
tcnie.ct ca cft atia plara bne folia plana. alia 
cnfprt.crradtjcplana dtatcriue ad nifjicdi* 
nimvnne.jhtame vcro tft alba jci i!pa f o 
qtrm^cinmciaOnrcti^odt alba sd cirrini 
rarcm fccdinae.tr fuptr vtriufcr radice" ilcuan 
tur liipiree bfiree mac tilae in niodu fcrptntis 
USbtlio: t>e roriue plire tii radtjL.ct mclio: ra 
oijc ctt groffa ct complcra er o:ra in lorie libc* 
rie.j£ r mdiue rpe coilccrionie ciue tlt vtr et 
p:incipiu$diarie.ertnlpatalidic:dip!ana. 
^lanaxa.eft in.unfpa in.ii.f jDalitns fct^in 
i 



SEtflrraru0 



a 



£ 






^> 



1R 



^jMana ca.efh'n pitnripib fcainducrifpa tnftV 
bc i vcriue c:et tn vtracp cft calidiras ? acui? 
tae q fi pofitra in ftjgfuie cii fubftitia rcrrca:fj 
m plana Iba rcrrca,cvinc€e plue:? vrraq5tlt 
abitah'ua:inctfuiii;pcnerrariua:apermija:fiib 
nliatiuaibuo?; gt cfto^ vifcofoai adberetui 
jCrifpa aiir ad bec oia eft forno: 

Bpmtioms 

f fcfafciocmcn ci^ocpfiijtii ^futcbabet in 
fucco ."Ra addito ftbi olco t oIo:cm auriu? co 
pefcit. Zanc inuncrus tji naritoaddirue po? 
lipoe maiimccurat:a tancroeoprime fanat. 
f JScmieeuetriginfa^anarij pufca bibtf 
ta cclifiinceoctilo? tmcndat.5lo:eeciue'a5 
rcperint maturcfccrcfia muKcrcp:egnarifue 
nnt odo:ari & bozkm faciunt.tlirt ue cft rsdt 
cie tiue calfda.vnde ozronovcfe mo:e clcetua 
ru accepta mcdicaf .f ZMicnrib; et cararru? 
bnribuc matimu p:t ftar tffcctum.f £bo:ac^ 
tumo:cecurat nonreuerfurosanaji imcft' clTa 
aur cocra accepta fucrtr. ficej tunfa er tn pttt? 
iicrcm fcnctamclle addito omia ntr faccre pet 
f piurctica cftivcntrcftimulat cu vino fctbiV 
,ta.vulttcra fo:dtda fagcdcnica cum b:ionfa ai 
^aet mellcpurgatf £ t cicatriccecurarefacic 
ct qua colliria ad puftulae ncccfiarie fiunt:ab 
ozfumfacit.f 3mpofiraticirur o/fiquis ejc 
ea radicc fc tintcrit f utue ab tncurfu fet penrit 
feruaf .Srcto mitta maculae limpidar. 
f 3obannce m cfuc.^oUjttoc cducit fic^ ma 
fubtilcx£rofTum.j(:tmundificafctconfo:fat 
renes«^uocatYriiJi:cte)LCt'tatcot'tu.f j£te 
cic rcbus mundtficatib?pect9ct pulitonce. 
f £ t ccfcrr as fu £ qutb? rtmei*frcc;nria anfce 
litue.vtlafmatictjptcrcwibcranria^umoai? 
Yifcofom in tiexj$ lie lobec cjc fucco ciue ctt 
mclte ctrob:? qiiq5 adminifiraf cii miie i va* 
ktfimilrf £ttijcitPcmocrt'tue3uusmetn5 
vmufq jfpeciei ciue magnti cft cmo:roida:u5 
tok>:t'bus z venrofirarttc co:u f m ocm modtl 
odmininiftrationie ipfiue et fumptit z tmpla* 
ftraru:a noe cjiperri fum9,£ t ejrjjtt iuuamcn 
ti cft fuper bujmo» cruc o qtti cft tn ftomarbo 
ct rcnil», f £ t ttur £>alie/Rcfoluit fcuricics 
,£t apoftcmata ©ura Iplcms 2 alio? meb:o:u5 
et cchucnir vlceribfraudulcnrie;ctftftuli6:et 
«onfumit addittbnee cartuutn na ribr.f £ fp 
bibctfieri in ciecoro1tone5etcar,cru^urt9 
a u re aus t>ifi illaf tn a nrc t u mclle a tonuoiit 
tinmtni ct furditatictsjoloaauriuct ifoftcr* 
0t ipfiue furdiciee et cjuerat vlrcra ciue^vti a 
q? tiuefpcciee clt ejc rcte q mundtficant fatit5 
f£t^iifctitfcditatctutiett5BicIctitparuit;m 
& tent fjjineejairiozfca^iprit; a;mmtlk « fta t 



cmplafirtt cjccacumcllcjtftcrroic rapwmnt 
fuEr^dagraapaifJioncneritoai.f £rcon* 
ucnitco2i)5tolo:ib:ef fuppofitio facta qcto 
cdttcit mcftrua xa faeit abo:fu m:et tii q fugau 

fcrpaitesa.va mcs vcncnofos 







CapttuIum.fjEjf3ft 

^VOloquinrida.^obanncsmcfucra.ti 
\ JhcoIIoquintidaXoIIoquinttda qua^ g 
^*^*fc6 vocant cncurbitam t>cfcni:q nafci 
furinplarifaquam etiamfel fcrrcvocanr.co 
cr ui foro ambitu bo:ts< ciue infcrficit bcrbae 
£tcftquafivcnenum eie:vndevocanf eatn 
arabeencccmplantaru.£reiuefoIiaftinti:m 
pla piIofa.aejttcndunturrami tiw fupcr faa' 
tmrerrcjficuter^tnditurruruibtrain ftrra f« 
per quam iaccr.puomm cft modo:um maftn 
tueet fcmina^t cjc cis mafculue cft fupcr qucs 
nafcit unfuur ct lanugo^t dt grauie rum t M 
rictect3fperj'fafcattincnenifircdint.£tlati^ 
danir cjc a's ft mina.cr p:op:ic babene p:op:t'c 
tatce t onae vt (it coloqutntida groffa .ct qn? 
fo gtcfiicz etlcutoJt^nto n.elio::ctft'taIt;ala 
jta Uuieet rcmplete rearurifatie:<utBepars 
a'ueintaio:cpuIpofalaiLactafb^cf Uuisve 
bementisalbcdinie.tlcrumquenoncftccm 
plaain maniritatc mala tft.ccnniftat ctiim 
fufctcicnttm iltfitn a venrofirartm a : m tsifii^ 
cultatcfaatctfoluitfuperabundantenetfolu 



Bttittbto 



t(oncduatr9tJg»fne.j£tto(rciiircficft. , 2 
cu figillaf cjc foro gtrminc plante vt nafcaf co 
loquintfda vna i illa p.m'riofa ct mala fmo cft 
vcuenii.ct cfi tn tot a rcgibnc no cft mft planta 
ciuevna p.fenafccecmala.aqnafcif intcrrl 
fotrifo i pulucnilet^aut uttia locaTcprilinm: 
autin locitermartX eoIoo,nridaefacri mfoics 
i funt fifr maU.&ueaurnafcif in rcrrj lajuez 
a renofie? Itbcrl cft tlla q eligif.£t: eit ertrabif 
pulpaciusipattcbflfrarca^Xcmpusflurcm 
collctrienie cfue cft a ururrtnue.^zie cu faj 
cirrfnefdtjct rcmoucf ab ea virfditae:calidec 
■2 ficececplcjuonie infemo. £r cft ccmpofita 
cr. parribueignriect terreieadufiue.? cft folu 
riua artracriua luperiuiitafum .Bttractiua e" 
i arcmori8multu:ctcftrcfoluriuainriffua ab 
ftcrliua .0 uatruoz funtq tcbct cozrigiifpfa; 
"FJocet em co:diftomacbo cr epanV: cft cotur 
batiua :fubuerfiua tifccnl faciens ogat ioncs 
t>ifficiU8:etapmto^iciavcnariJa£irfaefan^ 
fitjfneflucrcfacfcnte.^toperaffdvclxmcn^ 
riue cpaloce:-: ejccotiatviae^ntfdaf tm pu 
mu ct fcrJm nocumetu e|c ca mifccdo ct cjc me* 
dicinie cozdialito x ftomaticie x tparicie que 
mclio:arepou%ptirionea9:fi'aitaddtfcima 
ftic^p:ic x gallia x fiu'a.£r emendaf terrium x 
qiiarru nocumctit efue cu rcbue ac^rcnnbue 
rivifcofitatectfiliitinOfifateetrcmouetibab 
ca fcrolitate^citoealubncare faacritefiair 
cftwaganru#:iectbcMiu?#jmi ct maftijc 
sfitta.f £ttirir0alie.5wnraurcmeicca ct 
laudando parree fumendocqlee poft fricatio 
n2cf9cuol£orofa?pillule.ctfuntbonettfg^ 
ne ad ca que opo:rer.2£soduerectifica rionf s 
er3 fm q> narrauf rff Ifue £>erapionie.3nfun 
daf pulpa -d? in aq meUis:? #:iet*ecocrtome 
m Yrrbe:-z cjcficeef poft illud x rcraf vlrima cc* 
tritionczadmiftrcf cuaqua mcllie ptedicra. 
tj&odue recrificaftcie ri^cjcinucntioneiifa* 
3nridafinminurim'maeparfeecuinrifo:fo? 
intwluaror fubtiU fnuolutiee cn glurine feza? 
ganriaut bdclli:ct ecficeef ct ptersf p9 tllud vl 
ttmaf etrittone.? fta t trorifci aim pauco wa* 
fiicerefolutoinoleo rofarii vcl laudano.vcl 
. cu aq mdU'e.t;cc cm arefarit illam finc mok 
ftia .£t fciae q> te t ecocricercm ppiera fuff i 
nct.jttticitfili^^ejar.l^oopoMetvtmu^ 
tu tcraf.uirima ero pulucrtfatio cjccotiat viae 
?vcna8.<Cj£tticitfiUueScrapioni8.0po: 
tctvt pcrucniatur advlrimu pulucrifationie 
ciue.aliteremvlccr9rctvifcera.j£tmibividc 
tur q? vlrima puluerifatafrangif virtuea pef * 
mijctionc adfikto? cf :i jgtranfit loca vifceruj 
abfq? im^fitone nocumcnto? in ip(ie.j£t fo:t e 
iriea in c) ncktqure ftt illudjfjs tn fcnfata ad* 



bcrciie in villie ct jnuolutionito co: um apo; 
Itemat et vleerar ,j£jLpcIlunrur aute nocumcn 
ra fpfftiea co:p.eaccipfcndo aquapaflularrm 
cu olco te m igdalie vcl olco nucum mt a q 
mclIiecumoIciepKdictt i. 

f 3ob5.^efuc3oIurfcecducfr flcgma ct H 
bumo:ts v tfcofoe ar trs btne ipoe a ^tundi^ 
fareuitb:o?.f £t &!&umav.£3oluticeeri ^ 
ameducircolcra cifrirta.ertiueop.atio ejctcn 
dimradncruo?iucrurae.fj£rt>icitPvafco. p 
•Fontfiiciropatfoncem marcriieque funti 
vtie tequfb; fitcuranduerinmarcrtieq funt 
in,pfundfe locfe tfftanttb. f j£r cfue pofTe r> 
maptjmcftfnmundtficationcccrtbrivtlncr 
uo?laccrto¥pulmonfettpecfo:ie.j£tcfimc 
dicina magnaegrftudfnii corii ffcut tft to!o2 
capirie anriq ct tolo: cranrit cmigranca tif 
ficili8:cpilcna etapopk|tia.f j£t?ucnif cgrt^ £ 
tudinito nerUo? oito et verriginict tcfccnfut ^ 
aquc ad oculoe j£t cft rce m&gniiuuamcn ad 
afma a antfqua rufii'm:ctad cilaratfong ant 
bclfrus.f j£r eftefueopatfovirriiofa ^ tio! * 
lo:cmiunctura?erpocii!gramfrtgidaerfciatt J 
cam:^p:ief m omnemodnm adminiftfariofe 
tiue:erfnaffteritoercollfrti8.fj£rconffrrco 
Ifce flcgmatife^r infiatiuc iuuamctiim vlt fmit 
ctbYdropfff.£tfifupponafurfnmatriceocci 
dif fetura.f £r fi ejcco cum accto fo:ri fricetur 
mo:fca fana rca,ct filrlcpta ctelcpbanriam 
f £tffcuacuefqoeftintcftaciuset tmpleaf 
oieott bulia rin cincrecr inungantur caprtli 
tenfgrat coe et rardar canfcie.cr^bibcr cafuj; 
cout.f £t fitfftillcf teea in aurcm fanat to? 
lorc eiueiet coticnit ronirui in ea £t (i fmpleaf 
in acero fo:ti et colluatur ejc eo oe poft b ulliri 
one fpfiue fanat toIo:cm t cnrfe. 
f ^crapfonaucro:f.jgalfcni.Sfapo:cfKsc x 
amarue fo:rfe amat itudfnf8:et qir fumff non 
facitbperationcmalanco3pcrtculofsm:qi;oV 
nfamvelociteregredif.f £tqnponfffncri|[c *a> 
ribueccutnirfciaticcetparalifijcolicem^^ 
jcat flcgmacrfcumo^e crudoe t qitqifan^ji 
ncnufitqnfitciimcanafcalcocciditfctumcf 
pkatocarmenrirua.f£rqr5ipfacauauir2cjL- *H 
t rafeunf infcrio:a tfue-.tcfn de inuolnif circa 
ipfalutuctponif in ipfaacauetcalcftrfurj ig 
ne:ct fitcuacero o:ie collutio :ctauferr tolote 
tcnrium.£rfirfuppofito:iucn pulpa riueet 
lajcatvent re.£ r ttl colo: tiue t ft v iridie:i ipa 
cfr reccns: etejct rahf fnccue ciue cf frf ca f J ujj 
fciarica cft iuuariua valde. 
f Pvafort^ircue cft ipfipnrsafotia obulo 
vno acccpto cu3 mulfa mtjtro nicro cr mirrba & 
i a 



6 



±> 



'Is 



Kmtm* 



tmelk coctoin moo*u tatapudebcncpurgat 
ipfc vero pilc ficcc tunfe et mifte i crfttercad? 
bibtrcfaaacismcdicanf^araUricisfilrpfio^ 
laf.ifcgma?colaafcer»nuMnc1truie tperat 
abotfum faciunr.t>olo:cm©entuim tollut. 
f £oluria ejandeftunnq fugpofira vetri tief 
ponur.Uuidie atuemfucaie peruncnie fcia? 
ticosairat. 



jgtprrationre 

^Tfcadfcconfolfdemaiozfeflitattbtbttaef 21 
moptoicie medaurXonquatTationee rcticit 
tumo«8fpargit.f£tcufolq8catbaplafma^ 35 
tibue adbibira oia fimikter faccrcpot cft; 

fUulntrttoparacolcfurifacitcaniceintifas £ 
frukie in cacabo mtflaeiufe £lwirwre f a tic 





mMamjm CapituItmt.t]P]F3Eu) 



O»0nfolida ra.fcc Gmpbiro.£fanpbittT 
»irfdt confolida.£r cftmaio* et mtno: 
k t>epfolid'a minoain fcqucri capiru? 
to fraaabif^gbaiorpfolida nafoTjnlotla* 
Ipoie.virgae fcne fiTeeorigano i «nueetca 
pita ficur fbimum.virge lignofe et odoratcet 
loulcce rhguftu.tt r adijt elt illi longa tdbrufa 
^ofiimdmc©igiribrl8j£ftaliiidltmp1?iruut 
e\t picrenurocat:bafta babtf afpera flonga 
t>uob? cubirie angulofam^biinrueinanieert 
inquafunrfolia afperacrangufta? oblonga 
ficut bugidfla .baba eria ipfa bafia anguloB 
in quibucfoua nafcunf .fio«e funt illi mcllini 
fcmcnbabafujgbaflamficutftamoe.i?afta 
et frutcr.bfit puluerifiTe.qtf cum camiapphca 
tnmmmtputriginefacit.T^adijcxftcicdloie 
mgra:quccum fracta fuerir albaapparcret 
mtifalaginora.aiftadtcon(biidajnaio: 



/»VDnfoltaaiTrfno?.0alienue.rirl/irrw 
t J»far.ca,6mpbir0 f m rranflartortc grc* 
^^caminquttXonfoudaniinottfcortf 
rrartjecottltorvirmru»**>ab«tcfflquid sb> 
itcrfiuurmquo conrenrii in rotaee er pulmonc 
pue ejcpitrgarcnatueft.t5abct autcm qutdt 
congregariuum quoad fanguimecducrfce* 
iutwt.jetcotmctvuTabocbumidirafemqn^ 
^alidanoniminockrare^rerqulcrtulce 
apparetetg«ftantitoett)efccctabacodowm 

BptxmontB 

f ^nfitiailofujeftcumafticatjEtafperfta 
t*6Utartctiafanat.^cfmrni)prtbnc $o quc 
ejtoito jpdiaie $>runto fimuler ©yafowre ftiffj 
cieneetcolligcrcaccftriiigercconp^^r^ 

pterca inrdiirwltte ba r«j« apponif •* sd cuul 



& 



BtHbttW 



fioneiTciflioncscuopMndk bfbtf . Oufamcfc 
vao adsifiinreria 2 flucii rubcfli coqnree in vi 
00 ©anr.vrficcanre z pgreganre vtunf.-r qui 
euncBadnefrotcavrpurganrea madcnrc 
f ©impbiru aliud magnu fifecft virturi pdi 
cn;,no rn guftusulcemccfc odouferu olfacien 
tibus appara:fedfm boc «bfccdira pdicro. 
£5c£m vcro qcWifcofirargquanda ?mo:da* 
atatebabetquodimodofitrejriHir.iaruntur 
aure co in omnibue quibufcuq? z prius cicro 
$ *Dvafco:ide8*£6foUda mino: elijca in mul* 
fapulmonc purgarjejcientfb? fangninc? % ne 
frcaris cu aqua mcdcrur,*Radic cum vino co 
aactbibirarlujcummulieri8t)ijlringif.^t>if> 
fintertcie opimlaf.cum ojtimellcoata conqf 
farioncB a t)olo:ca larme faUiberriinc curat . 
malticaraamputarfirim.afp:edingfat?a'umi 
rigat.vulneri reccnriparacolclim facir. 
f £onfohda P m-fSliniu aucrorirace vcl optf 
nionc mulroui ©iuino mimculo curat ct rum 
pitanfraccmintrawoelapidceitrita. 



mrettiogradu.Stfdnoradu q« cft fpecics bi 
Itoucbnsfolia fifia lappacio acurowtli quia 
colo:folio?ccvno larcrcefkckftt8:erejc alio 
viridieJlos ciu8rube9aradijcrubca:q" ab ali 
quih>vocarurb^rdanamino::etabalic{bti8 
lappa minoz/UuTUe ciuein oito ficutvimiep 
mcfpeciafedremflTio:. 

fgmrrartonrs 

% £ofolida rubca fiuebtfiozta baber virtutcj 
?foudadiapfo:randi pccptu.f jContra ©tfj 
furriam t>etur puluis bifto:rc cii (ucco plarita 
ginis.ad conftringcndu maiftruafiat fomct» 
fum ec aqna ptuuiali •oeeocrionie pulueris ci9 
vclejetmabue parribu8eiu8.avna fpicc fiac 
pului8 c\ afpagaf fup:a vcntr^ (pfo pris mcfo 
lccalidoemplaftraton iuuarconccptu. 
f Bd pccptu inuandu fiar emplaftrii cjc puluc 
rc ciu8 1 alns fpecictoaromarici8.*^u(ui8ei9 
vulncra confolidar.f £ontra vomiru cc fccbi 
licareafuro:e colcrc pulms cius conficiaf cuj 
albumincouiacoquacnrfugregull ct t>ecur 
pacienri.f ealie/Radijcau^eft abfterfina et 
vrinariuaacalidecdpleiaonis. 



^v^ 



,35 



3c-WV»^ 




CapituIura*ciE)E]Em? 

OOnfottdarubea fi'uc:8ilto»fl. £tefl: 
bcrba itnepcntapbilonaitfiquia babf 
Jcptcmfoliavtrimq?;pitofa.aidcovo 
caturcptapbiton:cuiu8radijcerubcactro:tu 
ofafimttisgalangeTcdnonbabsacume.flos 
citi8aurofu6.et ipfa twdicarur frigida etficca 



Capitulum.rjEfp 



aOndroe apud grccostwo fcat.tfaj 
fcatrifum.dfirefpedcns mibi grec* 
intejTogantiquiddTctcondroetJicic 
i $ 



Crarratug 



fiirfur f ariflc jffcm fe ondroe^ponff qnod 41 
atiquac2rrtlago.filr<:adroecftgenii8rhHitf^ 
ri.fccqao DYafcori./CondrosfunrduefciK 
fpccicc.3nvnainucnifTniisrflnu:crm alto 
fcuo granarrquodlrber ipfoauneft ftamcru* 
la cr maiorisnutrnncnri o>o:den:boni fapo* 
riP.t p Jnis qui fit ct co minus cft nur ritiu^cp 
c^ fttecfrumcnr©.£ r fpecics in qua repcriunf 
t>uo grana dt plue nurrirro* c$ rifum: i ma ; 
gis conftricriua venrris ? mdio:ftomacfee 

Jdprrarionra 

f 5alidi.(.t>* a limcnrie ca .t condro .£enS 
frumenri cft condros fuftieicntcr Hutrit iuu v# 
fcofumbaben8cbimu^5ocvocar4irin:Ub»8 
$e,arabico tranftariecandaruftnm.Et apud 
Suicennam condaroeer candaruuo ?c. 
fj5at > .rit)Xim/ar.c9.condr©e.£ftquid£op 
rimue ctbue ficut ct r riticmfcd no" eft pztfcml 
negecq t>e cibo ©ererminarc vt fstanacfi vcro 
emplafticeeftvirtutietfdpUMonieverofiltee 
trumcto^luoillo vifcofw: et nurririo:.eft pl9 
illo uccariuum^jptcr comijcrionc* ficcanrium 
farmacowm 

f DYafc£ondroeconftrfcrfua cftqn ipfum 
coqmtur cum acao.t ftr linirio cu eo.er tradi 
cat fcabicmvlccroiamrz eradicnr vnguce fctf 
foe.f £r curat ftliulae quefunt in lacrTiuait ; 
etqft actoimiftraf inp:incipio etrumrzfir ertf 
cocrioneewecUlterc£tdr muarimimviccri 
bueuudtinouun. 




Capimlum.r*jEjEu? 



£>ndce.!£fera.U'.ag.ca.condceauc 
J^aQliud quedcjccMdmjtriftraf i 



radiitupRuc.virftjedlcau^atfkcam.ulJ.gfli 
du.tln iira mcdicina vtunf lauatowe lane; ct 
adfacienduUmalcnespuUbia qfi fnmigant 
ipam cu earz eft nora/R adijc ci9 cft acura« iti 
fo:mafuaicgatroruda.fpYaf<oudeevo^ 
caf fpam flruriu a macro obftrucw.qe quidi 
radKccHtboualbi putar:co er flcrnurcuicra 
mouct vtipm Uc? falfo t £ S macer ftemuramg 
tit puluie g fe mouct cttnarito miect9 vererro 
nofegni t ;albo4xlUbo:o.f^ar.vtt.fim.far4 
ca.t>e ftrocio,f m trdflarocj grcd.£>rrucij ra 
tliccmapcvtunf aai Ad^ejiiftete^m guftum 
ca.^ ficfmcapkiitongejcqrto fcregradu. 

I8»prrattonf0. 

f p vafco:idee.ir parieis tuutcntib ct o:f« f 
noicie mcdenrur.'i£>o:bo rcgio vrilif cr adbtf 
benrur cnm lacrenanbue infufc.cum mcllc 
codcariumvnum accepnimvcnrvdnmolUt. 
cumpanaci8^caR>ari8radiribue acccptcct 
btbirccaiculos vcficc frangunr ct crcludunri 
fijclirofim fplenie fpargtlt f £edce matrici 
«fpofuu mcnfiruie imperar:sbc:mm tacir.cfi 
polcnta t aceto pofitum Up:am roUir. 
f •fiuflulaecu farina o:dnimpofituujnptdar 
£olut «e jnictucaugincs ocGe fcetcrgir. *i£e 
dicamituh?ncaflariejnifccrur. f Zriru lier? 
nuramcnra p:ouocawiTmdlctrin;m crin na* 
r&us mthum caput purgar, f £>cra .tep:o* 
prierat e radicie eiue cft U accipiatur quod ab 
fcmdirficgmartmdancoliamgroflam;crrtf 
foiuir vcnr ofitatc8. f jSaUcnue.lRadijc cius 
rft flbfterliua ct vrinatiua.mouet ftcrnnrario? 
nce limiurer alv\e qnccuncB amara funr gufiu 
calidecomplcjrionie. 

f 3tcm4-> Yafcoadce factt fcmotum cspiru* 
lumaeeUebero a condifi.Bam condtfi vocat 
ftruciunuaicne capituk>Dcftrucio;Xanari| 
vrunmr ad fumtgium lane: co <r Umpidat la f > 
nam.*Radicc6funrrorundc a oblongc:quc 
fi btbirc fucrint fiurertcc funr cr calide. 
f^lini.li.iqLiii5.j£cdcefiuefirua'u^crbaIa 
naria ouib^araiciuniefac abudarii lactie. 
f f>latcariu8. Sftrucibe id cft agrcftie cauli 
rulu8 ca .7 licm jj .gradu.£>uccu8 ac funina 
foliacp ccperunr vfui mcdirinc £u inuenif re 
ccpriocaulicuU fcmcn caulie agrcftie jfcbct 
pontXu autipfa folia ©cbcntponi. 
f Succue ita SDibcr pparari,5olia coptcran 
tunetfuccuseitputTns adfole ceficcetur pcr 
bicnniu.©urar.roliaviridiap^nit)tbctinmd 
dirinie % in vngiKnrt6;X3irturcm baber ttilol 
ucndit ejcrcmiandittiurcricam. 

Cap«ulum.fjEjf3EtiiK 



» 



©tUfrtiie 




^^©n*aiiM.£att3diueu\iq\£cJiadrii 
W^h a menfe^arcio ferifvfqsmoctebtc. 
^aA. amatcgtcrrapinguefedtmaero fola 
nafcir«cfuefcmcq6>eruftitte fumt.mdme 
putatunbumote fcckctat ur i fatii bfi cu ekrc 
cjuocucg nafeif; &tra>li.afrgrc.ca;&T£bo:3: 
Idcftcoriandru auc£al'.Sfebftflnff a citie cft 
tcrrca fubrilte.rtft cu fcdcineo aquefitae rc* 
pide ^turienonpaucc quanritarierin fape* 
reciue f mpummilcft amaritudoi £t virtue 
eiue cliq abftcrgir i refoluii.£alien?.ve. .n'm. 
faMa.©cco:iandro.tlirt9auei)m9cft^nt8 
calida.Un pvaf.3nfri6idit ariuam ticit blc 
bcrba no rcctcccpofifa aut. cft cx ectrarrje p 
turibue:mulru quidcm bne amarc fubftantie 
queindicat c? fubriliu paraumeft ct rerrcfir^ 
iton modicujaSr babcne ct aquofc bumidita^ 
fievdtcpickt%rirtute.babctautc fiiprictta 
tcm no modici in quite omnibue opcraf qui 
^cmvaricomiaqcuncp Pvaf,fcripur.fcdpu? 
to (% eriftcreticur fi mor r*m pncfpia plagatie 
vdqualttereuncppercufiie iH aliq panicula 
tumoHiuiduevel nigcr ficrcriti^ ida putarc^ 
tur pafiib cfle et egcrc t>vafo:antib? ct cakta* 
cientitofarraacuef meundepuro modu.fi tra 
fcederit aUqncalidaJPifpofirio adfristdfl} ob 
Kuifccjidu5epjioJienoiadiim vcro alio fcto 



nok.tkl finemen volucrie pcrmurarc fcd toA 
cercficutqdac^aliaquidefncipp^liatjote 
clinarionie fcrtburauriIia.ttonauf ©pc:tct frf 
cn'd3drimarccfict*clmationiefarmaea.£d 
ccdtndu cm cft bcrifipua noinare fic\6 voluc* 
ritbmeioifpofitioneno tnta.vocarccsm e 
mittendu qfi ©cpfia e? rcmtfia.nequacp ergo 
ruc qtf auf iliaf « infrifiidariuu cfie putctn9 (U 
cut£>Yaf.vfcoziaRdru.qnjcfl!b2plafmatum 
(vttpeflit)cupanc.vcUtiacumalftti8.fanat 
fccrifiptla.certu cft bcrilipilam q rricr? iiiflsma 
«ua cft nunc& fanabir cum panc co:iandrfi: fj 
|2 id qtf infrigidarOJam^jptcrea ct noe in anre 
rieribuefcrmottitoqncumfcefcrmmaraetpg 
ncnria^barccuiuflibcr farmaci vinutcm po> 
ftutabamue.fimpliccm cm vt pofiibikcft mal 
rifmcporionc cligcrc confukbamu8.plurfmj 
eutcmcdicotunecjBqucdciiplurimccgrirudi 
tistm mor a t)ncipio inuadfitccpofita nofciit. 
nccpqupnifi.malia pafiio cft bcrifipila certa. 
eliavcro vecatur ab ornnjbue nobieiamee* 
fuctcct ab anriqweflcgmon.alia auteinme* 
dio b} multc.23ec quidtm ct vt vtiqytricar c\e 
bcrifipiIar1cgtT!of3.i?ccautcmvelutflcgmo^ 
fice quidcbcrifipilato6inuenice:autvelut Re 
£monce8lt'quandoetncunump:edominIe. 
B t vero x rdemafcofue qna"do apparer ficut 
cTbcrifrpiiae/icuttaltoefcUrofue.undete 
compoftris omntbue nonmodica babctetur 
multitudo Jaiiue vcro in quibufdam alse t> tf 
ctumeftt)ebie'j£tihltb:i8terapcnticcmcifco 
dit>ieetur.er nunccft tteciencctflariton mc* 
motari cjp» ctiam bcrifipilamnunql pudicmm 
fanabit catbaplafma.roco autcm certam:qn 
a colerica bumiditafe rcplcra fucrit parricula 
quoniam autcmlonge abinfrigidado eft co^ 
ria ndrum.licct tifc i ej. bie que fci ipfit k p^ft 
ce:idceaddifcerc.©crofulaecnun ait x>iffot 
ucrcquoniam nullum autcm infrisidaniium 
farmacomjiuflicittilTolucreftrotulae.neqs 
<m puto pYafcozidcm tubitarc muitaquide 
fcribcntefcroJfnlarujfanariua omnia vcro co 
cotdanria ct caUda cepicuontbue et $$&(c:e 
tica joperaiiontbue qiftcrc. 

^prrationfs 

^Yafco:idcecau:o:ioniidcftco:iaiidruom 
mbuecftnotum.tlirtuecfueeft frtgidu tnttl 
ct in cat^aplafmatibue rcdacfu cum poleta* 
ct pancfririccomijitum ct impofifum.^gncj 
facnjmciitingutr. fXumoaieipcoefollit 
mctteaddiro:«vn.aFatTa »jijpofifi;m eptmeti 
daerttumo^ teftium % carbunculoe curat: r 
couectioneecompcfcitcnjfaba fri,;a n:utura 
t iiq 



n 



Et&mtm 



■& 



•£> 



*B 



fcrofulfectpu(!uUcpIlatcfltctn.f©aneq9 
btbitu cu tuleo:e Ifibricoe er.tiguif . genitalia 
.i.fcmina viritccrefccrcfacir/Ramli multuj 
fltccpni5fucritfcmcnfcnfu8 boie btbctefcit: 
autciriueinferrnctcVunnont5 qutfcpvfum 
riue frequcrarc.f 2>uccu6 ciue aceto mir.ru8 
2utfpumeargenjictccrufeetvino:oc8puftu 
lae a caliginee tbuUace eitingua. tiic toct 
cue vifcidc cft ftntie rcltringir et refrigerat .ct 
ideo,#:ic ad igncfacrufacit licuf ctfolta cius 
cfi (acco maligranari:et olco m cotioc pcrmt< 
icnl aiaUa intranciepci nuixa ignira pcrfcquif. 
f SsKntfciueejc aqpotanl foluttoncventria 
abl triglt.mirij cft qtf jtcnocra tee tradir fi vm? 
fcminio granu fcmtna bibcrit vito tie ci mcn 
liruapnnerifiuuocttotidcmtatickclfgra^ 
na fumpfcrit.f SeraXo:iandru tiftillaf m 
ocuiumt a coTcrttolou er? magno cum lacrc 
mulicrio.£tfitemplal(rii cuco i abfcindirbti 
mo:ee tefccdftee ad ocuui ,f £t ide auct o:i. 
iibcnmcfuaYj0uando toa-cfcir. fcmenco:ia 
dri ftringit vcntrc.et abfcindit flujrii fanguie: 
qui cfr ab intcrionbo.cf b iburur tc co t iio auf 
rcicum4tj.5.atimidia fiicciplanragittie fiuc 
co cp buliat.cr fi e" flujuie fangmme ab intcrid 
ribuemtmb:ieairaf fi ponaf ftip:a locum fln 
jcu8.f£tidemaucfo:irafeaIbugmcXo:ian 
driicUfrigidunarfoncu induecns fimcopim 
aflupo:c:acftroj:tcum:quonia odo:atu cc / / 
gclat:zp:obtbafumofitatc8af<:cndercadc4 
pur.endcocofcrtfodci tb:icra ti.ctaibfcindit 
flujuim fanguinic:a ftringit ventrem 
«f£t icfcm auc3lejtandriXo:iandru,pfcibrt 
rumofitatce afccndcre ad caput ct ad ccrtbw 
tt^prcr boc poninw in ctbie eptlentico:u:qul 
ciocaufeepticnriefunt vapo:cs afeendcntcs 
afiemacbo 

C £t icle auc.2Ucau5i :qttldo co:iandrii ficriJ 
infundtrtir inaqua eius cu^ ^uccaro ab fcindit 
virgccrection2et tcficcatfperma 
f£tidcauc. , Aafi6Sibibantur.5.iiu.tcfttc 
co citie rcccntioccidit:? abfcindit fiujLUtn fan 
guinie a haribue quando odo:atur 
fj£tideauc.i7umaY.inlib:opejmuraf6fli6 
tint :q* pillule J3alieni funt ei prraric.?DYaf. 
vero cotradijtitti cu fcj J3alientistijcit:cr cof/ 
riandrii tedinat ad caliditarc quonta manifc 
ftum cft ipfu5 cflc v irt utie frigidc. £t cjt ziae 
fuo qn fumiiT fuccue riue octidtt 
f £t ic\c aucJjabic.jCo:iandrurccc6cft mo: 
ttnca tiuii « ongcla tiuihi f i bomo vttrur eo mf 
tu.Uel potu aqiiciiueeft toi.icu.-z fiponarur 
aqua ciiie cii aliq ejcaltje bei b ie •; qn di aqua 
diieliniuturapolttmafafanguineaauttolc* 
tica cohftff et cjiiingiiiteozijmtnflair.initio 



nce.OmniapKdirfarttalttntfccmcWcXuf 

cenndu) «ca ,x> c coiundro. 




€flpimfom.fjrjrjEtsii'i f 

OjQmea arbo:ltuccrar.ca.pY^^o.c« 
jComca ftncn a fructf: b&Ut itrr.iUm 
oUue:fcd paulo oblongiv tt virtdcjt t 
vo.caturgraccaimu.qt ctl maturatu^ ftitrit 
obruftjm babcr colo:c t cnii in fc bsbfe fcpa 
rcm fiipnamcft<a idto tif oluticne venirie 
er tiffintfricoecurar.a cu in ttiUoupofirfj 
AKrttmanducariFofcltquemcoliuccoBdiu^ 
tur tu falc frigida cft . ftcta 

g>Pfrsticnf0 

^t>p(.l~:viue folia cf5 ugno fco to foco niil 
fa fudattomm rcddtit quc illinira jt tiiac cpti 
mefanat 

H Salicnue.rj.t ccibic ca.tccibie filucflrico 
£e:nuverosbatia giandeea ccterifructs 
filucfirce modicum nurritcnie bfitcnrca i fco 
cbimtfunf.fctmalitlcmaffcb « inddcaabi? 
liflimi4:o«o:iimvao efcaejtifientce rionto^ 
mefiico:t;m fed inmcnnbue n,o:antiu:. b ip^ 
fie cm ptimu bntalimcntii.^ jEtidc.vuitm. 
far.ca.cranca.£raneeatbo:lfruct^fiipftcu8 
clt fuflic icnrcr clibtlie cjctf tcns4 rirca nuiltjn 



fceBjttbfe 



imYabtte attrabere ct fottitcr Scrf nerc cfi ratf 
ercm ficur et mcfpfla/olia fro ct gcrmina poit 
lica guftn funrri ficcant fomtcnvr ct majrima 
vulnera eonfolidarer^imzmap'mct>uro:* 
co^iiumparaievero vutoteritevdmolubus 
co:poubpconrraria magisfitnt .ttndmt cm 
baficcariua plue ©cccntc* 




Capitulum.rtfriJE 

^rv-OkJumcra-.m. £>vafcoridee capirulo 
•'• |»co:duiona'ddt co:dumcnum.:Ecrba 
ViAdtqucnafritur inSTidlia .duofrutcjc 
cft farmenrofajcmen babcus ronmdunutsu 
ptqcficut funt fabc:vifcidu et odoiatu. 

j&ptrarionta 

3 f £> vaf.STcmcn riue fi bibitum fucrir puo) 
cat vrinam cr mcnftrua.Suceue riue virgc i 
faninie rribue obulie bibirus cuj 8 uko:e fcie 

- bu6^eccmncfrerici6medicanmr. 

P ^T*Radic rius runfa er vr dcctuarfu compofi 
ta ro:arie caufas mirifkeatrar.^untus/Ra 
di,c due po rara lapides frangir. 

Cflpitulum.ttl 




O0ftu6.3u&: Jt jj.c9p\dc cofto. £ ofK 
fpccic8funt rrcs.Unaearu eft arabtf 
ca. tcft albuskuisT aromaricue.jEt 
fctundacfti^qtiieftragerkmerrilkamaJ 
rus cf..£t rcnia fpcs grauis odorie c\ nofnaf 
gariofiUr9.Bon9 aiir coftue falfificaf eu radi 
ntocnr 1 lcr»urie:CT / fpreranonmo^Jicarlii^ 
guammccf. babcr ocW foycm ."feclioi cft ff 
le qui cft alboe rcccns pknus no co:refue:ic 
e& feridi odorie.neq? mo:dicans vd kdcne lin 
guiufcrinckvndtteniger ler.ie:erntger afcmtf 
ns.et mcUo: Vft marinus fubdlce babene c oz 
riccs.Eft ca.m^.ficiniJOnipo cft qualiraa 
amara ct acrfs valdc % calidiras <x acredo if 
dco cripfaYlccrer.pY^rxapxcftusvrilie cft 
arabicue.jE ft aur^ digendue cibue lcws cum 
odo:c plurimo Skcundue cft vndicueq grotT 
fio:dt i r.iger er lcuis vr ferula Xcrriue l fv* 
nacue pondere grauie et rolorie bujrri cu odo 
rc fiiprico cr rnouJaci fapo:cbsber quide alif 
qui smaruudiwm er plus acrechnc ca,p«rria* 
pans qualirarcvr crrrabar.-p>aulue ca.ve co 
ftoXoftuscftca.erfic.compkirfortsin rerf 
riegradu. 

jBprrarionto 

f Smccnna. Xonucnitomnimcmbto 3 
quod mbibtf cakfacricnc: et vt cjc <o artra? 



Kmtsims 



£ 



Z) 



a*> 



batttrbumo: c^mndo.&bftcrgit'pflnnu cu 
ris Unir9 cii aqua i mdle.3n ipo dl vlccratfo 
■z iuccj cftiamaruecriecatvkcra.bumida. 
• f £t ?ucnit molhficatidineruo? ct aftritioni 
lacerTo?:?eftbontfa'arice,acmplaftrueicco 
pucmt Umgicii pucnit solo:ib? pcctoae. 
fjpf.puocatmcnVuabibit^ctrflftumigat^ui 
traiccro:io:tintcrficitferii:ct:,puocatya'na;ct 
eictrabitafcaridcs tycrmco. 
f fitoatviresad coitn:? ipfcfuppontror ad 
aolowe matriaerct conucnit ©olori mat ricis 
nibibirue et fcdedo intjccoctione eiue: ? mo 
uct natnra quado bibtf cu vino.et ipfc ne ©a t 
virce ad coitum nifi^ter bumiditatcm fupcr 
ftuam inflariuam quecft in ipfo. 
f £tciucnit rigori linifue m oko i couenfc 
morttooibusfomotfuivipmtalqs mo:uV 
bus qn bibif cu vino aut abfinrbio . loco rius 
ponitur piretri:mcdierae ponderie ipfiue. 
f D^^oftus cu olco rrftus -: co:gi gunct9 
ciircto ftipticie fubuenit.2>i aii t ante acccflfe 
enc ficvngafcrigo:? m pcriodiea fcbre:? quar 
f aita ampurat ac ctiam paraliticie ct fciaticio 
vcl quito aliqo inembui caleficri opue eft . 
f Onaue cttrabit bumo:e$cj>fundo.inpo* 
rionc vero :q: virtue cft el calida &iurctica.me" 
I irua.puocaf .pcfiarqs adiunctue ide oolo:g 
matriciemirigatmotfibueveaenariebibftue; 
5#.epimlaturcumvtnoet abfirttbio ©olo^ 
ftomacbidinflarionem:atotacw8viriac6> 
pcfativenfrem fhmulat, 
f £Q vmo^aro lubricoe latoe teponft cu 9 
qua potat5olco mioiufricarioi adbibir^ro: 
^terngo:ccalrfacit:eadevmiione tparau' 
ticoecurat.rcumata er fpafmata 1 veloii W/ 
tm1fanar.cuaquamuUatritu8adcftalae fa 
a'r.mcUimi0mflcfaeinfaa'cnaraet>crcrgir. 
malagtnaribnantidotis riccdTcmiftcfut. 
f Bdulteraf aur ccmiitt 1 ) cucnuiemaioribue 
radicitwfcd facile inrelligifcu nec odo:e cofti 
babcar nccfapo:cmo:dacc. fia eomcftus vi 
res babct acreeftringctee z calefaciefce. 
f£?aapionauc.8aueXoftue?ucnttrigo 
rib? fe.qn linif cu coi olco co:pufo pucnit fctf 
atice -rparaliricie -z oibue inquito calefaccre 
opo:ret aliqua owgieparricula velt>e jsfiido 
ad.fup.fiae atrrabcre aU'qucbumo:cm. 
f £:oprer eandeaut caufam.puocat^ metti» 
iiritas vrinam z confert ad eonrririone laecr* 
^caumetadt»olo«mlatcrie:etinrcrficitafca^ 
lidee pwprer amanmdincm. 
f £rquando linitur cuaquactmetiefup,cm* 
petisinenumctftcat eamtt-adiuuat ad ubidtf 
ncm.quoniadtinco sebumtdirarcinfiatiua 
srvoirofa quado (uButur titf otu cwn vino* 




Capitulutn.rjEn; 

^ryOjula.velmdapcrfi:ca frucrtieiftecft 
■" |»0fouenora6.S>aa.li.aggre.eap.bcf* 
V.*Arne8.i.cowla.Oirtueeo? eft frigi.? ba 
mi.in4.$ra.tta#o:tion9nfpaftcie». 

fj£tideaucBlcau$tX9iC9tcolcritgcncrat 
h«o:eegroflbe.j£ttdeaua.*Rafie.0ui<}am 
patiebaf fumofifatceab ali<5 bumo:c ciiiiac 
tnftomacbo fuo^tt>edi libi aliqto vicibue t>e 
crifomolieixo^ulierecaibvwfedame cft illc 
fumue.j£tegono crcdo cpreperiaf cito altqe 
frigtdio^etma^ieiuuariuue ftomacbo cali^ 
do cpipfa z iofaftidifl rollutf 3ui.lt.q.ca.ij ; 
©ccrifomuUe.*j^cUo:afuntarmcna.n6 cm 
ciro aduenttaco:ruptio etacaofitae^acum 
fumunfcrifomula.opo:tavtacapianfmafi 
cteaanifiequalircr.3.i.vfcfad.u.cuvmopu^ 
ro aumno^paffieparuermeUiefuntfri.ct 
bu.in.niToieunuclco?eo?dt ca.2ftc.in.fi. 
f £o:ubumo:cfaaitepufrcfacnonie-cco:u 
infufto lcdar litinuf £tcrifomula b\6c(\mtco 
ucnictutta homaibo cpEftca.-z armena fi co: 
runpunttnliomacuomccpacdcuntvclocitcr 
^oevtroque.af cUwit co^noaimcnti,mdt 



Btlbttbtel 



vtpmo fumafanifum etmafliteummtua attt 
vino ocpaflie eteonficianrur cum mcllc puro 
-olcum nuelei ipfomm eriam confcrt cme:roi/ 
dibus.Grauant crifomnla p:optcr vctocirares 
fue puncftcrtoniG.ve? inrufio fuecommpfcrt 
fcbabne antiquis.Ooba nnee mcfue in arc 
tidorario fuo.Dleum ■Decrifomuuefcdatto 
lo:em anict cmotfoidaruj:': rcfoluit rumo:c8 
vtccrumct impedimenrum tingueettoloKa 
aurium /Rabi mojfce idem vulr. 




Capitulum.r£hl 

aO tula fetida vcl oculUe botRe.Scrai 
U.3figr.ca.bicbarauc.!DYflf.*Bicbar 
iddtcotula babctfitpiremollcnu fo? 
lia fimilia foltjsmaratri:? floe eiue clt c t'trin9 
pUi6fio:ecamomttUfimtliefio:e corute.et i5 
nomtnant ea boc nomine.Et idcm auc.jSslu 
acuftasetmo^dieatio funtinca ptu8q>inca* 
momiHa.ctrefolurto eiuseftamplio: refolitf 
rionc ipfiue.Pvaf.ca4?uralmo6 f m tra nflari 
onenfam.butaunoe.i.corula.:23erbacftmol? 
Ii8.cuiu8 folia funt tenuiter fcifla maratro (i< 
rm'lia.et caulie eihemollie: nafccus circa mu 
ros ciuitari6^o:cs cirrinoe babcns ctvebe^ 
menter fplendenree: ac in oculounn fimilirt: 9 
dincm romndoe.Onde er nomen rrarit flo:i^ 
bue camomille fimiles.cr illa bet ba qucvoca 
w lingua nelira pucida vlcotula ferida:£ ft 



aliabutalmosbftefotia roiCadro ftUamafccT 
iujcta muroeciuitatis cni c / fio:ee fimt q. toro 
cirrini.2 ifta e berba q vocaf in lintjua nfa o i 
culue bout'8 vcl corulaj5atlvi.lim.far.ca.*6u 
talmu fiuefcmen iuco:ruptuvelonUu6bom^ 
nu8.vel comla fcrida.notarn quidc c ir a a fio 
rib? q videnffm figura ftmilarioculo bouie* 
f m colo:e>o fimilie eft artcmidi. magis aut 
ctmultoacriuseltobbocmagis^foMricu 
vt fanet turiaee ccmijctu ceroto 

j0ptrartont0 

flpY^f^oWaeisrritactccrotladdttapufiu^ 
las -z suricics apatum fpargir;? fi lio:ee cius 
t crunf cu croco.f M frirmant atiq q> (i poft ta 
uacru^balneucundcqsbiberitbonucolow 
rcftituct ct facit ipm vomcre et ma.umc arcua 
to mo:bo infectoe acrie cft:ct idco Vfticicti 
ca er^jptcrea fcbcfemarafouiiteu5 ccroro rirfi 
ciue m ctbttm fumunrur.f 3ui.odcK#coitf 
f crr vcnrofitaribp groll ie in captrc 




<raptmtum.tjElu7. 

>ry?}rulanonfcrida.vclocnlu6vactc.ct 
I fcbabetfloKenigroefmanriquajnrra 
v*Aflarionem. 

©prranone0 

f t?Y3fro:i^.ca.£ utatmoc0uetMnflarfo 
comipta eft.quoniam ^erapion^verbis 



iC 



Crartatue 



T>Yflfro:idie f m alialtraflaf tonc.fc» tafroridce 
t>icir cr b? fio:ee cirrinoe fltee fioribue csmo* 
miUeict boc vcrijclt.Tia crrraflario qua flttc? 
gat £5cra ."iSutdmoe bflfta eijrir mollcjo '/ 
Itamflratrifiliflf.oJcmeUinu bne ficutatim9 
i ma to:e oculo vfltcc fimile.vndcct nomefltf 
ccFir/P.flfcifinciwtfltttoic.fScdfintrari 
flarioncnffrm ©vflf.lMiralmoE bjtuae fpes 
tinfl «ft <i b5folia filtfl mflrfltro:ct fto^o fimi 
Icb rlorito cs momillcet ifta r oca f cotula fcti* 
da:vt inp:ccedtnfcca.traetflf.'Z latinci: pu* 
rida»ctP vaf. vocat cum parrcmon. 
% B lia cft qucbjfolia fitia coriadro i flozce 
cirrinoe nafece iujtr a murotf ciuirflt!: ? vocaf 
cotiilflnofcridfl:tlfltinct:ocitlii8 bouisvcl 
oculus xaccci grecc fitr ira fonar butfllmoe. 
fedflrflbiccvocarurbibar.i.ocutoevacce:ct 
ideotfradliftotam. 

f £utalmoecberba molliesnrimo fimilia 
tcncetmirrcerirfoe:*: folifltcnuif fcifla i moM 
liafimiUflmflratro^o:cecitrino8fimilc8Mo 
ribuecamomiltcet ifia fmvcritatcmcft co* 
fulafctidaqucalionoicvocafpucidfl. 
f £ t fubcir .£ ft alia but almoe caulie mollie 
foliacoriandro fimilia.flo:cecifrinos bfie na 
fcene iujcra muroe c iuir aricct ifia vocaf ocu 
luevflccc;vt*coMlflnonfctida.£tfceiftabcr 
bflclibecvcrifaeclareintuentibue.Wgecapi;' 
tulu picccdensfcjcotulafctida. 






.oW 




Captmltim.f)Elm) 

OOcognfdiumXamclea vcl"i£ cjtrcc» 
Xametefl grttcqtiflfiinfima oliufltri* 
cr axocy folia flmilia oliucbabcr.:£cc 
cft quc €i mocrcon ct cocognidiuXlndc ccca 
gnidtfi mcjcrton ? cflmclea funt idej: vr appa 
rerp. pYafc? ©cra.pv fl f«>.fa.<flmelc9 fm 
' rrafla tione n f 2 m /Camelea aut roroc.nidfcm 
baflae bjfup. fcrra5fpanfae.palmie tuobus 
longae:frurc]ccfripfiuefflrmcntofa.5oliab5 
fimitia oliucifcd rcnuio:a 1 fpiffa guflum moi 
dicanria et gula cjcflfpcrantifljScra.li.aggr. 
cfl.mejercon.auc.fcYaf.^tscreon.i.camelefl. 
cft atbultu gufi cuiue rami funt cpti ad ignej 
flcccndcndu.crfuntipfiramic)crcnfifi>circrrl 
tongirudinc t>uo:u palmo:u bnrce folifl oliue 
niff.quia funt fubtiliota cie mo:di( anrifl cr c% 
afperflriaUnguam.etfimtfupcr ramoet^cfa. 
J5altc.vii.fim.fflr.ca.cf meleaXamclca pdo* 
minantcmbabctqufllitatcquocircavlccra.t 
quecuncgmflrimccfcarae babcnncummcUe 
cjcpurgflrepoteft* 

&pn*anone0 

f I fcf afXamclea acctpra coleram 1 flcgma 
tcponif.ticbavcroficritrorifcicicbieadmi^ 
jcfoabfintbiotnipliciminfuratvnapartcca 
mclceetcafflpuciciuncromcllcvel aqua jto^ 
Ua riue impolira vulncra foulida curant 
f 3obance mcfae.U£}Cjcrcon fiuc cocognidi 
um folutionc cducit aquajcit rinam ci.m fo:ri 
rudincvcbcmcnii. 

fl £ t t>i)iit 3 lcjcandcr.mtrru cu rcte cducetffo 
mclaneolia cdurit ipa m .et cu rctc cduccnrib 
flcgma educir ipm.t abflntbiu tupUcatu 2 1 tt 
mirabolanie:addnnteibonifafe8nofa6:«fa 
ciunt cducerc coleram.fi^aiue afir iuuame 
rujquod cjcco eipectflf rit £dvdropifim.cdu 
rit cm aqua pgrega ram invcnrrcmocct tarhe 
cpfl ti immo 01 b mcb^ie nutritionie ipfine 
^jErinterriritliibricoe^^mce.-z folutionc c f / 
durit eoe ct ferpcrce vifccru.E t fi fiat vngnc^ 
rumecco^mcllccuratfifiuUmetvIccrfl Irau 
dulenra. 

f £ t fi ec accro t>cc octtonte ipflue flblurio ict 
confert r olori teriiin ct «moiiem .1 gitigiue 
iaguinee er mollifica t ici f £ r fir ct to vngcnru 
€t accro zckon ccra ad fcabicm bonfi. cr fir et 
co Uniamctuj cjifulf bure 1 mdlc 1 accto lo:r i 
ad mo:fcsm 1 lcntigince 1 barae 1 tcler cae. 
f5 £ t qncp fit pfrkatio iEfi mcricam a baras 
cu folqe ciue er accro 1 c: tucl t cr vltimum 
f £ t tiiitpcbamciv £ occgnidit .m valcrad 
quartana.4 ^lmt^W-^oltiemtijfitua 



BiSkflM 



ablTntbi: ptibue fcccoc ffe co^fnca> cu mclle 
poro.fotriectia impofirievlraa curarur ? pur 
X ganf.f 3ireiianudc0uomodo coltccm fa* 
tearcicftocuueiumcnforii ctpecorii. 




Capitulunwlu 

r /ryT*ocue.&M'.U.Q\fceaocoXroc9me 
V .> fliojeftreccneboniodoaefubtiliefur» 
VaA cuius piloe € parum albedinie no plu 
rimumXrocue fanue no veloarer t ingee no 
inuifcamrneq5frangif.ca.cfiin.u.fic.in.i.cfl 
ff ipttcue refolurfaue:Tn'geftiuue agtotinattf 
uuexius caliditae cft foitioi ftiprfcirare eius* 
craueoieucftcalcfaaiuu.f ;f>la, £rori funt 
fcue fpcace.prrefts q in o:rie nafcittuvz o:ie 
ralf e q wo:iente3 fte in medianie no vonu 7 / 
rie poni&inmedio fteul trce vtl qrroo: fio:ce 
Eui nafcttnr\£tigendi funt fubrufi.ci aut a'm'4 
nitarie au'c\dJ?abentabqcicdi.in'faeculo ftri? 
cro ©eco:to fcruanfcper o,nqj arittoeferuari 
pofuint.uirrnrebaberpfouariua er, cjlir arito 
fuieereicaromaticitate.^ , ^allaili.iiti>3nfe!' 
buiario mcnfeicrociferendi funtbulbi? fubrf 
lirer fi fuerinr arre fech'aidi.f £?aa.li.aggre< 
c3.3amfaram.auc.t>yafc3kAfo«io:ein 
mcdicina eftnouu6pulcb:ieolo:ie:cuiue cri 
iris vcrgirsd albedincilqgugJio fragilie:ple* 
JWeic) qn fricaf «n £it mmti cito acuti odorie 



f £5ar.vrj,fim.far.ca.©ecro( , o fm franflarfo 
nearabiclSusbftantiaciuee rarea frigida 
fed qrj vincir fu£ ea ecoplejiio calida.et in frt 
po:etiueefu]pria'faepattca.j£t^tU8ciuecfl 
q calcfacirinfcsJo gradu cr ficca in £ mo.vnde 
marurarz t>igcriralic]U'maruraricc.7 qti adf 
1'uuar ad fcoc eflipticitae pua cj rcpitur in eo 
£recrmedicim'8 pglutinariuieer T>i£ifiwi8 
er noe twcimue cr medicine ccglurinariue t zi 
gcfiiueXunrille in qbueccaltditae^no fo:r^ctt 
paucafttptiatate 

s^prrationf0 

^3ui.*j!bom6ipiuecolo:ccffiaVbonu:rcfol^ 
inr apara i limt ejc co bcrifipita .farir fcdsy.a 
ipenocetcapiri.^tbibifcurobadeb:ieta^ 
re^efacieefomnu.etobfcncb^tfcnfue.^co^ 
ferr apoftcmaticalido in aure.Sbflo-git viftl 
^bibet flujcu ad ipm.f £r vaierad pannum 
fcr/ir c]c eo alcobol ad varfet are accjfira i egn' 
rttdinib?:pfo:rarco::elenificariu5odo:arip3 
pleurerfcSrpbirnaicue vt to:miat:?$>:ie ei9 
olcum.f^tfacitarsbelitiifacile.tptotfatin 
iirumta anbeKrue.ipe 4? facir naufea:-z t eij 
cirappenrii,fprerca cy eppefituecacetcfifari 
qein ftomatbo.f S5tpepfe:f3t£cma< bu 
^pfaiKtf q^inipo csccalidifatesppsirario* 
rie z (ripricirate j£r cijccrur^daicrcrocuo c t o 
riue fpleni.cjc_cirarcoitu:et # p uocar vrinaf £ t 
pfarxjuriciciinamc^a^pftriaoiivlcerib 
fraudulctie^n ipa tn admiftrat cu5 fauo auc 
cumedulla cttt>ttpIoipitt8^aIio.f 0uidati 
fxrurcr ipmin poruiccdaur ad^luu pai rfj ct 
facmeeparm8liaum£r^:craurci.tri.?5ipo 
inrafieiur lerificando . loco ti$ ponii cerefto 
cqle pcdue ipiue.s fce Iptca cjuart vm pcderS 
ciue:2 pcdue ipiu&XiecoitkHx) cdfic iigncc . 
f£tidciiij.fen.canoni8fmi.ca.q.ait.<r5u 
cit medicinas ad eo:.f £r idcm tcviiifc co: 
dieaircy ccfo:rar co:f 3e.auCKi2fie.5uit 
mulier qda q la bo:auir alic\to tict» inp.rn: et 
ttedi.ubiinpotu,5.u.crociapeperitfiaiim:et 
ecptuefuibocfcmperctfcmperfuit fic factu? 
f^rccueindjtiarincb^iaricefoniicinporif 
invinolaificaradcoitonccfaciarinfaniaci;^ 
ctllcnri lericia^^igaircibu:-: ccfo:rar l.oma 
«bufuapcticitatc:etfo:tificatcpar.j£f nc tau 
dafcatb:o:aufertappctituttbi:7^iiocatv:i 
na % mclio:at cclo:Sf "Rabbi tvo\ fcs. ?* o o 
coaitovaugetappctimmcoitue.f^faacin 
viaticocaxeemigraneaaitiq-nttmplafi^ejc 
croco:gumiarabico:eufo:bio:aminbatqlt> 
terDifttmpcraecu albumine oui.comra cmi 
^ranea3.f •fcautasca/DCFedagra/Rccife 



21 



P 



£> 






B 



Q 



Crartatus 



^eucu^Mo'ouo?ctolcuYofa£?aquItTtf 
farHmctmifccantur;acum pennavnguatur 
locuspodagrecpco actu frigido 




£apitu!unujEtoJ, 

^^J^ma.tJbifctcndumct/ cuojmerce 
9i rwntinckmce^ndifmftfdam.Sjed 
^* A ^efnccap.tc aicumcrc afininovtf 
dcf ©iccrcQ*funtcitruUi.^S?alicj tiriit <? cu 
aimer-cs funtfructSficut atrulluoblogt tame 
nucp citrinefeunt:? bobej follao ita tifiinctae 
ncutmctonce.?cumaturanf bfit parutmlce* 
<Knt'8:erfuntinfipidi.qtf ego pccdo. vnde atf 
aimacs non funt melone83ndi.q* Sm.uti. 
cnn.ca.t»ecura tcrtiane purc ponitmelonem 
^lnduma cucumereergonon funtidcnn 
f ©eraxicitCucumercs nofunt citrulli ftf 
aJtapparain<:aXitralto8£teria£>era.tft 
aua.0af. cr citrnllue frigidioreft aicunurej 
crgo cuatmacsnonfuntcimiHu 

Bptrationts 

4 Serapictn iuaggre.ca. TCacrxra^ucgal'. 
id cft cucumcre9..£ ucumcrl fubftaria c groffa 
tura tigcftioni» genera cbunujnaui paratii 
corrupnoiquiejnelonftt cmScoirupfibOis» 
ict|?tU8ci9c4infrigidateti>uectatin.u.gdu 
%fbt moUit vctr^puocat vrina.£t qn fumi 
cur oirob aut m lactc ?fert v Wcrite vetat 



fcdatinflationcftomacbictfmimqneomcdif 
ct fcdat fincopim oc caliditate et eofert ci ctp 
ptierare qua bj. $ £ t ideaucr.lDabir.Squa 
citrulli pfert inftamatoifevz fcdat fjti: % iatat 
ventrelaicationebona fine nocumeto aliquo: 
et tcbetbulUri cii juccaro albo. £tno opo:t$ 
cy t>ctur babentito narura t ura nimis ad mo 
uendii.qu ia illa no babct v irtute tanti <$ W' 
atnaturaturam % ':, 

fiitfiipafcceritmojaminfromacboforiitl 
inducitlabo:eanocumctuet inftatiom»; 
f^ 9 bbi movfee auc.jSaf. £ucumcrc8 % pcf 
ponesft riro no tigcranf.fiit venena moaife* 
ra.fj6af.viq.fim.far.ca.Sfikini8.vidcfticc 
requucumaticafoer*poneaoimcreia t>i 
ao.i^ticit©iWni84.cucumcrefibili8ci.ci^ 
dempeponeftfubnlio^8 fubftatie.o,$oni> c 
talis grofftoue fubftatie ac cria abitcrfiua et 
tnafiua p.ticipat ^tut e.vnde t iuretica funt et 
fpiiididumrcddur co:pu8.t marimcfi ficca? 
uerit quie feme x> einde incidene et crib^ne le 
nirefaciur.tominafautin cis frigida-z bui^ 
da coploLio :no tn fomtenfed in feciido gradtt 
locarur. f SivaoquiefemenTiccauerit 
velradicenon adbuc bumide natureerir; fed 
iam ticcanrium in f mo quafigradmvel fecuni 
do ineipicnrc.£ft aute? abfterfio inbieplus 
cpuuamefruaus 




BtHtAfs 



& 



€> 



to 



w* r funx arboies lanigereifcruc eria cticur 
^-^bicas coronci maumasnicudinc: quc 
marurirate ruprctonuginispilae ciidut er cV 
bus vcftes p:eciofe linrbco faciur C3dcmli. 
rijcXucurbitis eft narura cucumcri fimtl tu* 
tajtar tn n3fccndo.cqiiebycmcodcnmt. amac 
rigtiaccfimfc£?crunf ambo fcmine in cerra 
fcquipedali fofiura inrcrequinoeriitvcrniim 
ct follticiu.parilito ramenaptiflimc^i liq ma 
lute)tJulendi8^>arc^aicitfbitae.4rfnoni8 
cucumeres et pcr cinqnatros fcrerc:fimiIt;mo 
dorcptatibu8flagelIisperarteftimafpcra;iti 
rcctu vfcp fcandiitnatura fublimitatis aufda 
virefqjfineaminieulo fcandinon funr.f ^al 
l9diusli.iftj.3n menfcXbarcio eucuibira fc 
rcnda:amatiolu pingue bumidu ftercoiatuj 
folutu boc in cucurbir$inngne cft q? loga pa$ 
riunt ct cleganria fcmina q in earu ceruice na* 
feunf.qucmvcntrefueraMcucurbirasfaciut 
crafliozes.jQucfnnjndolatacfiincacumini^ 
bus obatanf .vbi adolefcerc ccpcrint air.mini 
culie 3diuucnrur.jCiucfcru9nf ad fcmina vfcri 
ad bjcmc in fuauir are tependeat ,t einde fub 
late infole ftecenf.aut fomo fumenr unalirer fe 
mina putfcfact a tepereunnf Sfera. li.aggr* 
ca.baraXcucurbitaXUrtuseius eft frtfiidact 
bumida in fecundo gradtt. 

jE>ptrat!onr0 

f £vai.ea»ctuwbita.£ucwbitacnida rritJ» 
ct catbaplafmatitoadbibita papulas co:p.ia 
aropu at.9poftemarieaudomaarau^fidiue, 
f©ucc$rafureei9t>olo:ec9lidu9uriuinin> 
gat cu olco rofaru mijtc 9 ct aurito tnftillarus z 
cercb» appofituecftuatoes infantiu mtrigac 
f^tpfertapoltemantocalidtsqfiurinccrc 
b:o co?.Z.uouto octilo:u opitulaf/fcodagrtf 
cis macimum pudtum eft. 
f Elijta cb ct etpufia mcllc s nifro addita i U 
bita vetre mollif .cruda ct er.cauara i vino trri 
plcta fi fic manfcrit vna tte ct nocte et ponea 
btbatur ftfr vcntrcm mollic 
f £radccrtrireleniunr omnc" rtimotf. fuccus 
eius tolo^tsetiumttigatfi tiuriu8ino:ere* \ 
&earur :f j et oleo rofarii mijtrus eji vncricc ro:* ' 
Eiaad morus fcb:iu rcftringitflrdo:cm. 
f £t qn fit cmplafirii curafura cius i mcdulla 
panis fup. podagra calida: sut fuper beriup tf 
laccfcrr.f JCinisaridi co:ric$ efticacircr pct 
cobuita fanarc.j£.unde ancrcticfnwe sb ctfi 
ris vulnera in vcrctro ta inputrcdinc$fa pur* 
garcvz at cicatricc gduccrcpodagrecftuanri. 
cr tgnito faaiscouiccs vtridcs fubucniunt . 
f i5emini fieca flla vistradif vtinputocran 



rtsnfum rtfnfpcrfumfmplcatvutncra qcaua 
ta funr:f ^ncito nimpra flcmacbu rdajtat 
bibcdi tcfidcria nc cjLcirat.fuccu8 rcpcfacrus 
tolcri 9uriQ 3 cjc inflamarionc ealo:? firinfu* 
dii bt rr.ccrsr surccrinfrigid arcbundarcr, ct 
pririafiminfgnriumrafuratcpcllirciimpolc^ 
ta,i:cc cadcm cictr ©crapionauc.pYafco^ 
ridi8aicet fub ^ltjs verbie. 
f2Hmanfo:tr2Cf9tuterfto.c9.tcfUcUrbtf9, 
tuctubitacftfrigtdaet burittda 4 ficmacbo 
malaaiftcns appetitum tcftruit.firim c]jfe> 
dattct cpattss Itomacbi ardo:cm cfringuiu 
qnincie^bundaccalo:. 




CfipiiuIum.r]EltJttfi 

^rytllcafta ftuc £afo.*jSIinf.ca.tccuIca^ 
I Jh;fia.Culcafia qul alt^ jCyamon voeat 
^A^nobiltfitma banc in,£grpto envlo me^ 
tunt.caulecucocmetftarcnoioinmandcdo* 
^uflb aut c\ intra folia cmicat fpcctabtli M 
Irlslatifiimiseria fiarbo:c8ccparcnf ad fimi 
litudtnceomm q perfonatia.i. lappago ma? 
io: ttcunf piti Py 9 ^ oridem inncftris parri^ 
toyocamus 9quenvli fuis tonto gaudenr vt 
imp:cfii8colIocaficfoItjsinvariamfpccieva^ 
fo:um potaregrat ifiimiibabeant u&cc t<r 
bacftquatiaicoridcsvocatfabamc^ptia? 
cam.cuiu6p:op:ictatC8ctvirruree fm if m in 
«eniceinliKa-afabaeevpriaca.tciftam^bl 
K 



Cwttfltus 



s 



p 







s binnfgVP^faiitvorflf.Bufecnna'buIcas.tf 
qiia ca piniul farir »n fccunclo canonc. £ft cm 
cnkflfiafarienotaincgrpro apud macaro* 
rcs pwcr iaree.? in &\m*£t cgo ipam ba* 
bcoSalcrni invindario mco fccuefpecrabtf 
lcmfontc:cjculca. r iaviilgari nfovocaf cafo. 
£uiuefolia aquiemo:evafb? plenaefirow 
cr conualcfcenriu menrctclecratmecnd coui 
amnuljqccirant adbibcndum 

Bpmixom 

f £ocra.li.aggrc.c aMcas,(^ulca(ia .jfn fa 

poicbwueplireeftaaiitaect mozdicatto mf 

tatnipticitaepauca.ctvtrtuectneedcalidfl 

in.q.i qncoquif pfert ftomacbo. 

f £ t ideaua.Sben *£>cfuar.£ulca(ia c a9 

ltda?bumida.?augttfpcrma.?radi|Ecoquif 

a babctbonufapotfXf cft bona ffomacbo* 

ct appcrirom p:ouocat? vrinamXft ealida z 

bumida.er augct in fpermatc. ticc bcrba<cft 

multucg\ptU8nora:nafritur iur.ta aquae et 

babct folia magna et lata.? radic cocta z co4 

mcfta augctco:pu8* 

f ^auludca^ecuIcadaXuIcafia cfl bctba 

oib nota .-rnaftlfiuitfa aquae:cuiu8 radijc co 

mcfta ct cocra flomacbo cft vrilis. 

f 3faa c in nicrie firicularib cap.tc culcaffo 

£ ulcafia c bciba in egypro nafcene aliqnru? 

lupoivica aim ccuirate.vnde monftrarur ea 

hdactbtimida 

«ifCuiueradiicficIiircrur^cumencmirrif.ctv^ 

fccfirae qua prius larenr cr bssbucrar i ea agra 

fict . 3<icocf curigromq:. nurriroenri eft ficne 

rariua .fed asm fui poutirifatc ftomacbum co 

fouamventreccftipat.Sitnmodcrarcco^ 

rocdamr bonum genaar nummarm. valct* 

cg.'Diffmrcrict8aim vifcofirarc ct ponriciratc 

quambabcr 

fauiccnnnali^.ca.bulcasvVculcalTia.fft 

planra in qua c sfhmilario tc altfnen. jCalida 

£et ficca in v mo firaduX r in fpa c falfcdo ca 

fdpriritarcaparteeeiuenofunr fimilce:?eft 

cuminfiationcpauca.crfircrea fiarfiarifm9 

m tacrc ipft ue % fale.t in egvpro tecoquttcti 

cecaroaniiiafcuolco 

f£fclhlliecibueCifoIutionccductraqulc^ 

trinamcr^ziefcmeeiuectftjccuetpfiue.-zmi 

nowiurct; cavtfccbiliret 

f -frrouocarvrinsm :ct ficnctat fpama. ctcc 

pcllu^oleraVraqucfiratccumfacilirarc.spo» 

tueeisfitabvnatarialttoevfcgadfcuasra:*' 

riae lib:c. 

' €apitulum.#i£ 




^tyafcut3.^cra.li.flggrc.cflX afuebi* 
1* * I»cufcut a.£r cft res q adbtTct babie in 
^mA. uoluce ca Ucut fila Hcd in fitmirattb: b? 
fructnfubrtlc.ctipfaaefafinarbo:ite:rtifii 
mitateriue inuoluif fimul.*Rcperirur tc ipfa 
mttlmm in vincie:cr fccftruir mulrum bab as 
ci inipfocftamarirudoXridcmaucr.Sbcti 
mcfuaf £ufcutacft bcrba q rernrur inrra linfi 
ct fufpendirur ci:in cuiue fapo:c cft aroariruj 
do % pdrtcitae plue amariwdinc.ct virtf etuo 
cft calida in p:imo ctficca in.ij.f £tideaucfi 
^cfarufiie cH fri.i buXt idc aucr o. alabarf 
^ftccpofiraprrarqetrrwto.? cfhnca ama^ 
rimdo i Iripriara8.rt ecau4np i rtfic.in.u.,£r, 
idcaucSabo: £bcn.£ iue calidiras aut fri* 
fiiditas cft ftn ccplcjrione atborie cui adbact 
qm fit ca.p. adbaeria calidc ar borie^t cft frif 
fiidag adbaentiamnifitdc. 

&pmtiont* 

f©c.au.6aI£ufcuta£bftafiitafo«ifirte 
ctagit opflatdce cpat^ct rcnu ctfclf.f £t mu^ 
dtficat vcnat fubriles crfiroffaeab bumonto 
firoflie i colcric^ fomficar ff omaibri i cpar 
i ^fcrt u rtrioe facre^b opilatcccpat! i ftbri. 
ctffnic fcbtf infatiu.t purgar colera.f £ t idcj 
auc/jKjcfarugicXcfcrt ictcncic et opilfltioni 
cp.atletfplcm£f£tidcauc^UbanX&tai 






Btijtxbk 






ftomacbo etepari t eoal ottfaricute.t cjcpettCt 
ruefiiiuatcsnmio? ct" vcna?; ?mollif venrrc 
et?fertfeb:ku8.f£tfcc^aetatea'U6ectptf 
lerefiipfluitateeanriquaeaveni8.f £t idem 
fluc.Sabo:*en,£ftbonaftomacbo.ctma 
umeqii mifccrur cii ca anifumifcmi«a fifia. 




€apifu!um.rl 



/ T yOlofonia.*J!bli.ca.iDccolofonto.*^ic 
# r erica fic t>icta ab erice filiovcncrts-.qut 
V6/>victU8abi:erculcmurat9dt tn mon 
tcfmlnois.jln 4 m6tecrefcutarbo:ee:c|?guV 
mi ?5: colofoniaitnde cririca carpoefTucroe H 
liusarbozi8i£t «3:pt!Cgreca:q:t>eca igrecia 
in mlra qntitate inuenirur;f -paulue in ca.t$ 
colofbnia:catida c in.v<.? (ic, in p:imo. 

J^prrarion£0 

^CdtratimnterilfitfuflumigarioccpuUJcrc 
ipiue.f £6tra tenafmOnecjcfrigida caccpnl 
ucreipfius z nafiurctj cqliter m^tis fiat afper 
fio fttBrcneemdIecaljdop.uncto8.fBd ptf 
toe^efacieremouedoe-z facte ©caibancant 
Bccipc.;'iq.colofonie.3.t.maftici6modicuaH 
moniaci puriflimi h ©uTowciu vafe rei reo no 
no et mtido n ad vlttmu trcs gut tas armotiia 
ci ct mifcc etcola fng aqua fri^idam i mifce i 
malaca.jC.it autvolucris piloefollcrcrefoluc 
paucit «d igne ct m qntuui tcpcfacttl po ne I u 



p<rfaciep.Tnabo^'vdt>ttas^o(?ca rcmoue 
pilo8rem0ucttfacfet>cpuraf.£tfiflocti8ftc 
catue eu pannfs cf parii eu wgito madefacto 
piemevt melius adbereat/jbotcft fllud empta 
ftrum fcecies appom':et poteft fcruflri e tmoe 
tice.f Xotra afma ccfrtgidacaufaHiiaari^ 
ettftenf e sigcfta t fcuToluta acctpiar pflricne 
fnmumperoe, 




Captfulum.fil 

vry.£ra.j5alic.vti.(Tm.far.ca.©cccrafni 
•-^tranftanonearabicam.ttrtueeiue^ 
V*Amaeft:q> efteje mcdtcina media inrer 
caUfariemcecfin(Hgidantce^C]cficcanfc6ct 
bumcctantee:niu q: eft cii boc grofffl rCepa? 
viTcofa^f idco no Colupeficeat.vefuetiambti 
mcaar p.acct'dcne.poftd|g ful vifcofitarcm 
,pbibct refolutioncm.£t ideeode*ub:o Cjc co* 
decapittofm tranflajtioncmgrccamXcra in 
medto cqualif cr «ft calcfacicnttu i iii rri. ? bw . 
?ficcantium.£?abet &ut ejd groiTammparfi 
um i empiamcutv^fpter quod non folu (icm 
fedctiam^maccidcnebumecfatfo^tafitevti^ 
<$ videbimr^bibene tranfpirfltionee. Onde 
a mflrcria cf t atiquoul farmacomm que calef 
faciimtctinfrigidant.3pfaautefmipamio« 
fcigcftiuie vtiq? crit fccbiuto no intra co:pue 
fumpta:fed cjctrinfed appofiraJfcabetcm c\4 
paucu t yafo Wicc ct calide vir tut \ q plui tmtl 
participat'mci.fj£tScra.9ucfo.PYaf.^e 
lio:cicca eft groffa mtidaa fo:dc.in cuiue C/ 
do:c cft odo: mellie/r cft iri coto:e eiueparuj 
rubedini8.£t illa que cft fllba per coctura m? 
pinguiedtpoftipfam. 

K iq 



Mm&tm 



25 



cfcc apofonnrhct couenit afpcrirafipcctOJ$i 
qwandopomifug ipmeiJolco violato. 
f fetmoUtficatnmiostvlccra.tmarurat ct 
refoluir refolurione fc cbUi.er no 2 3 medicmia 
qingrediunffncoipoJcifcd^iUisqapponu 
mrqctra.crcfimaferw omniiemptafiroJiica 
lefacicitrium i innngidanrium. 
C£f idc auc.pvaf .Uitttie c" motliftcariua rc* 
plcno vlccra repterione mcdiocrt et non fo Jti: 
sfozmanfeiccagranainmodumgranozii ge 
gucro.tbibunfeKCie ©ecemgrana advlcera 
inrdlinozum 

fl Erpbiber coagula rioni lacris in mamilUo 
lactanritta qn ponif fug neruor afpcrifarem 
moUificatetlcnixipfam.J^tcfthipcrfluitae ec 
fozdca quam apceeqciut e.ura Domicilia (m 
?regittirwaUteartJ8.pjo quo lcgeca.apcsin 
tractatutKauibu*. 

fl D fafc.f m tTaft«rioncgrcc4£era vfflie cft 
rufa :cr pinguie i odoza taodo:cm bne melUa 
mBnda.et dt ponric4 1 crerica.alba ccra ? pi7 
guisiccunda babctvirtutem 
f^catbareficceramtebeBXcrlalbaindde 
minuti8panibu8etnnrtcincacaboRouo:ct 
mitTaaqua maririmaimponefoco:ctciifefol 
ueritfggeoefugmtfinitra.et pottc$ bis aut 
terbnlUcritOcponeeS.O^o^uTaucrit Uua 
©ccacabo ctptirgafozdKiemnfuerit. £t(ct 
cundo id fatia8rr timi bulticrir.mirrc ibi fun* 
eJumcacabifraeri^anriUudfitrotundUj aqua 
afpcrfumrz •oefau cere quod lucrit vcl beferu 
ponein folc aqua pcrfufum.Flam erlmo inler 
rutii afoum facir colo:cm.£Urifo,8 suti aqua 
falfam plue mifcrir .pUic albam ctram facif. i 
vcrtio fupcr babam ponttur: 
ifciirrueefi omtccra rcrmanrica tplcrorica 
mifccfatitcfuccteiptutibr^fcrvjffintcricof 
cfifcctieadiilcroalicinitlUeqiiotJecocfiofiat 
comcfitbitisanmodii ptllule trisgrana acetf 
pra (oagulst laemammie fcluenLVirx cfc>ab> 
oiseera relajtaret»urKieem.cUitcr 
f £ft cnimmcdia intcr caUdujnef frtgidum: 
ficcumctbumidum.CindematcriacJtaliouij 
medica mcntoznm,qma cjr, ea lenfiruunuir & 
piibimatactalia 

Capttniutn^It) 
Cato 
^promonta 




^TRabi movfcexa.te carBib>.aac.£§arX9f 
nce volariltu in cozpito calidie gcncrat mlta 
colera.-tota ccrcbzo funrmala fiomacbo:fed 
fcflicuIifiallo^funtboniaidqSozifcjcaiaUh» 
filuelrnb; eft* mcUus $ eji tcmcftu ie.tr cutfl 
da funt aialia vetcrara i viitna partute bzof 
dia galUnaru cUptr arii adopra n t c cplcji tbncj 
?impinguantcozp.a.ctpulU colubarn tnduf 
cunt t oloze ca pir t eXurrurce cofirmanr kn r / 
frim.SallinictgalUlajcantvcnrrc.-jSauoitc» 
©iffoluurcolica.f £arneeedinc fcre pucmult 
oce alia8 carneeX arncs capzcoUne cozrcbo 
rant fpf e.ct rdar^mvirtutequeredravaletj 
c ontra ftncopimXcfiitult gallozu funt boni j 
emia iuuanr«cfectoe;amultunurrumi ctau 
getfperma.^;3uuU.q.ca.i3ccamitoXarnc8 
bonefunr:caro ouinaquccu caUciratccfubf 
t iliact tuuenu capzarii ct r auro?.i comcs ilio 
ru q x>c cie funr gu i magie funt fufccpribiu» 
fcigefi tbnie ct fub tiUozis nutrimcnri.it cdina 
CjUide cn.inor fupfoutatu cparietinaf £a; 
ro lactatie laae laudcbiliifi bona lactef on 
laudabili efl mala.f £ tcaro ©ecrepiri quceff 
c% ouib? cli mala.ct ftmtlirer cjcfcnuaridi ma^ 
la.fXtcaronigricftlcuio:ctfuautozwfimtf 
tirercaromafcuU.etrtibca titiifacjt ammali* 
bue plurimc pingucdmis.t albc funt lcniozee: 
et varia efi minozi8nutrtmcri.ctKaratin llo? 
«iacbo;f ^eUozcaro ct tigclttbiUoz tfi illa 
quc dt circa 08,ct tie.ucra quidemelioz ■; leui^ 
dcq? finil ira.i cj e in n ccto laartozu mO cio? 
cft came nauo?.f £ aro aut lajca lug qua ni$ 
■ clt nertme:fo:r a 11 c elt fua uie:cr^:u quc cit jp 
ftcrg.encrationelact^ucutcaioinaititUc.^c 



mSmUc4ufdcmiftim^!cftbona.^fi teaefl: 
lac cft groflfumXcfticulo?. vero caro eft mdt 
o: slqe.? rolucnl ejdccare mclioze aduracb 
ct (ralltnarunni fubf iliowm earum. 
^fDmnie p:ercrea animaUs ficec complccio^ 
m'8 caro parui cftmclio: ficur caro cdi. jfpfa 
enim eft bona.cap^ina vcro non cfi bona mul 
rum.erduebumo: fo:ratTc cft maluaj^lde. 
&ircinaver<>caroeftm8laabfolufe. 
fl£rcarolurto?irwla.£t oeevolucrfs ma* 
gnc aqua^ male.t babctes eolla tonga. x pa 
uo x miluuo x palObtoe durcplurtma gcncra 
riodtmtlancolica.-zpaflcreeoes mak funr. 
meUo:earocEfuudrritoeftga5d.fccindepo:* 
qftlucftree.fjaeftveloctor^igdiioiscptio 
mdtica.? plurimi numincri.caro cius omntf 
noJiccio:eftcarncquadrupedi8. 
f £r caro vaccina ficrio? ccajjna. fj caprina 
dtficcio:zcifficiliot1x>i0diiot3carneoiJina. 
caro ?vrte?e>ebemetior$cakfacrct87 grof 
finurrimeri. Zcporis $o earo ca .dl x (ic. p q 
legecapirotu Xeptt0.inrracrarut>cataUbue. 
fjCartteemagru^aiaufutfirofieanatlto 
tcaroaqitarica?dtvcbcmctt8bumiditatT^ 
rft^inqua in boc carni ouine.£aro vaccm 
plurimi cft mimmoiri grofi a mdanrolica cc? 
ncran8c$rirudine8mdancoIica8.-;quod di 
mettue dt caro virulonim. 
f *Jbo^cllo?toparutdinurrimeri^)ter fe: 
tirudiue fui rdeluriois x vdxmeria luc bumtf 
ditar$.£t caro anatfcft plurimi nutrimai.no 
maittitinbouiratc QiNimqx fimtuuXaro 
vipcre pfat.lcptt.earo ericu dt bcmcctariua-z 
pucnirlepzczYtiropifi-ziDoloHrenuXaKra 
ita^puenitpuncrurcvermmvencnofo?. 
f £ini8 carnis afini f m 3uiccfi. i epatl riuo 
cii oleo fuf»pofir5 vfilet cotra fciflurae frigo? 
ri8^©eletfaofuto:fanatlep^.c6rraeri8ejt# 
ficatarefcdaiiniurccarmseiue.£parri9a0 
farum iduno.comcftum conueuit c pilcnrie. 
f Bucrroie.in U.eoU!gct.ca.t>e carntb.^c^ 
Uo:care c^votardttoeftcarogalfine iuucnia 
fane x pinguio.^b^miriibitc^pJicrare in tcpe 
rado ccplcittone.tiprerea bJoriiu fuu eft oprtf 
ma mcdicina lep:oJte;q: % crcb? t$ augmct ac 
fubftatiimicorEis^acuttingeniujfcjcambu 
lariuis poft ipas i caro cc}iix poft caro aricru. 
4 £5cd jSaUcno vidcfc/c arnce ritulo? func 
intUo:c8carnitoarictI.j£t3uiccfitncir.'<^c 
lio:can^uepoMina.ifcnrirerillacaroena 
ruralio: boito ct> tlla caro aiaUu ambulanriu. 
x ml'ri viruperst carnes agnoc yptcrea qufa 
tsominariir muUa bumidiraelupcr cae. 
f *RaitBXfimce agno:um fcnr poft bonira? 
$emcarnium edo?um.ct ejcrolariubue.cr ce 



UudabmbftmfcarncspcrcItaim.TccTtsccW 
nanrpanimladfrtgiditarcmerficcirarcm-zfitf: 
ficurgallinetieferri.^ babetimopzicrarcin ftri 
gcndi venrrcm alfe et dircSed tunures (Qt 
fimilirer boncfcd t>eclinanr ptue ad calidira* 
rcrmerbabcnr mirabilc p:opaerarcm in acu; 
cndoingenium. 

f£olumbcfuma.ctficct.groi1tori6fubftan 
ne cprtuturce.^ rpulUeoaJ babcnr bumtdira 
tem fugfluam.cr boc figntficat grauirao mo* 
tuum ipfozum ficur ftgaificat ealo: co:uj acni 
ali8tc.j£tfantumt»ec3rnitein generaU:fcd 
infpeciiUtnuemeeinfcTiiw ©c animalibue; 




Capttulum.tttt't 



/Tyafcue3tdo:u8.CafaJ5vocaat qn* 
wk b(i careum.co cy careat fcro/Bamq: oe 
^•^•ferumci f cducirur vrpondus arguaC 
•^aUadiue./Cafeuemcfc^avo coagulid? 
cft tofinccroctttferuoctJcdud ttcbenvt cc 
podcrtfeatguaf.X3bt^o lolidari ccpcrir topa 
f o poneduecloco aurfrigido.fr fubinde x>c 
P iTuo ad aatsp acquifira foUdirarc pondcrif 
buevrito ac to:refacto fale ©dxt afpct gi.crii 
turio: vcbcmcntiue pKmi-^oft aUqiioafci* 
C8 folidare k m fo:muleper cratce ira ftaruan 
tur.neinuiccm fc vnaquecp conringar ©i| 
asre5locodaufocravetorcmoro:vrrcneriru 
iine feruer a rq? pingu cdln e.aicia cafct fnnrsjS 
K, iiij 



S? 



ttartatua 






£ 







Z> 



^utficajsfiitautfiftulorue.qScwdtitfifliitpa 
rupmafcaut fflleenimioeaccipict.flut calo* 
refoUevraf. ^nrecentieafeopruicndo aliq 
nucleoe viridee pineoe rcrii t:arq* ita lactc mi 
jctogclant.aiicitbimutritutMnfercolatu 
pgdanf.0ualccuc$etiafflpo:eveli0efticere 
pot crio^diecto qtf elegerie pdimero.fcu pipe 
rie:feu cuiufcuqj pigmcnriX k li.t>c na .re? § 
tft £alie. Xafeu generalirer cfle malu. l>e m 
cafearapura tft int clligendu. Ha oc triplici la 
ctiefubftatia cafeus e.leru quidcmbonum cft 
i butirurncuu8.cflfeue aur£ fepifliritfOraqj 
cafcue lacti vicin9 et craflue ac burirofue bo/ 
jiuoeftafaniefanue. 

©pfrattomfr 

f ^lioOzoaftreefniDeferto folo cafeo vfriiTe 
annie vigint i:ita temperate vt no fennVet pot 
lo:em alicuiuemoU?i. 

f 3demli.nXafeue no fitcpvtrimqjtcnra 
risqmcowlacnoncoit. 
f 3de^viii.©cftiuecofdcerrect9eijno ca 
feo cjebubalo traditjftoinacbovriUe.o, non 
fuc falfi.i .recerce.Uereree aluu fiftur: co:pufr 
qjminuutftomacbo vriltozee.3nroru falfa 
minuunt co:pue:alunt molUaXflfeue recencr 
aimelle figillflta emcdat:mollieaUiufiftif. 
f pvafXafeue viridiefinefalc euftomacb9 
d t:pingueeracit buo:e6:carnee replet.vcntre' 
mollit^Ujcueatet aflue ventrem ftiingit.ru* 
nio:ibueoculo?medef:iiuo:e6 rollir. Saili* 
tueaurmsciepinguitofacitXacoltomacb9 
cft:q: facit ardo:e/z maame bubaltte.6, tame" 
coagtttatfoito tilo:itomedef fuppofitues o* 
aif macicXapnuecidc" ilrinsit et etia bubat? 
fcd pUie ardo:c" facit q: ficcto: cft. 
fOmn9qdepluenurrit2iriin9vartiirigit. 
q:pingut8 e.Qltefalutue vcntrcmollir.vctu* 
atltringit.aq f>o cafa (ameeimpinguac 
f jj faacin.irj.li. £afcue vniucrfafr peiTim9e 
ftomacbi guariuuetiigeftioiBirTialiO 150 & 
pimmeillovtcttscolmcawcicUttpaflione , 
f Etlapicksinco^renib? gmaafjfjin fctuer 
fojno eXafeuerecis mmie calidue ecetcria 
et acutue.vn vicinue in rrigiditaa t jxnditai 
ti qfiinp.gra.qtf e^prcr buiditateTactfactftf 
ratewfefeptineri.quarecaerienutnr?ili<» e: 
ivetvtrebumetacir abfqjvllo ftomacbi oocti 
rnentcupcipuefifalecareat. 
fOetueautctficcifltmueacuirie ct caktfebj 
paia^tcrfalacoagulificcitate.^roindea^ 
ro iri fumofitateet colcriroe bumo:ee couer j 
rituf .qtf tmoto modif c6tingir.vnue 1 q: am 
^nctuofitaein^atulcKlt.ob ciu& flclfitarie 
iarefll.Biiuep acumine qttacqfiuitcoagui 



loctfalo.idcdqjfttptiajeclrrtvitacTue.qufa 
non cft bonue ad nurrimctu.nec fld bonii fan 
guincgenaadu.nccfldvenrrcbumccrsdum 
fSui.^uXflfeuemcUo:cftmcdiueinferil? 
luquicjcfcndifvtvifcuearrflngibttemtoci 
dcmmaUfunt.rtAfapo:epuatneateclinfe 
ad fculccdinc.iactueaute ejtaccfefo mcUor 

cfteie. ■ - '■ - 

f£afdmaUctlaugmerantft>briUflnria:quia 

faciunripmpcnetrarecueumimpeUunr, 

f £t cafcue cap:arii q vefcunr fubtttiatiuc cft 

mcUo: cf earii q nil ©e robclqe. 3 n ipfo i&bt 

fterfio ct a co fit emplaftrn ob talmic i cjctrcnii 

tartpalpcb:cpercufle. 

f j&caataute^ptdcinYcnib? ctvcfica p:64 

prieq5bumWue.fedconfcrtvUeritcmrcfuno 

rup:op:ieauarue«rfbibetfolutiontm.>Co^ 

ctueautinaq ctmpoiucatue ablUctanub? 

laccommultipttcar. 

f picituretia q cafeuecum calamcnto moti 

tano fupcrvcnenaepiibimaf Xafcue rccce 

rrigidue cft cx bumidue in rcrtio. nunitiuue i 

impinguatiuue. 

f Xafeue quidem recene no falUtue ^fcibct 

plagae apoltcmari lcriirnarura:et ciueaqua 

foluendo educit colaa.SaUirue autnon ve 

ruevelociozcftin t>igcliioncet t>eftenfionc. 

Uerru falUrue ct no falUtue malue eft lioma* 

cbo. 




'BttttlM 



8 



£ 



Capirulum.tliiit. 

DSetttue.ylft.pacritt firnt palmc fhi 
crue.9 fcigiro? fimilttidine nuncnpaf 
ri.quo? i n omiitfl varianrur/Ra alij 
a fpdla tur palmule fim ilee mirabolanie.S li| 
t&bani.alrlmuealee.quoegrca?cflriatbo0 
vocant.f Srcfto.tn libw t>c vegaabiltbue* 
Smccoai quifrucritortfunr.quidam twlccs 
funtacmdio:c8vrt)acrilificue.3fcm fruct9 
quidam cu quito ftarfm femcn fit.aUq' opcroi 
Jo coopcriunturvtt>actili.fl''^h'ni9 lib:o.nij. 
•fralmarum femcn.id eft Ugnii qttod inrra t>a 
ctitoeeftoblor^im.nonvrobliuicojbiculfl? 
tom.vndcradi]cpjimufpargirur^crifaurcj 
pflruum.? bina tujcra fe compoftra fcminfl. fu 
percproridcm.qminfirmalinpliscfrplanra* 
quarcrnc ^o coalcfatnr. Suerrofe. v. £olU* 
ga.cap.te t>flcriIie.Pacrilanii.i.arbo: t>«ctt 
Ucumfrncm^floubueomnes parres ipftua 
ftipriararcm magna m babenr.fed frucr9 ciua 
cum cft marurue aliquam baba ftipriarare. 
£o:riceevao flfbo:iep:edicremaio:ebsbet 
ftipricirarcm» 

^prrarionre. 

fRabbi movfee.cap.tsc ©acrtlie. pacffligg 
ncranrt>olo:cmcapirie.OpiIanrepar.ctapo 
Itcmitcapuf.zcmoa-oidae crcanr. 
f Saa .aucro/Rafie. £aUfaciiir i generaC 
fanguinegroffum. , z puerrunf ciro adcoUrl. 
i funr maliitUo quo^complcjiio eftca.t cpar. 
ca.acuiciro cuenir foda.zfquinatia tbotboz 
cr opttario ineparc tfplene. 
^ £r t>aaio:ee cjccis funr magnii: t>ulab:ca 
cr non funr aliquo modo conucnicnrcs illie cj 
funr calidccompteuonier: no funr ©cbilie na 
rureimpinguflnrur9bcie.£tt>acrtli qui vo* 
canrurbfliron velbevrenfunr metio:es omni 
bus .quoumt colo: clt cirrinueet rubeus* 
^6af , .r).t)cedulue.ca.'De frucmpfllmflrum ; 
quidflme|ctactUteficcio:eefimr erluprican? 
tce.vt cgYpnj t> j cnli.quida aur mollee i b\V/ . 
midiertulcce,fieurquivocanrur bqron vel 
fcanocbi. Dptimi aurcm nafcunrur in palc '/ 
(tina:fiucu»bicricbo.3nrcrmcdU9utambo? 
t>icro£ gcnc^ funr omnce alrj ©flctili.funt atlc 
- indigcftibileezgranariuicapirie.flam ontf 
itcst>flctiU'mdigeftibileefunr:ac9piri6kfiui 
ampU'o:cscomefti. 

fl Q.ni atlt ab ipis tsiftribuif in co:p.ecbimu8 
groffue fempcr eft4?aba flureflliquid vifcofu 
.quando t>flcrtlusfucritvnctuolus.quadoau 
tcm tali cbinto t>ulccdo admifcctur. ccUrrimc 
qtiidcmab ipfp epar pbftruirur. 



f^cdtfflurSctflcgmontjaetfurgcfcecfum 

mcab cdulio ipfomm.conucnicnrafluretn 

crcpflrafplcnopilanf akdtmf jnulto cturcm 

magtelcdunrviridcsttflaiUfldomntflpaulo 

flmplio:cecomcftipaiaigtrurcrcaUdto:eba 

bcnr cbimum quiT>ulceejfrigidfo:2aiir qui fU 

prici.fed inflartonenoecnr: a implcnt virides 

twcrilificurfiaw,, 

f j£ande cnypoaibnebflbcf fTcits vfrfdee ad 

(iccfls:qua viridee ©acriU adfllibeOn noval 

dc^oc9Udielocienomaturflnffifcaet>flc«Ii 

vt ad reponendu fianrvrike, ct^pra boc co? 

acti viridcs comeckreipfcs crucHetouir.oiit» 

rcpknrur.et rigo:itot>iftu:ttUcr<flUfacttaiH 

capiunrur. 







Capirulunt.du* 

Sucus^li.ii.r^kfluet x>&faftk 
fuutt)ue.*6iiobfltifrimfl edin c&aa 



mottn flcbaia :i in fiect vbtalcenflri 
fcniculi filirudirie.cadibVorito folrfe imnmiko 
bufurifcprecto cflulcpcdflU'.radtcc guilHot 
dor! fufluiffimijjccinfajcofie nafctl nictfdia? 
nie.T^cUq gcneranflfcunf vbtcp rctrcn isi ollt 
fo timitibufcpuicc niUpingui fok>;fol«s co:ta 
dricauUcubirflli.c9pttitororiidte3tnteci0 
ciminofimilqjriorie milto.atbum cracrc. c^ 
4o wru omtb? flc feruce^Sccudu qupc^ pp;e 







$xmm 



tcariue.Craucue eftcalidus etftccuetn tcrtto 
gradu.£t©up^ea'u8mcdu8:viddicetT>aii 
cu3cbrmcu0U<:cictu6«iutam ctoetarcpcri 
rorp:ccipw:ctcftmaio2i6dricaci^w©auc9 
afinmue qw pteripue afinoatm cft dbuabic 
ctp:o cfocrico ponitur quiaillc raruebabcf 
tur.l?aberq$T»aucu8 maio:em crTicaciamf 5 
lxrbametflo:cenUllamverovd modicafnt 
Tadice8.berbaitaq* cumftoubuefcj colligia 
«abiectujradicitoinvmbwfo.locovericcari 
pcrannumin multafcruarur cfficaria.vtrtur2 
babetsuToluendict confurocndiet attcnuan 
ckejcqualitaribU6fttt69iur€ricamcjcfubllflii 
tiafubriu* 

©ptrationf0 

21 f^lflfcaX5tmfrigiduafmactfrigidatba 
nridltuflimoaturvinu t>ecocrioni8du8ficil 
q>ficcaru«contral!omacbiioolo«m ecvcti 

A tofitatcvdfrigtdifafe, ^ 

» f £ontra flranguiril ef ©tnurriam*? *>fra co 
Ucamctiuacamvinumvecoaiontedufdeeic 

. farirWc» 

fc f^ntraopu^tionefplenmctcparieejcfrfej 
dWattfa.-r Ydropifim ftt (\ rupue cjc fucco fetri 
cuKaccccoctioncilliue 

P f jContra frigidum rcume facecllflfur cflpuc 
cjcpuluereipfiuebenccalcfacto; 

£ f£onftan'nueinUb:ograduum'C>aucu6dt 
calidus ininirio tertu graduect ficeue in fccu 
do:5cb:cm flegmaricatnetmotfue rcprilium 
ac plairefim ct Ydropifim atrar : vrinam 1 me 
ftrua p:ouocat.due apojima porufoatum pe 
ctueafcrcaritomundatgroflbsintcftinotum 
bumojcex)tfioluitrnccveai6tsolo:eeacfo: 
iioneeamputat. 
* f 3 dem;$jpkm'6 et cparie apcrit opilario? 
y ncm.Jctficu apq femincmifecatur.eiueacrio 
fo:rio:ef?idtur. 

« f pYafeo!lde8.£tbirom mcnftruie impcrat 
ClrinampJouocarXowouftofubuenir. 3d 
omnevidumfo:act8Ydoneefadt.5Cufiiicnt^ 
bud dfecrum.trtbuft4>ercufliontbu8 fpalangi 
onisoecurm; 

<%> f %Mi vctaict totminofie^firit catbflFlaf:? 
marib? adbibtfu.^ullulaecfttimo^eccm^ 
pcfcit.Omniflfeminacumvinobibitafaduc 
tontramoriuefcrpennim. 

Cspuuamulu) 




'•y^\ , Rflg9nfuvd wagaganfu.^lafcfli 
\ l&ragantudtgnmicuiufdamarbo^ 
Vt^ vlframarenflfccntj.i^umiduae cm 
effluenectflcrionecflletlocnfafet ingummi 
fubftanriamutatur.j£ftautfriguluinfecun^ 
do gradu:bumiduj in p mo^uiue triplet dt 
mflncrice.j£ ft cm albu qtf mdiue clt fi fit cla> 
ru 1 puru.jeft ctfubrufum-: cirrinihqb' i&dco 
bonut3n medirinisfhgidie albu pcnif :fiib* 
rufom aur c vcldrr inu in caltdie.^er annos 
qdraginta feraaforirfute b$ infrf gidadi: mun 
diftcandi: bumcct andi:cogIutinandi. £? tra,j 
li.aggre.ea.babc:23abc cft arbo: cuius gum? 
mi dt t>:aganru:cuiu8 radijc grofla lign ofa. z 
vocarort>:agantme|cqapparct rcequedam 
fuptcrraJvn cgrediunf ramiciue.etfunrrarrii 
feu virge bzcuce t>utf ectcfi (up.facie t crre cjb? 
fum foha^radlia puapttma.sinter ipafunt 
fp(nefllbccqlc89urcqregunf?occultanfab 
ttmefoltt.e.Praganrum dtfeumfditae quee? 
manfltcjcradiceipfaqn vulmraf fcrro ct rge 
Xucmaturarionieapparentqnvulncrafinio 
c©1ctlVure:? radiiipavocaf arabtcc cbacbita 
^mcliyccx>wgantocftclarupuruiiubnlc:(U^ 
tue fapo: vcrgtt ad &ulccdinc.qtf arabtec vo? 
cafficbtrarim.grccenagantu4anrievcrot»^ 
ganrum.0fllte.vitjXim.far^a.9c.v:agantoi 



I&tfyttbis 



Dragantu vfttusauseff p:fma q fccilccatef. 
fecnnda gUiriuar :ct tcma ctt q frangir acuita 
u rera er acuta? eau'da?.m.iN4bumi.to.L 

& f^aa.aHc.pYaf,{jirmscfta'glutfnatfua 
fiait virt9gumi arabicf .? fpm adminiftraf m 
cobol oailo? ? tn mcdictnis tufiis et afperita 
rc canneptiUnonis:? sbfcifione vocis:? curi"9 
cararn t vtmla .qn (it ct co ?fcctio cu mcllc x 
pontf fug lingua\t tranfglufif q!5 tcipo t>t'0 
roluif.aut©amrt>cipfo.3.i^o(t63infmroifin 
xino cocto t>ulci:a tuncvalcfcriaadt>olo:e 
rcnu^v4ccra veficeqTmflcctur eicc co:nu ccr 
utno adufto.tparij aluminisfamcni.^bfbcc 
nocumcntumojfusfcrpcnru, 

2 f£lideauc..aibugm'g.praganmcftmgf 
dnjctem co bumidttasqlajcatventre.tpfcit 
tufii t vlccrito oajli:? lippitudinito eius: ? re? 
pmitacuitatemedicinaru latrartuarum. 

C f&idcmauc.^efarogic.fiftbonuvlcerffo 
. ■. vefice et afpcrir art gumtris ct li ngue, 

P f £ridcauc :&abijc,£ftinco rcsmodicera* 
lidtrat^buidiratietlajtatvcnrrexpfcrttufli 
ctvtccntopulmonis.': glutinat vlccra infcfttf 
ttozmnili q: addit in folutioc ct pfcrt vlcerito 
, oaili.? Ifppifudiniqn infundif i t>tflbluif ?col 
• lirifaf cS aqua a'us.autponif in vulnaibusr: 
coucnifjmifccfcumcdicinieaatrtelajcatiuie 
q:,pbibanocumetitcarumetagGrauartone 
fpiiuemedicinefup:an2turamfit)fopIacuif. 
jFo:maaiTandit>:asanfuinucnteefnca.j5u^ 

,_ miarabfolfccg. 

** f PYaf.|>3gantufn pulucrcrcdactutcuca 
lida aq pota/u cbe q fpafmu partunf: vel q> 

. aliq intrinfcc? vcne crcpuerutfilr fanat 

* f £alicnu8.3qtiao:daiuquacoerufuerit 

~ t>:aganrum per nocrcm rcmouctfitim 

p ^jConnafcifluraeortecrlabiomtpalatfvl 
caarceevdaro:iaficke.t>ifiolH3ft>:aganru 
maq ro.ct p. pannu cjcf maf :tcii glutuiofira* 
tc?ficiafputuieamidi.?inungaipma.7illtf 
niaflinguavcllabiufcpeetcitocuranfur 
f3dfacicmt>calboiidamctpannufup.f(Iuu 
rcmoucndu ponaf t>:aganttl in aqua ro.g no 
cte^ancaddirogo:acevclcampbo:ainpatf 
ua cjnrirarczfaaeefrcqnrcrillimaf 
f Scdarrendecjpqn t>:agantumin mcdfcf« 
meponifur.pcrfctJtbet rcri:quia conmnoi 
rcliftir.Sfiaiimcumalijsfpccubuecontera^ 
rur p:iue in fumu m refolucntur alie fpec ics qj 
ttagantumpraamr, 

Copttultmi.rlut^ 




J^V !Jpfamu.^taf. £vptam& velfcipiS 
"■ •numulrtttfcutcepulcgiu agreftevci 
• ^^batmbcrbaeincidaetplus cbicticn 
mowiaji^tpulcgiub^folialanofa^fuEoem 
mu iceincft ei vclut lana fed nec flo:cb?ncc fc 
men.Oirr9cftcitItaqntapulcgioiedpaulc» 
infcidio:.£ftctaIiudgcn^t>tpt9nniqt5bflbct 
folia fifimbuo ftfia .5 f ga maio^ nigra? molle 
eiufq? fo,odo:e bnt fifimbm . £ ft at tiptanfa 
lcptomcrT acaUfacicne lenifer acftringcne* 

^pnattonf0 

f3fi.|Dipfaniifafepofcmiecftvtfcrruaco: 
pccjtpcHan-i faguraeaajtiaf.vn tdspjibulo 
tacijctific (sgitt as a coujc in bercf ce eqciunc 
bacqdamiatinompukgiu matris fcicut^? 
prcrbcllirelacjicuticnda. 
f "^lat.Ciptannu cjcpcllitvcnenu.vii pcipue 
ptra iro:fus vcnenar o£ aialiu t>af fuccus po 
miet cta vulnae impomf vct puluis fi (uccus 
no babef .£ ft autbci ba ca .z uain.irj . gfadwi 
2^uius radircftmaio:is cffieaticq; feabaec 
vitidis cp ficca.f £ % tiptano ^altis qbufdl 
po t ficri pfeaio q vicc t yriacc.f bcf. 
f piprannu aia m cducit fetu mo:f uu.valctc 
tu c onr ra cptlemiam ct ectra pa raUfim. 
f PvsfcoJides.Si ipcfugponafur auifttf 
mtgioadbibeaturmoztHoeinvfcroinfantee 
c^ludif Xui ctia> tara cft vinue;vt a capufe 



•B 



Emtms 



2r 



H 



tcl ali^utobeftrWagirta EaimViVomcfia 
fomt^tatimcamfiMiseqciat.^mcreapra^ 
dotrtpraunubcimultisnafciffileTupdicro. 
fed rirtureinferiii8:q: mrriie infcidu cmino^ 
cpefficaria5b5.f3demciptannuTrirumo^ 
tu&oc meftrua^dudwtodojefuo tncefa vt 
per as ct ferpctcs ifirerficir. f £onftl.t>iprl 
nuvutnerabuoutoet melancolia miidtficar* 
btbiro aut fuppofitu menlmta;puocar.feajn* 
dina et fctum mo:ruu eq>eutt.£u'.u.]qcv.£etf 
uifvtindicauintti8)t«iptinumoftcderevuln€ 
rareco partcu^rim&ecidemwreKe.l^deali* 
bi qrineb:aa.rami&p^enuepulegio fifej fcr* 
umseraae.guftu.^olijstmvronfftoe null9 
. ci eft.femcn vt caulis.ra dijc tenniact fuperua 
cua.£t in dseta at no fperiofe nafrif mirec$ a 
cap:is ejcperirur. fl •JSro eo cft % pfcudo t>ip* 
tannumirttlinterrienafecsfoliofimiliramu 
lis mino:ibu8.a c\bufda condrie vocaru. mio 
risetTecrosftatimiriKlligif mprormu mima 
pouide acccndir os.cjel legur in ferula vel a? 
rudinepduntp«:ligantcjjnepotentia euanef 
car3utqt>icut vrracfenafcimulripbariafcel 
t>ererio:c8in agrispinguito.^ £tvcrn<c\da5 
tiipranrjuvdt»taannunonifu'nafperi&£fl: 
cr gen9terriut)iptani.nec facie nec cfTectufue 
folio ufimtmj ramis inaioabu8.,pceHdenteilli 
fuafionc^cqdincb^nafcifinfinifopftare 
fcterSriufdcgmcriealiaegenir^rimeYerp 
qp in parrtafo.altot\n biferum cfie. $ Bt pch 
utm mcrcinlMatia:? eleurriu ineuboca.t 
rora Ercbadia erX^coniaXTadunt arcba? 
de8c\dcn6medicaminibvri:fed lacre circa 
rcpus veri8.co cf ruc majrimefuccis bcrbettir 
gearrzmcdiccnfvberapalcuis.f Sibituauc 
lac vaccinti eo o/ bouesomino votffcreinber 
bi3funt;C3dcinli.]qcvq.piptannu fagirraa 
pellit pota.ct alia tela cjcrrabit illita.f Saltc. 
■Speciei q^:t>iptann9virtu6eft ficut pule* 
gtj t>ometttci:nifi q: e fo:rio:i6 $rotie:q: non 
folubibtfurfedcteofacronafcakfcu fumigiti 
eptrabir fctii momium .et ettrabit fagiftas x>c 
co:p.e ftatim t>cco accepto cibo 

£apmtlum.rluu% 

«f^\ DronicfcSera.lf.aggrc.cap.varo* 
m 1 iiig.i.tJownicuj.piaf cy funtvene 
l Xa^ albeinteriu8.e!creri9^o ad cirrinira* 
tetciJdenre8.erfunrfraftaingroflimdinc ra* 
mo:a fcitaragi.etin magnitudine nodi pulltf 
cie ad pui8.et funt aliqnt ulu tsurc et grauce z 
©cferurif c]cfYria.j£rt>o:onicuexfYriaclt illtJ 
c, uod magis adminiftraf cft calida ct iicca iu 
rcrnograda. 




BvtvmomB 

ffoTonicupfcrrtiolo^itecigcncranfaVim 
t ofirarito matric^j£:t coferr moaltevcneno 
fo? ?pucmrsco?bibiro.ctfacto cmplaftro cii 
co et ficubus/z intrat in cofccrioito magniej 
f % ben mefuaY.cft cavz fc.? pfcrt verofirari 
to marricI.T pfo:rar com cefcrr fui rrcmoa? 
cauata.fBui.t>cviritoco:di6$t^^fouo: 







iBfDfrbfe 



■& 
» 




£apitulutn.tlfc 

•fS attca .-jSlatea : jB pati 

cagberbacrefccsilocS 
acjfe lapidof .bj fo. mi 
nuta "Ccrrelapidibufqs 
adberetia.£m'cifepa* 
ticacipcipuc epat$eftiti 
uatiua*3n£tno grada 
frigidaectftcca,j£tqu« 
fc>5 maiota folia emclid^babctcp^tijte infri^ 
(TidIdi:etcjcfubtilitatcfubf{atiefncc6fo:tadi 
fS*rapionauao.0alicni.j£paticafnafitf 
in lapidih? bumecrte.-: cadit fupcr cam roe vf 
gutta aqucct cft fimilis Ienticule aquc,£t qn 
to maio:abjfolia:tanro melio: eft.fn'sida cft 
ctliccainp:imogradu. 

i^ptrattonf0 

f Epatica valet ptra opilatibnem fplcnis z 

cpatis ejc ealidamateria.j£ t cotra ocm egritti 

dinecpatiocalidcEtcotra apoftemara cali? 

da fupcrpofita mra.£ftenimrepcrcuifiua 

f Sera.aue.0yafcoa'dt8.qirru8 ciue eft q 

mfrigidar trigidirarepauca .crfceli'ccaret ab* 

ftergit.j£remplaftrucu eafacru fibfeindit me 

ftrua.£rpoftraaut carbaplafmata efiam fe* 

dat apoftemat a calida.j£r curar empetiginej 

crconfertycrericic. 

f £t confif itur vel niifecrur eu mcllc.afpfcdi* 

nemoU8velIinsuct>iftcnif.j£t|bibetfiutum 

bumidiratuj ad mcmb:a.£ft enim frigida: fic 

caetfhptica. 

f i>la tea .£ r tf: cparica quc piccipuc eparis e 

iuuatiua . S» \*rupus factuecj; aqua uceoctio 

niseiusjaddito reubarbaro in finesecoctcis 

ptra vctericia m eftoptimue. 

f S> cdin oibueaqs ej; quibus fyrupus fit eo 

tra calcfactiontm epati&poni fccbet cpariea 

tnnltum enim iuu9t.3teru.£ ontra calida a* 

poftemata valet inpancipio trita et fuperpo? 

ftta :Operarur enim rcpercufuoncm. 

Capttulnm.djf. 

/^fB anus vcl Ebenus.Briftoteles ih W/ 
\*Tb:o fccplanr i6.£benu8 % ea que ilji vi 
^*^ cina funt mcrguntur in aqua : qnia in 
co rariraseftparuameceftaerin ipfo c\ pof» 
fet ipm rollere.^arresenim eiits funrniultuj 
folide.3nterriGnempeva!decalidi8ctficci8 
plante no babct bumo:c cj matcric fufitciat . 
3de0cpparre8c6paerefunrerangu(U'mcar9 
Ondc calo: planram tntcr albedincm etmgrc 
cunem colowt.itrqj (ignum buitis mgr um cr 




mcrgif in aq vf ebcnue.f £>rafco:idc8.0>e? 
num eft lignum qrj eic etbiopia venir: coIo:em 
ba bene nfgru5T>upIici ealiginctact u Icnc m 
rum ct guliu ftiptieum.3n coticula eonfrica? 
tum.oltenditcol6:em rufum.£ft alrcru ej; 3n 
dia colo:cvario:fcdmcliu8p:edictum/i^r(^ 
ticpamomina ligna ctaceanricavendutrquia, 
cbcno ftmiliafunnfedinde ftunt ttota.q: mol; 
lia funt no grauiaXuncjsfructu fcrunt bafli* 
lia co:iifubruficoIo:t8 apparcnt:ncccdo:cmi 
necguftumtalembabent.£ftauteoprimisni 
quod cft nigrum « equalitcr lcnc viree babcs 
in guftu acres.f £jc li.fce na.re?.£ bcnus cft 
arbo: cuiue lignu fcuriffimum cr imputribile: 
non facjlecedcn8igni.0uod Itcerin igncve* 
bementifTitnuardeat quodamodo er abfnma 
tur-nuncpramenciuscombufiio rranfirinfla 
inamXotrcjceiusIcniseftvrlaurilignum 

fDprrattonfe 

fOtaf.HbamjvlceribrocuIo^vrilitatefactfi 
tlirtus cftciertapurgaro:ia.£r idco caligtcs 
oculom i reumatifumm tetcrgtr acp:ob:bef. 
^ulticotilaemcdicinaleecjccofaciunr 
f Bliqui xero trituractrafura m ciue cr Jjfiria 
ruraminfutlduntinvtno tieac nocrcet poft 
tct unt facicntce colliria.^ Itj p:o vino aqua'5 



Crartatw 



wfffttnt £omburitur etiim cac ab o mido be 
ne inuniro cpdiu cinaefaciarslauaf vtmolib 
do quipulms facir ad ficcirarem oortotu* 
f &uiccn.£benu8ealida eft ct ficca in fecuH 
do .£t eo mclio: eft nigra cqualie in qua non 
fiuit linecct in fuo taau umilarur co:nui ro:* 
nanli.£lraur valde compacta ?foltda,incu? 
iue fapo:e eft mozdicario. 
f £un$ fofi carbonem ponitunodo:bon9*t 
acume erca odo:af /ricicafin aqua ficut pul 
ncrcs laptdnm.£tcftfubtiliatiua etabftcrfj* 
ua.abftagnpannumocufcctalbuginr.et ad 
eius fricarionecolliria fiunt. 
f £onfemtvlcm'coanriqmecfu8 fcrratura 
adutfa ct obtalmie ffccea fcdbici ocult. 




<Capitulunul>f. 



/^yXarinus.t>Tafcoridc8capitulo clati 
l|W»nuebabct foliarotunda etafpcr a.ba$ 
V* / Wfa8rcnuc8 fimiuaelianc:fed mino:a 
ct rotunda ct afpcra sbaftae bab3 rcnuce tuo 
bue palmio longae.qnq5 aut fec eivna radic* 
babenefolia plana gultufliprica Inafcirur 16 
deautnsettnagrie.f^unitiecapirulocla* 
nn.£larinramuloebsberquincgautfei:tcmi 
ee et oblongo6.folia quafipilofa ct ftiprica 
f5aUe.vi.lun.far.ca.eIarin;mcdiocritcrcut^ 
fjigidafiuaetftiptica. 



j&ptraticwa 

fPt a ^.5^oliaciu8inc9tbflplafmatiteacl? a 
bibira poknra rcuma oculomm arumotej p 
biber.^iiptura eiuG bibita t>ifTintcriciemiri 
ficcmedicatur. 

f^ ! miu8.5oliacuj8irtfomcnfo!acb^maC & 
fjringunr, 

fBlccandcrcapimloocparalulctagiFOTc^ £ 
latis acop wn td eft mitigariuum cc agrrotnC 
wum :er eonfoaatiuo ct clar^id cftftipriusui 
frigidarurisal t£amcfp 4 




CapttuIum.tIjEtl; 

V«y f cra arbo:ea.3fido:9.£daa ticta l 
tW»co <f arboato rcptando adbcreat vd 
Va/^cf bcdiefupw lactie abundanriama 
vctcnb? incfca p:encaf.£dcrefrigidcrerrcin* 
dicce funt f m pbificos. ftom anrifarmacoa 
cbrietas eft fi e\e ad cdera awoncf.f •fclinius 
Ub:o viq3pri cdcra mcdenf fibi.^dcm lib:o 
pri.£daequocfcfoliand&eddunf;aangulc> 
fa funr.folio?quidevnira84'n fuo permanct 
cniq?gcnac^:erercppopuIo et cdcrc.£daa 
iaminaltaticifnafciquanegauctattbcofra 
fiue.nec in 3ndia nifi inmonte mao:f S lc* 
pandcr vao ob rrairareita ejtcrciru co:oiiatc* 
q, ;india victoJem rcdiflc libcripatris cjccplo 



Bi&tfbto 



a 



Srbo: cft intmica fatl Oib9.£>cpulcb:ai$ ad 
rauros rupene.fcrpentum #o frtgo:i gtiflima 
vr miru fit cu in bonozc vllo babira . P vafco . 
ca.ciflbs.£deregmcram'afunr:alba:nigra: 
i elir.Slba fo fcmcn afTcrr albu.nigra nigru 
aur croceum:quS multfoyontfta vocar. £!ije 
$o no babcr fcmcmfcdfolia minuta z angulo 
fa ? grofla /Btgra vero vocaf t>Yonifia a ba? 
cbo :qui ?>Yonuiu8 vocabaf :queporatuede£ 
ra eownatu aliqui fiugcbarJut em edcrc frigi 
dcrtoremdiccs.vndefuntfrigidumanrifar 
macu ebziantts.fi quis potatus edera co:ona 
tur,na co:onatus edcra nd incbaaf . tino ttlo 
ffie no inco:nubanf edera:nifiat> fummu poi* 
f ati vt fugerentctoterareVf£bcodo:u8 prifci 
anus vocarfrucru cderc co:imbum.a aotono 
98»q6 eft verbu acriuu.2 indc ©muaf io:rela 
riufi:idtp:cmiualicuiu8 ceitamini8.et.indc. 
venitcoa'mtoa^dcrc^u<tu8:q:inckca:ona? 
banfanriqui: t poriflimc.pocte ilignit virtuo 
fereplerioniscapiris. f aiiOuidius metba, 
cjrto.Etgradusfciltinguit vel eco:imto.£ft 
alia cdere q" vocaf terrena.£t alio noie vocaf 
cameaflbs. £ft aliud gcnus ciflbs no ve? f m 
pvafcoridem ca.dflb6.fedfic per quanda ftf 
milinidmcmvocamnqulmulrivocanrdfte? 
ronud eft rofam caninam* 

0ptrattont0. 

fD^fco.OiscderababctvtrtutgvifCidai 
ftiprica:vnde nerai ririus ea fenriunt corrarif , 
Undcejc prrartjs coponif virrutito.@riprica 
em i frigida z aerie cauda z aquofa p.ticipa8 
fuBa.Cuius foliaviridiainvino cocta.ma* 
gnas ptagas pglutinannz maliciofa cicatri? 
fant vlcera ejc igne facta .flo:cs eius sigirie tri 
busfublati-rbibitioiflinteric^mcdicanffibis 
in xriebtbere t>anf .folia d9miiera cu cerotis co 
buftiomtomajcimepfunt. CJte folia dus cu 
acero coaa-nmpofitafplengtumentre arrenu 
anr.fuccu8du8 iiaritoin/ufuepurgat capur: 
?t>olo:e8capiri8mitigat. f Cumoleo puro 
©ccocto ©oloabus auriumopitulantur, 
f Higre edere fuccus aut fijmitas d9 fi bibtt 
amcteolTOJCopitar.qncggranafemisci^co^ 
ctacitolco rofa?inco:io maligranari et auri 
©ettre infufa liniftro 'oeri toolett medcntur. 
f £t vt catbaplafma impofita capillof nigre 
fdt.ntr t vt vlcerito vtilia fur. fotia ri9 ru vino 
coera eobuftionito rncdica nf.maculas impe^ 
fita emedant.fumitate8 u3iti8 bibite vel fuppo 
fire meuruis imperat.f -fSoft purgarione $o 
mulie?.5.i.bibita generare non finit.f £acu? 
minaipfius trita z mdleaddtto % fuppofita ab 
o;fum pftannSwcHseius narfoimmilma 



putrcdincnaruim toHit4acb:tmu ct"ue pcdiai 
Io8ocridit:?capiuo6 atcllit^to cuulfis im 
pofitue nonrenafci iiniu^ J£t in x>cntc cauu 
mifliimiDoto^tollittipmcomlpit.fSucc^ 
radici8ciu6cuacetobibitu8mo:fitofpalan^ 
gionis occurrit.f -fcu.ca.seedera/Rafcif in 
iDiuerfisarboribusetparietitoperrisiterris, 
2^uiu8 folia trita xriflinrericoB remediat:7 fru 
menro mijcro ad combuftamet vubicra cancc 
rofaPU)delt, 



±5 
3 




Capftubmt«djEb) 

^»V»Dcra terreftris.Saf.vtjjlin.far.caiffi' 
§W»fos vel edera terreftrie.bec ec corrarqf 
^*-*«c6poniturvirturibu8.babet cm quid 
ct Qtipice fubftanrie qua j quidem teiTcfircm 
fiigida m monltrauimm? eja'ftere.!toabct aut e 
quit> etacrisquamoftendimuscalidam eflc 
vtguftusteftaturjtertiaautcum bis aquofa. 
fubftantia part icipat: tepida cum viridiseft. 
jCumcnim ficcatur boc quidcmt>Y3fo:ari pu 
mumncceflecft.fieUquiverotcrreftrem fiigi 
t>amet fttpticam et calidam q aicris dt* 

iBpmtiome 

f XJtridis.cy e coctis frondito cum v ino ma£ 
gna^ptaga^eft pglutinariuus.^icatrifat Sc 
et cae q ab igne vlcerationcs.cu accto $o fro^ 
dc8coctefplcnetico8iuuatflegmone8.vndc 
1 q 



CrattatuD 



fanatraimjfactvlccra antiquafm aurcs ec 
narc8.fi #o acriua apparear cu olco fculci mif 
cemr.^umifociusfeitu pcdcs interficit et 
capillo 8 teltruit.caltcte intitu cjciftcns ^tutis 
vt comburat .3 de daf.vn.fun.far.ea.ciracus 
fiuc cifroarus.i.cdeta fiiprica eft frufccin gu* 
ftu z in otbus q fm partc acribusfrofldestati 
tnet gemina parua trira irantu ficcatt fiipri* 
canrvt c6glutinentvulnera.flo:e8fa> niper 
oia funt oeariuio:e8.vr fi eu vinobibanrur z 
©iflintenasctvenrris imbeciiutatcst reuma 
ttiet biiiditatee fanct . £u fo carbaplafinanr' 
purridos bumozesvleerii tuuanr.£[tcm co? 
frrus no generofe ficeariua in.ij.gra : ? a men? 
furati8c6plcte.£fl autfrigidus tntantuj bic 
frutecvwepidaparticipetcaliditatc. 




€apttuIurn.rljEtt!} 

/^yXUbo:usalb.pYaf.cap.?>eeltebo:o 
■fc*4»fcn tranflarioncnf am,£ Uebouis alto 
^•^•tolia tefimilia arnpglofie:aiitblcte a 
grcifi fed teeuioza? rh'grio:a? modicii obmfa 
bafta cci longa fcuocc» palmteer rufiofa:tctri 
us folet marcefci qn ficcarc i'nciptt.£ t ficut ca 
piUimltacicvnaradice^ccdutficur^gulejia 
fcif locismoruofie.radipfodi rpe arcaro <o$: 
vtiliseautalba ettenfa etrragiliserplcna et 
iuncofa:qua cii fregcr] veluc fumum tacr at:«t 



albidio: T>cint9 cu gufiu a .no valdefaliua p 
uocas:pl9accepra botcm fuffocar.mdiM q? 
rinaicu 1 iralicu .capadoctfi bis albis c z rcmtc 
^Sfcra.li.9g.ca.clxrbacbenau.p\'af.cber 
ba( be.i.ctUbo:9.pue fut cf5fpee:alto 1 nigcr 
fj alto eplata:cui',fbiia fiit fitia folijs plaragtf 
ru'8 fenfolns plarcticreblete agrion.i. ficle a 
grcfi^mifi qifutb:euio:a eis t secUnsinria ad 
nigredinepl9ci5ttfn8rubcdinealtqnfuulte^ 
dctia.-:b5fiipifcqttuo:t»igiro?longurugo; 
fum/z qnincipir e]LCo:iari tcfieeaf % putrcfcic 
ciro z aiparet circa fiipire velut eaptlU fcbntf 
gri.bjradicula8multa8fubtile8egrcdienre8 
ab vna radice paruas toblongas filr cepe 16? 
go.THafcif moroofisfocis.jEr opo:tet q>fb* 
diaf radijcipius plant e z rcponaf rgc mcflie. 
£tmcub:adcoHtgeducc i ; plara ejtrcdif fug 
rcrra cjiteficc moderara/z cfl alto facile fragi? 
bili6:mulre carnofirari8.n6 bns acuras ffimi; 
tates fic fquinantu, £r qn frangif euofar ejt co 
res fttts puUicri. , z caro eiSeft fubrtlis z ;io mo: 
dicar Ungui mo:dicari6e fo:ri. (5 factf abud.a 
re faUui ad oe:t caueaf a nimicrare (ua:q:fuf 
focat.£r melio:cjc eo eftilic q T>cfcrf ejc rerra 
que tii ita lia.fed iUc q elt ejc caldec biacft ma; 
lue.t eftplira itite fquinafo:? eftMbcane. 

i>prrattonf0, 

€OTafc.£uobo:9altor1egmatoe8 huoies 
vomiru purgarX ollirqe nobilito mifccf .cali^ 
gine oclb? purgar.fu{pofit9 abo:fum facff, 
f 3nfflnrei vrcro occidir.fternutametajuo^ 
cat poU^e mijir9.molIifo:icc8 necat: clticue cii 
carnito cit i9 eae madidae facir.na nifi mijtfua 
fucrit polefeaut fifcmo aur fucco prifcne: auc 
fucco tapfie aut mulfe aut fucco Icnticule « ut 
lufi in panc co qus f ©ari no r 6t:q: fic ab anti 
quiefnucfu-crr.f itlon mcdicue t>octiiTim9 z 
efccttlTimue t iligctia loga 1 rcne fcripfit qua 
^ifripuna eUtbouie tef .V^IK ^oi mcco mul 
feinijcrutatpofieatatesmaducare iilie c) f? 
a cccp.inr c\ funt fo:rifumi co:ge.vn t>aru bifci 
plina fup.tb:inullaeftbcarionc facere pot cui 
^ceromijtrus.': coHiriu facru z ano fiifpofimj 
naufcam,}:bibcf.f j6af. £ lUbo:us rtcrc^ ra 
alto qs niger abftetl iue ftfr z ca.^turis funti q 
rctmotfeis-zempetiginttot fcabiebn Icpris 
coueniur: qmnetia filiulae momficant Duoto 
atu: trito tJieto^ed fccnriu rolonto cum acero 
coferur.CJo-mcfuexicirclUbo? albu t>cbe; 
re vitari.j£ftcmpfocatiuue,fup. ntgruafittc 
beTeprumerec6co:datomne8.ct < ff:ierecrifi> 
candofniarttmetlegectnocouaHtBifirobtt 
ftieco^onbusetanimofie^tepo^verie. 
f foffite $at9 quidc qft % cui meniuz qua^ 



n 



BrEjerbis 



\it er acctfcrc factt wucHefceria:: in rolunrirarg 
ctmo:ee laudabike ? c6pkjrionebona3.:2boc 
cmc^eras^icut^Ypo.tiuw^^icquidcj 
mudifi£atco:pue rotii a fujjfluitanbj matcri* 
eru co:mptaptfolurioneeducit cu facilirare 
colcra p.mitta.-z grofnimficgma.ctcolcra nfe 
gracu>iitute?finemoldfiarz mudificat fam 
guineet atrrabitavcnie fwpfiuiratce admtf 
PLra© fanguint imtno roro coigiii a pcauirati* 
bue mebzorii ct parrite rcmotie acut c. «f £c 
ecrebuefoknitomiidificado cercb? ? caput 
roru inftmmeta fcnfuu er ncruos er vcfica 
€£t ccferriuuametu magnuegritudinibiu* 
«a^ficurefoda^jie-z emigranca? mania ct 
mclacolit ? verrigo % eptleria? galiiie. % aqt?e 
c]©efccdumadoculu^pfmcgi^idimbiun^ 
rrurarit et t>urtcicm apstib aiz ? fcrofut.er i 
ficurtvriaca?medicfoe*ftfonomaricc«lkf 
pw.^ancru:vrfpc6bcrpctiexborbo:qfccp 
mcd unt.£ t bcc jobajnefue t>e nigro 
f 3 Itoaut foaiter ettnrTicuirervomerc factc 
cu accidetito timo:ie.et pfricatS ejt co ad cgrtf 
tudinee cutie:?fertcfl tnitc:et c\xm fcabicm 
cmpcriginealenriginee.et pfert vrerqj elkbo 
nie filiulie et vlceru» fraudukntie. 




Captruuinwljaj 

c Xlebomenigcr2lni.li.t5.ca.«5dlc.£l 
lcboute ilk q nigcr c; <(t Irufla indfa 



erdueanitYaefo:ffo:e(farutf*rca!bwiHtc\ 
ipm collfgiir p:cferaanf ab due nocumcro co 
mcdcdo allfa % bibcdo r im%? folia c\c)c pkn* 
re citfunr nttfl foltje fquinarnf? I unt vcbcmfttf 
o:tnisrcdie c|ipa.ef b5crueb:cucad pnrpu 
rdtatctcciinae.-zd 1 ; fignra eficut figura race 
mi.t in ipfa di fmcttie:': bj vcnae fubr ilce ntf 
graext cuiufdicp qru radice ficut t nocapira 
ecpa? cgrcdiunf ,£c q# t>c co admiftraf fcnc 
vcncflfe.;£ro:if in ficciek>cie.^bclio:ccl cft 
medtf inrcr rctcrc? nouu i grpGum ? cjcrcnui 
tutnecolo^ccinericcu.-zcielrvdocirerfragi^ 
bili no pcderofue.in eui9 vacuira re c cjddaj 
file tclc aranee fapo:c bfisacutu 1 mo^dtcans 
lmgua.£rbonn cidc qtf admillraf evt afittf 
manfgnuparaUqtf eftapudraciiccdue:? in 
fundaf parttfl aq? cr.eo:icf. er affumanf co:ri 
ceeilltue-zcicftcccnfinvmbw.Tadminiftrcnf 
mriacribeliari.f3o.mefiie.cfl.t>cclkbo:o. 
£ iue funt t>ue fpceTla aliiwealto.-altMger 
1nigerincolumio:2albo.ancfcminafsitbu8 
accidctia t imoue % tremo:$. "Rigcr fo acc\rit 
ci iuuencfccntia ? tneolumit* tc:? et co qtf ma 
gie digif .?$aie cuiffapo: c acutue mo:dicl8 
gultii.ct bne fa po:e ficut a farw ^p:ic: ct qtf c(i 
frangibi!c.er mcditt inter fubrflc er grolTum. tt 
mc&ia inr cr recene % snriquih? mcdium intcr 
p©n dcrofum % leuc:immo plue UuecB pctidc 
rofum-z q?5 clcuecardte afpwttatc^t mdioj 
pareipfiueplantecradi]cipfiuej£fmcli'o:j28 
co? funtcutce ipfo?.j£ t mcliue tpe coUectatf 
nie ipfo:um funt vcr -rcftae. 

0pfratfonf0 

flDYiif.T^adiiLclIcbountgrisccepracoIcra? 
•zfiegma p vcrrcpurgar.Slij fcamonca^fal 
mifeer.54 jnulti cu vifcelfca coquur:mulri cuj 
lenficula.naficacccptavarcpurgat.f^ur 
gatio iUa mclacolic^:cpilcnri^:arreficI ct pa^ 
ralitictmedicaf .f ©uppofita mefimte impe 
rat:abo«fumfacu.fitolaepurgaturipofiti. 
fRcddtt audirii p9 niduu eicctalicabi^ pur? 
gatmi.tta libanotidiccre ctpicilicldect oko 
citrino accto addito.fola vtcatbaplafma im; 
pofita maculae oee coigis t olkt Jcptae oce % 
3cmfielirnpidat.fcabie8curatin acctococta 
% garganfmo acccpto fcu adbibita 'wHoictl 
tiit m itigat.x mifccf ? 1 hpricr, mcdicamtb? mt 
pa vino tpollincouJd^ vrcatbaplafma sd 
bibiraYdropk!pltarcrlccru^£rfilinorucrit 
infcrra xvino mcrfa vinu cararricu! ttdder:aq 
incj fufafueritfi somtu afpcrgaf mufcae cc 
puliccenccar. f aboccifodif celerirer fodf 
opo:fet;q:farditatefodictivifti3bcbcf8t^w 
» olo:e capit^ ccmouer m plimi foilo:ce liu» 

x.im, . 



a 



& 






Kvmtitm 



alk fumpfo x vitio porato fcrorefodicbant. 
J ff Bui.£lkbo:9 nigcr pfcrt linirusfug mo:fe 
am cuacero.? fifr fug loca tn cjto lut fo:dce tt 
fiir fug alba mo:fea z aadicat vcrrucao f £ t 
euacuaao q fit cii ea ptienit albarae. pofia 
nigrt cft a fcirar.vi.vfq5 ado.i.fl £onfcetio pil 
4uU? qs t>cfcnpfit t?aly.qrii iuuanictu cft vl 
ttmu acl melacohcas cgritudines? cancrii t le 
4>:a et mo:fd nigri 'oirric ilc:cjnim cftbec pctf 
intjEUo/Recipe yctc pigre.^jtt).ettcbo:i nigrt. 
-jioiYpodq ana.^.v.agarict lapidiola^ulifalif 
indt.colocintideana.5.i4.x>ofi8a.j,q.vfq5acl 
aurcos.ij .funt fane et icjrgfc. 




€apifulum.djEut* 

V^yUpatoaii.D yafc.ca x>e eupato:io f m 
♦•^traflarionenfam £upato:iufrutcic cft 
^^•farmerofa bafta bnsrecra-z lingnofaj 
tenue-r nigrazafpcra in cubiri vniuslogitudi 
nepo:rcctaaut ampliii8.5olia funtciin gyro 
©iutfaftcutpentafilonautcanapisjcuiuc fo* 
liaincapitcincifa funtvtfcrra.fcme amedia 
bafta afpqt et fubrostjecluiu eftei.f Bni.lib. 
i|.ca.t>ecupa.£upato:iuefteiclxrbi8aroma 
ticis.t b?folt'a q funt ficut folia canapio. £c 
flosriueeficutnenufar.-z eftiUudq-admtftra 
tur.i fuccuec ca.in.i.fic.in.rj. £ It fubriliatiuii 
incifoumvaldeabftaliunmfineattractionc 
et finecaUditatemamfdta.£tinipfa cftfhp? 
licitaefiuiantf omkitae er air.autudo loif 



cf^. 



tieficut eamarittido *loeo «ff-fMi.ca.o* eup3. 
£uparoriii regta b5 actionacaulioli gno fi ni 
firicantisifrfuti cubiralis aliqn-z ampUoato 
foliispcr inrentalla 3nq5vtcanapiof> margi 
itea intide nigris 2 ipie plumofis rariiccq^ fitf 
guacua. C 6alf.vi.fim Jar.cap.oe cupatorio^ 
£iipato:iu^bcrbaqvocafvoUicru maiusvf 
agrimoia.cui9fubftaria c fubrif.fcpo: riuseft 
ftipric9.£t$ttt8ei9eca.calidirarc modica a 
©eficcat .©5 feiendu cv eupatorifi filr fm D ? 
af.ca.t>c agrimonia vocaucrtitanriq radiccm 
agrimom'c:eo cy eoiuretica valdc. 3rc f m m. 
de ca.tkc marubio ^arubtu cria qdii aiparo 
riuvocaucrunt :qm valcr p viriaepatie.': p:c* 
tato no e v«£ cupato:iu.qm D vaf.facir fcmo 
tmica.t>ceuparo:io:rfcmorim t>c marubic» 
-2asrtmonia.t5ocfifrvoli)it3o4i3cfuc.ca.t>c 
aiparo:iocut>icit:cpt>iciitalici cvcbcrba pu 
licu.noluit fin vau q> (it baba illa qtu latini 
vocatpulicari.iaipato:iti.qm pjaf;facit (d 
morimca.t>ccuparorio.qt5incipitcuparoriu. 
ct fcmotim ca.t»e pulicaria vcl berba pultcu cp 
incipitcoin5a.f5lictitt>icruct>5tnrellisi*iJbc 
fuc.'Ha tfr cy cuparoriu Pm^fda cbaba puli^ 
cii qm aliqui vocabat ba ba^ pultcucuparo:t 
umabn.qmeftt>iuraicavaldc:avalerpvi^ 
tia cparis.^iro: qlirenncdici noftrirciieno 
aduerrercs ^ba D Y*f.& ui.-z STaa . -Jilini. z 
jf3afo Damafccnicrcdut bcrbularijs faliuaj 
asrcftccuparo:iiiciccritoqnccin fapo:c nec 
in odo:e cti co pucnir.S>iaut tn ipa forilm vir 
tutc8Cuparo:ii inutueriit^p co ponerevolu 
cruRCiii9gfa ipm cuparo:iuvocaucrur.no Uce 
bat t>iccrccride eet:qmeuparo:iiiptt>i(ioc 
id cp valet ^viiia cpatt.sbcuqtiebonii -zpa^ 
co: qtf cft cpar.vndceiiparo:iu.i.bo3ul cpari. 
f5ve?cuparo:uieaiiid cj> anroiiomaricccbo 
IW15 cpati ficutillud qt> vaii cft cupato:ium. 

©pfrationre 

f Dvaf.f5trlfla.n0 .,£upato:iii vakt p viria 
cpatlrz folta c& (iccat ajatngia po:cina vctcri 
addita trirat impofirat>ura vulncra ad cica^ 
tricet>uciir.f Scme^o ei i ;<:folia cu vino bi^ 
bitat>irTintcric' et mo:ftb> vcncnat* occurrilt 
mcdicado.^j£adc tit toaa.ca p^p:io t>e mc 
t e D Y afa addit.£ t funt multi ci putat cr illa 
bcrba (it aGrimonia:t erranr:q: cft alia ab a. 
£ 1 1108 c\dc manifefi auimSia t>e eius ce in eo 
qr3riu'mu8t>eeo.^f£fidcauc.6at'.3ntYria 
caibcfareupatoriua^itopilaridescparftfo: 
tificar ipm.f 3o.mcfue.£ tipa to:iii folurione 
cducitcolaazftcgmafacitc.teft pferuatiuu^ 
a ptitredinc.f £t pfo:tat ftomacbii cpar? xii 
fcaarz pfcrt ©oloribxo?^ cftmcdicina fplc 
ni8;ct opilationu oim cgr itudin um ab ca fa/ 

l 



■ 









^r^0.y^ 



^S { 




:J)f«<T* ffif 



BWttbti 



ctarii.^jE-tfibtibiisIogtfEtemiVcfijbucnifi 
x>o\'ie' ticcocrioniscfus porio efta. 5.tti;vfcp 
fldvt.ctpulut'8o'ii8a.5.q.vrcpad.iil.lofoeiu8 
ponirur insefectuaus abfinrbq x a^ari. ana 
tnedium ponderis ipfiu8.f 3uiccn.£uparo 
riunt eft bonii in initio alopicie ct rvrie: er linif 
cu adipe veterifuper vlcera ©ifficilis pfolida* 
riont'8,<irj£reiu8fuccu0?fcrrfcabiaerp:uri^ 
tui qn bibtf aiaqua furttiteiTe et orimclle. i ft 
militcr flos ctuc et fuccus tpfius c fo:tto:Xo 
fert t>olo:ito eparisrz opilarionito cius ct co) 
fo:tat ipfum.f £t cofert tnricici fplenie:ct a* 
poftemaritoeparisttapoftcmarito ftomacbi 
jtmsbcitaerfuccusconfcrurmalicicifonriC 
ctaccidentibus bYdropifi8t>ariJin potu cttm 
vino:etc6fertvlccrib?intcfttno:u.f^oferrfc 
b:ibu8 cronici8:ct anriqut'8,ff>:ie fuccus eiua 
^uecufuceoabiturbn.locociuepontfpon^ 
du8eiu8t»ea5aro:etmedieta8p»nderi8tpft; 
usceabfinrbio. 




Capitulum.djEtnl. 

^Y.Ufragia.^auro8cap;oe «^fik c ^ 
■■«^berfjaquefimilarurin ftipiribus yfo* 
%» Apomifiquia ftipires fui babenteolo:e 
vtolaceurznobabentramos.^folia funtin .fli 
pirito a medietate Iuperiu8.et funr paroa imi 
faficut0alltatticrifta.ctbabcti1o:c8 refiden* 



tcsatfalbedmcm fatfeparoos. 

JE»ptratttinf0 

f^cdefsoloatoocttlo?.ct?f0:tatviftim & 

'xp: 




CapituIuttwIjEui^/ 

/?Y'2fbblici £>era.li.aggre.ca.3c amleg 
r^rbcUiger.ideftmirabolonicmbIici^bel 
v ^kria.pebellirici8baberurfuperiu86 
^.inca.bcllirici.£rfunrambefrigidcctitccc 
tn fine rerrij gradus. f 3oban.mefuccap.t>e 
mirabolanie.^irabolani cmblici funr ejc mc 
dicini8confo:tanritoftomacbumco:tepart 
vtfcera.j£r mclio^e c% cis funr babcnree fru* 
ftagrofla et Dcnfa crgrauiaque minus erc* 
fcunt in otiibo et plus in carne:rari quocp n on 
babcntfpiritum.etfuntfrigidccomplcj:ioni8 
partim.et(tc.in.i.0radu. 

^ptrationta 

f j£ mblicifunt cofoufaiui meb:o?. i coadttf 
na tiut partiu eo:u.j£ t funt t»e ejtf inguetito in 
flamationein ftomacbot epatc.jEripinutri* 
ti maforis funr operarionie i minoris co:ru* 
gariois.f^oduenutricdicmblfroe.Sectf 
pccj: eisqnritare qua Volucrie erfub merge 
inaqttaponefolivfcgdutumcfianttbume* 
ct enrur :poft cjt p:im e ? ponc in a qua mellie et 
timittep. tuosfcice.? sdndecoqueaim fa# 
l iii) 



a 



Crarratus 



«ftitatc.? poft cf cocttfuerlt&imitte pa rifrcfri 
$jerari« addc cu eie mellis rabarjct ficut quar 
ram parte roriue cr recdndc? quida fufif odt> 
unr cu fpccicto aromaricie pfojrariuie/iciir cu 
cinamomo jciloa loegaltta cardamomo i cro* 
co ex fimilito.C^era.auc.j3aU£mbh'cii?a* 
bent^prictarc^DtnigradicapiUoe.etptobiba 
cafutn ipfo:u.ctconfcriitcmo:roidito:'zipi ra 
mcfcunrinaqua.f £tcondirierct8 faciunt 
operationcs mirabolano? no c onditcc&nul' 
qtria funt ©cbiliozes cie.cr tnbelliricie maioz 
cftxpiktae in4cttmtnc#in cmblicie. 
<f £r tde auc, v 6cdiga:a6.ciiib licozii|p:iera6 
cofo:tarftoniacbim#bibenrco:roprioneab 
eo.fonificanrltcmacbu^ ausctapperiru cibi 
i incitant coirunw abfcindur ipurij i romiriT 
i fedant ftrim.? augent <opctariouem fcnfue. 
^irabolani cmblici bclUricie t*cbuU jntjcti 
cu olco amigsala? t>ulciu % cum mcllc ringuc 
capillo8tolo:enigro.C?dfoa\mrfue.^ir4* 
bolani emblia eduefir folutionc ficg ma X% funt 
■ct rcbus r alde ptouanrito ccrcb^ct neruoe,? 
^ugent intcllcctur: pfo:tanr co za pfcrunr rrc* 
4no:wiu8.ct4nundificanr ftomacbuma pm 
wefacrioneet confotfanr ipfum.etfcdant fctf 
4Jo:cmineo^aufemntfirim,etaddiintin-ap^ 
$ait U5«.f edant romitu. 




Cflpirulum.rlrije 

0'Rdiuta.3«iccnna.£ndtuiarum atfa 
clro:ruIanaetaIiafilucffrie.pcfiluc^ 
ftri in fcqucnri ea.tracrabirur.j£ t que, 
dambjlata folia :qucda5flricta.amrx vincuc 
lacrucamin apcricndo.f3faac mioierie par > 
ticUlaribue<j£ndiuia fcomcfiica i filucitrie e: 
quarumsomeftica tiuei fevirturt'6 eft.!£>Jb$ 
cnim amaritudinem:ponricitatcnut infipidtf 
tatcm.0ueircrjimin©uaefcuiidiairparrce., 
£ ft cnim cndiuia.br cmalts etcftiuaIie.t:Yc^ 
jnaliscft tnfipida p:oprcr a marirudinie i po 
ticitariepaucitarcm.jErctiam mfipidicae cft 
p:oprcr rcmpo:is frigidirarem.f rigtda quide 
cft in fine fccundfgradue.Ouidamanrem iW 
lam ©icunr eflc bumidanuquod fcnfii non pa 
tctjquia ftccif ae riue pala m clhwopter amari 
rudincn fuf a rq? ponricirar?.pmincdicriiam 
cft vnlie.£fliueaurcjncft amanmdo maiofc 
fedfrigidiM8minca.j£ftcmmfrigiCiain gra* 
du primo-fico» in fccundojncdiovf £cnflan 
tinue in libio graduum. £ndiuia tc amari* 
rudtrie cr ponricttate compofita :ct (kcacft ui 
fccundo^gradu. 



CJdem io tomacbum conro:rat.opflarice5 
aperir. Succueciuecocms et tcfpumatus 
tumoi.i5uc:carobibiru8j3umo:c8ejcpellirpu^ 
tridoejcttturumae fcbice curancatbaplaf? 
4narcindcfacro.calo:cpari8«rftomacbijni; 
rigaror.£umpoUinco2dcicroleorofcomijtr9 
apoftemata calid&matimeKtnoculie fuerit 
fanar.arterico8ioc:calo^mirigar. f Jfaac 
vbi fup:a.£ndtuia gcncrar fanguincm pcio^ 
f tinde »3aU'e.Xacruc^ fiueendiuia qucma 
ioiis cft amarirudinteipfa t crcric«c5 fangui; 
itcm rarir.ic ftiua cmm fm medicinamemcdt' 
^cri8.quepluecftapairiua.majcimeconftipa 
tioniscparie^ue fieUta t>erur cum obfomc* 
^aro ctolco minu&erir nocibilie.©ircro cii 
-accro ftomacbum confo:rar:er renrrem con^ 
Itipar. ^uccus eiue cocrue ac ©cfpumatus 
cum otftuccaro bib irue:conftipa tt one a peiit 
^umo:e8ytoncfacru8jnundin'cat: ct tip kt 
bricirannbue conuenicne cft. 
f 3era^uc.0alicj£ndiu»evutu8 dlfictit 
^rrueiacrucc. 



CapiruI«m.(I?iE 



a 







/gyWuta filucflris.t^afco :i. j^nJiuia 
#*#»filueftri8eft vna fpcrics que vocaf fcr 
^^raliatfo o/ tirfum babetinmodum fcr 
rcctin fapoie filucftrie cft ftipticitao cii a ma? 
rirudinc 

©ptrationtD 

f3dcm.Omm'u^tu8cftftiptu:actcuftoma 
ca.Oenrrc abftinet.cocta rii accto et maume 
fihicftrie.ncjcatum ftomacbu cofirmat. 
fiEcdroarioncsftomaiftimirigar.folacuj 
polenta pofira cardiacis blandif. 3n rumo? 
reoculoromfubucnit. 

fiolia vcro eiusimpoftracteatbaplafmata. 
Bcufium fowpionis mirigat.polenrie ttddim 
•z impofit i ignem fac? copefcit.mi]cta cu acet o 
t ccrufa oito reto calidis opintlarur. 
f 3faac.£ndiuia filucftris q frigida e in intf 
tio p:imi gradue/z ficea in finc eiufdcm4?abet 
ftipticttateftomacbu cofo:ranre.que fi man* 
ducef atitfuccu8eiu6potctur;mo:u»ifco^io 
nie.pdelte catbaplafmara fifr ogatur 
fTladiicduafipotatuncontravcnenumau 
tiliaf.cum mirta vero mijtra x immi(Ta:p:ouo 
cat menltroa.f auicen.tse virito co:dis ait 
#eonfo:tatco:. 

£apitulurn.rljEtf 




X»YXCtropium.^lf^fl.t)c elirropfo.!£li* 
•W»tropiumpmo nomcn accepit eic eo c? 
\*^»eftiuofoUtittbflo«at:ctcr foltemottf 
to folia circuacra ^ucrtat .vnde z a larinie fol 
fcquianuncupaf.'Raero:tetefolefto:c8fuo8 
agiu? feitcru5 recludit eu fol occubuerir.ipfa 
diqualattniinruba ac vcrrucaria vocanneic 
co o/c]crinsuatvcrruca8.c]caqpotatavelca'; 
tbaplafmatisvicetpofitaverrucasabftergtt 
pyaf.ca.t>eeutropio ctto farirca.fcc p:fo fic 
clitropul maiue multi fco:pio:on ©icct : eo o/ 
fio:ee fimilee funt figurefoupti .folia babet o 
3uno fina etafpcrio:a ctnigriow . tbaftae cp 
vna radicc c\nceiautn;critramur cpplurimia 
in ejto flo:e8 ftmt coIo:is albi-z fub purpurcrr 
fubcirrimficutcauda fco:ptj.Bliud capituui 
t>c elitropio titfr. £lirropfum minue nafrinjr 
locis cu Itie i inpzatie.i finile fupzadicto, ftf 
men rotundum babet pendene» 

f&prrationrs 

f pyafc.&ui 1 ; fecrbc manipuluevnus dtjcuff 
ct btbirus flcgma ct colera ©eponirX u vino 
bibirue ictito fco:pionfi occurrit Xarbaplafo 
maritoadbibintscadcmfacereportft 
f *^bultictiamradfcemeiu8coHo fufpcttJ 
duntcontra rim fco:pionu3.fcmini8ciusgra 
na quatroo: cum vino bibita ante accefiionc 



^OTSV^ 



fr ; 



a 



£rarratu0 



quartan3ru>natfmu>emcduT;eft:tcrrianarq8 
vero m'a grana vrilircrt>anf.f $olia ciuein 
carbaplafmarito adbibira rumo:ee fpargunt 
mirmiceae co:po:ie limpidat .ficca vero folia 
eius impofita podagrici8marmu p:eftat cffe* 
ctu.Z>ita ermatricifupporitamenftruie im^ 
peranr.2lbo:fum faciunr. 
f £litroptj minoris frerba cum cius fcmfne 
t>ecocrarz cum nitro ct vfopo et cardamomo 
bibita rorundoe ct laroe tambricos ejccludit 
clauosimpofita cum fale rollinmarimeXi fue? 
rirdijcacrimpofira. 




€apttulum.tlfrif 



►V S-Of^z. 



/*Y^itbimu.3obannc8mcfucea.t>ccpi 
§W»rbimo.£pbitimunafciturfimilevtcuf 
ViAcutcplante aur quibue fuper occrefcit 
*~ funtalkal-zalbafee.ctqueda fpeciesorigani 
o & -nvi(k(x ^ius aure aliud eft crercnfcaliud firicu.^je 
liue clt quod dt cretcnfe acuti odo:ie.ctquod 
nafcirur in fyria cft poft illud.fed eft mclius ru 
funuetmcliueeftadbuc quod eftcomplerum 
ponderofiue.j£tmclio:pareciu8 funt qctre* 
mttatee grofTe.q funt ficut fiozcelub cirr inum 
autemetpallidumeftminusbonum.ca.com 
plerioni8eftcrfic.in.u.£teft compofttum ejc 
parribue igneiea qutbue indt ei acuitas.? ct 
tcrrie fubtiltbue aquibue indtci liipricirae 
pauca. £ripfum quidcm eltfebriliariuum 



rcfoluttonum:apcritiuuopflanonl : utnfoif 
tariuuvifccruifacitlttim sgencrat dluatione 
in eo:po:ib? calidie.ct dt er, fcebilirer et rardc 
foluentibue v tptcr quod p:obibcndumeftf ub 
©ominiocaltditarieetficcitariepofitieXon 
fo:raruraute operatiojpfiuein mulritudinc 
quanritatietpfiues in aflbciatione rricu^co 
magnificantie cffecru dtie:ficut funt mirabo 
lanirindi et nigri: aut ellebori nigri. quar itis 
parua.&quaaut mclliecu^pauco fale.auc 
aquaoccocriomepanularucu^fale.fimilitcr 
aut aqua lactie cc caprie fumpri vigo:atopc? 
rationejeiue.Sfalgemmaveroautfalindij 
aut falnaptijunt ejc rcbue que fibi addita ad 
dutvirtutiupfiue.dtamauteafanTefacitopc 
rationcm eiu8.2n d aliquid virtnte acutum 
mifccf licut pipcr ct piper longu jinjiber t fimi 
lia.£tn6ptermittaequin cadatin poritoei'9 
oleufce amigdalie tmlcito in quo inuoluatur 
ctin&ccocrioneipliuepaimle line inrerio:ifo 
quonu addunt d ad bonitate leniendi quod 
rimeturecintrofitateipfiue.Et ne ignottscj 
niam cpirbimut>et>ecocrioncmodieuj fubftt? 
net:quare opottct vt fiat illud f m lege . "Pic'/ 
rogariulautcbabetfupcr omnibue folurtoe 
cduccn tib? mclancolia .cducir cnim cam facilc 
finemoleftia.£tcum 3oban.mcfue eoncotf 
dantomneealut>ocfo^8ficutBuicctk3c/ 
ra.PvafafSalienue. 

Sptrationre 

f 3oban.mefue.0utdam fcicun t cptrbfmu* 
cducitt>cflegmarcaliquid 
f £r t>i,dt £aulU8:q> fotarfonc educir bumo? 
ree aduftoe:et t>cclinanit ab eo qt5 copwben 
dft vniuerfitae:etego non fnucni qtf fiercr iV/ 
tad.poteftae autdue fuper bumo:cmelancol 
lico.ct egritudimtodue magna eft. ijpiie in 
egrirudinito capirie ficut dt mclancolia epile 
tia alguefguce t rimo: i vcrrigo:ett>olo: ca? 
pirie:quaru mareria eft mctancolia. 
f tialet erii ad tremo:eco:die. tfincopun. ct 
egrimdmc6melancolica6inco.ctcftmedict^ 
na magna opilarioui fplcnie % cgrirudinibue 
inco.f £rc6fertegritudfni Ypoeondriorii ct 
opilarionircml. 

fEtfrequeevrueporionieduecftmecIicina 
folenniecancro lep^ectvlecrifonigrieet fol* 
uit quarrana.pofie potio ci9 e in t>ecoct6ea.- 
3.v.vfq$ ad.rjc.et putaer! ctfa.Mq.vfcg ad.vu . 
3Ui autquifumunt ipfum vircntacecprione 
ctueincftate. 

f "^li.£pbirimubjvirfutepurgandi flegma. 
i mclancolia et e (cctcu adiucto fecu mcdtri* 
niepurgannfo mdancoliam. 



P 



Bihttim 



cpirbimi buliat :et in rali a qu a pon5tur,ui .la/ 

pidis tajuli vd ai mcmcuctfrigefta matcria t* 

nirparierui.mulricnimliberaiinir.valcrfimi^ 

lifcrtalie secoctio paiienribuo cmo:roid98 

ec melancolieo fangufnc. 

'C Pvafeo:tdc8.£pirbunuvirideaaeptum 

ftomacbu vecafcet vomitu mouct.ventrc' t«o 

oocatct.naufdfacit.accducitflegmatcolera 

•z maume m'gra.t>aturadpiirganduro:;iccm 

tu? mclie ct frifillirica mcue elccaia m acapif. 

*Ucriu8awctbimifio8alb?dtatq5afper:(ecl 

«ribocci^alembabftvirtutc.l^pcrospur^ 

gantftcgma ct pcrventrccolaarugrani t>af 

in quibu8p;eco?dia p:efocautur -jcpaaasef 

fafpiriotis. 




CapituIum.tIjE3Eii) 

'^Y^imcdul/lblini. Epuncdiu fiuc vt lati 
#*4»nivinectamt>icutfmPvaf in p:opo 
x ^^capi.baftababctn6maio:eedercfuTri 
lc.7folia.)c.aut.»;ti.carcn8flo«tfcminc.*Ra^ 
diccftillitcncranigracuodo^cgrauictgiiliu 
fatuomafcirur in iocio bumidie 

jE>ptrationt0 

C ftTafeoudcs.fbtiaciuotritaeumolrotf 
impofita nwmmassrcftcrenon fldmimmJ 



f 5blia cfoe •: radiic cii vf no btbita pofl pur 9 

gattbnc menitr«o?.5.v.ficncrareno finit fi.v ♦ 

autvi.tietobibwa fucrit. 

f £ pimcdia f m pfalcb>a*q?5 incipit mcfptf 

la cft mquit t illa q" inbvfpania nafcitur : qua 

mulriepimcltdivocant.fcmcn rorundu brle. 

bocaptu di adconicdcndu;: elt fiipriol: z tar 

dc mamrelcit fimilis fo:bo:a noe latiiu voca 

muebanccpimctidam anjarolam. 

f jlfidouie vocat ea5*£omeUdo.fc€ qua Jegc 

(apuuUunmcfpilunitx m 



* 




& 



Captrnlum^EJriuf 

V»V5fcmercoii eftapud t>vafco:idem cM 
«^*pituloj£ffcmcreon:qucm niulrt Trinf 
^* > ^'agrcficmvocanf.foliactbaf{amfimt^ 
lia lilio babct:fcd fcnera i f" ozcealbos et mtf 
noiee^t femen mollcradij. cft ct grofla vt.t tf 
fiitue.airtue cft illiftiprica ctodbzfe boni n& 
fcirur in locfs vmb:ofie ct in filuie. 

jDpfrationts 

CDYafro/Radir. cuie*ecoaafn «xrcttitf 21 
ta tvokucm ccniium mirigaf f 5olia vcro et'9 gj 
irt vino ©ccocta et caibaplafmatib? fmpofita 
nimoteeet trarictee fpargunt. 

€flpttuIum.tIjEjEU. 



iTraaaa» 




a 



/*\* BtUu8.^dccIflact*efaT)Uc9.£amc? 
w**j* acrie tf: cbulStf ftrnt plateomito nore 
^**- On $ .©abucue c acrie f$ cbulue c ca 
meacrf6.tSefambucotracpbtfmca.fambu? 
cii8T)ce. c 5cf.Ii.ag.ca.camcactie.j£amcacti 
fcuo funt fpee:q£ vna grccc ti acrie.m latino 
fambutf.ctfctfanoiaf in greeo camcaoiej et 
ci ue c intctto terrenue acrie.x in lanno t>i cbu 
lue.^rueciue c q ©cficcat ? incarnat? rd bluit 
refolurce teata.pli.caxameacri.£iue t>ue flf 
fpce.ca^vnaaiTtmilafarbozibbnntcramoe 
filee canis rotudie.cf£colo:ead albcdinc.t (e 
longa .1 fut in cic qrruo: folta aut a,nq$ po:rc 
cra fup. ramoe clflibera filia folue nucie;mino 
ra tneie:bnria graueodoze^infDmfraritora 
m.ozu funr flozce albi ct grana fftia granie vi 
ridito vcllctifoiclrncolozocclinatad purpttf 
reiratc cii nigredine.er fut velur in racemie.ct 
bfir mulra bumiditareodo:elini.et ilfa tii ac* , 
rie.Slia fa fpceq t: camiactt c mio: pma .bj 
ramoemaglrjfinetce bctbc qdraroeinc^b? 
furmlri nodi.erfoliainukcciftaria.ct fmgtif 
nodieftKafolneamigdafin fumirarito fuie: 
ntfi q: bfir r cnae: ct fiit lcgioza eie bnrifl gra 
iic odozc.? in fumiratifcramo? fut capitclla fi 
milia cozonie (updictc fpeci.et fcmeerf oe filr 
ct b3 ramoe logoe groffimdmetiigitibiuca, 

Bptmmte 

f airtp6cameacrieaipt4'ca.qaccepta>0o^ 



tf aqTuj vetrie fccporit. ct caeoR omatfca cfh 
fobaipfiHeclijcaerfupralTcutolueVerrcme^ 
Itur :cr majcic colcra t cp o rai t.ba ftc tlliue unc 
re clijx er eometrc oia ftfr faecre poffunt. 
fRadiripa elrra bvdropic$erimiu remcdiS 
c\*iSbo:fito vipcipofiraetbibira occurrit. 
f £ocra iaq etfomero adbtbitaturicice m£ 
tricie foluir.£>cme ciue cu vino bibiru oia fife 
rmtrfaccrcnouir.«l£uolco inunctiicapilloe 
nigrefcir.Jolia eiue viridia tumozee fpargur* 
polenramiua cobufiioibtmpofira pftelanf, 
m#:fitocaninieimpofira mcdenf.uulrterito 
paracolcfim faeiut,£>ruu8 vulneru ad fanita 
r c pcrdHcur.brdropiciect furdie fomcto adbt 
birapzcfrolanf.f Saip.ftuo8fono8 aurium 
f n nartto inrufum copcfotfifr ct vermee occi? 
dit.f ©ccbice cr pzurigiee rcpidn femefoad 
bibitu pzobibct.&iozfibue rencnariepccur* 
currit.Xaccoagulatufolutt.fXufnm anrtf 
qua copcfcir:fedreceteauget4Drtenoici6 ca 
Iid0rj deft.*Rcumagulc gargartfrco ^bibcr. 
% £> quinatKie ftngularc pzcirat crTcau. u m 
lcpedentifubuenit tolote tcnriutltainoK 
mirigat.f Bctie rizfambucusXamcaai cbu 
luetteficcartue ^tutie funf.etglutinatoncct 
drafozcticc.renerucbulicufolue tritu etcun 
nopotuitiaru calculofie^dcir.^Radicciuein 
aq cocta ad tertianam valecct btbira fpicnoi 
coemireiuuar. 




BWttbte 



£flpifu!uttw!£jEU't 

e^Ruca/fMate. £rucc suefunt fpcdce 
Domdiica videlicct ct filucO rte: i abc 
frtnt omnibo note.£ ruca ca rf ? feu M 
.ii.gra.Domdiica minoriecefiicacie b} ftluc* 
ftrie.afui medicine compctunr ferttinaifeeuitf 
dofolia.aimirebnrcoTumendi ctcoitii e>:ctf 
tandi.3lido .£ ruca t>icif qua ft vrtiea :co cp ig 
neefuvirruriert in cibo fepe fumpravener^m 
cendifi mouet.t^triuefpcae funt t>ue:qua$ al 
tera vfualie:alrcra agrcftie acriorie virttitie* 
Otracp tfi vfum vcncrie co"mouer.*fMi.eap. t>e 
eraca.£teacftt>omefticaafilueftrietfmifcc* 
tur in condimctie in quito arnee et pifcce m* 
tmguntur.tanta fuairitae ci eil vt greci eu^ono 
mia appdiaucrinn-ztncujomumvocari rcp? 
pcritncBpiuribuelocie. 

i>pttfltiont0 

fl -JMarca .£ mca b5 virtutc cofumen di ct coi 
tum ad iiiciridri.ad ftranguiria z •otflTurriam z 
paralilimvalet tecoct a cu carnibcconrra p:e 
dictae pulirie fcminie riuecu cepe ©ecoquafi 
cttctur bcrba ipfa t>ccocra in vino # rcnibn© 
carbaplafmara libidinemejceirar; 
fl"p>ecrini impofiravrini.piiocar.fbulute (e> 
miuieciue cn melle&r coficirur qni carbaplaf 
matue rentko bbidinc inrirar .fl £>at't>e dbis 
cftcali.et bu.in fecundo gradu..£r ipa quide} 
generat fperma :et generat vencofttatem :? io 
faciterecrioncinvirge 

fl£t t>icit j3af.eode lib.ca.t>e £ruca ftn txti 
flirione grecam calefarit potcter boc olue: vc 
neq? folii comedere tptn faale fi no mitru cum 
folqe lacruce:fcd x fperma generare cr edirum 
eitoimpctue ad coirum ejca'tar.t>olo:ariuutn 
aiit captris:et C magie fi c\e ipm folu comcdat 
fl^£didcinn.t>efim,medicinaca.t>eagno 
caftot>icit:crdtcalidectfic.coplcu'onie. 
flTlajtiicic cpagnuecaftue noc generatiu9 
fpiis vapozofi ficut eruca:q: augmcntarct im 
pcritcoitueticureruca.fcd^riu cft croceba* 
bcrevimincakfaciendo et ctficcando.no tfl 
agnocafto l'imilieeft:paulo nanq5t>cficit in 
amboto/flamealcfacriua quidcm ct ficeattf 
ua eftcruca^oirfcrt atitcmmpjmttione quali 
tati6avirtwi'e.fl©era.auc.j5at'.£rucagc 
neratfpcrma ctejccirarlibidineja gcnerarve 
tofirarem.etideofaciterection6virge.afico^ 
mcdirur fola inducit t>olo:e capirie:qre opor, 
tetvtcomcdafcuealactucacndiuia vclpo:* 
tulaca .et ipa.puocat vrina et lajcat ventranrz 
fOucftrieefonio: cpfitt>omeftica.fl £tidcm 
auc.Sbm mcfuaY.fuccue crucc recene qn ad 



minfftraf cufellcbouirto lataf vcnfrcet pfoi9 
tat t>igcftiua\s ttnifcu rie fup:a eica triccevlce 
rum ct t>da cae.flDY3fco:«5.cap.t>e eruca. 
£raca multii comcfta vcnrre" ftimular.SKtne* 
riueomnia illa facac potcft,najt>iuraicu cft 
•: calcfacro:iuXarnce f uare^ purredinc poc 
lacriautaccro miictuint troctfcie indc facria 
£rucc agrcftielcmincmulrij) linapi vtuntur* 
virrue cft ci t>iuretica % vtfcicjio:: vtraqj tnvC 
v ctcree aiun t comouct aaus vcncrcos 




CapituIura.rljEjEUff. 

•ryBula campana.3fi^5aba cft quatn 
§^J»ruftiri alnam vocant.radicc aromati^ 
v±Aca.odo:tefummicuin ieui acrimonisi 
Q>era4i,aggrc.ca < rafinauc.}3C?DYaf;*Ra^ 
lin.i.cnula.nomiuant eam quidam 5in5iber.ee 
babafimilia folqeplanteq t>ictlflomoe: nifi 
' quia funt afpcnb:a et longiota cie •: babet ftt 
pircm magiui.-z folia riue non elcuanf a rerra 
fcdeicfaidunrurfuperfacietarczbjradicein 
magnabonfodo:i8.cui9fapo:b5acuitatej'ec 
cftrubeicolo:ie.3nucnif autplanra que o:tc" 
ficutYreoeAcftfiaitfapenraria^nafciturin 
locie montuofie •: biiidie et in borne. £ttellu1 
aucc radit cnulc iutp.ccftiuo ct t>eficcatur. cc 
cftilludqbeceo adminiftraf.£tdtin bab^; 
lonia aliafpecicsenule.ct cft planta babcns 



i 



Ktmmm 



a 



£ 



rair.tilc c ! o ngttudme v n iue b:acfa .qtri c^re^ 
dunf fugtarafieur fcrpiUu.*z babet folia filia 
foliie lcmiculcmifv quia funt long!o:a -z pluri^ 
ma fug ramoe tpfoe.ct bsbctradiceeparuas 
cirrinae:qnaru grclTirudo cft fiait Sfgirue mc 
diue.afubtiUo: pare radicis cft fubtttic: fngi 
onpflrre auscact fupcr ipfa cft cozreiniger. na 
fricur vero rn Isjciejuaruinfe.Tirrus cctcalida 
•2bu.ctef{>ncacalichfa8 fuperfroa indtgclra. 
ppLa .Tsecllcnto f m rranflationem noftra 
£ Ucnium mulri fimpbitum voeant.Slti vcro 
barihSUi vcro fiomum. Xarini vero tnulam 
vocar:fc4iababeffiomafiViaauguftaetmol< 
lia ct oblonga non crcfcenria in alt u. ct fiipcr 
tcrrajlaretuilendtinF.^gdijccliilliingcaeet 
odo:ibilis et rufa er vifcida goflu non fuauie 
5rutet cft fimiUe lilto .tirfum babct albti5. 3n 
cuiue fiinimo floe cft aurofue:ermonruofi6 z 
v mb:o(i6 nafcirur locie et bumid t8 et in o:tis 
J5al.v(jiim.far.c9.cllcniu(iue tlmaUum fiuc 
tnulaeampana.:£>ccplanraet radir majrime 
vtilieeftadltatiminpumo aggrciTu calcfacie 
riQ:j£rideowcnducll no eertifudir.alircrcai 
tficcamfkurnigrupipcret albumimo cum 
bumiditare fu£f1ua/£lafeariue.£ nula ram» 
pana cajeftinffoctcrtq graduser bu.infrmo 
£ nuleradir magie copcfir medicine qjfolia.? 
viridie $ficca. 

Bpumwwz 

fSera.Xlirfuec^eftqadiuuaradcvccran 
cki grofibe btlowe et vtfcofoe a pecro:e z pul? 
monc:-i calefacit membza cgra egritudine fri. 
fiairfaaricacmtgranearz cofert fiujtibiUrati 
membto? qucfirabbumidirare 
fjp.rqnbibtft>ccoerioaue#uocatv:tnamr 
menftrua:etc6ferr coartariorit anitet artritet 
neruo?ettumo:ib:et mo:fito veneuofiepto 
pt er fui ca.folia #o ciuQ qri coquunfcii vfoo % 
ficindc cmplaftrii pfcrr fciarice.f j£t qnradic 
ciueccficiEcu rob ell bona fto.cc qut confiriut 
caBeficcantp:iU8.ceindeinfunduht inaq ct 
rcrut ct ponunt in rob ct reponunr. 
f ;!pumav cc$bo vpocti.£nula aufertiram': 
triflitia et fomfieatoe (lomacbi^ mundificat 
pectuei? puocat fugfluif atee que f ur in venie 
pcr vrinamcrmenJtriw.?p:oprieYinu5 quod 
fitcumca 

f gaUc.£llcnium:id clt enula campana tnP 
ceturcumclcctuattiequcfiuntadcduccndum 
vifcofoeet grolToe bu,ctiitctceinto:acc ica 
lefaciunteaeparficulasquefrigidiectt>iutur 
nie palTionitomolciianfclicucfunr queda3 fci 
atice et emigraneaet cotinue pamoncs artiru 



culo:0#>fcr frigtdirarcm .f PvflfXUcmrm c 

^turiekruenrie ? mictualie •Radijcciue efta> 

tefofTaficcaf.Bqitaclicatureciuevrtnam^ 

uorar.menltruieimperarfolutione. 

f *Radir ciue cotufa adfciro mclle vt clectuari 

um rufiim fedar:? owonoicis curat .moriibus 

venenatie occurrit ermedctur.folia vcro ciua 

tunfa % catbaplafmatibiie adbibita fctaricos 

fananr. 

f 5 olia ct vino cocta ctrenfb impoftta corio 

fbeemcndaHr.2£>ulri vero eadcmfolia fieca 

falcaddiro at>ulco:e;p uoeanr.cibum j> fto* 

matbtfatubritate.quequidecu fale ficcanda 

funt:vr ct caparo cibi fteri folent. 

f Succueciu6cumrutatufuenftbusp:o^ 

deTt.vrinam quocp 5menflr»azpartu crpellir 




CnpirulutintIjEri'it) 

^V^ula^o.^cfucjBfulacftcr fpctfc 
•^f»buelactiriniarfj:2elifoluriuum rufiiJ 
\*Aco:um.£teftciuealiudnigru3 babca 
radiccerotundaecrgrofiae fpiflt couicts a 
ticnfiponderofi.j£caliudeftparuumbabcn8 
radicce fubtileerenuium co«tcii.J61ccrioma; 
gntim elt fcindcns Vifcera. -fijaruHm ver* 



Bt&ttbte 



flludquod eUgifomcutopareplantcdiie c(i 
co:fecradici6ip>).slacctttec1t aarri9-zfo:ri9 
■zjridio: radiv ciue eft babee ,jp:ictatee c)nq$ 
fc$ cuiue co:rcjt cft fubtiliot i lenio: faale fran 
gibiKe,cteft babene j5 rubedine aliquid Itcuc 
. catTia,rp:tefiiE quapKtcrqt mcdicrao anttt» 
flcccns vcvo menfie fui cft mala.nigra ^o^ 
iticiofa z oaa in lode tcrmarii fimiUter/r mc* 
littetcmpueceUecrionisradicieritis eftprin 
cipiumverie.etlacri8etuerimGipfiue elt cali 
dc completionievz ficcetn pridpto rertu .1 lac 
ciue cft calidiue, et cft copofitum et fubftaria 
ignea acuta t fubriUVz ejc fubftauria. rcr rca l\i 
prica,ct eft inctfiuum etfubriliariuumcetcvfiO 
cariuii matericrum fubmcrfarum. liqutf jcttf 
uum fcifrnpriuum oafirioaim venarum, "Re* 
ctificarioBocct coidi epariac ftomacbot vit 
rumpit venae: 1 ejtconat vifcera : ? ccreliucit 
inftammarionee farienrce cadere in fcb:ce. ct 
cmendanir p:imum nocumcnru quod eieoti 
mctur:permifccndo aUqua ejc «ncdicinie co:di 
alibU6ctftomaricieteparicicueo.£tfcr'mz 
rcrtium comgttur acquirendo ci bonitatem 
cumrtbuecongtorinariuieacoadunantib^ 
confo:rantibue:fiatt elt wagantum ct gum* 
miabdeUiumetmufalagopfillu.etfuct5po: 
rulaec? fimilia.£cquartum nocumenru tolli 
rurpertmfccndodecrAueinfrigidannbuet 
cj.ringucnrtbueaUquae ccbiefadettb^apud 
me elt vtinrundatur t fucco altara,tacon: auc 
f n fucco endiuic et pauco acao.a fifuerit acc^ 
rum-occocrionieautinfufionie titonio? erit 
meliue,mirraquoct5 figillat ctjbonitatee nol 
rae et abfintbiu:fimiUter et aloc £t ujrit.3u 
deusanfundanir in lacte ©uld aut acctofo ct 
ineo remoueat lacmultoriene z cjLUCCcturJ-e^ 
priminiremfuamaUcia.£t©icit'Rurue.S4 
folurio percumfupcrarlabcaiofalcdcatina? 
qtuafrigidafolutueCmibi enimvtdaurvabij 
iitctiucnicnsjctrcundas cnim frigidumtnclu* 
ditctcoaduiutvirnitcmedicinc a co:robo* 
rat eam:nccno 1 materias i viaetmpulfionuj 
rcpcUit Ucut te farcfecimue, Succurrendum 
cnim tunc ficut ©irimue in canonc. 

^ptrariontg. 

^ f 2Jobannee 'i£)cfue. Sblurione cducitfo! 

gmavebemmraetaquamcimnann bumo 

reemebiicoUcoeamafmaeaiueturiezco* 

ferccoloziearum; 
» ftftcjcmediciniemagnieYdropaie.tlcruj 

nocaltomacboaepariaseficcatcotpsvtai 
c ti8ipfo:ctconfumitfperma. 
** 4f £t lac ciue farit boc vebemcntiue . ct faric 

cadere tnfcbJce. Pofie comcie radide dua 



cft a kvrat.tj.vfq} ad.itj.-r cftie lactie a fcvrar.f. 
vfcpad.icj. 

^&cd (c kndu cy efula o?if in loris ea lidie-z V> 
ficciejcuiuemagns copiavidi fardinic 1 timVf 
ui:: fimflaf mulnl bcrbe fciere lunaric.nifiqj 
cfula lacrcfdt.lunaria vcro non.Undcvafue 
j£fula lactefcit:finclactc nluaria crefdr. 
ft> vafco.j .« . radiris dtie acccprc coleramt j£ 
flegma t>cponut.!Sucai8 ciue obu!o.i.acce^ 
pme aut eecliarium.vmjm<omnia fimilira fa 
ccrcpotcft. 

^/Confccrio pilUtlarii pfcretiii ad ydroptiim, $ 
Bccipiunf riue pwparari partceiiij .mirabola 
no:ii rimnotu parreequamio: a!oee;partcd 
quincg conficc cuj fucco fcniculi stut abfinrbti 
^ut cndiuic.jE t cft sofie caruj a.^.i.f .vfcp ad 
iti.ct quida m cjclactc ciue ct farina oblatae fa 
riunt ctfoluuntcu .cie;aqnidajfariut ctl anc 
toetjuccaro etlactetpfiiieetquidamrii car; 
ne citoniotu ct mafticcetlactcciue:^ faciunt 
folutionum bonum. 

f©cra.aua.Pv i «rco:idie; c 3rircradiccci'9 d 
«ccipiaf,5.i,ibibatur cu mdUcra to lajcatven 
trcnua pondue t»uonl onolofat folto:um ei9 
idem facit.afemenriue (i vcco acctpiatur:U 
rtatcolcramctftcgma.ifumafciilactcdue.r. 
,i.idcmfacit. f 

fEtidcmaucto.SbcnmcfuaY.S^ccb^n^ ^> 
p:iaae cft (icut mejercon J©i aore quie vulc 
itlum accipacpteparaipfumt ficut p:eparaf 
mejcreon^nifio/loco abfintbq pouaturrofc 
awagantumn bibatipfum cum aqua mclli 
autcumrob aut cutnt)ecoaionemcllie:auc 
cumokrc tamcno ct^ofteciueeabvno^ 
ratvfcpadii. 

f •fcaulue.Q» ccb:an.t'dclt cfulaiajcat aquaj ^ 
cininam:qnbibifcumfant'cb, *• 

f^tidcmaucNabcntncfuaY.Xajcatmcla^ - 
coliamaflcgma. A 

f^tidcmfmUbnim qucndamvcncnofo:uj 
3dq^T>e[ipo acciditeft pcndue.5,tj.aabfcin 
ditnujcum:qut accidttab co federein aqna fri 
gidattptoucaeipmfupercapurriue. ^. 

f ^tidcm auctotitatc^abtjc. ©ctb:an cft ^ 
caUdaiutariogradu:aficca inprinripio fe# 
cundi. 

^'Bofandumeftcy inlactccfulc noncft alicf *• 
bonita&Hno noca ei qui acapit ipfivj: ct mc^ 
dici viato^ceocriduntajmco mftoe p:optcr 
igno:antiaipfo:um:ctclt maio: et mino:vt 
figura bic oftcnditut tllud quod ma io: opcri? 
rur;iUud cttamnun 0: faccrt potefr, 

CapituIum.tl)E]EiiE 



Examtw 




Capitu!unt*d^ijE 






•Uforirtumeft gisminotu.ct vtdetur lb? 
'nare apudgrecoe bonum fo:midari. 
•■Ramfcicuntatfoation.a fouon grece 
qtf eftrimo:.Teu.i.bonu:qfibonuTuupfom W/ 

incre^pterfuiviolentu.^fOy 9 '"^ 3 ' 10 ^^ ^ 
bio f m rraflarioncnfam.£ufo:bifi arbo: cft 
fifie fcrulealbe.flafcirur in maurirania £era 
fienft.quearbo:plurimulacb:\;mufacitrifa' 
dum valdc.quelacb:Ymumulti colKgunt ftc: 
•pvifatudincpmo arbori pclleveruecins \\W/ 
ganr.a fict>e logc ball ilitr» ia cuiaf in radicc. 
•zdi pcufla fucrit radijc vnu rlume ftatim p:o* 
fluit lacb:Ytnie.a cueoagulat9fuerir fic cnw/ 
de colugut ©e pellito fubtraa$.£ft at optimu 
qtf eft reccne fubalbidit ct glutinofum cjt W/ 
\ to lingua vcbemcrer fubmo:dene et calcfaci^ 
cne.£ ius genera funt tiuo/onum quod collt 
irif fttbtr acrie pdlito quod meliue cli .alre? cp 
cadit in terra 2C.C"JMi.*Reji' tiiba inuenit ber 
baracufo^iia medicifuit£i8 nofc cuiuercgS 
volumeeicraninuaiitesm in monte atblante. 
fpectaffolijsacbantinis. Uieauetanfa eft 
vt fuccueeiue e leginquo rccipiaf. inetfo trun 
co fufcipif; vcittriculo cdino locato bumo: la- 
ctievidctur cftluere.f £?cra.Ii.ag.eaafo:btf 
€>mauc,pYakafo:bion ceufo&iu: et di arbti 



from fimacfmtleinftgura wa.nafctttnmaitf 
ritam'acerafiefi:?inregione rabejccft pleniiB 
multo gumi aeutoXaueant fibi boiee sb co 
qui colligut ipm gijniiyprer fui nimiS acuir a* 
tem.£tideo acapititverrceaialiumct lauat 
eoe a alligat fiipiriipfiue arborie/ocindc pu? 
gut arborie liipite a longeftatce cu Ucea.cfiii 
$trarnaqrinvenmb9eueea>ftipifcmultueo 
piofumfubifo acfifundcref et vafeatiquo. 
3taey aliqneffunditurintcrractiacjceo (vb 
iro^rcrimpcwfuicarue,£tegrediuwur fce 
co ejc arbo:couefpcaef.vna earum eft fimilie 
farcocoUein quanritare o:obi: % eft in frufta. 
et alia aflimilatur feci. Sdulrerarur aute cum 
farcocolIa:et cjc gumi arabico libi admijcrie. 
'Z£>eliue cic eo eft cla? acutum , £*paimentii 
aut ciue g guftum eft ©irTicile.qm ipm motdtf 
catlinguafubitocuviolentiamulta:at>urat 
mo:dicatio aue?>iu. £r,fprcrboc ome quod 
guftarur ejc co:poftea vidcf bonum.p:imvaut 
adcuiuecogmrioncgucuitbecmcdtcitiafuic 
Uneaerc)clioy.ttideau.j5at'.vi.ftm.far.ca.6 
cufo^io.virtueci^eftfubtilieacutaficurvir^ 
tue aliarum gumma^ (imiliu. 

©Pfrattont0. 

f Serapion auc.£yaf.:2?ocgi!miqnfit co 
bolcueo:baba^mteabftergcdiaqua qeft i 
Octb nifi q:ei9mo:dicatumRatfota t>ie.et p 
pterbocmifccfaialtcitopotionito quc fiunt 
oi fpecicto:? bibitur i confert fciarieie. 
fj£tipmcjcco:iittcfl*aivnor>ie.':Jcparatcb 
eielragmcntaeoE,jC)po:tctautvtpmuniaf: 
caro circiiftane ofltcu eeroro aliquovel cum 
pani6lincie:tipmbabetvirtufclaiKdi2calc 
fadendi bumo:ee aquofoe licurfinapie. 
f £r idco cofert lajcat io atte ydropicie 2 coW 
cc/i aliie frigtdie cgritudinifo fimilito illie. fj 
ipm aorit colcram % inducit firim tiimia: quia 
©cficcat.C>po:tet smtcm vtadmifceatur ei k 
menpetrofiliniaut anifi. 
f£tt)icutquida quado aIt'qdatalremo:dc; 
rit alique frindaf ur cutie capitie dus 2 ponaf 
inilla fcifliira.-ejcbocgtimmitnro nonocet ci 
venenit'zpondue.5.ui.ejccoocadit:quotiiam 
vulnerat liomatbum-: infdtina. 
f,£fidcauto.3lcau5i.©tringito:tfi'a'uma 
tricie multu.adco cp.pbtbet cjcire ferum. 
f £ t idcm auc.abcn mefuaY, -]&:op:iaae;ci9 
dt lajcareftegma vifcofum quod dt i lumbia 
ct in in tdiiniemifi quta infcrr anjud a t c m % t>e 
liccationcm aduftionem et tenafmonc.tt re* 
cnficatiocftCFnonferarur mulmm z mtfcea^ 
rur cum bdellio aut ctun fucco liquirictc : aut 
cum fpecitbue auqmbue tim di tpica ct una 



Btijttbiif 



fflomfncaflia llgnea rc tiniatur cu olco rofa? 
ctolco amigdalino.Enndiusctco eftclanr* 
nouu:qj5 trarifit abvno annovfqj ad tree. ; eo 
loz eiue cft cirrinus calidiodo^ am.irii acutu 
jEtfcofieaSeftatJuotokvratvfq^adtrcs 

£ Oobannee^efue.Solurionccducitflc* 
gmavifcofumet grofliuna lods pzorundie 
coreiomudificaoiuncfurariivacuitateabbii 
mozito groflfe ©ifltcilis cradicatipnie.neccli 
d rcs funilioad becctcft cjcrcb? mundificanti 
busncruos:er confumcntibue bumidirarce 
wbibitae ineie.fciflbluirorin olco fceyri.ct ritf 
ungirorcumco.erconfert cgrirudimtoncruo 
rumrrigidiftftcutcftparalinsftupozef rozru 
ra et trcmoz ct fpa fmus.? eft mirabilie rcd ad 
id. 

t> ^f£t fumptu in potu fm nodos cmendariois 
rit tt)edicitn magna T>olozrtonodoft'e:q va^ 
duntcrvcniutpcriuncwrae.ctclteicrctoqfa 
ciunt ftcrnutationecu foiutudinc 

U <tf £onferaaf autequadriennio. "Rccene aut 
annifui eftgniciofum.iJi autq fumuntipm 
rimcant frigueXonfcruaf' aut nc cito fcneft 
cannmiltovclfabievellentibus. . 

ft «ff £t ©iicit Pvaf. Sureus vnus er co intcrfi 
tic.pofie cine cft a Kirat.i.vi q? adicj. 





pba.3fido.f aba fcidr; 
! avefccdo qfifaga. jPagc 



jnancatzgrccccomcdcf 
|rc."jSrimu aiir boiee boc 
.legumincvfui funt.^al 
jjladiuslib.tj.^abafibis 
!j farculef pzofidet multu* 
•fructu ct marimtl rcddi* 
«ura.vt ad menfura modtf coplendi.ff ^dcm 
libzo fcptimo.^cnfc^unio fabavcllcda e lii 
na miuucnrc anr e luccni fanc ct anreqt luna 
pzocedaf.£|tcufla etrefrigcraraponatur ficoj 
gurgultonce infcftoe non patietur.3dcm hb. 
©uodccimo„3n. pzincipio menfie^RoucnbzJ 
^abafpargcuda eft.qucpinguiflTmum vfflcr 
cozatumtefidcratlocu.vclvalUm qua fucc9 
venicnea fumntitafcfccundcr.^rimo ferirur 
T>rindcpzofcindiF.crronefulcarur. • ' 

f jjdcm ttj.3n menfe peccmbzi faba ritf 
ca fcptimtimYduepofcft fmVBapofteractl 
bzuriiammalefeminaror. 
f B uiccri.^abc pzox imefttn t cqualitati: fcd 
plus seeliuee funtad frigidirarcm z ftccitatcm 
3nirX\8eftbumid«aefiu;crflua.pzopzieq5iri 
viridtbue.quc frigide er bumidc iudicanrur. , 
^abacfcquidcm vcbcmcnriueftiptice funt. 
ctcg^pitacebljmidiozcsacminozisnutrime^ 
ri.Uirlidce funtplurimefuperfluirarie: ac rar* 
detHJgeftionie:ae multe inflarionie. 5sbaru$ 
meliozee funt groflc ct albc:quenoa gurguli? 
onibuo Efozanrur.pctertozce aut car funf rc 
ccntcei6ar.vq .nm,f arxa.x>c^aba. f m trafla 
rioncmgrccam.car^Xiamue.idcftfaba/m 
vtraq? pzopc media m complcjtioncm eft in cjc 
ficcan^o etinfrigidando.t>am'ripataute qrt 
dam partimper abjtcrfiua virtutc caro ciue, ii 
cuttcozrcjcftipticue. 

©pfrationt0 .■.::■' 

ff PYaf;ca.t>c'5abafm franflatforiegrecam 
^aba noftra fumpta inflanbncepzcftat: ct iti 
digcftibiliecfK 

^Xuflrmmcdcf.?acccpfa tiflintcrijetfoUi 
tionrvcntrie fiugularc pfidium cft.vomitibus 
cft vtilie.cui ft aqua in cottura rucrit mutara 
Marioncmftomacbouofaat. 
fUiridiecomcftavcntretnflaMcacoftoma^ 
cbacftrarmcfabccatbaplafriiafibueadbibi) 
tacumt^Icntatumozitopcrcuftiire occnrrir* 
3dfolafaccrenouif:tumozemsmaru5fimiIi 
roodo curat.lacmamillie nimie ( pfluee tmpo 
(ita vtcarbaplafma ftringinmijcro mcllc i Wt 
rirw fcrjugrcciparoridibue pzodcft. 



txmitm 



O CXuw^sforpoae^rttfjgifXuntroTa t fba 
icmafculo?aibturitncoiumiaoto!o:eeocu 
tow ?pdat.£>cnnt»?quafiaf4 ttroittiimpo 
firarum^eefdJiufpargir. 
£ f 3 rtfanritoft impofira fiwrttteftce pzopcnl 
<Jacn6finik£o:ui dtocoau? catbaplafma 
ti impofiru macias afljasottedar^rttialnae 
fricationcadbibira capiltoet^udccre facit 
S % 5lunimfanguim'snflncnimitrinfiit pu0 
uerdpfofoloafpcrfo, 

£ f .fabamcdfa dtinfcrrrisidatcaiait>iffcm 
pcrantia alic^dp^rdcipane^pKcrortevirtutte 
et ftipricc.Ouarwf criuopofira fittc moldfi* 
t>diccat,-0odasrici8tjgif et arrericS inaq cof 
m admiaaadipcota'8rcceri:autanfcrinarrti 
tiga fooloic ncroorihaur prracrionc: t viccra 
tiones cum^jLimcBe fabc farrna cocta % fupcr 
poutavrcatbapXafmafanafc 

t> fiqaaatcfliculc^ttnamitUieetl^ptjmtlca? 
tbaplafma.amantdfi locabcc-medibcritcriti 
frigidatifiiint inftatrmtata.inattmc qircc-la? 
ct ie eoagulanbnc pariuttftoflamarione. 
f*Rabi*^50Yfc8 capi.ccfaba,co:rupit mcn 
f arQfa ac in ■oims parr icttiartb: particula^ 
iiiacapitDlotscfabiP. 

W fabc in naturaiua frigf de fn (ictit af e tiucr 
fcfunfXoincdunfurjficccCTjjfccfcftiiergib 
Comcduntur cnim viridesriccduj rticffioni8 
fuc c omplao f gaviridce frigicleiiint zfo umtf 
dcin ptimo.gradu*. 

<tf Kutrimentu co:u "imis gcflcrat"burrtoic0 
cradoect^offbsinfi ariuc vcntolfrarem fad 
unt infupa to:ib? vcnrri e<r^pfrrqt5 Komai 
cbovalderJociucAmti 
^£» ia:c#o.finf q* t^to.rrfeCtffrisfdc funt js 
ftcceinlinto^radano inlauda1>ttc fanguinej 
crcanMwdoomagie nutriuw accid&autcr t» 
naruralira tuato te caufte.ana ptoprcr fui 
ftManrie groilidc ct raf dirat e foluf cis ct mj 
bus Xubrilitaf c fc uibftatico:dcwt tiftbUifio 
ik ciuncbtioeit&vndcmtmjenwrik » 

-a fSecuda^tafuitnutritudtnwvcf*fitaff3 
tfirofficietius.vndecameinfiatctDilataf.ct 
operaf in ca idqd fromctuin fa rina . pcopt cr 
boein fupaiorib? ventrie vcntofitarcj.pturi? 
«na^ofiaengcriaariinflatiuarn.ccquafum9 
incipit ii fccndae ccub: o nocee,; Jbmnia mf 
ja eomipratnducit 

afi ^tuigifnaturatfr^cbfibctttfabc;no<tea^ 
liquo cocrioniemodo pofumtaufcrri.ancfc 
£)alie.jFiibc!intnuu coquanturinfianoncy et 
vcrtfoutatcfua f taif o:dto aiifcrriJkquiuim? 

.& minuLTCtaiticnpoffumue. 

" f fctpaimeto aurejbaf indeo,m fabievrat 
t£efiUiducindigcliicuicpatiunf^tfifanaTim9 



fiti6tidcm.Otnnfa autquctfrifnuecantjfii* 

liuttJiiedullctanrumocJo» 



3 

3£> 




CapftuUitn.djr3P3P? 



E3B>a c ^iaca.pvafceatofaha^ 
priaca.5^abIcsypfiacamulnpoHcricc» 
appcflantan £ gypro naf cirur smafi* 
a ainficilia dn itagnis lufc&folia babcs al* 
tvtick'nccrlarifudmebnriaA)^ferctiecit)aii 
que fi mulrii ftcwcrit jjdunf foh'a.P oe dus cft 
tn medto ipliue vbt eii rotunditae cuednm 
Vbt fitiqru: ipfciiofcunfiU>^^cir»aax)icir 
nirx* rarice qua iicrafuloe t iojr. f. quia bcc 
cft iluecofuctudo eicar^ilafadut^crastibi 
irtctudunt ^>ft:m femcruct ftc pontlt vrtiafcaf 
Tftadtjc c^rofito^canncxocta ct cntda ml; 
duca«ir,qm:ctcoUocaitaappc[|af,a quibuf^ 
dm culcafia,quodidcm e.j£t idco ad due in 
uc%atwtif qucrc inlitro:a cukatia fupm'9 
^jCSocmcn ctue comcditur ftccufrviridcr 
colo: nigadt i maio^nofira fiaba.f 0ali 
cnue li.t|.t>e alimcnrtWa.ocfaba «0TPtiaca« 
Honcftlupinuevt putaucruntatiqutifilfiiti 
facitib idcmaliudcapirulumtclupiuis.^ccl 
apud Bciccrinamltb» fcnmdo tc f£bae$v> 
pti'aca.qucctfabafvriaca^icitur. > 
f Ondc Suiccn. vocat ca fabi fvril: quonii 
t>ctpfa tr.iilru nafdrunn fvna.^cd urafa* 
ba S> yria di fat>a grcca S> 3i£ba cgyptiacaj 
i)pud^oteic^craiipric^ftfonduefo| 



Btllnbm 



t dcrane fiimenect qttuor fcdm mbce.tt funt 
obuli qtmoi.zfmu brana.jclvui. 

Bpmtionm 

j& fSuicen.&inatctcagargarifmiieaimla* 
crefaUcentracgrirudwcefpiritualium pfcrt 
reeibueiiicgypto. 

£ f £t folurtonc cducit aqul orrinajrt pioprie 
fcmcn eiue ct fuccue ipfiue. 

£ f £tp:ouocatvrinam:etgcncratfpertna.?eic 
pcUitfolcrametaquofitatemewecumfaaltf 
wtcct potueipfiue fit ab vna tcrrta Utac vfqj 
adsuaetcrtiae. 



f £ti*nvoocampjodcfrc:^arajevarrofa £, 
tcmr ,o 

f ^abarutscniclfihquariic^cimead cojrcn^ * $> 
diceectadncruoaivctercecoloKe.pdeftcuj 
vctuftatefuilliadipie.Efeqjtecoctc ad fcrri 
aecomcce fabarum fiitunr aluum» 





Capitu!um.fl0jEi't. 

"ir*7&ba inucrfa.*jMi.5 : abamucrfae bcr? 
^|W\ba;cuiuefoliafttntficutfoliaalkcken^ 
# — fc 0i.ftipceciuel6girudiniecubirivniue 
autouom autplue.fcmcn ciue viridc. tendee 
adnigredinejmagnitudiniefabec6munie.ba 
bcne qfi ctTigiem in mcdio ficut fafeolue:? ro 
mani vocant eam fabariam. 

? 0pfrationf0 

a f fabaria fiuc faba inucrfa in vino ©croctat 
adteftiu rumo:ce ac genitalium p:oficit; 

P f ibmfto erii cr aceto fceeocto tumo:ce ma 
turatctapcrit0tcUuorib;cl5c6bufttemcdcf. 



Mpimlum.tlffflii 

JPjy^gafmon.pYaf.ca.fagafmo.^agaf 
Tp^mon quammulti apparine ©ijtcrunt g 
^— * plara quavocanrfancfton.fcft rifion 
■icft gladioluefegrtalie.foiiabjvridi firmlia. 
fed mino:a ct angufta ct acuta.bafta? bj afpe 
ranucubifalecu fiorito purpurcie.iRadicce 
funr illi tucparuulectrotunde.vna babee fu 
per terra pofira ficut bulbi mino:ce. 21 Ircra e 
Dcfubruettnuiet fuegroffio:/Rafcif locie 
'cultie:fupcrio: maio: cftcraatonevirrurie 

j^ptraticnfB 

f PvafXaibaplafmafibadbibita puflulae % 

'% t uttio:cece:p,ie t ollir:ir.cdKii minibc mijcra z 

fuppofita maiftruieimpcrar. 

f Jtttm vitto bfoira ventrcftimularXatba* «a 

plafmati impOfita cum vino arq? ibure fagit 

taevelftirpcecducif. 

f © oluit ctia in guinu colleerionc/ft adir. $o <- 

inferio:acceptainfantiii cntcroeclicoe mcdct" 

m ir -■>' 



SCrartatu* 




difera:cuiu6fructu8 c ©ulci8:fed pecro:i nocf 
ms.^lmvcroclariiTimulapadibueadmini? 
ftrat.lignu cius fatis admodu wiru :fcd vermf 
buepmetrabile.mifi fiimo perutf uerit cotfnue 
©dibutu:r iride aiit in aquis pofitu per longa 
teafcrmrinlapidcmMrcf«rc« ^_.j 



fc 



P 



"1PW7 B gti6,jFagu8 c(l atbo: glandifcr a in* 
^^dc noiataclTecredif:q: olim dPbomft 
«—- ticevitxmrfmctibue.pictaefi cnim 
fagitc a fagc grcce qt> cf| lar inc ccmcderc 
^^^^•^^Siepcctiiicfitranfuerfiinpulpa 
fucmmapudantiquoe.^ndavafteionos-- 
'Jjbarc? curiue ittra tiit fe ep fseda nibil ar t igif 

: fe prer gutru faginu^facrificarcf .hrgnu" inlo 
girudine* ita ftuctuatvt cj pare ftnt aradice va 
lidiuo fidat.^ague acccrruscclcriter marcef 
ainr^actlieeitfagitsininatcriaqucepftajBi 

i lio ac rencra.£adeq?ficf ilib? laminiein tcnux 
fleribiU8.capfifcf$acfcrint?8 fotavrili8.fagU8 

, iuplana ©cfccndit ficutcr qucrcue.^agoq? fa 
cihme c)l omnib>ej refinaferut: fed minuncJM» 
rantpwterq-ejtpmo, 

&peraiton» , 

f ^li.li\vf8^ui?sianemurib;grat«Tima e" 
f 3dein li.vnitj.^agi foh'9 ingtngtuaru? la* 
bt©£ victienianducanf.CtadisfiJgince cinie 
calculi8iUtnif.3teeii.mellc alopirqe. 
f 'j^alla.U.f mo tcf ago velfatino. tfutiiTime 
tabuiata3:urabtir.fi!iranefiip.palci6vclfiiic€ 
ciilriebumomfcpadtabulati co:p9accedit 
t3dcft,jit}. iagtie in ficco vflhVdtdbnnwK 




Capitulum.t!»jE« 

"ip*7Sfeo[ii8;Scra.li.aggre.ca.lu(b{afi? 
JUr(.uelubia.auc.pYafc.lucbia.i.fafeolti8; 
<«— * foTia.b;ufiafoU]6pl3tcq & cufuieiniit 
q:funtmoUt6:a.irami ciue funt fi.bfilio:c8 
fifce filadberctce berbie:c|Jxi app:opmanr: z 
cldganf -mulfu fcon«efinrmb:aculu fnbcte. a 
;b?vaginae ftibfilcefifeevaginie fenugrccuni 
fi quia fimt longio:ceet.pingiHo:ce.cf inurif 
ite vidctiiqTivarutiuerfi colo:i6. quiaqurf 
-dam trabunt ad albcet queda ad rubci coe? 
•difbuiue fiiucfus clinue ficutcocdunf fpargi 
Xliraiseofcalidaetbtimidainpmo grada 

©ptrationto 

"f^crapion.^cncrantmultavflifofitatem 

•z^uocantmenrTma^inrlant.-rgcneratbHft? 

res fitgmaticb8groffo€..£ t funtmah' ficma 

cbo.et rubct funt groffio:c8 

C £t quando fmtmnmr ctim fmapicrcomc? 

cu1wr^inapi8|^b^efmalic4acoal,cralbi4 



a; 



fei 



BtlbttW 



de (ntmulta baidftatebnrcs:ettut graueefc»? 
gefticH'.7ciminuiuuatadt>igeftioneco?:7co 
nicdcre cos calidos cu almuri 7 oleo 7 cimino 
ct no comedaf o>:rcr eoiu ejacrio:. f £t bibif 
pofteos vinu parii groflu.et purpuratt cii a-> 
ccto ft^irTicifcigeftioie^fer ficcitate aceti* 
f£tt>e i ppetiiteeo?e < puocarcmcftrua^7ma 
jcime cj fat rubri C|t cio.^E tipi fiit boni pecto 
ri ctpulmoi.7 faciut fomnia malaf Hucrrois 
li.colliget.cap.t)efa|eor.^afcoli©eclinantad 
ca.7 bu.f £t impinguantco:pu8:a,puocant 
vrinam.et fanguine mcnftrou.ct lajcanr vetre 
^opzierubei. 




£apimitmul&jH# 

Tf^ftmme.yfi&zwue vocariferf.fl> 
•ftw^cpmagioinafperislocis montanifoj 
*— ' frttgi8nafcif.Se.li:ag.c.tirdan.i.fra 
pnueita noiaf greceinoaetaarabcs noiant 
ca arbo:ectnicu.7 in perfianoianr ca biwib.z 
cft arbo: bristn ramufcamcrulas in cito c bitf 
mtditas q qfi fceficcaf genaanf ejcea alia aia^ 
lia, unulia amiato.f £t ideauc.&af.gjapo* 
duaeft fti?mcue.#fju8 eius e q infrigidat7 t>e 
ficcar.tf£auui8 ca.t>e frarino.5rar,rou6 frtf 
gvqueeitificcusinfecundogradu. 

t2>pfratiow0 



f Srcra,tUrru8ciuecrtq>glufinatt>u cft re 
cene ct pglurinat vlccra recetia . ct radijc cius 
ad boc valct fifr qn^qcif acj inq t»ccoquif (W/ 
E ofia cuiitG coglutinat io l neccflaria. f £5$ 
co:rejc cius t>u recee cfiff>zie fi ligef fup locum 
pfolidat eu.f pecocno comcisduspfunnc 
rlegma.ctqncoitejcejcficcaf curat egrirudine 
cu q elenaf curts.f j5af.li.t>Ynamidia?.ca.t>c 
paftioitofplcnieXomcefrannicoqueinvino 
ct t>a bibere.7 infallabilifcr iplcne artcnuat. 
'Ra res pjobata e.o/ fi t>ef pccllo bibere alic[* 
b ef int a ficiaf guifiimu iriucnics fplcncm. 
f 'jbautoeXotrafluicuvenrrisetlientcria^ 
t>i(Tinteria.vjfometuejcaquapluuialit>ecoa» 
onis comcu ciue.f £otra vomituejc t>cbiu'ta 
revirtuti8ptetiueco:ticc8ciu8buliitetfpo 
gia iutincta fug ftomacbii ponaf .et ec anerc 
cui87argetoviuofiteptimii vnguerop fcabie 



n 




CapituIum*rijEjfjEin7; 

Ipy Xamula.^la.flamuladjqz^tute b$ 
*»^incenfiua.eteftca^tfic.in.iti.gra.viri^ 
*-- A dt'8 eftmulte efficacic. ejcficcata fo twi 
liU8.f3fido.ilamulaca.eftetltc.tnfi.tj.gra. 

ii>pfrationf0 

f *jSlar e.Sd cauteriu ftiie igne fariedu flamu 
la.ceterif 7 foe tocuponif.acE ©iet>imittif:uc 

m m 



Emmw 



» 



U5 



pofteacij^ccfauftflwgff.fSdapsfarupcn* 
du qn tfum e ad fanic:? caput.e turu.*Reccu 
fquama ferricorerif ? cii olco fuppouif4Dku 
ficlidepoTiifadrcla^tionencliamulaiiiuIfuj 
teftcca.f £6rracjrt:mactia et artcricainfcri 
ue oeaf.0lrit rofaccii ejiea ccfcctu valet coft 
rra $ iiaca:in cfbfevel alio modo fumptiu 
f 3dc 4? valet c]cteri9 inunctu:cotra t oIo:cm 
artetici»ctvIiacafiragiuriactoifiinteria:ctco 
tra vitium lapidie fi chfteremiectikafere 




Capifu!um.ftoi!t* 

"•Ragaria.Pvafco.^gariabcrbaeft 
mult u nora.fruct uscfue boiee folet co 
medcrcfolia babetfimilia foltjs biiot 
mcmtfiqzfuntmolIioiceetlanufiinofirRami 
ciu3fubtilc8fimilc8fili8.fcmcnbabctalbum 
fimflemtlii Jragariafrigideerbumide cft co* 
pUjuonisinprimogradu. 

"Bvttatiom 

f $lar .£?crba ct fruetue frigidefumcopleict 

oras. f Otranimiuflmumenflruonlfuccus 

frqgartecu fucco plaraginiemijctu ccferrOfrc 

fragaria fumpra cubo:agineetbuglofleinci<; 

bisgcneratbonufanguine. 

f £> mnia vWnerecofoltdat 013 (ncco fraga? 

ricIuMta.^ecipefiiccifragaricjaque plata? 



gimect flquefeflbfofc.fltf a.^.u.mdtroffltf fijc 
cimo:o5'ceIfi.ana.j.i.9ccti paru mifccanf fiat 
gargarifmce.f 3uptu V3 c6rra apata gutm 
riecu cogargarf fado . Succue cria frsgarfc 
cu ctmtno fumpt9 valct ad fefo^orisO te cii 
boatgine fumptu valct^p t olo:e eapitftco:de 
^teaqTccocricteciuefragarievalttptoIo 
rcm capir l:ct fcdat fndo:eet caIo:c.f Smct ue 
rius fcdat fitim.2« d ccfoltdadu fractura crn? 
rievelaltertoemeb:i.T*c.fuccu6fragariefuc 
cusplatagfni8.ana.5.ftj .folia fra j;ini.34.ioeco^ 
qnturftiadmodu cmplafiri ctfupcrpofitum 
fouttu valet.f Stoccue fragariecu fucco ce? 
folide mino:SmijtM8 ccfblidat vwtacra. 




CaptfuIum.fl0rir» 7 

'ir%7£nicuIo8.*f>la.icnicuIu8cftfn.q.gc T ti 
•Jpwt ca .^fic^tutebjtfurefica ejcfubtihfiib 
*— * ftaria? cjhtflrito fuie.Srcmecius i foli 
a ct co:ticc8flt cp radices ccpetut vfut mcdictf 
ne.^npncipio verl colhgunfcacpmedffi an* 
numferu0nf.f<oera.Ii.ag.ca.ba3fcm8a»c& 
^5atl'5a5ieni8.id eft fcniculu6:cft cjreo tcmc 
fiiat8€t4gt : cjtt8,pomcfticu8omnfbu8enoj 
fue:cmuevirroeeftp:imaquccaUfacirimfi& 
g.tt)efic<at in Fmo:fc«Sa fubrilianterriagtne 
rat la c £ r agr<ft$& mflritinuevel montflnua - 
r9dijcciu8etfcmefuntfo:tio:ltcficccaf6i8034 
r^etfone?omdlicf;qmttomtlli©epa? * 



fertlrrbbi 



mra.iScmcnfcnlcalucakfacitdidcfoititervt 
e& tcrtio iam pofltt gradu enftere:ficeat autjti 
fimilircnfed ?m pmuVz,iprerea!lacti8gcneratt 
uticft/znogencraretfi ficcaret foJtifcr.fuftii> 
fie aut autiliaf ftneandcronc . £ft#o z ali9 
fcniculus filucftrie:que vocat.jpter magnitu 
dinccqnu feniculu.cuius radijc et femcficeio* 
risett«ttsfllioqapudno8cu\j£tmibivide£ 
ejnndcq> ea q^mvennefi'ftat?c£tidcfejctc* 
fim.far.ca.Ypomararrit vocat feniculu iftu fitf 
iidlremvpoinaratru.velfenicuIuerraticij.vel 
cab allinu.fiue cquinum.pvaf.p' m tranftatioJ 
ncnoftram. f eniculus calefacit rhamfcftcfc 
©eficcatmediocriteh 

Bpmnonts 

flaui.li.t».c.i>e feniculo. 5enicul9o:tu[anH0 
ca.c.in.q.ap.itopilatoee.acuitvifii.z.jp^git^ 
ma ei9z pfert in initio aq:ct apud ei9 ocfceTu; 
%£t t>emocrir9 cjde ewmmawt cpvenenofi ^ 
mespafcutfeniculirecenrtsfemevteo^vtfua 
Cdfo:ref.fl£tvieeetferpac8fiicantoculo3 
fuoscuegrcdiunf ©ecauernisfuis poft bte* 
me fufi ipm.-vr illuminenf oculi.qd bumidu eft 
lacetuberarefacit^jieoztulanij.etqnbibif 
cuaquarrigida:c6fcrtnaufee:etinflat6nifto 
macbi.f£criu8t>igcfttoefttarda:?et9nutri 
metitemalu:puocatvrinaetmenftrua.£tfi[l? 
uefterjpzic frangitlapidc.interreno d,de i fln 
uiali eit iuuamentu ad rencs z vefica.j£t,jp:te 
confert filuefter t>iftillationi vrine. 
f £t qn comcdif radit cu femine fuo.ftringif z 
c6fertfcb:ibannq8^t>afinpomcuaqrrigi^ 
da.fl£tc6fertnaufeeetfeb:ito.tMamati6i 
ftomac|?i.ejcei8f6ferteiu8 cecoctio cuvino 
mo:fui vcrmiu venenofomet cn aq.-z tertf ci9 
radic-rponiffugmozfucanisrabioftzcofert 
f Saf.feniculus generat lac in mammtllie. 
2> uftufiones curat.eteftoiuretic9'Z,meftruo 
rii educfiu9.j£tfeniculu8 filueftris ftftit ea quc 
fin ventreetem adeft fhptiatasmaria ei.bu* 
iufmodiigif nofolu radiiufedmulro mag$fe* 
mcn.£t potetia lapides fragcre:et vctericos 
fanare.menftrua.puocarcet vrinas mouere 
f Slius^occtnttsfenieulueeft cuius femcn 
rotudil efemini coaadri.fimile#o in ^ture fe? 
mini alrerius ec\ni fcnicultfcebtliustamen. 
f Dvafcoades.^eniculus lacmammillis ge 
nerar.comeftU8 vrina m er menflrua educit.et 
carbaplafmatibusadbtbitus cum prifana co 
meftuBidfaar. 

fl£licaturaeiu8bibitanefrerict'6etvc(icet>o 
lori mcdetur.arinam pwuocat.^otfibus 
veneuanscum vtno occurrit. 




CapifuIum.t)Ef 

lj^£b:ifuga.Dvafco:icie8. iebaYuga B 
*fr*\,uc cetaurea mino: eft bcrba fimilis ca? 
*— • momille.virgambabeneperlongaari 
SuloJam.fio^mpnrpurajm.5 : olia minuta ee 
oblongaficutruta.femcnficuttriricuimctfic 
oblongum.radiceftrioblongaetinuttlie.tfti 
ftu atnara/Rafdtur loas aquofis/Rominaf 
criam ab alns elkboatisfiue 'amararrum vel 
febnifufiia. 

i>pfrflriont0 

f D vafcoadcsX cntaurea mino: fiue febaTu 

ga tunfa ct impofita viridts vulnera purgat 

paracolefimp:eftat. 

f£icatrice8vulnenbu8reccntibu8etvctcn> 

bu8inducif.£licaturacW8btbitacoleramt 

bumo:es pingues ©eponit. 

f ©ciaticis ano fuppolita fanguine.puocat 

x t>olo:c«tti9m'rigat.<£> uecue c\u2 mellead* 

dito caligincmociilis tetergit^bojfum facit. 

•Herui8©otaifo fomcnto pliat aujtflium. 

Cflpitultmujeti 

m iiri 



16 



Kxmmm 







l^£nugrcra.Hui.h\q.ca.x>cfenugrcco; 
7(^5 r cnuflrccuca.ctnfincf)mi.ftc.if5nio.T 
*—* noeuacuafepbuiditafe eprranea.dua 
StuseTHgeftina ct lcnittua.-z iltf,ff>fcrea cr in 
ipo aggregaf sc cauditatccu vifcofitat e/za? 
vifcofitas pbibet tnium nocumcti caliditatf 
ct cius caliditae opaf eti facilif ate:z et'9 buo: e 
ma!ue.licet no iit paucue.£>ubftaria bj gliiti 
nofa?.itutebjmaturadi , :Tclaicidi.Diaf;ci7U 
ceron.#ucerd eifartatbouis comu.cglocero 
^ocap:icowu.'B5f«mta fenugreri co:mcur 
fifibj «nnibo funt ftue eiue e matactica D ar, 
vw.lim.far.ca.tYli6.z:Tli8.i.f^Sr ec " ca - eiT ? 
n.uc.in pmo.Sfe.li.aggre.c.balba.©alba;i. 
fcnusrecu.ttU6ertca.in.u.gradu.fic.inp:imo 

^perariow? 

f Eui.£iu8 eleu qd fit rii mirto pfert eaptlf *, 
vdtigqevlcerij.tpfcrtffcfngtdi^fmu^ 
falaginofiiate fua ppe cfi oleo rofa? % ttfgre* 
dif inmedirinispsnuetfactt coto:ebonutn 
f £t alterat odo:co:^remouerodo:e co^is 
% fudo:?,£trrioluir apatafiegmarica ?sura„ 
C. £tciU6farina valetadapata ca.apparctia 
socculra cu nc funt infiamata.fed fctedman 
tiaadtniriciecinda.-zlenitadublefzmaturai: 
ea.f £tpfertcu olco rofa^aduliionngnis. 
milda t furfurcsabtutcc capitlfacta ep eo.2 fa^ 
cufoda^necucomcdffcumttri.cfwsuicum 



almurimim^ noduS rToiracfeo.fXlariuYflf 

vocc z pulmoneV: lentt pcctue % guttur i fcda t 

tulfim i ttifniajprie qfi coqf cu mclle aut tac 

fifgutficub^rmchitecvtpiugafetiariifcac* 

rifcarnofte/ifumaf fuccus ambo?? mifceaf 

cu melle plurio:': fup p:una8 tgate calefiar ,z 

fumatur aii cibu t£c lcgo cumrro faetu cmpla 

urueteo pfmfpleni.€£tdueT>ccoctio cum 

aceto pferrt>ebilitari ftomacbi.,|p:ie cr ec ipo 

receee.Etciueclcctuariufacitnaufeljfjace^ 

tu ? muri etpdlutnocumetu ccmdtioie eiue. 

^iteucatifmacpDccoctdcipiueadapatama 

rrict. •: "ooUncriue z eoartarione iptf.f £t d9 

©ceoetio cuaceto pucnit vlceriko intcftina?.et 

fifrrcceecuaccro qnccedif.£tt>ccoctio ciue 

cu aq ca.gbona tenafmoi? foluridi.f £t ci9 

oleu ebonu aparito ani i ad tcnafmone, i t>o 

loie vcntr^ pungittuu^ric di almuri an cibu. 

£t no mouct ad ctpeltedufccg uifi' ( |pt ? fua acri 

monia.-jjprie cu mclle nd pfimo vt nd mo:di? 

cct fo:riter.f £t cius dccocrio cu^mdlc facit 

tJefcenderc trtndiratcegrofias ab intdlinie.ct 

yuocatvrinletmeftrua.vt fupponaf cu adw 

pe anatf.f £t pfert wiricirimatric^facit gc 

nerarionematricisfacite^uius gcnerariocft 

»ifTidf4pft>eficcarion&£tebonubrifibu8c 

motfoidae.-r faritfterc9boniodo:?;zfacit fe* 

ferevrina^fudozc.tnoneficutlupiniintJifi^ 

atltatcfuiecitus.ffiaf.jfcnugrccufcrueter 

inftamatices cjcacerbinminue ^ocaUdos eC 

qcunqjfclirofi funt tiafo:andd curat . 




BtiSttbti 



•^p^£nu3fi.W.P?ii.Oiottn bcrba ntolUf 
n[^;MfanYca fcnfifcicipdf.tmatfeqfcrifo 
* — *■ a hqn apta c numcdWRafcmrafo cft 
ijpi iumcfo2.3dcr'r:faiucticrii cy, 15 cyeo fla 
ma nufrif.flb8ci9ft3mae.0c fenoarfr glo. 
fup. 3 fauivl.ixnti nafccdo bjritwc? crekcn 
d o t>cco:c.t>cin dc fl o:c: tadc calo:c fo t' ftcea* 
riircdigif in pnlucrc.fiajr i boo, etarii fucccffi 
one t>ceo:e amif tit ac cadif inpuluerc % i mo:? 
rc.jfcml traq? cf?diu viret i frodct mores i p:a 
tavcfrit ?o:nar.?faflo:ti putcrfiratc cjj etiaj 
viro?venijftateadfuiafpcctuintue,iuoculo6 
allicir.reficir et t>clccrar,jpf cr fue fubfHrie aut 
virfdiratc:fcriicte fole ri^buiditas t>e facili eo 
mmtf.tberbaq pmo flo:edo qfi ridercvide? 
baf.radc a fua gtia fpoiiata penitus immit. 
'RI fenu qo" o:if et virefcit:crasmo:if et in clt 
banii mir tif . q: cjli fubito ©cficit et arefcit.fi> 
attt>cimpioBliTitudine55:inp8.5iatfiajtfe^ 
tiuteaorii cypuG.icvbi tftglo.cjnro fenualti 
usftat? mtn9pfundeinferiue ©cpmtnradice 
tanto minuscrefarummo ciri2©eficit ?arefaf 

Operationcs 
f ^ena crefcctia tn loc$ aiiqntulii motuofis 
mcdiocritfficeimag^ fuiodoafera.aia alid,to 
magis fapida q? alta q crcfcatin prisplauflri 
busfaqfie.^fatoi ^Mi.q:iniIli8bumo: nu 
trim&alismagS et>igeft9:inilU8vcro minus. 
f 3te fcnu adt>iucrfo8 vfus ncaflariosrci 
feruaf.quccaufab:euit9ti8rclinquo 




«Eapttulurn.tfriif. 

ip*? £ni!a.3fi.5cru!at>icta eft amcdulla 
1 W.'R5 \ luvarro mdit fcrule elTe mcdulla 
*— qiugrcciappodtlo vocirjjonulliaf a 
fcricdo ferul.i vocar.bac ctu pucrivapuiarc fo 
lct.bui?fucc9saIbanii.-i>1i.lt.tin.5cruUna^ 
fcif in loc^ calidis atcpfr afmaria geniajlar?nc» 
datafcopis.Dvaf.c.tKfaiila.jerulaqiiamt' 
ti cnt'io:evoc3t.Sacdu <y mth fffpcs ferule 
i iira^ ■oiucrfarit fpqz fiit tiucrft gtimc. f.fcra 
pinu:armoniaai.galbaniJ.opopan3cu.afafe 
rtda.tpteriltae fpcs c vfuaf fcrula nulla bna 
guininccifitcurandiicui^femce carcoo fiuc 
canereos.vndctiiaf femla a mcdutlis.itdnuF 
li vocantci fica faicdo.q: bacpucri ct puctle 
vapularcfoter.vndefuntaliquefpes ferule q 
no fttanf in foltis.ct tn tiicunt fcruleqm faciiic 
flipiieaptumadferieudu. 

i>prrarionf0 

^Dvnf.ca.rafertUa.afuarfcrula vtridis q»& 
ihulucntcriojcvocafemoproic^ciliacisma: 
rimil cffccrii.pIiat.mo:ftte rencnatis potata 
cu vio dccurrir. *hXufat tpofira fiujulfangtii 
nisvtilnqifMnsif.Srcmcei9btbiriifojrion! 
bu8 medicaf .f £r> aneri9 cu otco tririi ct per 
unctu t>o!o:e?moutf .#ge efi comcfte fudo:e 
capit^moua jCopofif ein fale comcdi poffunt 
fdatVEmoptoidsctciuadscdperir. 




CapifulunMjEciiii 

ip*7 3aie.3u'dorii8;5i'ajs frcundifatcvo 
^Wcanirfcrrilio: c cmcacrlatbonb/fla 
*— • rtfquatcrcppcrfingulosannoefractii 
genaar.? aircro marurcfcente:alter abo:irur. 
tHnc ct carice n copia nominarefum. I>lmi9 
lijj-v.trcgcnaepomoui ficueamplifTima eft 
qucdamq? cf pii ie magnitudine cmula.5icu8 
3udeaniberoliuemagnitudine:ronldio:ta* 
mcn.fa po:emefpili.S lcra ndrina bancibivo 
camgrofi%»dinceubitalirumofam:mafcric 
ralida.lcntamfinelactc.com'ccyiridi.folioti 
licfcd moui Dncfiaitftraditinbvrcania mul 
tum noftrie circtulcio:csfanlto:tfc?.Srant 
cr lidic que funt purpuree.£tmammillanc: q 
fimilitudincmmair.marubabcntOtcmjCal^ 
Mirufie fapo:ep:eftantio:c8.fico:um omniuj 
frigidifiime. 0ucda in egvpro cute caricc t>c* 
trabimr.£?ec vr puramcrircntiboficis.cj ma? 
lamcplacctin eifdem ficae, 3refio.inlib.t>e 
vegaabilibtte.jjn quibufda rnictitocbumo: 
vt lacficut in ficubue qbue e x>nk\ fructus ar 
cpmcllarisficur erpalmi8.3ckm in li.fceaia* 
lib?.Xaccjccoaguloctlacteficuucoagulatur 
qm lacficuu in lana aggregatur . teinde la na 
flia eumodieolactie abluif:ac pofimodu ifto" 
itkm in rcfiduo etjaf.a cuadmifcctur laai co* 
g-gulaf .5icuto ac cacristmlato apes cibanf 
*^alladiu8li.iirj.5ieu8 qucinmontanie-z fri 
gidis locie nafcunf:q: minus lactis babct ad 
uccitatc turare non pofiiinr.Ufus illiin virtf 
dicii mcliorio magnitudinie ct faporie acuti 
0uenafcunturineampi8ttlori8calidi8rjin 
£Uio:ee Junt;ct in fiecitate turabilee ftlr Jto 7 / 
Jtanrinuein panrcgni. ficus in p:imo gradu 
funualidcTiridcsinfccundo bumidc.Siccc 
vcro intcr ficatatf? bumiditatcm tcmpcratc. 
3 faac in •cicris particulartto ca .t>e ficuto.fi» 
cus ccteris fructibiislaudabilio:? nutribilto: 
bumtditatis tnfue caufa groiiosercatbumo 
rce/Har ura ciueca.-z fic.cjlirasaut caliditate 
«t ficcitatctjinerfe funr^t fm fuiipfiue tmerfi 
tatc8.£ftcmfira8ccmelh'ca«fiwariea.£>o 
melhcacria in viridc tiiiidif ? ficcaj . tliridis 
^j tuplet cfimodue.qm qdam cp/ccrc maru'/ 
ra;? no ercaematura.l^c» rjfectematura mtf 
iiusca.': magisgroiTa^ptercominationefcr 
reftrie p.t i6;2babct rfi buidirat celatcr.tcequc 
aeuitargcipuflaun^ficcitateinfecudo.TJnd 
3pocra8.5ieu8qntolonfiinquio:eftamat« 
ruar csranro minue caltdio: i magie grofia. 

©paatiome 



ff5cra.lib:oaggrc.ca.fU!.9ucfo.MJCui 

id clt ficue.©tint cm cis filucftrce tomcfiice 

ct monranc.£ t et t omcfiicis quedajfunr rc$ 

ccmc8.qudsmnon.fcdfumficce.£treccnri* 

um virrasctl tibilfe^tri' tboc cy adnrifccatur 

ri8t>ebumiditatc.ct liccc funtmelio:c8: i ma 

MmecamofcEtiUcinquitocftacuitaetpuit 

ctio abftergummagiectrcfoluunta babcw 

infebumiditatcm fubtikm. 

f £t atiacftqTefoliritapoftcmataqn mtfcef 

cii fatina o:eki:aut cii mcdulla panie frumenri 

£t aquaiqua coquunf ficus fcecoetioncmul'/ 

tauftfimilismclhinvirtutcfuactreccntceci 

dcm i ficcc l#ant ventre.f £t virrue liilucftri 

tim cft att ractiua arefolutiua.£tita cftin to 

mcfticieantcctjmararanf.qmeftincisalicjd 

laai8ctatbo:e.f£tflibo:c6ftuufccmcfii* 

carumvirtu8cftcalidactfubrili8.ctlacriu8 

ct,fuccu8 foliom ipfius calcfariunt ealcfacrio* 

nefo:tto mo^icantn vlccrant coipue.i ap* 

riunrorifieiavcnarujqiuntinano.acuclliie 

vcrrucaeetlarantvcnrremi 

fi©edinaibo:eficuufilucftriu5eftt>ccaIidf 

tatc « fubtilif ate rantfi q> fieoquanf cu carnc 

bouina tura fariutiUat>ccoqui.eteft fo:tib: i 

omnito pdictie 03 tomeftica; 

f ©ed mct anaru ficuii arboris fapo: eft aoi 

tu8p:oungen8ctabftcrgen6.£rqrifttcmpIa 

flrum eu ramis eius fug verrueaeq t icunrar 

capita clauo:u apait cae,ct ita cft te lactcri? 

fcjqnfitvngucntucrco. 

f j£ t qn fit medieamcnrii ct eo 1 melte: abftcr 

git maculamoculigroflaj:a eft pucnicne ob 

fcurirati vifue •; ttc^cnfui aquc ad oculu q frt 

ab bumo:ito groflie multum 

f j£ t cincrce quidcj ficuum z glandiu a la cti 

cinio^funt mclio:e8 cincrce ad abftcrgcndii 

3ui.li:q.t>cficubU8.^clio:cftalba:t)rinde 

Tubca*.ticindcnigra.fctqucvcbcmcntcrcm3 

tura cft mclioKptorima ad bocvtnon noec^ 

at .j£ t iicca quidcminfui8 opcrationibuscfl 

laudabilie. 

f tkrutamenfanguisctcagcnaatusnocft 

t onue.^ta bocfacit pcdiculos. 

f uaumfifumaturcumnuceciueebtmue 

fitbonu6:ctcum amigdaIa.-:liuo: omnibus 

cftalbarillaquccftbumidflcftcalidaparuin 

pcr.aquccbumida:&plurimeaqurirat]apa 

rumcmcdicinalie-Oucveroimmaturacab? 

flerfiuaadfrigiditatcmparumttcclinanemilt 

lacau8.£tqucficcalida cftin p:imogradu: 

1 tn fine ipfiue eft fnbtilie.a quc ficca cft ct^ 

pric acriefoms eft abftcrfiortje maturariua % 

Tcfolutma. ^ f£t car* 



s 



©fSjfrbtg 



fiofa Iplmimcmamn tidiext in ipa fimt glti 
rinario crinafto a fubtiliario f £r fitucfiriee' 
acurion fo:tio: inl?.?fruct9qdeei9fflirflbili 
o: c rcliqe frucribon cj vcbana^ cma turatcif 
^jpinqgadrjvtnonoccat.firtinjpacinfla^ 
rio:etc,cpclUtfueftuiraree3dcurim:iffldtfuf 
darc.t?mtfch>imoficcaftli-crtJcllitadeiLferio 
rizfadt fudarc-zillaqdeqcbuida vclocie c 
fjturimcti t pencrraroce in ftomacbo? t co:ge 
^iimmctu $o ficue liccr no cnflit in robo* 
rtnufrimeticarnio z #ano$: tn vebementw 
tftroboas ^numnicntumoimfrucruu, 







£apt'rulum.ffru 

jny3cu6lupivl'comar5'.p , Y3f.caXj!ma 
*»*\ru84.fiicu8lupi.£tcftarbo:firiecido^ 
*~* nic fjfolia minuta b$n fructfcocci mcl 
Icfilce.cftcrnorTite.qua muiti mcmeqtiilon 
ticat cui fi matur itae fuerir rcfu facit colo:e$ 
fcdcucdifrcmancrino^fubftautiacidafilia 
ci q rcmanct cj: fieuto vocsrur arabicc cstila* 
bincb.i.intcrfccfo:patriefui.tficoelupi.'*cft 
•rbuftumquodvocafr.fojdcomatcsimcm 
fructue due e in fupfiac afpern babct fap o:e 
mittu ejcsulccdine? acctofirarcaliq J5cra.li. 
ajj^a J?aruacbictb4.ficu» lupi.&i bojic bui9 
folia funt fitia folne cir or. fo? Jj funt nuno:a t 



intctat.tqRin«fttrflf»alfiiatfotojdueacTm 
bcdinectqn comcdtf rcmanerfoo:efubftajia 
filteciqrcmancteptKcub. 

€>prraricm0 

f6al'.vti.1Tm.faMa.tccomaro4.ficueIup(, 
3rbo:ctfructueeiue funtftftwici 

fPYafco.dtmalueftomacb^opOataYoet 
fndtirttftupo:e.j 




Capitu!um.t)Efu) 

jn73ciiecgrpriaca.@roIi.5ic9pctpiia C 
^•>egipria fouiemo:a ecjjflnda. pcmd no 
"— ramietmr5^caudiccgcftae;tfq5£jdcd 
fucfcaldirar$ angufta evtvno ano fcpticefru 
ctificcf.tlfi co vnu pomu Dcccrpfcr?: alrcrurti 
finc mo:a pwrubcrar .^lfoi.luiq.3n cgipro 
mulrafuurgencraarboipcjno alibi.anre ofo 
najecgiptia cbidnoiata.arbe: mo:ofimiT 
folio:ma^ntdincafpcrtU.'f>otniifirtn6raj 
mipfcdc2Udicc.3dcEipmficu6e pduUS ffcc 
cnic inrcrio:ife>:p. qua fecildo $ uctufcalpcdo 
tm fcrrcie Trguib: flliurnc maturtfcir.fedal 
f actum Squarto * ic t>c mctif .alio ft b nafccYe 
fcprcno ita nunxrofo partufcr UrcrAso cftaj 
t ce mitrto Ucre abundante.»ii bnafcifet im 
finorifcuipaturfcfue.quattrcftarcp:ic:(m? 
^cjcpclUf itrmaroramOdcmubJo vtfupwi 



Ctartatus 



#btd^dacgfptiaMt5i^ectT<«tmatfirfe 
H5 erBn egspto^nafcif ;fj inf^ria^onwcg cir 
ca giiidii:arq5in*Kbodo Jup.coinanrtbn8 fotf 
Iqs floie candido cu vebemenria ardozis 

Bpttmotm 

nccarioito vdecutfurtfetpetu aptuTim9,pbar 
f^rcrerca unpcrigfneshpjasmacfae z p©,$ 
dagraa admirtus catbaplafmarito curat.fo* 
Ua eiusreceaa fupcr moifu3cani8.rabiofipo? 
fitaconfcrunt 

£. f aalcnt ettaTcabietaimporiunf fug vlccta 
groflatwnu'ch'tatu:rtfup,V4TnKa^mo:feam 

P f ^udfdefricafaffittaspalpebw^etfcabies 

£ ca^.f^uecusfouo^^riuecjulecranvebcmc' 
rie cit calefacrionie ct abfierftonie. 

$ f&pmtcttinciavenarajani.^nporufcatur 
fuccS eiue ad coagulationelaaiGin veurre. 

f paf oleo mijcro ei qbjfohito^ fciflintcria 



& 




Capitiilum # tmjt>; 

lP"73h'pedula fiuevifcago tdcubifciett^ 
TW,du q? boc nomevifcago aliqn ponif p 
f L —*' qdamberba que cftvifcago arboris 
X>c q fit vifcus ficut apparetiri ca. vtfcueinfe 
riuscev.auqnponifii filipendula^tc ber'/ 
bA qticfa. vuranwririisparob; rep«ritur.ai(i 



Spulta.t Cnmontuofis todettflUcMJfldijc 
cwsppctftmedirine.gt infinc autuni c oltfgi 
rur.zefcece annoe fcruaf jet eft bcrba bfie fo* 
lia pcrrofiltno fimilia :fcd cleuara 2 no in ter* 
raejcpafa.in cuute radice funt qfi nodia adbtf 
ren rcs.^rute b? t>furctica qc fubrili fubftflntta 
rtepqualitflritxjfuisca^ftctficanui^raciu. 

0QCtatfoiU0 

f £d"tra Uptde flraguiria ct tttTurriact fltad 
pamonepcipucvaletekcruflriufacrileptiua^ 
topulucrlfihpcndntccttritofflrifrage. 5 
f £otra rhacam paffionefiat criftere etputf 
ucrc ciue aqua falfa t oleo ct mclle 
f Detureriflmbencdtcfafltuatacjcpuhjerc 
cius cum vino puluerie cius. 
fj£§trat^lo:efiomacbiei:frigfdflc9ufavci 
vctoftrarefcef puluieciuecn ptrtucre fcnicult 
■% jCotra ftraguiria et titTuria^ rhaca pafiio* 
flecicnutritiuo? Vttto:ponaf puluieciue inmV 
ra.qntitateinfacoilo ?fiat©ecocrte eiSinvi* 
no eroleoet fupcr lociimfolcnrcm ponatun 
f £crra ftigidn flfma t>cf pulute cwe cu pul* 
uere gentianein cib ie t porib. 
f £otrfl cptlcnria valct pulute aue m cibie 




€imiru!um/rrtp$; 



Btijttbto. 



a 



^?*7 jfliue atite paf re5,vel gariofilon.^ii. 
Ip^» ca.garifilon ixrba cftfacicns flo:cm 
rr-± ficutbutalmo6:cuiu8 fttyitce faciunt 
ramulo8plurimo8.fcdram$poftnatU8e]ice* 
dit longitudine mc natu.aob boc filiv ante 
pfcm vocaf ,? vocaf filr oculuetbrifii. 
f Bui.inij4i.titcit # cft planta que nafatur 
in vcrcetfloe riue eft limiliscroco owulano 

f&pfrarionfe 

f Suicpecoaio auccu efiundif ct afpagif 

fupamo:fumvipere:fcdatfcoto:eciu8 

f^li.Succu8riU8VdpuliU6iuratfirtulaj 



pefctr.ftafoBcMoluit.ipa baba bibits v$ 
frecbhincnnicP.ujisimciafipuflulaocafbii^ 
plafmatib? adbibita purgat.f0af.vi.fi. far. 
ca.t>ama(Tionufeualtifmadc.i.fiftuIapaiiojt; 
bac baba narrat p ^ fccr ciw radtjc ft bibif 
fanaretimntcriae.faetrccpftringerc-ztuo^ 
res (cdare poreft.ffioe tn fc oc n 6 ejtpcrf i i'um9 
pald aut cr b^quanda abfterfiuavirturan 
f B%li.u.ca.oefi'ftula paftoae.llirrus eab 
fieriiua :rcfoluitapoftcmata fluj,a ct grauia i 
Ivifeenbue. 

f£onfertlapidircnuj*zfrangtttfmioccocfio 
eius ctradiK ipfiuepfert v lceribue. 




Capitulum^njE 

lTV-JftulflpaHoric.PvarVo.ca almea.f. 
TM»fiftula palld»e.*>abet folia fimtlia ar 
^* nogloffe:fcdanguftactfupcrterrafpa 
fabaftamtenucm foUvtuuocubiruet fupcr 
ipmcapttclluflotcmviridcm^pfcrcna.radiccs 
tenuca babet (icut clleboajs od ozatae i vifr 
cidae*pinguce.nafarurin!oci8aquoue. 

fbpmtitmtz 

^pvaf.^adtclau8CUvinobtbita.j.t'.tmel 
li8.5.tj .bibetib? lepo^marinu •? mieoniirc opi 
ummedicaf,fo:fionibU6fubucnif.tifiinterie 
marime,pdeft fola cutanco bibua cquo po> 
derc fingulare p;efidiu eft.f Poloie latef! co 



£apifulum*fr 



T«73Iilcltuefiler.3Itdoi?.5rti|Ccftbabaft 
Tp«\ftngularifare foltj appcllata eft .ej: vna 
-*—* t»entqjvtrgulacubifau' atatudiucfcif 
fa gignunf folia. f Sera.li.agg.ca.farcE ftue 
faraci.nlet.aucpYaf.j£ftberbaqucnafrirur 
inmontibuectlocfepctrofi8.ctnonbabctfit 
pitcmneqjflofcmneqj frueru.et babetfoliai 
quc qcpandunf licut alc? odo:eno bonuVRai 
di% ciue e nigra Tcforis longa a q multeoriu? 
turradicule:ctinfapo:e ciuse Iiipticifa8:et 
maiue iuuamcntii qtf eftfn radtee ciu8.fapo: 
ciu8eamaru8parumbaben8itiprictrati8.ct 
iftccft facj;mafculu8,Uirtuee!U8equc qXitf 



TtMMM 



3 






m (mfiondoiH fiucmot-i-ationcs lauat 
ttcorifo:fatvirrurcm. 

f p vaf.f ilejc inmficit vermee eucurbirinoe 
i coranf eeco aurri qtfua: cu mcUicrato: ct 
interficittetu«cicpelutmo:tuo. f £t cft atia 
fperiee faraej: q bj fotia ftfia fupwdict cnifi qa 
bjpluree ramoen fotta cfcfut aUiow i rcmo* 
tio:a a ftiptte.-z bj radicce togaetf colo: caru 
eft rubcttu pauca rjifiredine.jett Sjdl ejc eie ba 
bct cototfrubcu Ucut c-oto: fanguie. i ifta cft 
filcjcfemia.f £rrady: ei9qn mifccf cu mellc ■: 
ftt loboc:er.peUit Ulbricoe togoe.f £t qn t>af 
muu'erfl» ( pbibetimp0nationcrt pgnari facrt 
abo:fum.? qtiseficcaf ? tcnf i crib:af ? poni 
tar t>e puluere et^infiftulisbumidieiq? fana 
rio eftfcifficttiecuratcae.f j£rtblia ri^tene* 
ra recenria eUpata z comefta lajcat vctrcra. 
f Sar.vitjXtmifar.ca.tcfiUccqtJ iopft pterie 
'prterieid drntejc.foradiccqdeb?virtwcm. 
Onterficit cm lumtttieoe amploe fiqrruor 
tragma^ podue t»e ea in mcUicrato $e afiu* 
mar.fm eundcm a8tmoducmb:ionce viuoa 
co:rupjf :moJjtuoe^o «ctrabitrt nuUumirum 
dtiffiamaraftipridtatepamcipane fouiter 
ficcatiua mdtn dtino:dar.f S«m_#o buic 
fbiUpteriefileicfcminanoiatababct virtute, 
cfi ©icit in eode capfrulo.^iUcee ftipticeejciftc 
tceqttaWatcn6imcrito.flPfariae?t>ifiin# 
tcriaeiwianthttbitc. 



._^___: 






__ _ .. 






§E§ 


MlN 


IM^ 


g£ 




Igl 




^v 


•— - 













Captntlnm.ttt. 

^JL^O Uum^crapienlig. _fjgrega.c_i> 
«— v i^ dis, atjao.Piaite3idiC4ddi 



folfu.t cft bctba quenafdf trt f ndia mtectyi 
midie i psludofie carce radice.ccUigurtf.b_c 
folia in aqua fu8natanria,£ftawoprimum. 
qdcft[cuc?albiduvelnigrofu5nardi rcferfc 
odoteTinevIlafalfrdineac t>iu mulruqj refetf 
uane."3bacberba cu indi eolligur inferuntfilo 
Unco [i ficcat d tarc.3 Uq ctia illoe ramoe cOt 
Uguttficferult.£tqntcrracuoibuebfrbis 
cftatevicatorie ardcinnififoco berbe aride 
fuerint |_ufte:alioannonull3 gcnsrat bcrba< 
jEltautfoUuimcgriodouecufuauitatefaptf 
cum'it>iucu^iutumoodoic.virtutcmbabet 
fpicenarduquialimitoeTdtfciu&ricurru 

©ptratioroe, 

f pvafconVke.2_inK«iteoaib?dijaimfii & 
vino fomero adbibcf.f •fiulucre" riue iaqua j& 
fricatum ocuUe fugunge fobum mafticatum 
t>uitiueodo^retmct:quodivcfum_riepo^ 
fimm cum fncrir nncolae non pcrmirrit :ct ret 
ftibijeodotegratumrcc}dit.f_BuUlputa? £ 
uerontfoUudTcnardintdiafouu:fjfaUunfur |> 
fj£tidemanc«>rj_JaUcni.aatuadtafi[mif '. 
virruti fpicc.aerumcftfo:rio:ieoperationi9 
f ^auUjecapmloccfoUo^alicUimdtin fe 
cundo t Ucaun^fcrria 







Mtobta 



ipyamus tcrrc.iS U .ca.t>e foino rcrre.Jti 
Tp*H.mue terre q: nafcif ? rcmirrif a rerra in 
* L — * tnagna qnrirare vr fum9: nafcif a qdi 
grofla fumofir arc a terra rdbluta: % circa fug 
ficicm tcrre adberercj 2 fifc ejc actioe caU'cJtta> 
riegenaaf.pcbctcmvtridisponiinmcdici? 
rn'e,j£r dt cr eo altfcuiSfloe cft fubalbidue ctf 
ncriciiw.t aliue cufuefloe eft pallcne violace 
ue.T ifta cft melto:. f 'oera.Iib.ag.ca. ftcviQ. 
auc.pYaf.©terig.i.fum5terreberbaeftfimi 
lie paftinaee agrdfcmfi q: magis cft minura 
ea z amario::? babct radice cui9 eolor vcrgic 
»albcdine.fj£rauc.£>af.Saporri9eama* 
rj^ftipricu8.virt9eiueeftca.2fic.in i t}.fira< 
f PYafco.ca.Decapnoeftn traflarionegrtf 
ca:q larie fumarie &.nafeif i fagctc o:deacea 
filie coriandro vel co:io berbe: f5 moUis alba 
% «nerofa r? multii fiotfbabcsz purpureu. 

\, a&prrationre. 

ff P¥afco:ide6i£aligineeoctb? ©etcrgtr. la 
cp:Ymaep:ouocar.vnznomgaccepit.bcrba 
»pa comefta vd bibita plurtma coleram g vri 
anm^puocat.f-fSlatearius.fum^terreqnto 
viridio:riro meluweffcejtficcara nul!i9effiea;> 
ciecft.f£rpncipalirerpurgatmdancoIiam. 
fecudario flcgmafalfnnnrolera.f £orra fca 
biemoamrfuccuedusadditojuccarocu a* 
qua ca lida ter in feprimana : ? op rime purgat 
bumo^inducentefcabie. f tJafet idefuccus 
corra Ydropifimfifiateteo fYrupue. f CoM 
tra optlatione fplenie 7 eparie saf fucate cB 
flddito juccaro eu aqua calida.qma fumStcr 
revenroGtatefacit :©andu8eftcii aliquo re* 
p:imenteventofiratc:vtcfifeminefem'aiIivct 
maftice.f Suicena.inmus terre tncirur cfle 
rrigidn8trip:imo:ftccu8infccundo.mcIio:eft 
recene:acutu8amaru8.fanguinempurificaf. 
3n ipfo eft frigue^ter id quod eft ibi t>e fa po 
re ftipriatarie/z calo: p:opfcr fllud quod eft i 
ipfo t»efapo:e amarirudfnt'8. % quafifrigS eft 
fouiits.f '.Bibirur ad pusrirtsm er ad fcabie . 
©mngitcg gingiuaiofomacbii confbtfar . 
£> pita tioncs epatie aperir.g t namra m lenit. 
Urinarop:ouocaf.f£onftanrinue.5umu8 
terreca.dt in.i.fi'c. fni?.gra,andc confo:rat 
ftomac bum:cjccirat aperitum fuccus pofiit t>a 
tu8. f £o:pu8afcabie acpmriru puftulifcfc 
mundificat.£olcnm rubea aduftam purgar 
Sangwnemcalefarir.inajtime fi cummira? 
bolanis irii,tf9fir.f PYafcoridesquocp tririt 
cy fumne terre fua p:op:icrafe mundat eoqpS 
ab omni br.mowm purrcdine. 

Capittilurn.friij. 




T^7angue.3fti^ungt ©icunfur eo q> ar l 
jR^.diigneaccepritpcipilr.foeeiigniee 
*— *■ fnicfcafulgo &;cocyfifvomeeignt'8 
et mif rimentu.S tri ©icutntngos vocatos eo 
q> funrereoarmgenerecidainfercpri.vti zt>c 
fnnai.f j6ar.j£6ptecioeo?frigrdaerbiIida 
mulru,tprer r3 fiif^emedicuiasmoirifer asec 
jrpriccirij fubftat ie admifcef aliq pufrefact io^ 

^Pfrationf0 

f j£tttritgaf.inli;tct)iaa.^om'e)cct8fjTf 
nonociui? futfri. ? fi cje vrif eie nimis gcne^ 
rantbumo«:e maloe,j£ t er rie funt fpcemale 
mo:tifere.tiamvidiboiemci pafluseftab cfs 
anptateanbelimeetcoarfationc-zfincopim: 
1 fudoiefrigidu.-z euafir pollcp pot auit vinii i 
e}t»ecocfufueratpuIegiu:'Z,piecrue fup ipfuj 
baurackz ftc euomuit fungoe tttoe e% cjfo ge 
neratifuerutbuo^egrofltin fiomacbo f Vln 
c\ fiigoe comedtrifibi accidit crdecotica 2 fuf 
focario £ViatardIdinocumetu ipct? cft tafe 
in pottt vinu punl^uraqua cicemcn aceto z 
fale et Dccocrioefaturcgieetorigam-z ftercus 
galline cu accto mtjctii 1 mellc et facr indelo 
boc.f £t fungi djde nutritlt nutrimcf fuper^ 
fiuo:nifiq:funttifriciftrt'gcRicie:ctegrcdiu 
tur cu ftcrco:e inregrt fine mutarione.j£t nimi 
eraefungoat gcnerat ftraguirilf j£t ide auc. ■ 
abenmefuaY.^eli^ecrfimgipmocoquaf 
cu5pirieficciautrccentib;:2bibaf pcitea vi 
nupuro.Ej.jprietae co?eftq> gencrSt fiiffo^ 
catoce..fj6af.vti.fiin,far.cjiitkite.i/itngifj'i 
gidi 1 bu,fufttaer cr fnnr:vndc igpiic ^Aictcri 
jofa^^ruteaningutxmajctc quecuqj naruraj 



n 



3 



D 



£rarfatu0 



& 



19 



Emittajbnfputrcduiali auYui qn'farf.<|f j£t 
ideU.ij.'cecibiP.cflXcfun6!.5 : ungibfibitllin 
vd fcecocti in aqua veniur ^e edulia apoya: 
w tfi fic rminodo vrunrur bominee. 
f*f>pcparat:aiifzcomcdutnitri{bynitcr:fleg^ 
maticii aur eft qtf ejc tpfle nurrimeru cft.erpa<? 
laqtffrigiduerbiimidii -.ctaccidit cjc ipfiema 
luecbimue.marimecViesago innocui alqs 
fungisfunrboleri ^£rcgo vidiquofda^ bo* 
lerof AinnoaiilTimivtdcnfjdiplures no be? 
nccocroecomcdiir.XJnde qucnda ejc cisvidi 
iiffticruino:evenrri8:et grauaruet angufta* 
tem er vijc refpirate:a fpiriru 'oeficicnreer frigi 
du fudanre:et vijc faluarii per oblarionc fedan 
riii groiToebumo:e8qualecff ojumelper fe.-z 
cu vfopo ct origano incdiocrirer fcccocrisin 
ipTo^Etcfmllefumpfirctvomuirbuiufmodi 
fpuma.poftc£ vomuir comeftoG fungos: iam 
aliqualirerin flcgmaricu cbimii fuffocanrcm 
et frigidu er grolfum pcrmuraros. 
f Blmiifoz trac.ii>.ca.T>e fungis.iuiigi rube 
rico va Ide ftmt t>aerio:e8.quo:u quida bonri 
ncsffrangulant atq; occidiit.quiaurcejc tllis 
|jon(e.|tiJtwntinco:po:e:vifcofumgeneratfie# 
gma.^j£teftaliudgenu8fungoui q# ctfirer 
nominatur mbera.p:o quibus lege capirolus 
£.ubera,infrat>e.2:. 





Capituluuunrft 



^&riofiutf>iu».tfu 
*[6ariofiui traduf inin* 
idia gigni piperis grania 
< fimile griidiv fragiliufcg 
jBcUfebifaurodortgfai 
limsinfpinispiperisf? 
1'militiidine papua ama? 
ES ^fritudine:folijejgui8.*t)eii 
fifqs cip:i mo:ra mis rriu cubiro?: cowice paUi 
do.radicclaralignofaq5:buiceicolo:i8.baciri 
aqua cu femine ercepra i erco vafc mcdtcame 
rufiriqo* ti tion-a (pellaf . ^"jjb latca ri9. £5ario? 
fiu' quidc^c o:igine p/ectu acuti fapo:i8funt. 
1 bi lut ca .? u'c.in.iij.gradu.0uidam remifitc* 
ree babet qlirarce. ? bi in fecudo gradu iudti 
canf .£>unr aut finaue aiiufda arboris i jfti 
dia . qui maruri collccti £ annoe quincp fcrul 
tur.*per t>ece vero fine comipricc: ? boc in Io> 
co ficco rempcrare:q: mulrum bumido ptirre 
fcunr.3n mulrii ficco arefcut z eomigif .£u> 
gcndi aur funt qui in fugfide baber aliqnnjlii 
planicierz qui cjcimpfliocvnguis aliqd butni 
ditatisemirtunt. 

©pfrationrs. 

f •platearius.Sairofili babet virrureconfb: 
randicc aromaricirare:t>il}olnendi? cofnmeV 
di ec qua liratite:ad t olo:e ftomatbi cr. frigidi 
tare vcl venrofirarc.qi jConferiir ad ccrtb:um 
confo:randuXonrra fiutu vcnf rie ejc acumi* 
nemeclicineXontra cardiacam et fincopim. 
f PYafcoudee.gariofiUicalidumeft? ftccix 
Cnfecundo gradu.ponitur in colurije:quia vf 
fum acuit f -poraru vero naufea p:cbibcr.*pri 
ficoe iaasn.tittias arbo:is gumma vires ba 
bavrrbcreboina. f Buicenna. j5arioftl9ca 
lidus cfh ficcus in rcrrio gradu. ^o:p.ie odo 
rembonu cfticir.tiifum acuifz ccfcrt panno : 
confonarlf omacbih epam confcn vomirui 
i naufee.f £onfianrinu8.35ariofiIi calidi fut 
ctlica'infccundogradu.©tcmacbumtepar 
a inrerioza cum fua a romaricirare pfowant « 
vcnrrem confiipant.cibum cigcrunr. 
f^erapionauao:irare.^?acbin.3ngrcdif 
in medicinis qucacuunr vifum.rcmouer nacp 
obfcurirare vifu8:-z coferr fcbel z gluren gario 
fili dt fimileglnrini albotin. 
f 3dem aucrorirare*ftafie.j5ariofili confc^ 
runt Itomac bo z epati.confo:rant cor a ftriti 
guntvcntrem:it>igcruntciburh. 
f £taucto:itate3faac.0uando bibitur q: 
garioftlo.?.quinq5cumlacteiniciunio;coa'» 
bo;at porcntiam coirue. 

- Cflptrulunwru. 



6 



Bttjnbw 




"-/£*%tiohUta.V>w(cM baba ffmflfe 
\ 1 a ^mcmi'c:cuuieradijcodo:embabct 
^ , gariofiloantrictaa quibufdam fana 
munda et enancia ct pee leporie ct oculue lcf 
po:ie.ca x\l t ficca in fccundo gradu. 

jBprrationf© 

f Ittrba ipfa rrira ct fuccus eiue UdnUe ink 
crue fanar ipfa8.£>iVr operaf 0« caprue 
fSdmmftraapuocandafiatfoinenriieicaq 
fcecocriois cfus.f £crra coliea ct a d t>igef iio 
ne cofo:ra ndu t>erur vtnu fcecocrionie ciue. 
f6aV.ri/tm.far.ca.Xapagu.i.oailoelcpo* 
ris fiuc gariofilata :ficcatiuc rirrorie cft: rt q 
fmvmtrerajmatababcrfufficicnrerfiftat 

£flpitulum.rru? 

0&lla S>era .li.ag.aue.pvafco.ca .gal 
la.£ftejcea q accipif cjcarbo:efua re* 
cene:immatura:parua.rotuda:nodo 
fa:n6p.fb:araetgrauie.£te aliaqeleuie 
fo:ata;fed pzima medicim'8 ecoucnienrio:. 
f 3de aue.^a V.airidce ejc gallie funt acei be 
pVimu cj> cltin cifubftantia tcfrea.? fapo: c$% 
llipticue mulru.^rue ea?cfri.in q.gra.-z ficca 
iniq.f^ii.^allcfructu8in©Yriact^g\p 
tocopiofiueejiillir. 

^prraricms 



f £raf.0eefpc«gaUa?funtftiphcc Me 
q qn tcrunf % pulucrifanf fup. carne fupfiua tf 
lent ea.-r cofcriit adrlcera eo:roGua.f £r p:o 
bibenr buidirare q currit ad gingiuaen cofe* 
riic alcolcf j£ t qn accipif id qtf e int ra galiaj 
?porifinco:rofurat>cntlfedatt>olo:ceiue. 
f Etqncoburunf fupp:unaectemrigunf in 
accto ctfale ftringut flurii fanguinief £t se 
coctio galla?qn fit fcffio inea cofcrt erit uima 
tricie ct curfui bumiditaru anriq" « ejritui ani. 
ctqninfundafin acetoaut aqua nigrificanc 
capilloe.f 0n puluerifanf ect>anf inporo a 
qua vel viho pferfir buidirarito vlcc? inreftto 
rita fluri anti4 1 funr pucniaee in cibie co n: 
t fit'r qncoquif citoco? in aq in q bulterint. 
f £t vVr quide ad miniftrade funt ad ftiptica* 
du:retincndu ct t>cficcadu % infrigidat farie. 
f £tt>icit £jera.auc,£>aV.cj> frue ca? f«5a c 
repcutitet^bibetct aggrcgar.? tcrtia fttffc: 
tiftcar meb:a flura t>ebilia.*r,pbiber oes cgrtf 
tudinee q fiur et btlom tiff oluttoc:': co? rlujc9 
^bibctf £onfta.in li.gra.#alla fri.ein.rj.fic. 
in.iii.l^iue queda c nondii matura .q bulla^ 
taenccp.fo^ta.3ltera^omaruratumoriac 
njbo:iperrincne; 

3deocj3min9frigidifari62llipticariebabef. 
f txc vfta fanguinolera valcr egeftioirz t>ecj 
ciicp loco manaucrir fanguie fliijcuijfcifiurae 
cijcalcancoujmfanat:crlabio?fiffura8curat 
n iti 






% 






Craf«ni0 



^em&valet & llfl locie cjfo repngnflf to % c 5 
fiipario acrcficcatio fnrofJoitunaf ^larea. 
jfiaUa fri,c « ficin iitj gduOin afia rcp.ifp.ua t 
no £fo:ara.3nrcr baegroiliotfe plus valcr. 
b3lKrcE.^rufcpflringcdi.vfllctprlu)Luvcntrl 
2t>iflint£rii.pflu)tuf8Fgtiini8cn2rib?.ptjU}i8 
cius vulncrib; fugpoto ca confoUdat 




Capitulum.rcutT 



^fpjfSIbanii.S^crali.ag.cfl.t?cnc3lbcgi 
I *) .i.gaibano,auc.pYaf.#albanimi cft 
^*^ giimi plarc euiufda ftfie feriilc in ftgu* 
rflfuflXtmctfSeiccocff iUudqtf efl mtindtm 
filcolibflroaufarmoniaco fldbcree trMui. 
tio.bne fllio.d ligui incc fcmie ci9.p!5ra i lignQ 
bnt grauecdo:c\ctn6futntrrie ficca.adulfc 
ralcu rtfina piniq at mifccf cn fabie fractis et 
armoniaco.^ifiar.vin.fim.far.ca.gslbamim 
fmrr2nfl.gre.0slb2nuopo8efcrulariplan^ 
rc mollitiue i tvflfotct iee ejme ^runeX t crit 
triq in calcfflriedo.eji-.iq.grfltUncipicf e vclin 
^.coj lcroxiftccado vero ejc.ii.incipientf, 
f3cfo:.Salbanueftfucc^fcruIc.ficurtic(t 
^fido.te q.f.fei ula.cc]u'rj.e9 ,t ictu cV£U. lib. 
jijJ&M (yrta in amfl no inctc galbsnu rcfine 
jroco.qb mflrimc laudarcarriUtginofuj? pu 
ru ad ftlittfdine at momacurmmcq- Ugr.ofcm 
Bdislrcrafafitfabaautfagapcon.^ p\af. 
<9.gal.0albanu lad»imu e cuiufda.bcrbe ftf 



mffferule cj inicomedfa nflfct?? fvrifl.aiftcft 
optimu c? emtldtfftmu? filearmomaco i tbu 
ri in colou biie grana vt fabfl. ;&dulrcraf i t 
refinfl etfabatiutfa-rgunaflrmoniaci f "jMa 
te.jSalbanu e ca.in q .g.bu.i.i.X icjr e q in effa 
tc a (TUriceerupir :i circa fruriec pdcffli.0utf 
dacfi3fo:ticcnndutvfmag^effluat.So|:bi 
fticaf aut et immimone minut o? ligno?.2l U? 
$o mifcetpuluerccolofonie^fabas frfltrae* 
£ligendtt aiiteft ofi albii cft i puriS.25abetq$ 
virtute artrabedi ct tifToluendwofumcndi ct 
kmendijrnaruridi:rclajcandi. 

i>prrationf0 

fSfcra.fluc.1Dv9f.tlirfU6ecicfllida:tgncflt 
cttYflfo:cticfl.fl£6rrflflfm9frigidutenf.j. 
m.eu ouo fo:bilivcl aqua o:dci.ptra iirargtl 
ponaf fub eflrbomfo :etrccipia t paricc fumu. 
ptra fuffbcationc marric^ idcm fiar pcr cmb o 
tum ponatttr infertf. f £ crra fplcnis t uricic 
ponif in aceto p. fres ties i nocree:? pofimo* 
du fiar t ecocrio.tcinde eolcmr et colatura in 
miido vafeponaf addiffl cera cr olco ct picu^ 
la:er fiar cmpla firii fupcranre galba no.vcl ce 
rotufuperarcccra.vel vngucntum fuperante 
©leo:fed meliue fi fiat cmplaHrumara q? acctf 
dat ad ccrorii ad mcnflrufl;puoeandfl:ct fttu? 
mo:niu:effccundinaeduccndi:fi9tnafcalecii 
co ettincf o in olco.f "B d apolfcmata matu* 
randu et rumpedCi fupponflf ad lumbricoe oc 
cidedoe tcnnir pillule cjc ga Ibano intincf e fa 
mcllc,f0Yaf3ppolttunart'torumigt'o^fup 
pofifumcnlirui8impcraf.abo:fi!mfacit.9ce^ 
to cr nitro nritruknrigtnceroUirivr granufa 
bc glutirii fuffim mcdcf ,f rifnoicie i flfma^ 
ricis opirulflf.j£|c alro cadftul ccquaffarioifo 
fubucnirXu vino *: mvrrbfl btbirum vencnis 
oceurrir.^nfanresin vrcro mouuoeacccptu 
cjccludit.3mpofifutolo:cmlatcri8mirigaf. 
Xo:rio nes fpargir.£ pilcric^ vtilirer acbibcf 
f -jblarcariXontra fllmafrigidtimtaf cum 
aqua o:dci.£6tra litargia fnp caibonee pc^ 
nif:ctparie8ft!murccipif3d flpoltcmarum 
pedit ct mflturardu fugpomf .Bd lumbncos 
occidcdoeitcnmr pilUilc q: co mcllc itmnetc^ 
valctt in cmplaftro prra fplenie tsuricicm 
f£onltan.inli.graduii.0albsnucftcelidu3 
intcrtio gradu.(iccu5inlccundoXatbaplflf^ 
matu cti m rapbflno et aceio fc:cicicm putfu? 
larii mundificat :Xt fiimq ct an bclitu lollir. 
j£ pirima fugpol irum rcprilium mo:f tto rtpu 
gnflt.ffSuettnft8toiaeeacco:rofurem 
bnres pofnu coe t \\n\t ,g>i vtro cu fo:u r Hit> 
p^gnatitctur: iroztubcckritcr ctpciUn^ ia/ 
bo:oft8ctialpflimatiti6 (kbucnw j 



mt$M&. 




Capitulum.fn)ii) 

^^&ligfl.S.ui.j3aiang9 efrufta fouo^ 
■ 1 lutarubeanfgra.in.g.gra?5.ca.eff.ar. 
A,a, ficct cftfubrile refchmuii.^Yaf.T icit 
Cpctt ra dijcq reeitur circa artoriepcdc in per 
fia.qtf patete]ceo cf babcrinteriueradiceqn 
da;3r etia t en a adbcret ci,jpt sfit fcruari B c\n 
<$ a nnoe.j£lt afit cligeda fubrufa i in fua ma 
iteriepodcrofa .1 etia acutu bre fapo:?. j£ r q 
? gfo:ata :et fa cile inpulucre foluiNbijcicda g 
tiirrutcbjcofottadiqc arcmaricirare cttift 
foluedi 1 cofumcdi er, qliratto. £5o!et aut fo 
pbifhcariejc c dmijLttorie iunci t pe rsdkc tcit 
ruofam ct eiia cjc admftrfonc b ifi c:t c.tin ofci 
rur ant qma iunei radu. infipidn vclfa Ifujbaif 
bef fapo:e.bifto:ta poricu.jBalSga vcro aro* 
maticu ctacutii.Slu fcpbifltcenf boc rrcdo; 
pulucri3at opf imu galsga»: piper ccftdtltaij 
accf o:ct imponut radicc inuri e notr ect cfiiri 
ruracuufapo:ie:fedtinofrifq:iwcriHnffp# 
difapo:i6e.galanga fo acUti.S5era.li.agg; 
ca.galugcn.i.galanga cvcnain grolTirudinc 
caflielignee.crco:te|cciueeriibcu6.'infcri5'pu 
rukntue.tpefertur eic fvria,ca.e^rficitef5o g. 

&pmuiotif$ 

<ffpY9f3dctg<fiioneco»ifo«andact9olo 



rcm Jffomac biejc frfgfdacaufs vclciivcnfoffta 
tct>af vinfitsecoctiomeci9.f 3d ccnb? con 
fonandu.nanto appliccturX ontra csrdiaca' 
pafitoncctfincop im tcturpultaecitie cfj fuc? 
co planra ginie. f Ccm raft*o:c o:ie accfpe 
galangam ct coqucin viiror: pofiea tcfpatt 
cntiadmodu fvrupi qtioltbet manc: et rcmo^ 
iict fcfo:cm orie. 

nir fic gmatfctg Tr^i 
Rcmacj&o.j£tfacit tigen cibu,jprcr fuamca? 
leJscrioiie^jprcrfusm^^ 
re.j£tcoucnitcolice:f £tfecitcdo:cm o:is 
bonfi et calefacit rcnce;? coraouer fpem a.£r: 
quando frirfium qcca tenefurinc:efacit eru 
cwaricmmmcgnam.xande ccucnit frcma^ 
tbo et tigcrit nbiim anUc^emaferie.etccuc^ 
ritfrigidifatircnum. 

^ j£ t idcm aucsbcn mcfuaY.£lf'ca,et ftcin 
iU.grfl.ettficoucnicnsbabcrsti rolicam cjcvc 
tofirafejiamfrangit cmncmvcmouratem et 
cStteriitbfibcJicructuatfonee accrofae 
^£fta.vbifup:a.0a]ag^£intcrtiogra^ 
ctUc3toma(bfi flcgmaf tcuc^jijf.^irtu 
tcm t fgcfiiua acluusUjnijrofitSfun tn?c!? 
uit.p6od6nfcru rxdcTir .£ isratccIicsro/Rc 4 
nce calcfacit^et sugerWidfncjm. 




15 



CeptMtinuo^ 



Ctactatua 



& 



0glU'rricu.lMa.bcrba cfi bnefo.fimfli 
a fouie gtidin f5 Uuio:a. fapo:c acum 
bneiMUrricuqriationomieftgaUi 
cctrii cii a.i fic.in.i^Bcto:.0aUimcu e qrJ 
alio noiepoHitricuvocaf g annuf uaf.CutTu 
rc b? -- fnmcdiicskfaciccli -z refolucdijolia ct 
fcmc in mcdicinis vrunf : in bottie nateunrur 

Opcrationco 
Cfrmcru qtacj tceocticie ci9 faeru mam'c2 
oprtcmudmcaremc%ufl#tK>car.fSecun* 
dtni cductr.ieul momiu ejcpellir.Suctf fouo 
r u e& cu fete forifrage % mara rri fumpru valec 
calculof ^Vim tecocriou? eitie bibifu^puo? 
car fudoje:? pfumitftegmarieoebumotf 8 
fLonftan.0alUmdpfo:tatctadiuuatfngi 
dulioma.groffumcriWScritcibum.frpfltic^ 
cardiacieipter colera nigri ac flcgma.pa tien 
tibue fubuenit.CBaribueappUcaru opilattf 
onenarifi ac cercba aperir. 

CapJtuluuuriE 

03Uttricu agrefte.^lare.0alk'mcua^ 
grefte ebetba folia bne Ittia pdica.fcd 
maioza et latio:a pa?. ca.-t fic.in.u..g. 
Opcrationce 
f0Yaf.atwtecocri6iegallirrittagreft}va 
lcr oifco fcbricitatito.^ £>pilationeq} tplenie 
^eparie agirXotra anriquu afma taf Jjabet 
cm^ietates? ^tutesoeebaUitria ptedtcu 




Capituluuutr* 

_^rXadiolue.3ltdo.0ladJcIue ticifur 
§ ^\ co cffitfoui8gladiofimilito t\rfoeu 
Vt/ birali:fto:ito purpurcie.p ysf.c a.te* 
rene.i.gladK>lue.tcrcriebabcr fclia fimflia 
* ridi;fcd lario:a z acurioHU? bafta^ tn mcdio 
folio:u cubirivnius longlet groffam; in cui9 
frgis funt capitella rrigona fub ipfie fio:ee ba 
bcnepurpureoe in mcdtb feniceucolo:cm^ 
mcn ciue in rbUiculiscft fitc cucumcrie.-fcmini 
rotutiduanigru:guftuvifcidum.*Radij:cftil 
b' nodofa tonga ct rufa.£li.cap.te gladioto. 
^ladiolum ome noucrur .JSladioUie ticitut 
<T fitfolqe fimtlib; rvrfo cubiraluftonbue pur 
purcte. Ejcfinonimisfcicndum cp acotuecft 
gladibtue.£Junt cnim quatruo: berbe in fbtf 
ma fimilee valde.£>cd aeoms t ifcerntrur cVt 
mnoflo^rubcacpradiceSparulafetidama 
lo tifccmirur odo:c:et earerfiotf.jmsftotf 
rem gerir purpurcum^reoe album. pladio* 
webabercroceunufcdfparula fcrida album 
Picituraurebulbtieomnibrunicaradir^Bt 
vcro modemimedici qn fimpUcircracciptunt 
pwradicenairifi. 

©prrarioms 

f p vaf.Oulncra capif ie optfme curat frar tu 

tis nicdmir .offa confracta ejx Uidir.omn ia in 

ftica co:po:t euoca t impofita*fi $o partce t ref 

ftouimeiaddanturut radiciecentaurcc par* 

rcGquinc£cf mclfurTiciene etacetum .et vtea 

fbaptafma imponamrtunuwes ct turicies 

fpargent.bibimm conquaffarionee rcfoanat 

taterie tolo:cm toUit jSftrangwriie % fctattf 

rieoprimeopuulatur. 

fT^adicctusfiuritvcnrrieflringttcutulco^ 

rectaqua maritimaacccpta .fcmen ciu& tiu 

rcticti5 eft.quod valetobuto vno accepro :auc 

.54 .cum vino omnia vr ftuna faccrc potcft . 

X.ivm aceto bibitum fptenficcat 

«tfjUc radit ec vino potata venena teflrutt et 

ineitrua^puocat.trita^octinmodufomenti 

poritamruculoeetfpinaeteco^oKCjttrabit 

ct omncm t urictem tiiTouiit. 

$£U .U.icci. , Radit tiue potata cnm r iho ad 

vcncnupficif .fctum ? menftrua^puocat 3te 

trita ettmpofitafitrunculoect fpinaeqc ioJ^ 

po:e cjttra bit ; ct omnem turiciem tuTouur. 1 

fuapo^t. 

f£onftan.vbtffipw.^ladiola4.Trco8eca; 

lidain fecundo gradu.poloum ncruowt e 

ficgmafemitigat.2iifttmq3tiuturna5pfacat 

ct fcreatum facflcmrcddir. 

4f 0roffoe pecto4.fumo:c8 attcnuatcu.acc; 



B 



&t Dt rttfe 5 



to potata motfuereprfliii fanat.rplencttcl fub 
«cin'tXpafmmn ac rigoje fetoium cura t 




€apitulum.rt?$ 

jrrjr*Ranatum.3fi'do2us.^>alus grana 
■•l tusfcminini gcneri8arbo:eft.pomu3 
Vl^ vero nattrufcj malogranatum. & e'/ 
rapion li.aggre.ca.£?urnaiTUid eft granarum 
funt ejc eis acerofa ctt>ulda. et virtus aiiufcu 
iSMllouim eft fm illum fapotcm . et fapo: ipi9 
granan' toriuset granow ipfotu eft plus Ripri 
cu8 cp fapo: fuca ctue cr pluris tcftccarionis 
£o:retvero eiiismboceftfotfto: grano u;^ 
U8.£tco:pu8granariqtjcadttaba:bo:ceft: 
plus in boc cgcozrer.Et idcm auero. £> vafco 
r<idis«Q mma gra nara boni tbinu.jgaucttus 
vitj.fim.farmacom.ca.fcegranaro.*^awm 
granarum omnium ftiptica parricipat quali* 
tatemon tamen tsominanrc in omnibue.que 
damcntmeo:umfunracida:queciamtiulcia 
plus 63 auftcra. £ t iuua rncnrutn vmufcuiufr 
«rjcommf m p:edominantem necetTeeftficri 
qualirarem.piaum eft aurcm in,t'it!.bo:u?tt* 
b:o:u t>e tmlci fapo:e er auftcro. ande ejc illis 
eftribifitogifare.funtautegirgara fucco fh* 
pticio:a£tficcto:a, 23isvcroadbucco:tiee8 
c\i vocan i ftdti .fimilis & ut v irturie co£ iij nc 



Suiccn .lujxa.scgranato. £ranarum itktd 
quodcftt>ulceeftfri.adputnu.'zbu,inipoxa 
caofuradtrri.sficaimin fecundo; 

©ptrartowo 

f 3dcm.3cerofumrcp:imit cokra'- .pbfbrt 
curfum fijpfluirarum advifcera rc^piievuiuj 
euisrz tn o mmtomis fpectebus vfcj? ad acet o 
fum e abfterfto cum ftipticif ate. 
CSrauagranatiatmmdleliniunfadvIcera 
frauduler a.-z ci'9 capitapcipucad vlcera adu? 
fta .f £ tD ulcc qutdem leniftca t. mujum ve^ 
ro c magis iuuatiuum ftomacbo 63 potna vel 
cifonia:fedciU8 granumeftinaluj.? fmod t>c 
partito etus magisftipticum cft capira funnt 
grana eiusftipricafunttfiuefint grana tmlcj 
aurnonsulcts. 

f firaiiagranaticumeUe pfcrut t>olo:i auris 
£t funtiuuamcntuinrcrioti nariurm 
f £tc6feruntgranagran3!ie6trita z copofi 
taotmmellc alcolelinita. £tfigranarat>ul^ 
cia coquanf cuvino t>einde rcrawf fecutfunt; 
ct fiat et cfs cmplaftrum auri conuenit#pofte* 
maticius. ..^ ;•' .„ 

f £r iutia metugranatict rob acctofi,tp:teVc* 
uenit eolcrc.rucciis acet ofi ! co menit v ngulc; 
3 cef ofum ejcafjgat pect? et tmlce lcnit ipfurro 
2?fo?tat pectf*,ct qn t>anf itx portt granagw 
nato^cu aqua pluutali valct ad fpuru fanguf* 
nis..£ t ipmtotu confcrt trcmo:i f o.:di8. ct at» 
ftergitoe ftomacbi ,f *Kabi mo \fcs a llegsn* 
do 0aliei)5ranatii^p:ietate ba bcr miraculo 
fanuquianon facitcibum cotmmpi inftoma 
cbo:ct acefofumcoquittatu a:m abo nonfa^ 
cttcibuminftomacbo cozrumpi. 
f "RadiccB gra nati acesoii vatcnt contra ^ 
meavellumbticoequivocaururcinguUHnvr 
folia inbuncmodum admmtlirara.*Rc. radi^ 
cumminutartungranaftaccrofi.erradicura^ 
pefte,a.*^i.i.piftenf:eittr3ctt'ep:iu8ramcttfu 
Ihbns aiftentibue in pzcdtcrte radtVth? cr b ult*/' 
ant.pollea cumtnedia quarra viutgrca vcl al 
tcriu8vinioptimi.ilbivfcpadeonfuniprionc 
medictatis viniset in fineponarur.j.f .piper* 
nigri trifuetcolerurpcr pannu^er^uietur a? 
cruc3.parientiinmedianocri6.etpoitct^al> 
fumpttoncm no touniat.f S> cra.auc, ohai 
mefuav.qu accrofiun ftmttf confcrt flujcui lio^ 
macbi quiMcidit a colcra er JTsncopijque i cci 
dit ab cadcmet,pttocar .vrutam. <§ j£t cu$ fub 
nlirarc d\e acetolit af is pfert vngulc oculi qn 
do ftt collirium aun co. 



M 



£ 



P 



& 



*ft 



% 



Crartams 




I l , Dcmfa-i3.^icir<Tdtb£fcrameii.i£ta 
^*^ pudfcra.aue.cuiufdamvocafairac.z 
rft arbo: granarifilucftrie. £r fructfds voea 
turbcU cftarbor fpinofaXtflignuerubeum 
vdpurpurcuiEKtfmalmanforem bjrlozcci* 
m*nu»inbarbariavocafaldani.tngredifinrro 
dfcii- artdromad rvriace maiorieXuiue loco 
ponifB ui.fructu aItcbur.S>cra.li.aggrc. an 
mabar.:t£>abarfunt vcnc arbo:is granati fil 
ueUrie q nafcunf in fcni vltra mare i in co:af> 
teVjfuntverjegrofiealbe eoUigut inbafmen.; 
j£tci$malagranaraulr(icurmalagmnarato 
trjefiicainpncipioo:rusco$^rcolo:eintcrru 
bedineer viridirarc.£rinter malujcius funt 
grana rttbea rbruda in magnirudinc fcminis 
lentifcur vimirrunr cum in c ozrice fuo : quan 
do egcnr eie ejctrabur a co:rice 3£>abar e ca. 
% bu.piaf.c.tf afpalio.&fpauuuucsfpalroa 
id elt granarii iiluefire,*Bafcir in infula *R fco 
do:cuius fpes tupkjc c.£fr cm vns fpinoiam 
rrncrice^tYrfugraucbns.Er^cpofirucuio: 
riccpurpureo velrubeo.fcefo cr ocoriefum* 
mi etamari.$lreradlalba ugnofa i imbcril 
ne.fuple et ifta cft quaferapion vocat in* bat 

©prraticws 



fpYaf.0ranan*ll1ue{rre$attgerfp.m3tco^ & 
roborat coiru.-zcft bonu podagre qn rerif z co 
fiafcujacero^liniffupipni^pfertfpafmoct 
mollit^uriae iucrurarii j£r alici ©icunr o/ fic 
afpaltii.etilld idefadt qtf iit>itim9. f jldem '& 
pf af.Oirtf ei9 1 ca.? ftipti.q? cu vino fi fucric 
ekjcatu vulnerito oue mcdcf u. t purredinee qa 
grcci nomao appellara putredineo narure citf 
rar.f^tvaletpvlceraverrisqnficejecocW £ 
ftcre i borbo:nafi.er ejcpdlir ferum qfi nr cii co 
nafcale.fj£rfomaovulnerib^ddtpeiTarti8 $ 
additu mulicbaa ©eponir,cui9 elijearura venj 
treltringitianguincretjdenrtbufifubueniwq 
riuebibitainflarionesspillurriae cepefcit 




(Tapirulunurriiit 

0*Ramcn.lMatearij5ramcndt bcrba 
faris nora bns ramos rorudoe nodo 
foe fa% rerra fecjcpandcres.era nodis 
ramo^ejccutradiccercrra ingrcdicrce.t ulccs 
cu abbominationexuiue fotta parua funtstd 
fimilirudinecanncmino:i8j£ftfrufic.inpn^ 
cipio p:imigradu8,^cra,ub:o aggre.ca.ne 
ge.i.gramcndibcrbababcn8ramo8 baben 
ree nodoe cj cjcpandunf fupcr faciej terre? ejc 
ramieetuegeneranf radiccs cjceuntcea no* 
dte ipfius figetcs fe in rerra er radiecsanslba 
bcnr nod oe.i olia riue funt oblonga acureejc 



©e$frfifo ; 



ffcmfoutefiatt. foluim' fauBcpamc.jEft «Kj 
fpecicecuiuefolia ramiaradiceefwnr maio^ 
rce c$fup:adiac,immo funtfoKa fimilia ede# 
4 f rc;qitt4ncoincdutanialiacaoccidft:hiajct? 
wciUudquodnafcinirinbflbtlowminvti8.z 
quod nafrirurinfictlia qn comedif abouito 
apeftonantuna.iftam fpmeinuenieein eapi 
i-aUmus^ecJSediHudqo nafcirur in co* 
foe bab ct plureeramoe cfcalia fpccice.bab« 
flo:cmalbubomodo2ie:«fcmcnminuru in 
quo citiuuamcnru: ctradiccoquincpautfcp 
ingroiTitudinet>igitiaIba6:mol[cs:t>alcce:z 
fctcntc6.^al'.r<,fim.fiir.ca.afirofi»e.i.gram€ 
SubftanriacwecftJnbtme:?fapo:ciu6eft 
tvkie.t cft in co pa? acuif ati8 rii ftiptiritate 
pauca.£rradirciueb&5fapc:eabbominai 
fcile.ct vtrtneeiueeftniu. (iccu rcmpaame? 
ro £>vaf. ca&t agroflie.2lgrofiie.i.grameri 
virgae babct nodofaect fpanfas fupcr rerra 
fiip. quaevirgaefoliafunracura ctlatacttu 
ra ficut canne mino:ie;Radijc clt flli nodofa % 
tmlcie c&bouce ct alia animalia pafeunf 

j^prraribme 

gj ^aqnatccoaionu5ct$yate^tufnrtaltb^ 
barwafrangitlapfdc:acuratvulnaavcfice 
^trc ^^puocatvrinartcftccgwrinatiuaradij: ciue 
I ~ £t curat raima vcntrie. ia&, na; i y«ST§* 
* &" f S?aa.atjc^alieni.£u'rf9a*$ eft q a&u& 
nat vulncra rcccntiatiu funtfsnguinolenta: 
7 coautrur sbibif riue aq ct frangit lapidcm. 
©cd fcmecuie quod cft in cbfoe,puoca t vrii? 
nam.ttcficcat afi airrftadftotr&cbir.? inrc* 
ftinaciibumiditarito:cnvifttte riue cft ocfio 
cariua fubtilie fine flipricitate. 
<f 6ar'.*Radi,t ciue fa n guinolenro? vlccrij cft 
ccfolidarittaipfa quidebei ba cai baplai ma* 
ta infrigidat.quidc no vdxmeYaeoiififiit aut 
m mcdjo bnmida a licca. 
«|f pvaf.:bcrbaipfa carbaplafmatito adbibl 
ta vuincritoparacolcfim facit. -M li^arura ci9 
bibica toaionito a^uTuricmcdicarur.uulnc 
ra vcficc oprime curar,j£ t calculoe frangit: z 
Trina r puocat£anceqnfe ^oUlrpur garc bac 
bcrbammanducanti, 
g, ^fecennali.ri.ca.t>cgramine,gramcn fa- 
rLifl^tcoboaieplaflae fanguinee.£r fcccoctic* 
W ciuecttrabit lapidcm j£tfcrncciue,pK>uoca£ 
^&waconftringit, - - . 

f f j£t idcm aucf.03t , 4Dccoctfor3dicu«i$ fa* 
citid quodberba ipfa.ct ciue fcmcn.puocat 
vrinam;puocarionerom£r abfcinditvoiri 
tumcrflujcum, 

£8pim!um.tju 




0*fcana rititfo:u^atc.0ranatfncfo* 
raeftarbuftuvnde ringiffearlacnnu 
On &©e#o o/mft veltitfvefte coc r / 
O'nearf.rincrac3occo.f.grani6t>cfcarlaco.vo^ 
caf ail fcariice.£tefrntcjcfin t>Y3f,ca.tf coc 
co farmctofa:bne inipie$>giebaculoerom> 
doe (icur lerieula q colligunf % conftriunf .jE ({ 
aurbon9 eoccuegaUcric9 % armcnue.? fctfs 
flfianu6etliaueMpan9^ooimnouifltinus 
Tirrueeci(tiprica^aa4i^ag^uc.T>rafc.cai 
barmevel karme.i.granarinao?eft arbuftuj 
quodadMmltrafadigncacccdedmacftfn? 
eendiuinrer 9rbo:e? baba cuiue rami (ur ttX 
tifubrilee ftig quoefunt-grana rotuda filVas 
lcnriculie quc coUtgunf a rcponunf arcfcrul 
rur a conftriunf ad ringcndu.j£t mclio: cjcitf 
la elt cj ©cfatur cjct errie qne t>icunf gallarcei 
aandabafiaarmcni-^tfaJa cfttUa dc frria 
:liaaxtt>crcrio:oitoclttUaquc «cfertur ab> 
b\fpania.tregitinarbozepnafat?itmiliinfa 
Iqe arbori glandium in terrte calicbic;Ttn e& 
mlhpIicataialtcftofumparuufitclimacijeKC 
coUigat ipam mfiace illiue tare rii ro:c com 
£t idej9uc.j5at3apo: ciueclt ftipricuecuj 
amarmidine.ctviajtteciitetitficcatfirjcmor 
dicationc a abltagit a incarnat 

©paationtg 



tCtsmm 



f p^f.£oecm*.grana rniffO?flccfo mrue 
& uitipoiuiwvukicitoparacolcfunfflcifrtiicr 

uie incifie maumu P W» cft.f Scra.aucfo« 
& ^af.5ranarinao^ confm magme vlca tto 

ncroo? auomm memb:o"? quando f critur fo: 

riten mifccrur cuaeao? meUc.TttiaT>ccocrio 
^ necom tant iUie d, patfuitf in ncruie. f ^li. 
*• caxecocco.XJaUtvlceribpmagnieflmarimc 

ncruo? vlccril» tz valer ? tremo:eco:die x ct9 
,. ©cbilitate.f 23ocalYcrit ftlr pamafce.in anri 
^ dotatio fuo m quada cofcctionc q incipit co> 

fcctto.alfceimce. 




H^ 




Captmfum.ff]EttV 

0T*tanucuIa;tJSrerapJi'.«(T.ca.loba* 
cbiHm.i.granu culcuLjFotium eiuee 
. fifcfolfo albene.et eberbaq babctvc* 
naBWgrOffirudincpollicie-zindicie^tcgae 
crruntcofte^efetTaiicutfccl.rfumincicno 
dt.etnafamf invnoquocp nodofolia fimili» 
lolqe balfam i.t <ft albu maiue.ftn fummita* 
tc eiufl nafcunrur flo:ee'in vcrc.-: inpnnciptje 
r»cflium:quo:umcoto:eftcolo:vtoIaruj.nifi 
q^funtmaio:c«ei6.j£r#cpl"c^babafrticru 
wagnu in-quatitatc ciccrienlcmim ©ukio fa 
Po:ie.lartne vocrf granum culcnl. £t bci ba 
«iue inucnirttrtnloc^ vmb:ofie:cHujcfa rcbe* 
menrerbumcctie^tfpsccUecrioieci^cftin 



fEemdrie.atrtnecf!/a.ttw4n.i?.sr9<Ja» 

0pttattent0 

f i*?era.£raraicukulmouacoiru?flttgce 
fpcrma.? crccrionc rirge: ct jfrik qn confuif 
cii mclU;vclmtfcetur cumfifsmc^tquivttmr 
co nimieincurritcoUirica pfifiione.f £r id($ 
auc.7kefarugcr.qfi bibif poft ipm vuwm fai 
citfodam.cifp»cquando tozrcfir* 




Capttulum.rfjEUt' 

>< g ^ j£ndanfl.^unLtt.rjLV.6cnciangm'it 
■"§ ucnir ffenriuerec lUiricouiubiqjrta? 
^*S fcmte:inilltnco cfi p:diarifltma.folic» 
frauni.fcd magnitudine lacfucecauletcncro: 
pollicie cralTifudinc cauo ef inani ejt tnterual 
4iefcltafotriucubifo?alfoc2fu.radicctcnta 
fnbnigra fiucodo:eaquofa Sipubalpiniemo 
nfcuepuirimanafciror.Ufueetue iradiceac 
fuecovfSla.jBcnciana efi ba ba ralida ? Itcca 
cuiue radijc p:cc ipue compcrit vfui mec tcinc: 
noipfabcrba^nfinevcnecolligtmrctftcca 
turxtpcrannoeqrruotinmnltatfiicanafcr 
uarur.tDtbct aut cKgt loUda z corimia babee 
cifrinumcolo-cique non fit powrancc faci* 
leputuerecitfotuafcumfrangif.tlirmrcmba 
bctttfro!uendi:attrabcndi;?fumcndi.-tapc^ 
ricndi.f pYafxa.3e0et]ctana.jgcnci'ana fci 



Btfttxbfo 



dufdan gflitfe.tind«iiomen acccpinnHua 
folia c\ area radicee funrnuaeodo:e babcnrt 
ctiunt fimilia plantaginijfed paulo iub:ufto* 
ra er in fummo siuifa vel incifa fpecie fcrrc tm 
mediarcbabcnebaftam.6;baftalent8cft?va 
cua.trfgtri babens fimilirudinalongto: tuoto 
cubicis nodofa:circa quos nodoe folia nafcu 
furJcmcn cft ci circa folia in pomulio lotie et 
lcmto.er no inurileficuraffodilli.radice babec 
ficutariftologia longa.folidam 7amaraj:fcd 
nigrio:an cr fragtlio:cm.nafarur in locie alrl 
ct bumecruu vmbTofto 

©prrariont0 

€5aF.v(Xim.far.c9.t)e8enrianafm'tr<infla^ 
fioncmarabicam.3dquod©e ipfo fldmfni* 
ftratur cft radijtbuiue:cuiue fapoi cft amar* 
in ftne amarirudinis:cr virrue eiue eft magna 
fnmundiftcflrionecrabftcrftonerrapcriendo 
opilarioncmXftcmcalcfaaiuatfliprica. 
f £t idem codcm lib:o cr codem ca.f m rran* 
flarionegrecam.£entiana buiue berberadij: 
crTicajccft.vbiopotfctfubriliarealiquod-zab 
ft er gere i iwoptlarcnec cft miru fi boc porcft 
a mara violcnrer ejciftene, 
<rj£>era.£go non vidi mcdictnam mclio:cm 
in'mo:fitecanierabidiquandosafe|ccaqua 
libcr t>ic vncia vna trira cr aib:ara cum vncia 
vna m\rre. et cum vncije tmoto pulucrie can? 
cro:umfiuuialiumaduRo:um in principio e* 
gritudinie antecprimear aqua.'£rbcc qutdcj 
planra prraria cft vcncnie mo:rifer$:« a ufcrt 
nocumcnrii eo:u cu aurilto tsei 
f DYflf.6cntianactt acriecr calcfacro:ia:ct 
rcUi a ne acrimonia cr amaritudinc fua paruj 
cj:pelUne:er fcrpenree fugans 
4ff *Radt ci ciue vittue e calida cr ftiprica .que 
radi)c.5.ii.cum piperct rurasvino accepra mo: 
fibue venenatie occurrir.fuceiciue. j.q.oceep 
ta t>olo:ib? larcrum cr conquaflarionito vtili^ 
rerp:odeft ficutrclliritimujppofira. *Radi]c 
facirabo:fum. uulncritoimpofira mcdcrur. 
£?uccu6ciu6ftcuru'cinmminuncru6 tumo> 
rcm oculo:um compcfcit:macula8 co:po:ie 
tollir. * 

t ff *R siditvero infufa (naqua t>fcbus quinq j 
« poftea cocra cpdiimrfuteeic ca fcimfftft eo:; 
fricaror:erfie»cliquarur.peftea aquafpfa re 
coquantr c|dtu mettie fptfff nidwcm factar: er 
repomrurinvafeftailiadvfuni.f -Jbanlue. 
jSenriana ca lida cft cr ficca in rcrtto gradu 

<Captrulum.ajEUt!j 




0£ncflra.3o.mcfuc.cfl.t»e gcncflrfl.ct 
vocaf capiftrii flrbouta cft arfc o: md 
rana:fupcr cuiueftipirc ckuaf tcnfi? 
raefufciumnlreroriiditatie.ercuplicanfnon 
pariuttf fra cruraexmdc liganf eic cie at b o:es 
cr^pducunr fl o:ce fimilce figure lun ari cimni 
ratiemulre.jErjfmmtfoUtcuIosfmfcmiram 
o:obi bnree femina t illincra ficur Icnree 
f 3 ncjr pyaf.ca .e i fic.pplcjcioie in.tj .? fcm? 
ciue cft c$\\c\iw.i in fl o:c aS ct ftipirc c bilidrt 
rae fupflua cu virrure incifiua^re mulriplicat 
vomiru.j£rfuntoc8partcea'u8 corurbariuc: 
i'ncifiuc:fubriIiatiuccr|>uocatt'uc.^aulue. 
ca.tcgencfira.£fta1iaqvocafgcncftrafri.'z 
fic.complcjcicnie:ut'i6 gcncftre fupfo:i:fcd mi 
no:c.ababctfiipireemino:c6ctangufiio:<8 
craibtimflo:cfacie 

©prrartonr© 

fDY^f.Scmcgcncftrectfloebibit^cu mul 
fa buo:ce vcmirttopurgat.f &eX.$x\\tr) ge 
ncftre 1 baculo^ fuccue lajcatiuc no tebiliter 
clt$mr!.f3o.mcfue.^crvomiru?p_venrre 
educirflrgma.tcufoutrudincvcbcmcrimaie 
ria8qfuriniucrurl:fj£rmundificarrcne8ab 
oitofuEfluirarito.tpuocatvrinlfowit^fra 
git lapidc in rcnitccr vcfica .-: no pmirtir marc 
r iae figi in eie nccp Isptde ©ciari. f J£r qn flo^ 
rc8 ei9 prrirypmafcu mcllc rofa?. aut cu ouo 



a 



%$* { 



Crariarfe 



- fo&ilircfotuut fcroful».? orJmciera'* aur fe 

$ mieipfutefoluif apofrfara fplcnie. f j£r fifre 

Cinra^romiruo cude«?ucnit fciariceet poda? 

firc? fcolori renih fcofie riue c^uc I o?.a 

3.q. vfcfc ad.v.fcminiau8 a.jJj.tfct, ad.itj. vcl 

6 ift.fpT:T3cmeciu8«fto8bibituecumul 

%> fa bumoue vcmititopurgar.f i^aulue. tlir 

— turcbabet pliringcndi^dfiujcu mcnflruowm 

■jr*>fRo x*f aUt fomcnrtt ejcaqua tccoctiome ciue. fup? 

' jwfirouumctia ccpulucrcciuecrfuccoplanta 

#ni6.vala aiamconnatifitofcriam pjcdic* 

«umfomcnrum. 




CapituItmt.ftjEijE 

Jfp>^ 3 tb.£5a vmo ;£irb e gcnue Icgumto 
1^1 iife cimino in qntitatc Jcd nign ir olo:{ 
lV *^ ■zinpanctulcowdoimponif.f £iaf. 
Eirbcftbcrba q infcgcnte crc(cit.br1efcmcn 
nigru minut ihodotc fuaut.relatat cfn i caicfa 
cir.f ^la.ca.«ru ficcuin4firaij£tc^aba q 
-fnterfrumctu o:if.fcmcn nigrfoqfi triangulu 
faar.Skqnrula bjamarirudfnl.rrj tiurctirft 
«It^rurcb5 uuTolucndi x pfumedi.f ■fcMibs 
ftr .£j trb qc grcc ie^jltj mclai bio^lt) mclafpctf 
mon voear oprimu q$ cjccitat tmmi ' odo:ie. 

Bpmtimto 

f t> vaf.jgirb porarii vrina Tmcfirua^uocat 
tob?ico8c]tDcllit.impofifum Jp tumo:ce aut 



turfffcefotulfXHtttatetorttiffccIcpfemf 
trm.f Xcp:ae ac $>rurae appcfim rcllir.pi* 
$uce ac gluririofoe arcpr li ipa toc fctoicc t ft 
gcrir.f JLatarru fanatrflklaaaido fipukus 
ctue ligcf in lintbcolo ; a d narce fcpiuc appo 
nai vrcjuoodo:ef.Xil:?icoeailr cmcat to? 
mcf u vcl prulu5 curinfcc9wnfri appofimm. 
f •jblatcXcrra optlatccm cpat! ac fpknie.ct 
rcnu INguti iaxifttntaia;(Iiacapaf!ioncm.? 
t olo:e 1 1 c n a< ticjc vctolitat c taf \in m «cf 
coctcieci l /^puluieci^incibf6.Ctalcrcr(ctra 
tmo:roidae tnrlatae. f jCcrra klb:icoe ctiaj 
taipiiluieci$*umdlc.v$?p$mceauriu. 
f 'plM&cid f pettu platf? fco:pionu.3ufof 
ricnmcUcctaccforcpCTio.3nrcnfoq3fctpetc8 
fugaii.bibif.?.i.p.arantoe. f jCapirie tolo* 
rce illinitu ccacctoctinfufum nanb;;tcntm 
tolowe coctu m c um accto mitigar, 




<Tapifuftjm,ffjE)E 

^wommiarabicu^»cr94uaffff^a.fanf 
f f 1 filiarabi.i.gCmiarabtcu.£rcftgumi 
V*r qjJrcp,iffuBatbo:cmacaci«.fiairake 
$.. mcq arbo: noiaf amgaflevz meltuecrco c 
qtf ccr bac arbo:cftTe ^miculie tn figura (ua, 
Aolo: ci^cflltrurvtfru claru.cr ncbjltgmi.fe 
cundu $o peft ip m ealbu.-fcd illud qucd e ftte 
fo:dicici refinepinicft maU14rufl % fic, 



Bttottbte 



f i»er4.attc.6at'.vnij g'$tue eitisqX>cfiecat 
3 alia c^tns eiusq pglutinaf :ct anfert afpcri? 
fajc^fragit^tuteemedicina^acura^lcnit 
9 fperitate pecto:?:? ftringit vcntrcrz fomficar 
inteftina:? meliow oflafracta qnfttemplm al 
eo.tcouenitmalignitarivlcerupulmonis, 
f £t auc.&abir.p icit # e bu.parii t retinet 
ventreqn nimie rluit.-z pglutia*: intefiinu in c| 
eft temfmon/z pfolidat ofla fracta qn fitem? 
plaftru cu eo tfedat tuitim qn retinef in ozeet 
trafglurif qo* inde foluif.f Sut fimifc etur ali 
quib? medianieeofererito ad tufljm ■zvlccrifo 
pulmonisqnbibifeteo.f £6umitobtalmie 
et rectificat medianas laratiuae qn mifcetur 
cil cie.et.pbibet aojitatc earu. f £t frangit 
vomirucj.puenit ab eie.etqnn'tasnofieeiu8 
ad tuiTim.erad renncdii ventrcaureoeji.qul^ 
domifccfcualijemediciniseaurei.v.^r^uU 
caiim cben abma53rin.li.qui&ferujro:.5otf 
ma affandi gumi arabicu eft fiait omes alias 
gumas.qu.ivultaifarigumiarabicu5opo:tct 
vtfrangatillud tn fruitaad magnitudincm 
o:obi.t)cindeacciptatpafella z calcfaaat eaj 
et auferar ab igne.et ponat fug ea gumi arabi 
cu.a mifceat bene fine inrermtifione t>onec al 
befca t.et fi w albefdt pma viceateru ealefaci 
<at patcUam vt p?iusT>on.ec fiat albinet codcm 
modo fit ejc altjs gtjmmis. 




Captm{um.tff]E). 

BufcrvclbJiifo:.3ui, 
in.q4i.ca,facirq fcribif 
baufuu:f«! in ara .c bau. 
fcr£t<?atifo: clacficiniil 
qdda^n6cta)c9:vtqdi 
fciriitvelfpcs ei9; fijjj cu 
iusvmbiagiclitanffcoj 
mientesjvt pyafeofMfe 

•Hambaufo:eft lacricinium,« tajaseft ar? 

bo:maguaetvmb:ifica. 

©ptrartonts 

f^aa.u.ag.cap,bau.£>aufo:cplantabn"s 
lata folia.i nafaf in vno rp,eanni.7b5pcauij 
q?5 egredtT ab oculis ramom fuo? i a loc$ fto 
ru eius.f £teolligutab eo boies re ?umieM 
tc.z fucco ci9 e amaritndo.? egrediunf ab ea 
jnala (iait tefticulicamelo^.f Etegredif abtl 
lie pomisqda res acfcjrens: ita o/ no pot fieri 
caateriu cum re meliori ca.f Etimpknf er. ea 
culatreetpuluinaria,ernoiafetiIarbo: dus 
coberea .a qn inciduntur folia baufo: cmitrit 
tisc lac q6 colligif in mcnfe *^aq.£,t ponanf 
in co co:ia;et no renvanet pilos inris. et vnu^ 
vas impletur e.c suo toimp:eflionih£>.f £t li i 
gnu baufo: eft lcuegrotTum rectu pulcbm -sc, 
Bliusbaufo: evna ej; fpeaetotirimalli. 




X 



1 



o « 



fTratiaitts 



a 



p 
& 



Capitulnm.ffffi)* 

"tfu-x crmodacriiue.3 obi mcfue.jbermo 
m » ^ ct,lu8 f ^ r Jcl ^ ^^^^"ot .■ nracius 
#* G. 4 ilut8lo0ttsriaitt>i'giru6.altusrofui^ 
dus.ftd mclio: dl ro tundue.-z ciue alf5 albus. 
a!iu8rubeii0:flli9niscrif5metio:en'bi8cqm'c 
albue vcrc atbcdinis tntus i ectra.-z c\ eft grof 
fus et sntriciei mcd iocria.Blitcr aitt fact i ma 
lifilr.©cra.li.ag.ca.©n5rjgc;auc.Ovi)fco. 
<2? ruragcnfiue fura geu.t .bcrmodacrilu9 eft 
bcrba que flo:cfcit iu ftite auttlni.et e dus fios 
itlto fimtftn f igttra fua flori croci.peide cmit 
tirfoliafttufolijsbulbiinquitocbumidirae 
adberene manui.ct babet ftipirein longitudi? 
nerniuepamripozreoil.ciuecolo: eli atbus 
©ecltn-ts ad nigrcdine.er babet radice an l ) co 
lo:cftnigcradrubcdinct)eclinas.fedtviuando 
auferrurco:rcii:apparcr radir intcrius «tba: 
inouteiOulctsfaporierz plena buiditarcq gre 
cc vocaf coliricon -.vrappararrypria littera. 
£ft k radftipfa t otunda fimilis cepe bulbi. z 
raditipfa babcnitmedto fiiifcuTuram cpqua 
cgredti uipcs fitper quem eit floe.multu m(d 
turinloco qumciturcbarin.etin terris que 
fcicunrur guagtta. £r bec radit; a atia operaf 
xt infra f -jbaulus ca.t>e bcrmo.t^ermodacri 
li funr ca Itde i ficcein pncipio fccundi gradus 
i^XTbadtcircaradiceeriustuburofitatcetn 
tten iunf quc co ttigt ncbct ct vfui refer uari/jin 
cftarecolfigunf i rcferuanfcpcrannu vnu ier? 
«art potkm .25 mt mtc eltgeudi qmfunt al 
bi < tioiii.il. t) >.bet autej vircutein sulbumua 
ecfuinpauiuattractiuain 

BptmitmtB 

^Scra.aitc.6af,*Radi>:bcrmodactiIique2 
atbiitnnJsetejctracltmclio^.ctbjvirtuteU^ 
jcat iu;t .<[£ t aqus in qua bulticrit.-verum ma* 
lue cft \\ ontacbo.Etconfert oolo:ito iunau* 
rarii i podsgrc.£ tbibendue cbnttto tuttaitf 
rasmoUcsanimisbumidas. f 3deancro. 
^eiafurugcn.aibus eft bonus.S>cd rubc* 
ue ocddtrmon quia nimis frigidusttacy nar 
cotifa;quia fi boc eflet no etTa lajcatiuue. 
«ftBben ^&efuayyRubeiis oaidit vlcera an 
ttqua et confert variolio.f 23abic. £ tmelioz 
qc eo eitqut cii c?:tertne aintaiusalto/zqua? 
dofrangirurcltfractio eiusfadlisanon ou 
ra/Rigervdo arobaisXuntambo infcrficie 
tes.<{f-p>aulue.-j!surgantautcmp:incipalifcr 
flcgmaXontraarteticametpodagram:cvra 
^r.i m et iliacam pallioneni.s mo:toec flegma 
tc no ejciiicnre fe.vala bencdioa acuta ejt ber> 
jnodacuiie;vaaicgodion;rbeock):iam;ana* 



cardina.f £ ef ra fcfettcam podagra i cvra* 
gram fucais feniculi cum irrtUetecoqtiatur:* 
cum tali tnellc tcnf.5.q .btrmodaci M>:u.?.*. f 4 
feminiefeniculi a natelectuariumqt.od troi 
rebenedicrcpottft fumi <ff£ t nota q in tolts 
trx bct poni vncic tne vel frce bcnrcdacrili. 
e^^ontra ^liacam paflionc fiatfccoctio met 
Ussdditaaquanceicuratunetncmclacanct 
e% flto melle addif ie.j.tj .bermodact ili et cyna^ 
momix>eturpulni8t>ermodactili:fupcrfluam 
caincmcoa-odit. 

f ^ulttie citte confioarur cufapone galltco: 
ct licinium intinau filitif.tmponat aiampul* 
meciueaaifoXonficiaf cu attq mdlkina cc 
nbritconfottanre.^tfiKcllutsc bombacc in> 
rincramnarifcfiimmittur cacbaim confotf 
t at:ct poltpum coirodit. 
f^oljancemcfuc^olutonccducttflcgma 
groiium:? a iunctur^p:ie.acft mcdicina maJ 
gnaartcticeapodragefumpws^cafbapla^ 
m atU8:i|p:ia cu farina o:dci. 
f ^.mrctlisouoaiautmtcapams pinguts 
avi[cllieoui.cfvfueeiusimpinguatco:pue: 
i augncmumcfricitin fpctmarc. 
f tt efi medicina bona vulncrifo.flbl?ringft 
ctn fo:dee coui acolumit cai ncsputridasin. 
eie.Dofieciuedt abaurco vnovfcpad&uas 
K onicruatur autper aunos trce. 




iBfiJtrbt© 



^L-^ ermcrocaUce.iMarca.ttocrmerocal* 
•jf A iesad eft pianra vt bulbusemaricos 4 
^* Ci manducaf .fructus cius e ficut narrif? 

cuoiwTcrcnsabcomfioictltu.fO^^» 
bcrmerocaUe8,23ermcrocalleeautcatbalcp 
rcn vclutbulto einaticuo.^olia babetr bafta 
fimilcli(io:ininitio cuinccpcrit aeircflo:c8lt 
Iu>ftendittre6velquaftuo::fedpoftq3fio:tt* 
crit viridcmfacit colo:embonu ?odo:atu.*Ra 
dijcqusinmagnttum'nefimili6eftbulbo:fed 
paulomaio:. 

€>ptrattont0 

f£>yaf.:*3ec fibibitafucrit:bumo:cm fo:dtf 
dum matricisejcdudir. f :£>enftrui8 [perat . 
^blia ciuscatbaplafmatibusadbibita cobu* 

Ifconitomcdicawf. 




5buu ciug % flo!ce buida ct non ttca qH pof 
nunf fug cmpcttginc et pannu cicpellir cos-r rc 
foluut ocmfuBfluitatc.f £t puenit babemtto 
catarrii:ct mirigat x>o\oie capitis illie q fut fri 
gidecdplecioi8.C£toleu dueeft iuuatiuum 
in bvcmcet fibne calida cople]cionc:odo:et ni 
mwscipfocueftviridis.f jfdem&ben m# 
fuav.Confertbumfditaribuset flegmati faV/ 
foettenitofrigide eoplqcionitoet confcrttx» 
lo:itoiimcturara.fRemouctlOqlam amif* 
fam.tptcrapoplcjcuvfparalifiminpotttfum 
pmm ciuo fuccue auriu.i.vd.q. 



Capttulum.tcflmt). 

^L-t £rba parau'fi8/fblarca.£5erba para* 
j| 1 liumfuic bcrba fancri pctri fiuc parali 
*»* uricaftticartcticajqueomniaidcmfunt 
et eftbctbacuiuefolia fio:crc incipiunt tege 
bYCmi8:qfccjctcnduntintcrraquaficitrinavt 
ali8fagu8.floKmcttrinu < pfcrtca.cftctfic.co; 
plcaotus. 

^ptrattontg 

^Pfaf^ccberba7olo:fomedcfmcb:o:0| 




Capim!um.rtj^o 

^U v £rbagralfnla3cto:.t5aba grafiW 
*1| llacberbaiocquainucnif !maib:2 m0 
**■» i- no:.£tmino: eftvermiailaris.fcc qua 
babef in ca.vcrmicularis inferme t>e a.^£>a 
to:cft berba bns folia tenera ct pingttiarin q> 
rumfupeiftciccbo:ra 

t^ptrarionta 

f Oalet p ignie arfurae.fuccue ctus curat ra 
miccpucrorii.fSfiaccipianffoIiagraffulez 
cimcoliuaructteranffubtitrcuajcungiapo^ 
rircccnti.etcicpmafpcrpcril.ibuaafcumodi 
co vino albo quitoadmifceaf mafticct oliba 
num:ctpoftcavnsamr. 



tfatmw 



S6 




^\ £rba fencl3.etel:>ert>afubriiitofolrr3 
jj fi filie berbe cj roeaf abioranu plenafe? 
""^ C minitofimilatibc» fanfo liib:ico:u. fa? 
po:a i ;$gicad;amaritudineHoaua5:§uioo? 
doj^fapozeWcamar^cualiqfairedtczftipti 
citatepauca.-zecalidwabfintbioj-it^bilio? 
ab:otano. 

jE>ptrattom0 

€ £ft mali ftomacbo ;et daudit oriftcia vena 
m mat r icisfic cv catba pla fmara fup:a Vcrre 
caltda.f £onftringir fanguince-jceunte poft 
paml:ct t gc menftruandi. 

Capttumm.rrjfjEOi% 

tl^ ^rftdina fiuebarundina.2lcfo:.i?a 
*J •mndinsanpomtOfi.inter arbo:ee. ct 
^ 9 <* boc(vt vidcf )#>ter qfda fpeciales qrii 
t anta cralfimdo z magnif udo efie <6z: vt ejc il* 
lio naucs ct cdificia fabnccnf.pecctciis autc 
t>tcm c apud Ufi.inter bcrbaeocculrae.etw? 
tcr fatiuaG.faiec.in epfa ad 3 t ilto^oft vr 
cto:ia nf am , oe • P a rio rcgcpbrenta :accepr is 
centucincisinta ©ucito indo? :q teeuitates it i$ 
neru notterincu p.geremue prerflumeapparu 
ir.cmue ripa barudo pcdu fccagcnu vcfciebat 
pt ,m a bicruqj viticens in crai wudiuc robc* 




ra.eaq5indivtunf adcdifi'cia.aqua vero flu* 
minieguftu dkbow amario:erar.qua nec bo 
biberenccpecue etiafine to:mcnto potcrar* 
ipeinde vidimuebotee nauiculteper fiumen 
vebi rorundie c]cbaninch'nc:c\ nobie ondcrut 
Tbitmleemaqua poffcmueinuenire. 

l^prrarionre 

<Ti^lm<Ji.r^i.l>arucU'nee^atuferictinfcr 
aqticoe fruticee frigidiega udenree.Belli pa 
dfc^apmneti^nccelTariefunfmfcBeriajinte 
ticrje grare.£>ie cni o:ietalee populi bella co 
fiCHint t>ii fpicula calamie addfit f 'Rullue at 
(agirtie aptto: e caJamue crj in t beno £ono* 
mcnfiamnecuipl'imaincftmcdulla:pondu8 
cfc volucre.£6tra flarueq) paruicajclib:a.cip 
pe non eadem grat ia belgicis 
<|£?a:cftcrerici8 ccmaidattonito,c|c| p«fe 
ranf indi.q>u alia quibufda^ vidcf narura :qii 
a baftaru vicepubent addiriecufpidito.^a 
rundot>cniqjindica arbo:eabab5 smpltfudi 
ncimqlie videf in teplie.^ olia vero b:euia .na 
uigouicB viccm p:eftar ( fi creditnuejmtemo f 
diafingulaif1bli.li.icvti.3llaquenafcimrin 
3udia etfvria odo:u vngueromcf caufa.ari 
nammouetcumgramincvclaprj forfinetie* 
cocta jnen/iruacpcirat mom . f £>vdropifi 
IKodcftacfulTiaiam futTiru. 



a 



25 



Btfynbw 





Capituhmurmifit; 

Ofquiam9.3fi&3ufo;a 
mtteebcrbaficagrccie 
I appellata^alatinieber 
bacaliculartt5::coc?ca 
liculi riSin figura dcaro 
rfinafcafvttmalipuni 
ci.c\m o:a fctrata fir bn^ 
reetntrinfecSfcmiapa* 
pauerie fftta.:toec berba e infana. vocaf co cf 
vftte eiue giculofue cVoem'03 fi bibaf vcl cdaf 
fnfania facitvel fomniimaginc tut bida £iaf. 
fm tranftatione nfam a .t>c 3uf$ amo. 3uf 
quiamuefrutej: cftpamuebaftajbabce grof 
fio^etfolta lata et oblonga fciuifamigra i af 
pera.urtta cuiue baftae fut capita plena femi 
ne.S>ed 3nfqutamim'a funtgencra.vnum 
pu rpureum fl o:cm babcne:et femeit nigrum : 
folliculoe t>uroe % fpinofoe.3 Itcrfi vcro flo* 
reemelltnosbj-zfolliculoemolke.fcmeobm 
fu? ficut aifm6.abe£o iftc mania pftat t nari> 
coticcfif ? min9vfualeeXertiuto gen9e cu* 
iii8 vfuefirccintaf.folia b3pingiria ?mollia:et 
cbili,fucd plena:flo:ee alboe tt femciralbum 
.pferene/Bafcif in locie maririmie? in ripie.fe 
menvcrovrikeftalbum:quodmin9fiinuetu 
fiKritrurumfceundaf.TJigrumveroinutilee 
fcmenciusec fouaetfccanfcbafta ipfiuetuu 



- fa ct a p:efia .rfcfc faccw m foJe fta cTt:e rfr. 
q: vtiliccft viuifoftamul.fiituncitie ffccii itt 
calida miffum niudificjcpjinuf.cftvcro fnc? 
cus mclio: viridie $ ficcue.2£ulrivaofari 
nc rri tfccc fuccum ciuc a dmijcti! m factie troctf 
cie rcponunt.i6at:vit].finT.far.caxe ^ufquia 
mo rm tranflationc arabica.3ufquiam9cu^ 
iue fcme nigrfi cxt fignfi fup, boc q> fit fcmeni 
grineft cy floeriue $gitat> rubedine. facit ma 
ma i fubetb.3Ucf?o cmus feme fubrufuj cft: 
cognofofinboccffloeeiuecatrinue.ete.p? 
pinquue p mo in virtute. ct xptcr boc opo:ret 
<p caueaf ab bie ambatofpecicte:? no vratm* 
qe eie; q:no cft iuuamctfi incie:fedoccidunc 
Jufquiamueverobab enefemenalbflet fio? 
rem albu.eftcouenienev(uimedicine.<tcft in 
tmio gradufri.et u'c.Tn.n 

0pfrat!ont0 

f £> Yafc.Utilte eft luccne fcmfni viri in volu 3 - 

tarioX onfcerionite rolliriow mittue rcuma 

vifcfdu tcaliducopefcit 

f poIo:e aurifi mitigat.Sfericascaufaemc 3 

dcndo copefcir.mittue polcnte. vel vt carba? 

plafma adbibitusffio:es fpargft. 

f Skmeeiueoia filrfacerenouit jnajtfetuf? £ 

fienritefubuenit z carbarrfi foluit.reuma ocu? 

loritettolo:e;c6pefcit.obulovno cfifemine 

miconis ct mulfa mijctne ct bibirue fiuuiima* 

mueetfanguincretiaentiteopitulaf. 

f Scmeriuefolum podagricie aujtilifivmo f> 

mirru et catbaplafmarite adbibitu; tumo:cm 

teftium et mammaromfoluir. 

f^ult$aujecatbaplafinariteneceffaribmif 

ccf.foliaei9marimealpolentamicracrin ea* £ 

tbaplafmatite adbibita tolo:e tolluncu vino 

bibitaautqtcrfcb^eempialaepwbibet. 

f £octa ficutoluectcomefta ftarim mamaj 4 

faciuntVRadijc eiue cocta in acao tolo:e t»e 

rium o:i rcrenta mitigat. g 

CapifuIum.ttjErijE 

-w-tmipcrue.3fi .3unipcruegrcre ticfa 
|k cft.fineq: ab amplo in anguliii finit. fi^ 
-*- ue co cr pccptfi igne t»iu f encat .it a (i piu 
ncejcciuccinere coopcrtefuerintvfcp ad anf 
num pcrucmant.-jbii eiffm ^rcccAd cfi ignis 
latine.3unfperueaurcm alia parua cft.alia 
magna.-^li4i.jLrj.lS«pcri8granu:aiiue arbor 
in 3talia nafcitur.3unipcribaccie mirevtm 
frabcntifoadulteranf.Srera.lUg.ca.balbi^ 
balacb.i.fumpcnie cft vna et fpecieto ap:efTi 
mafcu li.j£ t oee funtcjtfuo: fpectee.z ffit iuni 
pet9ctfcabel,i,fauina ct jabi etgara4.ittnip€ 
uu 



fCtm&tw 




Ttisq notaf arcona&Eftejeca alia magtia:a^ 
1iaparua.ab5fructuque"da:cuiu8 fructus eft 
magnue ficut "Habaeb.i in Ifa babel Dicitfi^ 
cutjaro:.? cjdl citt'9fructu8eparuu8 ficut fa* 
bamiliq:ipeeronindii8tot96af.vi.fim.fan 
ca.?)ciunipero;Uirtu8arbo:$buiu8eca.tfic. 
fn;ii.0radu,f5calidita8ipin8 fructuse fmf?. 
fedfica'ta8ei9cin£na'pio terttj.£tide £>e? 
fa.£> auinaeilla q &Macbo8ft'ueb:acbeo8 
cnonbsfructu.-znosoeillaioicemusmcapii 
£?auina,infra t>e s,S» ed jcrbin e illa qne si* 
dturpafcrae.etbabetfractufitcm fructui ci* 
p:eflunifiquia cminoico faris;j£t eet jcrbin 
paruafpinofa.ctfmctumftmilefructuiiunipc 
ri:cuiu6magnitudoeftficutgranu mirri.fcd 
crotundum.etvtrtusjcrbincft calida? fieca 
mXi.gradu.S»cd gara efpecies parua rcfpel 
ctu3«rbin.'^)cmo;iaeiu6vcnictuica.lauru8 

0ptrattont0 

f &rcbeuto8 fiue Srconoe.^unipmtsma^ 
gna et parua.ambe caUfaciut % fubtiliant.et 
^uocat vrina.£t qn fit.fumtgatio cit eis ejcpel 
lit venenofa repriua.j£tbabet fructusjcuiua 
c\da rcpcrtf inmagnitudme aucllanc:et Cjdam 
in magniradine fabcnift quia e rotundue : et 
b&aofoiebonfaeviAcisbwmtt atiqM 



tulu amarftudfnfsjf t>V9f.cfl.T>eUmipcrof5 
irKlarione greca.3unipcru8 arbo: alia e gua 
alia magna:fed utreq? acrioae funt ^tutia at 
<p mictualfe ct infenfibilts.f &uer.cinto col* 
ligct ca.se MnipCTo.^uniperusquevocatur 
abcl ca.e % ficjn.itj.gra.f •^aulus ca.fce #ntf 
ce J3umi ipfiuearborie e vcrnir. 
f3te^Yaf.£ram'8impofttefamt'gfo:ferpe 
tce fugant.fruet9 cius iocudus e et odorie W 
mifi in o:e tctincf.t cuftomacbus e.ct co:aci 
vtiliseft.tufltmfedat.focntre-zinflationes 
fedat.to:tionttoclcp bibita fubuenit.£ontra 
venenapftat auicuw.trturctfciicftiUi adiutou' 
um.Sfpafmaritoct reumatitop:odcft 
f OrTocatioee fterica8toUit.Bppellaf autcj 
agrecj8arcbioride8.fuccu8ciu8 medef vipe* 
ra vccat^f ^ucc9ciu8C|cuftu8 atcpeu aq illi 
nttu6lep:at>efpuit.£UmarioftU'gm'eiuepo* 
fuit>ataintcrficit.Xacb:tm9eiu8 potui fcaf 
ni8 tuflim:vcntre atcpperotidae fanat; 
f 21 ucr: abel^uocatvrinasmenftrua plus 
oiialiarct>onccfacitmingercfanguine.£tfa^ 
cit abo:fu5?ertrabit fetu momul.^ro ifla fpe 
aelege £5auinaminfrafcee« 




i ttiube.auicen.U'ju.3uiubc4nc!io:cs 
funt4naioa»earofr^iacfuntinfmo 



Btll&txbte 



equatcs fn (iccitttc z bumtdit ate.et ftmt t>ccli 
ltantcsp^imadbumiditafcn^ctnutrimew 
tum earii et •oigcftio fimtsiftkflia.ctfermo cj 
dcm in cisbonuseillequanoiut £>aiienu8. 
"Ron repmiuiubae in confcnmda vamtate 
ctjemoucitda cgrimdinc aliquid opcranfeo. 
fed rcpcri eas nifftcilis tigdhoiscr paucinu* 
mmcnti. 

C&uiccmia.£onfert acuitati fanguiniscaltf 
duct extimo q> illud cft ppterea cp jngroifanc 
fanguincet vifcofum faciuncipfum 
€£tilloatoctimarioqt}iputant<p ipfc dartf 
ficattfauguincmct lauent awn.eftejtrimaito 
comtpta adquam cgo non*oecltno 
f 3dem £onfcrunt pectorict pulmoni.S»ut 
maliftomacbo t>ifficilis T>igeftionis.cicttmant 
quidam cp confcrunt fcoloa rcnit % vehcc. 




€aptmIum.tt]Eje#. 

-^mcus.Sera&aggrfcca.Dis.attcM 
; jP Dfafccaidt0.Di8:idcfttuncue.eftbcr> 
H^ba cuiu8t>ucfuntfpccies.nna!ipfarum 
babct acutas fummitatestet ifta etiam fpeci? 
cs fimilitcr tnuiditur in tmas, quia eic ca e\\ q 
tton babet fructum.&lia eftquebabet fructti 

groffio: cpcanna altcriu8.et eft tcrtta fpccies 
qucbabetcannam;groffio:emadbuc ct ma* 
gWannofamq$fup:adictet>uefpea'es.ct'bii 
iusfpccicifructusquicft in fummitatitocius 
cftfi mflfe fiwtuiumci fup?adict«&rum fperum 



^prratiottis 

fjjde aucro.j5alicni.:bnfuc bcrbc funt tne 
fpeacs.vna earuj cft fubri tio: et ©urib: .1 a tia 
groffio:'et mcltb:. f irocr us buiUs fccunde 
fpecici facit oomiire.fcd fpecics pma eft fimili 
rcriOuarumfpccicrum.Onaquenonfacitfru^ 
ctum ct non cft in ea uutamctu aliquod iu mc 
dicina et alia facit fmcnw faat fomrtomift qz 
cft^cbilio^cppMma.etiftafpcciesfacitfodaj 
f Erfubftanriaiftarnm fcuarum fpcckrum 
cft copofita ejd fcrrca patica fngida paucc fitf> 
gidita tis:ctfnbftaiitia aquofa ea.paueecaltf 
dttatis.etfceficcatmnfrigidatteftnarcorica 
f £t©ue funt fpcsqrt affant urm ignc^ fumit 
tur in potudtringuntvcntrctzabfcinduntiW 
fluitatan mmft ruomVz tscfiecant qo* t>efcertf 
dit a bumoJito adpartes Maioi&n 




Capitulunurj$jEft 

-^rXadaica.pYaf.cap.bicrob.i.3udaicai 
«• ct eft feerba potrecta virgultis vlf ra cu* 
^^bitum.gcniculofiscufolijepintcruatla 
©iftanritotancp queratsincifib etfubalbidia 
Oiresbabet acres etmictuales» 

lE»pfrationf0 



© 



ttmmw 



adferpcnrie mo:fnm ct aranearu cr rabidi ca 

nfeXalculueqepeUif. 
» f ydropicoe fanar;vukiera reccnf fa fugpoftf 

ta curat.facit ad eos q indurat as vcnae bnt 
£> f £ tcibu etjciunt p:opter parotidas ftrumaf 

coUo Ugatur 
P f ycferico8fanaf.5.i.e]cfuccofoIio:u^nardi 

.5aiq.etpaululiimYrrbeeicaquafciafi8.iq.po^ 

tuisata .radieem buiue quifecum babuerit a 

erpenterutuserit. 




CapttulunurwJEitr* 

-«-'Rcenfaria. pvafcoudee.^ncenfaria 
JUberba cftfactaficutamofilolTa.fcd afs> 
— *-pera z fupcr rerram fpanfa. cuins odo: 
cficutodonburis babcne in coliie aUquate 
pilofitat c5:ct albcdinc ficut cnuia.£t folia ba 
bcnt fo:mam aliquaUrcr couiie nafcent ia . 

BpmtmtB 

fpvafco.pcftccatbumidifatempecto:t8:et 

confo:tatncruoe 

f£tvaletadco:i5am; 




•^l^dtcuc.Scfa.lib.aggre, cap.TCilccb 
'jjj* auc.t vaf.£lt t>eipfo tiomefitcue': fity 
"■^-ucftrie.ftfcomefticueaUequo rincto? 
rce vrunf.£ uius foliti cft fimile folio plantagi 
nie:mfi quia eft magis vifcofum i fo:rio:ie ni 
grcdinie.et babet ii^ite longitudinietoacbij 
vniue.£> cd agreffts affirnilaf someftico. ni 
fi q: foltuciue eft magie fimflefolio lactuec:ct 
babetramulostegospluresgracflcscu mul 
tis rarrrofcuU'e:quo:u colo: tendit ad rubedi* 
nem:ct in fummifaribusramout funr vagino 
lc mttlre fimitce Unguie.£f cft in m fcmeu . et 
babet P o:em pantum fubrilem.£ t idem auc. 
0af.p omefticue cftillequo vtunf tinctoKs 
fapo: cuts eft a martte: ftipticit8:cf virrus ci9 
cft q fceftccat fcfcriter (inc acumine. f £t idem 
auc.Sloefme.fcftatbufttmiptiUicrulenfu: clc 
uafurq5cuftipitefuo longirudincvnius b:a? 
cbtj^bjgcrmina ramomOnfumitate fuae 
flos (iojt floe coriadri:? ficeaf ctrerif : ct ponif 
turcumalcanna.t?icuutquidam cp acblcm 
.i.indicu8 «ft arbo: nilet cbar ieia nefme funt 
idem.£t idcm aucfoOfaacbenaramalearet 
ncfmefunt idc.£t eft balbac:z eftplanta bna 
foku longum plue c$ fbUft faUcie.£t affrmilaf 
foltefafcoiicobasquafiaurcufedmamscft 
ct eft caUdii ct ficcum? ft&ricura 



£apitulum.f$fttii) iE>ptrarionf0 



fetfytxbte 



f £>cr a .atK.£aF.X3it i tue indtci ihcarnat-r r* 
foluit z coglurinarvleera q funt in eo:po:ibue 
t>uri8.etiam fi fucrinr in capirito mafculom.-r 
flbfdndit flurfi fanguinie ct cillb luit i minuit 
flparamoUia.aconfertvlccnb?purrtdi8?for 
rofiut&.f 3de auct.pYaf,£m#aftrii cusfo* 
Iqs ciuo confcrt apollematib? cr vlccrito. 'fia 
in pztncipio ipo:u conglurina t ca fua calidit a? 
tc ct abfcindu flunt fanguinis.f j£ r curat fot 
micamtbcrifipil4.j£tagrc(h8fo:tio:lc^tu^ 
tto. i cofcrt fpkrtcrirte qn bibif <a fit cmpJm cn 
t04t iuuatplus^pjimuej 




f^aptfl©3ropnecllbcri)abiirr!tit8JC?lefa^ 
cir et flcgma t>eduet'r.rtu8 redictto ribil foai9 
i pcncrrebilius inrer fare.f $larcariu6.£ c'/ 
tra ruflimfrigidavalctvinu tecoaioniseiub 
ttficuuliecaru.adidcm vaktdccrusnu qr5 iit 
cr ca fc? ecifopo.f &uiccn.3fopu8 alia cme» 
rana*aiTao:tiuacalida crficca intcm'o.cr cft 
fubrilie ficur origanifcjbotue riue calo:cm bo 
nufacir.erciu8gumeravcRigiainfacicabftcr 
girXum vinobibira rcfoluirapoficmara t>n 
ra.f £onfcrr pccrorier pulmoni paticnribus 
tiflurriam ct ruflt anriquc. ©olucd o atttedu 
rit flegma ct afcarideeet vermce.f Ualetcril 
Iplcni ct vdropifi.cccoctio ciuscu acero aotf 
imUefedatfcolo:etcntu>.£tvapo:tKcoaio 
l»ie'cu ftdefofcrt fonirtii aurie. £t ipfa otam 
coctafitemplaftru^rarfari-zfianguinimomio 
fub palpcb:a.f £6(1 anttnue.^fopus cali.cft 
ct ficm tcrtio gra .Sntccus rius ciitKub? co£ 
cru8:ctmdlectruta btbitvapoflemata puln o 
rusanbclifus ct tiuriciesfufiim ct caprrum 
ad gulafceeapire ©cfcendcnrem curar.lumb:i 
coe occidit 3po5ima aim mcllc groflbs fcilo 
rcefciflbluit. f Ddcm.^icumficutoficae 
vtatur:ct vcnrrcbumccrarcrcutcm darificat 
£ um accto f octa fioe rm abluaf:eic ca tolo^ 
t>cnriii ampurar>aurico indcfumigarietolo? 
rcmafonirumplacar. 

f "Rafte.Dfopus vroriganii valcr^ccruet 
pulmoncmpurgar.3fmattquocri i tufii anti 
queconfcrr.5kgmartVcrmcecfo:po:ecdu* 
cit.f -p>lini.Ii.ia:vi.3 fopi cincp rami cu t uoto 
rure ac xicie rribus serocre rora cc5 purgar. 
f 3rcrum,3 fopi fafciculuecum quadranrc 
mdlieat) tufiimsecoquitur. 



■•& 



C8pitulum.tr«f)EU 

-<■- Sfopuc.-^latcaii'u8.3fopu8 cft calid* 
r Jw % (icc9 in .irj .gra.tlirrure babet tm folia 
HP»-etflo:e8:nonfmradice.3n cflare cum 
rTo:c8p:oduntcoWgif«nvmb:ofoanonfu0 
mofo loco fufpendif ct ©eficca&in medicinis 
abiect ie fiipirito rl o:ee % folia ponunf :p annii 
feruanf .virtutc babcr t>iurericam sifTolucndi 
attrabendi:confumcndi. 

©ptrarionrg 

& f 3lt.3fop9 cbcrba purgadie pulmonibue 
apra.XJninvcrcriteftamcnto afp.gcbanfcum 
fafdculieifopio, agra fanguicvotcbanr mun 
cUri, ttafctf in petris bcrcne fajco radicib* 




5 



» 



% 



Ctartams 



■& 



» 



(fapituluttKffjEjrsuK 

«-r-Sropnm bumidii. fctafco.ca.*e vfo* 
1L po bumido f m rraflatione- nofira.yfof 
*JL oi ccroru cft qfi fordce.i fuecuelanaru 
fuccidarii que boc modo coiUgif . Zanc fuca 
dc?fo:diftimcmoicfcaunfemittunfinvaea* 
qua ca lida fcuett lic acccndif ignie vt aliquid 
faucantcindc rcfrigaaf. i ofi fupnaraucrit 
fn rnodu pingue dihic flbtadif manu n vae fta 
neu ab ftagifa fic ipm vae rcplef pluuiah a q 
-z coopcrrii rcnui lintbco ad folebtduo ponif. 
cr itc tmio t>ic aqua tdtmpidaf t rcponitur. 
adulrcrarurcii pinguedinc acaa.fjinfelltf 
gcf q- fincqi odo:e lano fuecid0eruar.£>aa . 
lt.aggrc.eap\£tfaraftab.£teftpinguedocj 
cft in lana.que fit in biiemodu. Sccipe lana^ 
fuccida vcl molle:ct laua cam cum aqua caU* 
<ia:crinfolecalido.ct c)tpJimc rotuquod ica 
dtcclotde/iponcfo^dicieiUa invafc babctc 
orificium lartKct p:otjce fupcr cam aqui infun 
dcne ab alt o ctl impctu vt fpuma faciat. pc* 
tndeagtra agitarionc fo:rivt multam faciat 
fpumam fuper aquam abftcrge aqua marina 
cumimpctut)onccfpumafcdctttromnino:rt 
funcrolleptnguedinem fupcrnatantc:? poney 
invafercrrcoJoeindeproqcc ivafc itc? aqul 
aUanuagita ficutfccifiipamo.etp:oqccfuBf 
fpiimariueaquammarina:? t>w\itte fedari 
fpumi i colUgc eam.j£t faeiae boc qnoricne 
fpumam vidcrie.tidndeacdpc pinguedincm 
quamaggrcgaflnmalacaeameum manib9 
H r fi aliqua tn cie inueniee fo:de:ettrabe ipa ? 
aqua agtrandoXt faciae boc toriene fconec 
vidcae ipfam albam-z puram pigucdincm u> 
ncadmijirioncaUcuiuerri.': cumboc feccris 
poneinvafeterrco i ferua. 

^iScra.'^bclio:c]c vfopo bumido cft illud 
quod cft molle quado rangitur finc afpcritate 
babce odo:c lane fucridi £t qn tiuToluif non 
9 iparcr ibi aliqua grotnciee ficut in adultcra 
ra.j£tvtrt i ;buiu6dkaltfaaiua:moUincariua 
vlcerii indurato?.-: p:op:ie viccrum matrkie 
quando mifcerurciimmellectbutiro. 
f £t quando fit fi>n?ofiro:ium cumco jwo 'j 
cat menfirua % cjipcUit feriim •: fccundinam. 
£tquandomifcetur ctimfcpc anatie ccfert 
vlccribue ani i vlccrtbue virges tcfiiculo :u ct 
crifienttbue circa loco illa. 
\ %i confctt p:uririui lacrimaUu oculi t grcf 
ficiceipalpcb:arum.£t f onitur invafenouo 
fup:a lencm igncri t iminif toncc vcniaf pin 
eucdociue:afiatcuiie.cteft conucnune ctf 



nieiricoUtrijertmcclicinif-ecnlo?i ; r 
f ^tcofertmotfttovcnc^ofieinupiivcmfi 
anriquotvlcmtointdiinottl. ' ' 
«£t abfcinditfttttu mcnfiruoai:et &tflouift 
fanguincmcongclatuminliomacbo.aquan 
do fumif inporamnndificatvlccra potoMcet 

f£tquando mifcaurcumbutHio tfirnafca» 

lc cum co poft mundificadoncm matriae;?4> 

bibetimp:cgnationcm. 

f £t qnt>fltur in potu muUerib poft partura 

facitcaeadbupacadimpwgnationcc 




CapituIum.ftjE]EjH)it 

SrabcfMaf eariUe.^fcarflbc cft gum 

mi arborie vtgcirma vndc annulifi* 

h unr.ttndfckctrum.fnccinujKarabe 

fub codc5ponunf.quia clccrru e kara 

bcrfuccinucKarabctindc b£bcmM'n Zllej;. 

ca.tjctiftintcria rroctfcie tYalecrrum ^rcn» 

*Scruiue fupcrbucolKonUtrgitti in egloga 

pafio:te'tiicit.cr dcctrum cft j oft fuccinum» * 

3tcm cafiiuefcUjctractatutictrocifcie ticit 

Zxociic oe t»c fuccino ct efi dccrrum:et tefai 

bir trocifeoe t>c"Karabc. jEfiaurcm gummi 

arbo:iet>icrc&Yafagrioe.s cftfpcctce popuU 



&t$)ttbte 



arbo:ie.vt pafetinillo capitulo agiros.vcraj 
aUndfaatcapirolut>epopulot>iucrfefpcciei 
flbitlo.Butccn.lib«n.©cco9Mofafitcapitijla 
Xjnumt>ebauro:au confonat capitulum t>c 
popnlo arbo:e.Bliud t>ebatiro romano cui 
confonat capinilumtJc agiroe.quod eria? cjc 
ponit p vafeottdce er eft populue arbo:.3 ui 
ccna tn'citcreitacbirofa:vole8 tsicereagiroa 
fcd in arabico eft acbiroe euiue giimi vt ©ic i t 
atticen.eft karabc.£r ©iafcoridee t>icit cr ct 
bac arbo« fuccinu nafctf f m quofda.i in rbo 
dattumdiftillat.etipm eftelectrihvt oftcnfuj 
dtTup:a.Dueergovidcnf efle fpeciee buius 
arbo:ie.£inacalide ccmplcj:ionie.BUa frigi 
dc.fiattp.Vtruo3fcictucol!igif.fauicconaIi 
b:o t>evirrtx>eo:diekarabc.caUda eftinpmo 
ficcain fc?5o.alicl volunto;fitfrigida.-^aul9 
•ekarabelwabeeftgumiarbo:iebaurro* 
mani.-z calefaatcaUdifatetemperara cttj pau 
cafrigiditafe.*6uleafim cben aban ajarin.U^ 
b:o:qui©icifurferuito:karabeficaflaf2?b« 
ritur.Opo:tet cyfrangae karabcin fractutia 
paruisfaflUvnaviceveltwatoaferuaisj 
cobuftio a'9 cft in bunc modu.&ccipe olla xv, 
crilem .ct pone karabe intus er daude os ciu& 
culuto.iponcitttgnevnanocfc.t>eindcejLtra 
ber<vfere:etrere. 

Bpmtiomo 

f S utcenna.;&abet p:op:i«tatcm confo:t an 

di co: ex letificandi ct repellcndi cardiacam: ct 

fonificandifpus 

f £?erapion.fcarabefumuur inpotu et ptot 

bibctcurfum bumidtrarum ad ftomacbum.-z 

abfiringit ventrcm ct ftomacbum .ct cofo:t u 

cum.etabfcinditfiu]iufanguini8.£tquando 

coitc% btttus arborie inciditur minurim:ct \c't 

minatur;inletamine:o;t'uturibi intofo anno 

fungiadcomcdendum. 

f *»>aulU8.*iNarabecftgummiarbo:ie baur 

romani quod quando bibtf rainet fiuuim vc 

trie ct ffomacbt .*et fanguinejvndccuqj fluetc 

^tputantqutdamcpfitfandaraca.-zticunc 

cr karabe fodoma buiue cft gummi .? eft gu* 

mimneriseocrlatiuiponcbantipfujfup. co: 

po:at>efuncto:tim, 

fEridcmaucrotttateBlbnbcrigXaUdirae 

eius cft t cmpcrata cum pauca hi&ditate.? ba 

bap:op:iefatem rennettdifanguitjcm et p;o? 

p;ieintatafmone.j£tcottfertcardiace^ lirin 

tntvcntrcm, 

f£tidcmaucto.bcgde;ftcu*abccalidacft et 

rerinet fanguine vndeeuq3 flucnrem. 

f fctidcm auctoutafeaicaji. S> ufpenditur 

lup.apoftcmaetconferr.crdtfrigida.£t<on 



fert eardiace et fputofangutnie: tflujari otts 
anaribus 

fSUaeffurceinuenicsintraaaturelapidi f> 
bu8pwaofietiKa.0argate8. 




€8pifuIum.ff]E]EjHitr) 

Slcndula.^liniuecapitulo kalendtt 
k la cft bcrba cut9 fiipce plurimoebabj 

ramoe^ olia c itie funt fimiUa foltje co 
nt?t maioris fcd anguftiow ct pinguto:a cum 
flUquaU vifcofi tate a odo;e graui:vel vt coni 
ja.^loeaue aur^fuafirailis eftaurigaiive! 
buralmoe.fcmina ciuecg pUtrima o:dinarim 
pofiraincapituloqtiodam babcnria foanaj 
co:niaiIouim:ctt'pfa fcminafunt pilofaaUqlc 
cer.£ftcaUdcauccccomplenoni8, 

^pfrationra 

f tlirrut cm babct ftringend4:confo;tanfi: et 

t>eficcandi: 

f £ ontra t>olo:cm ? cntiu j puluie U inuolua 

t tirin bombice et t>cnrtbu8 applicetunlrat im 

fcolovclTar.fimilircr naribue inrromifla ver* 

mcmqui cftin&enrcocadir. 

f £onrra rofMlaepcdum valrtfomcmum qc 

cafactum. 

P 



£mmw 




fbiumvnum.ptenuefoliie.tfhi«ueduspcfi 
ticusXJecUnans ad amai itudinc.ct colo: cina 
t>eclinatadrubed(ne\£tidcmpoftepcongrc| 
gauiinfcrfcrmonan0Yafco:idi6cto.ilicni 
fupcr omncm bcrbam inucni;# £>alunuend 
tucmo:auitmirtumagreftcm.£ t £vafco:tf 
deenonmcmo:auitTU5bcbae.£t vidi cp ©e* 
fcriptio 0aliemfuper"Kubtba6 rfttdcripti» 
pYafcortcfefupcrmirtumagrcftcm., 

©prrattonr0 

f £>cra ioemeeiue bibitu vrina,puoe3t:me 

ftrui8impcrat.calculo6veficcfrangir.^ 

^f ycrericie et cepbilargicfe mcdiaf /Kadiie 

cius ann viridie cft a mulrie p:o fparago co^ 

medirur .que amara cft et ©iurcrica. 

<tf£r idcm aucro:ira te 0aUcni,£ft medicina 

fimiu'8 m.in fapo:e ct virtutcnifi quia eft fub» 

riUo:.muIruideo fit aperitiua opcrationum q 

funtinco:po:erofo; 

f £r pwuocar vrinamtet mundificat reoeea: 

lapidc quigencrarurineie.£rcftbona gutf 

turixtftringitventrcm. 

$ IbauluecapitulcoeKubcbal^ubcbavaf 

let conrra rrigidum reuma.? confouat ccrcb? 

itcurarapopler,iam. 



Capirulum.tf*pE. 

Obube.^luca^cKubube:£)t:ci8fuC 
k x>omcfticcetftlucftree.©unt «fn fru* 
• ctue cuiufdi arbo:isinpartib?3ndie 
nafccntce.Etfunt triii generii.Santcnim fil 
tjeftre6quefuntmino:c8.ctfuntfapo:i8acu^ 
ti ficut piPcr.ct ftmt gcauceintue plcncbuuis 
ftipme.^untcria5flltiefupciio:itefil«£rirc8 
m>i io:es pondcrofe fifr et ptcuca mari fapo:ia 
fupcrio:ibii8 melio:e8.£> ut alic quefunt ©o 
mdliecommte p:cdictie l3iidabilio:c8.3nte 
riiseinance Uiueponderte l6gifh'pitl:modice 
amaritudinie.3n fumirarebaberee planicie 
aliqttaiTvbioiungifftipiticocauitaseftqda?, 
oi mafiieaf fumoftrascjdamcuapowbilie «d 
<ertb:ii afecdirXu fimplicirer ponififta inrel? 
"Ugirur.airrus eft tn folqserin feminc ciusea* 
Kdc ct ficce rcmperatc. f Scrapion U. aggm 
c.kububcc.*Kubube plata bnsfoUa mirtc x>o 
mctticcMi quia funt tatio:a cis.ct fummira? , 
K8co:ufuntac«te:ficutfummifafe8 lanccc. 
£t baber frucrii rorundu 9liqntuUifcep:ciTu5 
ctlarora.jhueffolia ciuo rcpertunuquod qii 
mar urarur vergir ad rubcdinem intcr ipfum z 
granuri iangulu.tbjramuloe ftfce ramis pla 
tcoicrc laroe:cgredicntcs ab vna radicc ficuc 
iigfcllie.X5im'cilcfrangibai'e,lfgU8cirtitcrb«i 




a 



BtVjttbi* 



Capmilum. tt?l 

e, Sctuca.yuUXacfnca t{ 
wj cif co cp abundantia laetT, 
m cjcubcrct.feucf lactcnutric 
y teofcmiastplcr^cc-zivi 
M ri8veneri8vfumcocrcct. 
^■j ^ 4} f -f>larcariu8.Xacruca d 
■ bario? vfui compcrit fcme 
riuemedianc.qtffrigidfcdtip^berbaOudi* 
canf aut ab autozito omniil berba? ternpcra* 
ffllima.f 'f>a(ladi^ub:o fctfo mefejanuario 
lacmca fcrcnda cft.vel pecebzi.vr plata ctus 
dFebzuario trafFcraf ^tefcbzuario fcrifvtpof 
firapzilimefttrafferrc.S»ed ccrtucftci foro 
anno bcne ferufi locus fit letu8.ftcrcozatue.fr 
riguus.antecp pangaf radiceeciue refeccm9 
cqualiter.t liquido ftrno knantf.ur' q tampa 
ctc funtnudare lctameacciptaf.3matfolum 
ftibactu.pingue.bumidfiJterco:afu.fauice 
na in capittb X aouca.jEt fut ei9frce fpeciee. 
Una eft q voeaf lactuca agrefiie.qua grcci fa 
ralliam vocanrXuiue tYrfus in modu fecun* 
di eft.eteftfpecieefcarioleficut apparet iW/ 
dcm.Slia fpectee ©icif lactuca asint qua firiB 
fcire legc ca.jcjcjd? 3ncufa fup:a ?>e2l.£r aka 
fpecies qucoicit Xacr uca tonicfiica q omni 
bue cft nofa.se qua bic loquimur. £>alicnu8 
fejcro fimpli.far.cap.oc lactuca. f m traflario? 
nemgrccaXactucetiomcftice virtus cftqin 
frigidat i bumcctat ficutaqua noncictranec: 
fedficutaqualtagno£vdlacuna?:vtfonfa* 
narnm,£t ipfa elt que gcnerat fanguine bo* 
num.Xactuca agrdtiecft fimtketomdiiec: 
ritl i quia ftipite babet maio:c, i folia aue func 
albioza foltjscius i fubtilio:a i afpcrioza .£ t 
fapoz ciue eft amaru8:et clt in virtutetua fimt 
kspapaucrinigro. 

&ptxmom$. 

f foerapion li. aggrc.cap.£?akae.i.iaetuca 
Clirrue lactucctomdticeiftcj; pucnit apofte 
manto cakdie i berifipile.£ t femcriue qn bi 
bif abfcindit siltillatione bumiditat$ fpcrma 
tte .£ t puenit pollurioni que fit in fomnte. 
f £t idcm aucto:iratc jSalicni in kb.teribis 
Xactuca generatfangumembonu inftnebo 
tritatie.j£tcgo quidcm comcdcbam lactucas 
qn cram iuuenie: quia in ftomacbo mco ge? 
naabamrcolcra.ctficinfrigtdabamipfum. 
1 1 unc etiam poftcp fcnui comcdo cas eliicae. 
3deo quia non rcperio akquam bcrbam cum 
qna pofliim curarc vigtkae ficut cu ipfa . "Jbn 
md: vero quigeneratur.ejcea clt frigidue i b* 
roidu8.£tnccgeteaaccid«nocumenru ficut 



fjcalue olcribrrnonftringitvcntr2ncclajcati 

q:nonbabetftipticitate:necfalfcdfocmncq} 

acuitatem; 

f 3dcm45auc.pyaf.Zactucatomcftiea t 

bonaftomacbo:ctinrrigtdatvctre:ctfacitcoj 

mircet ( puocatlac.j£tquando ipfa ©ecoquif 

cltmagieiuuaf iua.ct qncomedif fic cuelktur 

finc ablutionc.conucnit illte qui conquerunf 

teliomaebofuo. 

f ^tafliduuevfueccmcftionfecaruobtcnc J> 

t«atviftt5J£tqrifit e^laftrit cueacoueuitapo 

ftcmanbuecakdi6Mtbacupile.t>umodo non 

fit vcbcmenrieinflammationie 

f Sedfemcnciuebibiturtvalctcofraflujcii j £ 

vent rie.et cjctinguit kbidincm et pollurioncm 

fcminis in fomnie. £> ed qn lacmca cmiferit 

rtipitcm fuum tunc cfftcifur virtue fuccict lac^ 

tie ipfius firniks virturi lacf uce agrcllis i pa 

pauerienigri. 

f £tidcm aucf.*Ruftt.iacnicaquidejcurat $ 

cgritutiinra quc fiunt ab cbziera tc qn fumitur 

fcd ipfa nocet intcftini8« lcnit xetre.i abfcin^ 

diflibidincmctfacittozmire . 

f3tcmqncoquifcuolco5i5smino.tVomcdt 

ntr ejcpcllit \creria'a.ctclt mcdicina bona opi 

lanontb narift i cci;i5eqti comcdif in tciunio 

coaa cii oleo .finapiu ct lac lactuccromcfticc 

1 cii aniftit llipitcm abftergit vulnera que ftunt 
in tunica coutea.Xac vcro la ctuce agrdiepo — *r 
firum in fronre inducit fomnum. 

1 f j£fqnfttcoUiriumcumeolactetuuenculc i> 
conuenit vlccri comce.i placat tolozcm capi» 
tu?.ctp:ouocatmenltrua:etcuratmozfumru^ . 
tcleetfco:pioni8. 

f j5alienue.£akdieflcgmonitecogruir:nec 3 
nonparuieberifipilarionitomontamen poi» 
ten8dtmaio:itofufticerc.£ft autcm cjcctbis 
fedantitofitim.Semenvcrobibitumcontra 
gomo:rcam.i.eftufioncm fpamarie cobibcr. 
tJndeetfomniantitoDatur ficutcriam femcn 

: agrdti8lactua'kquo:cmatiu6colligit caltgi 
ncm.necnoninfupcrvfiionibu6 aptaeftfuW 
iunctaculacrefcminco 

• f£tit)cmfecundoIibzot)cribfe.ca.tc2.a{ 
ctucafmtranflationcmgrecam.l^ofccautcj «* 
opo:tctcjcbmnibu8oleritopaualTtmutcba^ 

' cborimum fanguincmgenerantitociclacfuca 
namulrumquidcmneq5cacoccmum.non th 
cucbimu perfcttc fanguincm gencrari: come? 
dunt aut ipfam vt ad multu quidcm crucksm. 
qrt autem crrif etit circa pzoducrione^ feminio 
cftaherp.epulijcaramtn aqua tiulci oftcrunt 
cumolcoetgaroctaccto.autcumaltqiio fab 
famcnrozum.£ t majcimc queamqj cozu; q ctt " 
cafco pzcparantur. 



r~ 



/n 



Wmmw 



w> 



B 



f tuuiftir aumti ipfy crmec* in Cfptfc im* 

pctrfluerit paqua ditantcejficurcr cgo r .unc 

inafix%c\i\QX>mta tabcop:atoe,kice *m 

aUqtriesmiroriiin pfccfudinccWtmnibi qc 

tnutto t pe oto* toc lATfc ott>fstrs autc nuc t ua 

roatricfltfbniffiindurftwocfionctn 

^atcbar autcm lacfucic inuiucmt;te quicJcj 

caUfacicnrcn ibi conjitiue lupi t icauritt un 

frigidarioniegrafia. 

ijB uf .li.n.ca :t e lact ura.jEjc ea eftt orocftica 

i uukTm8.£ ttllaciuc cft filudirie tli ItiT.ilie 

in virrufcpapaucrie nigri. 

f £ t idcm aucrorirare ©alicmTFton ctf in frt* 

SidifatcciiisqiietomcllicarclouDlanacap 

pUcatioadvluntum, 




CapituItirtT.rfr.tj 



"|% *3cca.^larcarfue.Xaccacftgi7miar 

SJL boriecquodtcfcrtura partibuevura 
^*^*niarinie,quo ringuntur panni cole:c 
rubco^abcr virtutcm ettcnuaro:i$m.£t cft 
caUdcctftccecompleicionieinfcrtiogrfidu 
3crapionltb:oaggregflforiec8pifulc2lcc 
«*»cro warc jDtiikeridte &a thpma atbo 



riequenafcitorinrcnte arabum.ef eltih ea 
fimOcmYrrbc? fio:aci.£t babct ririttf cm et t 
tenuandi. £t idcm flucroarare fialtem.l ac* 
tuca cft gummi arbo:fe qucnakitur inarat it 
quccftitmiUemrrrc&abcnstfdofcm bonurn^ 
i acjmmftrarormfumigne.? ringunrur tf.t* 
panni rubef coloeta^t tncif rinctwa lUaKar^ 
mee.s ©efmurfjmitttcroc armeniiw eftcaliil 
dc?n'ccccomptetiont8intcrtiogradu;£tide 
aucforifatc£aHenrin tranflatoncalbararirb 
Xacraeftgumma arboriequenafctruriha 
r ybia:que d 1 1 (mitiem vrre.biibctie ocio:e3 bo 
twro.£t idemaucroritatc*Rafie. Xacca caf 
ditctcctefupcrramoearboris gubcraodcfl 
mefptu in parribue ^ircfun infwlie marie* 
i ri *• calidc cr n'ccccomrHcrioni8 
^atri-jenna lib 10 fccundo captrub t>e Uccflt 
Xaeca^ijccrunt quidamt>equtbn8 cft oicmj 
•fSaulue: cft gumma bcrbc ftmiUe rr.frrte bo 
nioderi8.ct opotfet cfadtmniftretur cuj cau 
c da .ain vcro errfluerunrcf cft Karabe. Ucf 
rumlacca tn pknfcp dlurrutie Karabcicfl 
ijitcimatwavrnurevcbcmcnct; 

rfpfratfcnro 

f Drafeorick8.Xacca ronfert flfmatMi pul* 
uisdue cutn ouo ftunarur icinno fromacbo 
2 confcrt fpleneticf ein frropo fi ponatum^ 
uocatmcnfrrua,tconfo:ratvifum rmomncj 
modum adminifrrurionie eiu8,?confoMat I o 
macbum:etapcritJopuationcm fiomacbue;* 
parie^t curat Tctcriciflm cicopaarionc. 
^©cwpion.Xaccababctvirtufemcjctcntt^ 
ancU pinguee,tbJbunt tecaftfcnericu afma 
ticii confcrt,£t quando bibttur cum mdlicia 
topwuocarmefiltrua.et abftcrgit macufaoq 
nunt inoeulis abfteritone reloci 
%£t eurat tcbfliratcm vriiie quando mifcef* 
cumvino^fumdecoIUruan.^cfibonaipoIo^ 
n tcnrium.t apcriropilarione8.ctfo:nricafvi 
fccra.-:nngunturindcpannicolo:wruba 
% £ tapcriropilarioncm fiomacbiectconfo: 
tatcurmctconfertvctcrine.£tmodu8abluffi' 
onie cws cft^ accipiturgummi cius et rcrif: 
ct p:oncirur fupcrca aqua caUdain qua buli 
crintariftologia ctfquinanrum.tmouenjr.cii 
piftdl«ert>imimturrcnclcrc^cnciturfic]te 
indc t cficcaturinvmbta.? reponirur tri vafc 
vitrco^fi non dariftcatur prima viccfactao 
fecundo. 

^TBui.Zacca confcrttrcmorfcoft3ie.ct#Dn# 
fcrtepari.-r ?fo:tatftomacbum.?pfe«fC|«ri# 
ci€2idror^intok>ub;cpatt8i 



Bt$)ttbfo 




CapttultraMflEltf 

■% 2trijc.3fi.Xari]c a caflello liridno fcft 
Wl cta'e(t.ejc qua tcbule tcgulta affijce fla* 
^^Anlrepelliinnecccfc carbones ejcuJtc 
erTiciant.*lbU.li.]cvi.Xari)C eft arboz ec filucftri 

gcncrecui foliano oecidum.ficut nec abteti. 
niilloq5flo:cejMaraf;prinu8 etnfloze (rua9 
giqntf:i!>)otts amat ficut? ccdrus.ct eft c\nf 
ta gen? earii q pice ferur .cui fitus ide et f aciea 
vt abicri.lsuius materia loge p:cftantio: in? 
cotrupta .vis buo^ cotumac rube9. ptcrea et 
odo:eacrio:.l^uicq5plufculu erupit liquotf 
mellio<olo:eatq5letio«nunq5^urefccnti8. 
Sqctu^ogenusefttcda.lariafqsnwbuseft 
vt reda nat.D mia vero butus gencra q picem 
fcrutacccnfafuugineinmodtcarepctecarbo^ 
ncm cu eruprionis crepim ecpuunt.ciaculatur 
cp longcejccept a larice.que nec ardct, ncc facit 
carboncs.necaliomodoignieviconfumifcB 
lapidcs.Omnia quoqrilla gpctuo.virenr.Xa 
ricc fut omniti arbq? altiTTimeatcp erectiflime 

&ptt$twnt& 

f -jSli.inli.vt8.6tgnitetlaric caucbrin (tcuf 
erab eis.viq; pillula iti mcdirina vim vredi ba 
bcntcmq cotinetnuclcumpinasfimilcm 
f J dem tnU.icvii.S» emnftir autefeminenec 



vnq? ©cgcnerantlarCr. ac q?p:eflu8 ac patme* 
^•p>alla.li.]Ctj.XaricadmateriacftvtiIi(rima 
et q tabulas furTigas regulis in fron teet ctr re 
mitatetecto?,?tulifti p«fidiucotra tncendia 
"Reccmrlamasrcapiumsaiit carbones crca 
rc pofliint. 




Capttu!um.a]ESit'j 

Slppactum ma!U84Dvaf.ca/8elapp« 
a'o.ponitquattuo:du6gcnera fcicea 
> Xappactj qrtuo jfunt gcneravel fpea" 
cs.anii quod manducaf.et cft iHud qt5 voca 
tur infipidii.Slterum qtf t>taf ocilappactuYet 
acctofum lappaciuj. £tilla cft bcrba q vocaf 
acctofa q in locis bumidis nafdtur.ct in fum 
mitate eiue funt folia acuta et ©ura .vcrii me* 
liu8cquodino:ti8nafcif£ftaliudgenu8lap 
paaj quodeft a0refte.abonnmminus.fimi; 
leplantagiitifup.terrafparfum-zindebile.gJt 
aliudgcnu8quodmulti5adamt>icut.5oliafi 
milialappacio agreftibaben8.etvirgam mtf 
no:c. femcn ri eft acutum et rufum fiiicfnbni^ 
grum. rt triangulatum z vifddum.fue $>gam 
babens femcn f ^af.fcjcto fim.far.ca p.t>e lap? 
pacto.Xappaeiiifcvafcuaieemoderatevirfii 
tis.Scutu vao lappactii mijctum fimul $o cu 
t»yafo:etica et repercufiitia parricipatquadaj. 
P k? 



granaate 



qualifafe,£>cmcn f o mie baticf quid ftipti* 
cfi ftiani'feftc:ct eifunrerias er taaris c fananz 
mmmc id quod cft acutu lappaciii. £ quinuj 
aiir lappacium in ncmoiito quidc geiicraf.v t 
plunmu aui cft ciufdcm quidctn cii yiedictl t>e 
biliorieverovirturie. 

i^prrartonfa 

21 f pffl r.dirnislappactjvnaeriqvcntrcmol 
lir crudum cr tunfu j? cafbaplafmanb? adbibi 
nlciioUorofarusuriciesfpargir. 
& ^ , aalcteriapfcabic:anpctisine« ferpigincj 
fi accipiaf fticcus cius et oleii nncie.? piic \ic\t 
darz nTbuUanr.? colcf.et eolature addaf" pul* 
uis tartari/tfulpburie. i f iar vnguenrum ad 
apoftcmara maturandum.Xappariu acutuj 
rriructinokot>ecocru:?cua|tijgia fup.ponat" 

*- <fl ^onrrafpienistairiaeTuctflappactj acuti 
cii fto:ace licjda ctarmoniaco i acero confici 
arur t t>imittaf rribus ©ictcjpofiea fiat t>eco 
crioscokfcercolaturcaddafcera ^olcu ert# 
arvngucnru. 

f> fBquavclvinut>ccocriont8eiu8folutropiV 
lationemfplenis velcparieXonrra fcrofalaa 
noucllas fi3r<mplaftrumejclappaeio acuro z 
apmgia fimul conrrine. 

£> ^ £rilpeUefacrcerlappacioaaitovaIent atf 
jnatiae cjcfrigida caufa. 




CapiruIum.ffjEliit> 

-% Bppacifi minue fiue rorudii.^larea^ 
SR^ Xiippaciurorundii&eocradrorun 
^^*ditatc tandir;^ mino:e fupzadicre. rg, 
clialtc.in.itj.gradu.^aulueca.tielappflcio: 
ecca eftmaio:amino:.',£baio:vocaf barda. 
nus:? efl mafculus carcs femine.*z£>fno: vo? 
catur bardana er cftferoina faciene lappas et 
fcmina adbcrcntia pani8.an'qui vocanr cam 
lappamjnucrfam! 

^prrarionfs 

<ff £>?af.*Radit eius earbaplafmara lcpwfe 
inedicat £iu8 ckjcarura fometo adbibim in 
balneu? fricara.p:urigine eo:p.ie rollir/ootoe 
auriiimitigar.f 3nvinoeUica tsolo:e©entui 
gargarilmo compefcit.etcatbaplafmara fcro 
pbae fpargir.£ tomntu virtfe" vna cu pdicra. 




€aptfulutn.frfut; 

•^ apago.t^Yaf.ca^pp:oparuic.i.tapt 
2» go.eieberbatgaemulraebnslon* 
^!>ga8 1 qdras tafp.ae.foUa rara i in or 
diepolitaXcmcndtci albinrorudu ip.uii.ui 
medio firufatuficut vmbiUcu8.fio:ebabet al? 
bum.ioUa€W6vefiih?rranfeuntiu inbercnf* 
jy^fctfdrcamnro8ao:t08.^acbabapa/ 



£ 



iBf2J«b!0 



ftotrep Iiquflfo:fo vf unf lac liqntcs. 0af.vi. 
fim.far.ca.apo:ina .Sponna^filiatroFos vcl 
filorropi tf:.picif cria lappula minuta t pur'/ 
purea.mcdiocrircrabftcrgitatcficcat.b£bct. 
autcm alictd fubtiliii parriu. 

Bpmtioum 

fDvflf.iouccusbuiusbcrbctgaitictfcmt 
nio cius mo:fuj mittga r.fpalagt6is cu vino bi 
bitus ct vcnenie oceurrir. t>\c fuccue aurib? 
infufue earii t o lo:arit'rigaf.bcc betba <u fljtu 
gia mnra fcropbae fpflrgif..folifl aurecitte co 
(tringenrisfunr virrurie.f £ r^prerca fluc:ej 
fangutniocarbaplafmarfoflppofitamcdcnf 
«reicoberenrimifccnrur 




€apimluttucjE(ui< 



-«l a unK0fi.Xaur9 a laude xfot* e.vn 
y) z olim laudea ticebaf.&accm cu lan 
y*k*6c vtV fo? capita co:onabanf:co q> nu 
^ viriditatem teponat.fola quocp arbo: bec 
vulgofulminari minimc creditur.f Suiecn* 
Xaurus eft arbo: ca.-z (ic.in.u.cm'u8 odo: vcb 
dolens.lDritur in locte montuofis babens fo 
h'a ficur mirtimifi <y maio:a funrXt cius fru* 
ctus cftrubeue.^tufqj tlliue cft in folue 2 fntf 
ctu tpfiU8j5 rana cius funt ad modum auella 
neparue.^n ipfa tota eft calcfactio.S? jgra 
nactU8CfludiP?ar»ntfoliJ8Xo:ref;vcroT>cbi 



lio:eftefmtrjo:tecaliWtatie.£lfl.Zautf>c^ 
eet ficX ui9folia ^rure fcnr cofottandirrtictf 
cr.flromarictrarcttiroluendi2pwmendi.5o? 
lia eicficcata tn Ioro r mb:ofo 1 ron ftimofo g 
anroi in multaVfTteflria fcruarff.frucr9i> ttios 
flnnde.f*£ala.li.irj.&ettfefcb:uarioe,r;bac 
ciemirre? laurifcminaria funtfacicnda.vlTi 
factfl fucrint er/olcnda . f Scra.Ii.aggre. au 
gflrfl.auc.£>rC0flrfl.i.laurue:j£jtco e fcne 
ftricra foltfl.crejLco.cfi bns lario:a.crcmafcu 
lus.cr cclcfaciunr % t eftccanr ca lcfacrice cf " tc 
ftccationefoai.je rgranu ciH fo:»9.f pvaG 
ca.teXauro f m tranflflrioncgrcca.Zsurus 
fllia cft lariom folto:u,alifl rcnuio?.fed vrrecp 
fcrucnrie virrurie funt flf $ rCco:po:atiuc, c]? 
clirarura calida e.f 0al.vi.l?m.far.cfl.dafne 
arbons fiue laurtram folia cp frucf us ficcanf: 
^calcfaciuntvcbcmenter.plu8tflmefruct9o3 
foliaXo:tctvero rfldtcieminusquidim accr 
1 cfllidus.mflgi8 flut amarus:? quid (iiptidm 
riebflber.fjuueualis.Xaurusearbouutf 
folti0Vicro:ceco:onflnf.vndelfluio#>rer vtf 
ctoaa co:onfltue:ticif laurcarus.? co:ona q 
p:opter rirginitarcm mulicrcs co:onamur: 
vocaturteurcola. 

^pfrattottfs 

f fc>¥flf.£ lijcarura ciue fiin fcsfio miftfl fucric 
atefu e fcdearvefice-z matricie tolozecopef* 
cit ,t?uiu8 folia viridia ftipticfl q tunffl z cat a9 
plflfmattto acbtbtra vefpa? ct aprm peufiiiin 
p:obibent:?ocetumo:ee fpargent. 
^f£tfif\nflpiaut polenremifceanf zxiridia 
bibitanaufearjuocant.ftomacbu^fubuerrijfc 
22uiusbacca plus ca,cft 03 folia. 
f £ r babet virtutc fo:u'o:eq rtinfa et clcctua? 
rq mo:c melle collectatf ulTienr cs 1 ptificoe ov, 
tonoico8ctfo:aci8 rcumatifmum fanirari rc^ 
flituit.cum vino bibif a ictito fco:pt'onu occur 
rinmaculasnigrastetcrgir. 
f Succuseiusfurdtrate aurtu manere non 
finit/z incogruos fonos cu vino etolco rofa? 
adbibitacopcfcif. 

f Bcopie ct vncrioniteca Iidts notabilitcr m; 
fccfur.virmtitocriflm tYafojcricis ncccffe mi> 
fcetur.Coriu eiufdearbo:is trim ct bibitu cal 
culo8rrangit.abo:fumejccluditcpfltici8obu^ 
lis trib? cu vino bibittl p:cftarcftccru. 
f ^uccus #0 radicisciusminuseftacmct 
m,e flmarus -z magis ftipticue.^jpter qr5 lapt^ 
des vefice rumpit.ot8 aitt arbo: viree babet a 
critcr rdajcantes % calcfacietes •: oiapozatcs. 
fjSarXaur^lapideGfrangin-zeparic^fert. 
bibitfcii vino odorifci i pcdcrctnu obulo?; 
P W 



a m 



1 



m:^ 1, 









£> 



Kmwm 



Z) 



X 



f &ui.Xaur9 cofcrt fcolorit» ncruoui omito 
Xiaii f«g mo:feam cii v ino .ttefoluit ena fo* 
ds m i facit ad t>olo:c8 a urie frigidos 
^sfi6.3ar.i.laur9.SpoftcmaM'matrici6et 
puncturc fco:pionis:ac t>olo:i neruow auuli 
atur.q- rotu femen etoleu aujiliant faftidia tit 
ct vomitu faciur fl£o:re|ceiii6 b ibitus frangit 
lapidcm. 




Capifulum.rfjduft. 

aureola.obifciendum cp alict pufat . 

laureola no cfleme3ercon.cj? fc;crro? . 

oinofdrurinca.coconidionfuperius 
t>e£.pvafc.ca.Dafnoidc8.i;laurcola.babet 
virgas logas ouob cubiri8.tcnue8 rccras et 
lene6.et foiia lauri fitia.fcdrenuio:a z viridio* ' 
ra.femcn in ifted-je foltjs bns.j£t idem f 5 m a? 
liamtranflarione t>afiioide8.i.laureolacubi 
ti vnius baber longinidinenu $gas multast 
nofragilesfedmufcilaginofasijfoUa funr illi 
lauro fimilia fed mollio:a.id eft flejcibiU'o:a ef 
©urio:a.et no frangibiUo:a guflu calida ecaf 
peranri3.5l0:c8a!bo8babet.fcmm$oin'02 
cumaturuerit.Tladiccftilliinutitis ftafiirur 
locie montuofisXt flutd quod oeea adminl* 
Itrafeitradijc. 

3©Pfrattont0 



flDYaf.£afnouJee,f.taurcola.fotfa ct'5 (ka 
i viridia bftn)raflcgma ventris ©eponut.vo; 
mitu.puocarit.mcnlrruieunEant.Bpoficema 
tifmis mafttcata pftat auuUu Jrcrnuta met a p 
uocant Jeminie eitte gran a ,jt Jbibit a ventrcm 
molliunf.f£a££amcdapne.i.laurcota.pK> 
uocat vrina ct mcnftrua„£t cofett fciftitlatiot 
vrinc-z mingenritofanguincm 
f £afliu8 feUr.ca.£amcdapnc.£t cft tiure* 
ttcavalde ,5oha eius catbaplafmatib? adbtf 
bita t olo;c capiris rolUmt .cgcl t tonce lioma* 
cbi impofit a compcfcunt. 
f £t t omonee antertoKe tn rino bibitapo* 
rifiimecj femina babefttantcriue.poltcrioKs 
vero q funf poftcrius mcdican6.S> uccus ci9 
cu vino btbirue mcnfiruisimpcrat^nouocat 
vrina.pefiario adbibifus:becoia facit 
f ^ictualiscftvtrmtis^umfoltjefufsftnc 
fionto incedidfe fe labowhfes quidamcatba 
plafmaucrunr.Ouevero x>kit 2&cfue. vid€ 
ca,cocogra'dion fupia t>e£. 




Capimtom.r#lun% ; 

^fk 3udanum.£vaf.£ftcnungcnueccfc 
zn re.quam multi antion vocanr. %% 
^^>barbamYr(inam.quiapingucc , oei'u8 
adbcrer garbis vrco:um.frurcji cft fimilts c\ r / 
Uercon.fedlogio:afolia babet bcc? inregra 



Btfynbfo 



^tncitio qua^tlnguodfog babctfup crfclia. 
titittaB cfi illiftiprica in fotrje:cf ejc ca t oitigif 
feH*mirm,^tu'uecmtn ccfcrcfotia \rci ra J?}i 
rum Kbentcr manducanr quacti3 tcpafccrc ce 
pcrintpingucdo illa quefuper foltje erit bar* 
biB nfymaie yrcouim fldbcrct-£ t a tiligcn 
libeicipfie eollccra erinfcrcdacra laudanum 
faci«t.Slfl vero fuper ramoe ipfiue lunce tra 
fcuntejctcndentee wifef k.K tlrquid tr, ipfa pft 
guedinefunii2dbeferitcolIigunt.j£tficvtunlf 
talittfciplina ctmanibuefricata malaianhet 
paHilloe er ipfa faciunr:quod la t:dcm m r o^ 
tanr.j£ It autcmvtilequod odotcplcnum cft 
ct virideict factlead malawndu? i ptngtic ne 
babcne arenam commij.ram:er miniire fragi 
lc.et fimile rcfincX uiue virtue calida eft % bu 
midainfinep:imigradue:p:opcfccundum. 
f^ubltantia ciue cl'r fubtihe n um.m.cnn fa; 
p o:cetuecftflipricitae pau<a,f £>crapicn, 
X a.lcdcnt.id eit Iaudanii.£r c olligtturcj; vn a 
fpccieciflbe.ctcftarbultiim quod afiimilatur 
cificrcon.nifiquiafolia ciue lunt lcrgic:a:ct 
nigriora;? bab « bumidifareque adbcrcr ms 9 
nuiragcrciecaminvcre.crcft frip titfl.? cjl fcac 
fpecieaccipitur laudanum qt;od tifciplina fu 
pcrio?iconfirituft 

0ptrariont0 

f£5af.vrj,fim..far.ca.£itbuefiueciftue.fdcft 
laudanum.£li autcm fubrilium partiu in fi.b 
ftan tia % calidc virturie f m pzimum accciTum 
complcfe.vt eft fecundufmtangct p:optcrca.£ 
tur ciuecft que mantrar.aggreg*jt % fo:rificat 
ct fimtlitcr tjafotetice cfi virtutie et t igt fiiuc 
ct vltra picdicra babet quandam fiipticirafej 
b:eucm^:optcrquod confcrt cgritudinibud 
mamcie.afomTicat cam* 
f £t facit oriri capilloe qui cadunr.p:opfc> 
rcaqttcftruitquodcftin radirfboco?? bui^ 
«Jiraiitceoutf maue.sftringif fua fiipticitate 
po:oe g quoe egrcdiuntnr pili.itunt cnim bc 
pantoncep:opterp:auo6bumo:ce:vifcolb8 
«rgrof;oe:quoeincifiua % ty afotetica farma 
ca maiitme cducut % cuacuaf .Uibtiliu vcro par 
tium opo:rct cfle virrutie ca.i nc multii ftiptisi 
ce/fio in intanrufubtiliu partiu i ficc anttt m t 
Ttftcccnteittpafcetcubtonbrptcrnfltur^m :, 
flccruatie tbi naruralcm bc miditateq augt nt ' 
capiUoe.itacnimnonalopieiaefanabutma* 
ftp q. f atuic icm opcrabunt ur. 
f freeno ct laudanii incarnatvlccra t iftiv ilie 
^folidarionig et mifcetur in medicinie fedanri 
fcue tuflim.j£r quando bibitur cii vino vercri 
flringir venrrcm.er f ir cr. eo limigiu? ad cipci 
UndafsiHndiniini^pgmimnaualibyyattnl 



tibuefonfraturtcummafricip» 
f i>auuje cap.te Xaudano.£ ft ctt^cMum £> 
quodcft pondcrofiuect nigrumK qti maUi|ta 
ri potcft.j£ t vatct akmfic clcctum cctra cpi* 
kntiamfiinungatur f^ina p3ticTitie.tf valct 
&d nigiditfltcm matriiieerfuCoc ationcfimu 
licr qcco rccipit fumu.zfupcr infcrio:a.tlfiI(t 
ctiam conrra rclavaricncm t citriun-.:ft lauda^ 
num ct rfliftiicccTiciantufacirca gingiuaeeic 
trfletintueponantur. 

^TSera.aucforifatc |Dyafco:idfe.cap. Icdcnt 0. 
idcft laudanum.airfue landahieft ca .motto 
ficatiua.apcritiua ozificiow vcnaru/qn mifccf 
cu vtno ct rnirra.ct cil oleo mimno ftipa ck& 
tricce vkcrum mdio:at cae .://' 
ftf qft mitrif inaure cu vtnoqtf «5: tdromct £ 
autciioleo rofa?:curflftole:eca?.ci fit inde 
mmigiii ad oipcllcndum Cccundina m 
f £ t pomtur in confecrionc nafcaliuitt vcl coi 6 
Itriomjmatrtcum .ct confcrt turicitb: carii: % 
mifcctur inmcdicime fcdantito tolo:cm.ct in 
mcdirfnie tullie et in vngcnrie. 
f jfctquandobibitur cumvinovcterifiringfc S) 
vcntrcmetprotto^atvrinamfacilfrcr. 
tt uicenr^a.X audanuj cft fubttie.': cft in c o 3 
pauca fi ipticitae^ cft mat urfltiuum fcurridi? 
tat um grcflaru vtfcofom quaecu cqualtrafg 
refoltiittnquo cfi virtueartraaiua.wfi calcfa 
cnuii.apci ifiutim o:ifico:um vcnart»j.ef irgrc 
dittir in r cdationcco!o:ie„ifacit naici piloe: 
infpitlat : rt s ct p:o!ongaf coeet coUfcruflt p> 
p:ic tum ckb mirtino i tum vino.cti;cn facic 
toc nifi quia ipftm cft fubrilc :a ptofundaf: 
ct cft rcfolutiuui munckfu at co:ruptione coz 
rodentcmcarncm. ^ 

f ^tcft flttractiuu? arfrabit mafcriam fcona * 
ad piloe.vcrutamcn nonvidctur confcrrccal^ 
uicici cu m incipit :? cafui pric? cu apparct c n? 
tie.1 fiujtui ca pilio?. ct ron pcrucnit c d fcoc vc 
fanct alopit is m.quoniit? matcria alopicie no 
rcfoluitur mfi virtuequc cft fup:a virt ute rcfo 
lutionieciuei 

f Jfit laudantimconfolidatVtVerflturc rori^ % 
folidationie.i lallatur <nm olco tofart m in 
fiurtmTolo:ofam.? ingrcditurjn mcdicinis 
fedcctpulfationie. * 

fttconfcrttiifliircfoluitflFofttmatamflfri %& 
tie fuppofitum nipcilario.i attrabit fcttl ir.ot 
tmmi fecundinam fuflumigflticcfflcta cc co 
in traiectono.i qfi btbiijcu vino anriquo:(oti 
ftringiwmrcm;?#i!0catvrii}atn, 



Cnuratua 



ctbonumbabcmjwhbabcotriKmmnfii^ 
fkpanm^adi^iMncainpctftvruinKduuK 




€apttulum.rtflijf. 



^•l 2Wua f m C> Yafcoridej.in p:ep:io c 9 
2L p:rulo,rirfulum baoetoblongum faf> 
^^dtafewgirfcaiuijinfummoquafirft 
inutumwffufum. ctfoUaoblonflafrucrumin 
fummitarcramonimbabene rrianguluimct 
fubrorunduminmodujcappariain quotria 
grana conrinentur fub membwnula quc in* 
tracomccmcflv 



j&pfrattonrs 



fpfa(co:idcs.Cranulacius.vij,vdi)c.pota 
ra v cnrrcmfifcidc purganr.q* ft aqua (hgida 
rupcrbibaturcolcramrubcamct flcgma vcf 
ponunf. 

Capitultmucl 

■^ Sucnduladtbcrbacalidcctficccco^ 
2f pleuonic.^aulue<,%9ucndub c bcr* 
^^baomnibuenotaejaretfcmine.fio* 
rca r fui mcdians to mpctu|tf«ctodo»m fuaue 



&>pmt\ont8 

fX3irtueci9cftqucrcfoIu(tctfo«fffcat.£« 
tra fincopim et cardiacam paflione ejc frigida 
faufa fiatsccocrio riue in vtno odo:ifero:ad 
dira aqua rofarum er©ctur parienri. 
^Xaucndulacllp(ianefomnu:afcdat fodl 
qn emplaliru cu ca fit fupcr rronrcm. 
4 Squa ©ecocrienieriueporaranefret ici& 
cpflcnriae:erapoplmriecofert.laucndulamC 
fccfur Diuerfie anridorie ct mirie ct varqe of 
doabue grate mifcenir. 
f 3temodozeiuegrauatcapufctfarit fom* 
nu.£t qn bibifsccocrio ef ue cft conueniee illi 
cuiue cereb:um infirmarur. 
f Bqua riiiecfloate&iftiUara valctad appo 
plcriam.£mpl9ftrumetcofacrum cu ojuno 
ralet puncrorcfco:pionie. 
: f B d p«fcruandam apoplcriam. "Re.flo:erri 
. lauendule.3.q.dnamomi,fpice.aoa4tgni alo 
vf»,maf]iicie.nudfmufcatje J 0ario/iU.calsmi.9^ 
romarici.jtnabcri6.rofarumaci.cardfiiT!omi 



fet&trbfe 



<n^f ^oleftttt cu aqtta tofaru irt vna ffola vi* 
trea in cine calido:poftea coletunct paularim 
aim coclari potui pzopinetnr. 




€apifumm.rrl). 

•^ £uifticu.^lafeariU8.Xmifticum e(l 
SK berbaomnft)u8Uora,calidaetficCain 
^^*ii.graduXuitt8femen filr appellafur 
£t in medidnie femen ponif.uirtute babec 
t>iurerica.vfrtutej cfe aperiendi et er,tenuandi. 
<jj£.onftanrinu8 in li.graduu.Xeuifhcum 
eft in rerrio gradu calidu % ficcu.£> emen aute 
ctradijc in medicinisponitur, 

©ptrationra 

C^latCQinu r el eril aqua fcecocrfottie eius 
valet conrra opilarionefplenisctepatiotfco^ 
tra vcntofirateVz ptra t>olo:ertomacbi i inte 
fttttoru ejcventofitate.^uluis etia eius ciipul* 
uerecinamomit>atU8 valetad pdieta. 
<GXdTtanrin9 vbi fup:a . Cibum t>igerit: opi f 
larioneepatiaaperit.ttcfrigidobumoietolo 
remmirigar. 

^£>romacbivenrourarcdnflarionerttgiru 
?inro:fionctilTolttir.7&eftrua cr vrina p:o? 
upcar.£tia iila^bafm Xcftanrinu babcnf 
tn libzo x>cfimplici medicina almagefiii 



€apituium.rdu 



"Jk jSitifticu filueftre.£5vaf.ca Xbafpiuj , 
SR^ fmrranftarionegreca.Xbafpm.i.Xe 
^j^%fttai filueflre.ua fcif in tumulie ci in , 
vcjstfugtcguiaeiberba cminuta.sfolia fcfis; 
angufta tuiofco t>igitis Ipga .z in fummo t>iui . 
fa ct pinguia.^ga in medio.pfcrens t>uo? pa Vk 
mo:u cu paucieramulie.in quitofert femcn la. 
tum fimile carramo:** obrorundnm ct vcluti 
eonquaffamm.vndcetttomenfumpfit.fiozej 
babetfubalbidum. 

©pfrarionra 

f Dvafcoridcs.tlirrue eft tifcrmatira.-z po^. 
tim'mcfeminiciu8potuit>atuminacccprabili 
quanritate per fupcrio:a atej> inferfo:a.purga, 
tionem facit vcbemcnter. 
^Sktaricis p criftcrc adbibirii medef .bibitif 
mcnftruis impcrat.abo:fum facit . 
4 BaliettU6.vi.fim.farXaf9pi8 f m tranflari 
onegrccam.j£ fl: a utem lcuifticu filucft rc cui9 
fcmettaa'i8virtufi8eft.q:apoftcmara riipir. 
^[ £ t pcr anum impofitum fciaticio cc uenit . 
B. ft aut et alteru purgat iuii fuper i fubtus col 
iiricombibmlinojiifabimulrirudinc. / 



6 / V^n*t: 



ff= 



<vJb*. 



£mmm 




Capitulum.fdif?. 

"*k Enricula aque vet lcnttgo aque.Se* 
igL rapion.Ii.gggre.ca.gabakb.ideft:len* 
^^*ricula 3que.qttaeftm3ri1ta.ctej: eae 
aqueT>ulae.fcdflla queeftaquetmleie eft lef 
ttVuiaquereperinirfuperaquaeereotabat^ 
ro«fceviridem.cteftrotunda ficut lenticula: 
flmiliseft ei in figura fua .EtreDcrif jnlapidt* 
bus fnper aqua cretta matans fuper fa dem a? 
qiie.0af.Tiq.fim.far.ca.facue.idcftlcniicula 
aquarica bumidcetfrigMecomplerioniein fc 
cundograducriftcnefmvtruq3*f -jbaulus 
fa.Sftrariotis.et cberba quMtafciturinfu? 
fide aq ite fineradice cii foltis fimilib? fcmpcr 
riue:£ft aurcmvtrfuris rcdarguemie acrcp. 
moJdcw , s.pT3f.ca.lfuriculaaquc.Xcnticu^ 
la coloicm viridcm b2bcne:virr9 eftci frtgtda 

&prratiotit0 

a f Mcnue.Xcnticula aquebabct quid ftip 
ticiratie^rer quod vulnera potcft confoltda 
re.et vlceribue cft vtilie.quida aut co ademo: 
rofagiAsvrunturctadftltulae. 

'£ f -jbauuie.1>ogifoaravaler ad fluote fan gut 
mse)Lrcnibu8.ctaim acerocontrita.arqjvt- 
carbaplafma adbibita . 

jC fDufcoridee.OmneerumowsfpargJ.jg 
nem facrum ecnnguir :podagricie neccfle mt 
farur.medicaminibo fola.et cum polenta ap* 
ponituriufantibue. 

Capitulum.ctlui'?. 



■«fc £ne.£>era.K.aggfc.c.$cdm8.flucfo; 
2/0 £>Yaf.mclio:ee ejc letito funt ille q vclo 
^^ciue.maturantaqn infiindunf in aq 
ad mollificandu nd nigrefcut.jSaf.vq.fim.fa^r* 
ca.tJelenribusfmtranflarione grrca inquir. 
Xenfeeftuxicantnofo:pitcr.inmediocaU.et 
fri.pfiftnt Jficcantautin fecundo gradu. 

iBpftationfa 

€6af.codeUi.etca.fmtranflarionearabicflfc 
©apo: ca? clt fttpticue ftipricir atcpauca.vfr 
tuelcrie pma e medta Oiter ca.zfri.tciciccat in 
U.gra j£ripfa flringit venfreqn coquif bie et 
p:oncif aq pma.et aqua in q coquui lajsat vc* 
tre.f £f ©ijcit3?po.vt.eptdimiaru «pcft tgata 
tn ca.-z fri.t tcdinat ad calo:eparuper; £ 1 ftf 
gttutnboceftq>noapparetEea qti comedif. 
aur qn mo:af in ftomacbo aut qnt>efcesdtr a 
ventrcin frigidario eo:po:i.? eccpofita cjcfub 
llantia qflringitvcntreqncoquif bis^^ptjctf 
tur aquaprima .1 aqua m qua coquunf lajcat 
vcntrcm.C3dem auc.P^af.0uado comedt 
tur ec ea affidue Mt obfcutitatcm vilue.t eft 
x>urc tigcftionie malo ftomacbo:et accidunt 
cjcefuciuefomnia mala.etcft malancruie et 
pulmoni.f £tidcm ^era aucroararetgbe/ 
farugie.£jccomcafcejcbtefuntfrigide:grolTe 
Itringutvctrecfvtinajefingroffanffangmnc 



Btifttbis 



fii venf sttnoTinunteucumre.f £t idem m 
aoiitate 2£>cfuav.ien8 ipa eft frigida z ficf 
ca tn p:imo gradu.etco:rejcdu8 cftcahda ct 
ficca in primo gradu. £ tt>e p:op:ietate eius 
cftminuerev«nam:ermenlmwp:oprerciH8 
fanguinisingroffationem. 




€apitulutn.ftUt; 

^ft 3li5.Smb»GusXonftdcrfltcltb'aa 
2L gri.q?fB8fttcando:infol^:ipfaq5fo 
^^*lia fiipata qud ab ymo ad furcmu af? 
furgere videanf :vtejcp:im3t foana ctpbi.? vt 
auri fpcaesqda intus cffulgeat. q cu vallo in 
riraimiru floris obfepra iniurie nullcpateat . 
*5 i qs buc flo:e oecerpaf:': i folia fua foluat 
q tata dtmaii^artificis q lilqs fpecie rcfo:ma 
revaleaf.f6lofa.fuBXucaU'.ru.Zilianon 
filuis kd i boms nafcunf:ncc vllu agricnlaru 
cnlnlreqrutficutcctmfruct9JIcutfcniprucf{: 
j£dTt'dcrate Ulia agriqudcrefcutmecp labo* 
ratnccpncnt.^Rolaboistcoloab? odo:ado. 
. neq? nmrfibi wdum&afacicdo. f •fcalladt'9 
ub.in.3nfeb:uariomeTeliU'o?bulbos pone* 
mus.vel lilia antc babita fa riati9 fumma otlt 
gentia neoculosdrca radicenafcetes z mino 
resbuJbulosfautiemus.&ui amfe fubrra» 
cxi atcp in alios oigefli o:dics noua lilicta fo: 
mabut.fpfaf^a^elttio.XiuubKcft lcctf 



na qua multi in cd jonl pon3t . 6t cftoitond^ 
tfijcutfftoKs albifutfatis.Eftaiit alitfgcn* 
lilq q# vocaf vris yUrica.foUa bjfiluio futa V? 
gladiold:fed maio:a t vaftio:a.flo:e8 babet 
etfugio^sinclinarosfibunuice oiuerfis co> 
loiitoalbo. f.etmettinoautpurpureo autvep 
necino.*Radiccsfut (ibi ©ure z curuc zodote 
bono plene.£>e radices colUgede fut % filo tta 
fermde.etficinvmb:apendetce ficcandc fift 
©urarr b^uisrt Colo:is rufu? odousbonkl 
gcndadt in gulftt calidio:. ^©erapionli? 
bw aggregatoue ca.2lnfeaadcft Ulium. £ft 
enim calide z ficce eomplerionisin fecundo* 
fcjc co cft oomcl ticum et filueftrcS» ed filue* 
ftris funtfpecies;ctnominatur vna arfeme? 
rimad eit celeftcet eft album: quod cft notuns 
Pe ilio inp:efenti ca.oicemus. 

0prrationt0 

fSuicc^a.Xiliualbuo:tulanucaliductftCiJ 
rii in (c6o3 n tpa cft t erreitas fubtilis acqui 
rcns amaritudtne.etaqucitasita eqlis copk 
flonis.Cdfert patto ct lenrigitojpaecn radijc 
ritt6.etmadatfacieacremouetei9 cotractio* 
nc.valet incifioikD ueruo? et fplem.fed maluj 
sft l tomacbo^jpuccgoleu ci9. qo* eft refolurtf 
!utm:ap^'tiuu.1enm'uuouriririmatrici8bibi 
mmctinucm.O©eradicri9confertadufti 7 / 
oniaquecalide.qmeicficcatuiacftmoUitiuat 
abfterliua :oi cqualita te cdfolidat. £jc fcecofr 
ctioecijipfius radidsfitonscoUurio adt>o? 
lo:ant>mtiu.?#:ieiUiu8quodfilueftreeu\ 
43de.2jliu ptertpuncture vermut veneno? 
fo:um:p:op:ieq5fco^)idi8.?Dlcum45ciU8cft 
tvriaca eo:iandri z mngo?. j£mplaftritcc fo* 
lus cu vino factu fug beriftpila cdfert valde» 
^•Jblinivli.rici.Xiuu rofe nobiUtate ,pjct'mug 
quada cognatide vngueti:oteiq? qtf uubn ap 
pcllatur.'BuUafto:ume]ccclfit98.maio:.3n? 
tcrdumcubitonttriumlongimdo,aiba UUa 
omnito eifdcm modis fcrunf quito z rofa. fli 
bilcBf«cundius;vnaradicequinqgentos k r / 
pcbulboscmittente.f^era.^ducnitcom 
btwlioni igms qn afTaf ct terif cu olco rofa? , 
etpomTfite1ocuc6T?ufti5isett>itnittif©onei: 
curef.qmcobuftidesegcntmediefnaqccfic^ 
cat et abftergtt cu tcmperameto ,$£t eft bo? 
nuadt'ncamanduomniavlccra:ctmoUitt>u 
ricicsm3trias.ibUaeiu8fncarnatctabfter# 
guntabfterfionet>ebiUou'o3radijc.j£tquldo 
coquunf et ponuni! fuper combuftione ignts^ 



ri vlcerarione" co:um.<C j£tfunt quidam qut 
infunduntfloicsciusinaceto.ctvtunturas 
tncarnandum vulncra t et contunduur flos 



Exmmm 



-to 



2£> 



-B 



euio et etpJfmitur fucais eius a coquf tur fn 
aceroimeUe.ira crctfucro firqncKeplufcp 
a r crii -zmcl.C £ t cff me-dicina pucnf ee ad om 
nc qtkga ctficcaroe finc mo:dicat6cfieur fut 
vtilnera rnagnarr^ic q ftunr in capinbcHnuii 
feulo? % ad vlccra oia cj funt fctftictUe incartf 
narfots.f Sfcd alrcri l )fpccici Ultj q x>iat yiis 
ctdtUtiu agrelk Pm eudcaufo:e.Dal'.£5ub!» 
(tariaeft ftibtili6 z mundthcat % maturar. £t 
conenit lipecid» tufuerz facir afcatdere ftrca 
tum a pectoje^ curat toaioee venrrie z vke? 
ra fouJida.2 qubibitur cum mclle z aqua talt 
da Upat ventrem.^ P Yafco:ide8.5lo:ee UU) 
©omeftia poffunt emoUire tmricics ncniorii. 
^oltaeius cocta z impofita ad cobufta pficti 
imt loca/Gleicatioee ferpentum eurant .Sntc 
ateauemelUadmiictusacsecoctuetnvafeu 
lo nouotvlceravetera medcf.^SaUcnSfcpri? 
mo fimpUciu farmaco^ cap.t>c lilio. ^los Uttj 
©omeltici coplejtioc mt,tru6 eft fubriltu partf ti 
quadaejcterrclirifiibftantia.af. babctet m 
qtie in gui tu amarirudinc t qc quada aquofa 
eucrira .f Unde oleum qtf ejc co clt ptgmcnrii 
in mo:daci8 z t>Yafo:aice z molUtiuc cli vir? 
t uri8.cjc qb ©uriciebus quc in matrictte aptif 
ff mu e. radic aur et foba per fe trtta Itccat z ab 
ftergutctVfafojafmockrarcfButcc.vcvi 
ribue co:cit6 a u.q confouat wu 



-% 3Uu?ualltii.^ta.Xtliumc6i2^Ui!«i 
eii bcrba babeefic:ce bcncrcdoletc©, 
*^*&fo\i} & platagini maio:( fiiriUa/Rcc 
foha nec radip vfui mcdianc cc pair : kd rW 
rree vfrtutebnt ccfo:randi et rtfoUicndi. 

f-tMi.*Re.fio:c6 UUo? pualliu lib.f .ponanf ! 
vinooptimomcTuravnallcttinfiindcpmcn 
fetu.t»eindc^ifiilkf viiiutftnd £ akmbtal .al 
ifta aq rtfiillatc fumc.5.q.aq laucc^lcji? & 
na piperie ro.j.f .mifceanf .©e il ia fumc in fe* 
prim3na.3^aeiuno f?omacbo.?ifi!a feprima* 
na no bcbfe apoplctia ncqjUtargta.f 3dcm 
£ uifta aq erfam porcelim'retimpo:a.ininuit 
fluirit cararrale:? fedat foda.^f ta a q aia «# 
ratcoUcapalttoncpotaru:?cofo:tatcoj. 





v Captn4lura.tratf. 



Capitulum.triui}. 

■JJl 3liaue.£ade.e3.t£]tvi.ZiliaU6 cfl qf 
2$ 61 bcrba bne foUa ftc rubca rinttout 
^^>nifiq:lucmine«:zvtcucp afpcra.^ 
pldcefcErerra.ficberbasnofvclrubj.tiu» 
floe e parutfic fioe folatri bne rertc figura W/ 
Itj tomciiia'.f Suic.U.u.ca.fllgucfte.rf alu* 
feu.i.bet ba UUaUe.? e baba ciii^ fioech ittia 
liUorz,tprer boc $i Ultaiievi d\ ca.i fic.in. i. e« 



Bt.fytttts 



0pfrationf0. 

f 3cfcm.l,ilialie&cficcataim cqualttatc et 

abjtcrsii^confcrtpanaricib^crerolmttorii 

tUudcumcquaUrate. 

f 5-alien9fccto ©c limpltcf mcdicina. capitfo 

alinlim.aiifliim fiue amplofttb.oiaa eft qui* 

dein auflumad eft lilialtb berba.qz mirabiliter 

ptcrt moziiii a cane rabido:imo z iamoccupa 

to r^tte^pmata fcpc fola fanauit. 

f ^icisauttfratur inplurifo cognofcer cp 

©fafozeriaj eft medioerircr: % liccat iuu cu eo 

quidaitcidabftcrfi6i8babet.^incaiitauio8 

ctenlinas mundificat, 

f jMinmscaplb 3lifon:id eftultalisfitseft 

rubee nncton nb ©iftat ab ipfa nifi quia ipfa 

ramict folia funt minoza. 




Capitulunufluu). 

^t) 3:juirida.Cbcodoz9pztiaan9. lAi 
SfL^ quiriciaefteugedanbmultumgrofla 
^^^necnimistenuiecjinteiTa crocea fir. 
que eft'5 cu frangif leuis clt et tnt cri9 fubalbi? 
da :fcd nigra vcl viridis abrjaenda cft . fucc9 
dus foztiozis efftcacie cft qui efficif fic.£uvtf 
ridie eftradtr:cbattif bene:z in aqtia ©ecobj: 
vfq$ ad pfumpaonepoftca ecpzimif tfjcficca 



tnrmfole.tinrotimcta cozpufajia fm fozmf 
vafculo?fozmaf.aiii fepbifticat boc modc» ■ 
faciuntpuluereliquiricieetcoqunnt inaqua 
et addtmr md z faciunt vt biicimue.f Skra* 
pion auaozitate D yafcozidis capirtb Iherid 
eft liquirieia.? eft arbtiftu bab ene ramos loti 
gostMobu8bzacbne.babetfolia fttia foltja 
arbozie maftirid.ctfupfolia elt bumidiraa 
que adberet manui.? fioe cfSfimilie cft bcrbtf 
ftozc oicte bzacbion.cfh purpura colozie.£r 
femen riue cft in magnitudine fcminis arbo? 
ne •oicte kalarabas.verii cft afpcri^eorj^babj 
radiceelongaeincolozefue fitie ligno quod 
noiaturinozicntebunum.autlicutradir.gen 
riane:? clt in eo itipriritae rii tmlccdinc: z cjc^ 
pzimifmdefucai8»fDYafco.ea*j5licozi5a» 
£tcft que nafciturin capadocia aut i ponro. 
^rorer, cft babea virgae longas tuO?cubifo 
rum in quito folia funt fpifla a fimilia ietifco J 
fcd pinguia z glutinofa .flbzem pZofert iacin? 
cto flmile.femebabctltmileplatani7 afperuj; 
quod femen cft U tam-.kd rufum et oblo «tgfi.- 
funtttliradicesbuflci eolozis tlongcfieur ge 
t ianc cenltriae? fculees que eriiccanf vr licul 
f •jblmi9ea.ocu'quiria'a.;Slicozi5a berba eft 
quc nafrif in eampi8.guliu twlcis z cu t>ula# 
dtne abitdanre:t>e qua fuccus qxra bif ':? ntedi 
coy. vfui feruaf »f ^Lafliue fclijc eap.6 licozija 
grececjceo oicra cvfeulceradice b? £>lien tm 
grere tuilce Tirif.f 0alicn9. vq.fim.far. cab« 
t>e liquirit ia. "^aius inuametii qd in liqmri 
cia cii:clr infucco eiv radtois. z fubltatia eius 
cltflpinqua fubii.itic nf i coZgis.z vaidc fimi^ 
lis eit a.©apdz etus radtcieeli oul< ie cii iiii 
pt trit ate pauca Xlirrue eiue frigidioz eit com 
p'euoe boipu cft tcpide calidit atio. % idco eft 
pzope coplerioncm cqualcm.et clt bumtda t& 
pcratcbumiditario. 

fBprrationfg 

f airee bj relaca tee cu tmlcedine cjt bnmid^ 
t at e.vnde i (itim fedat «rcnii z veficc mirigat 
tolozem:'z r puocatvzinaamcnfirua. 
f ^tomnefumozetuhfat impofira placaf * 
fuccusipfeafpzcdinearteria^^illenif.ctnbii 
folamtracbe3marteriafanat:fedetiam fatf 
biofa m vc ficam .qui fuccus tnu fub lingua vO 
tetU6glutirit>54Zcftuatione(tomafbirolltfJ 
z nimo^ftomacbi-z epatUolltt acccptfcit. 
f *Radijc veficefrcnum vulncrationem curat 
btbita cum ©utcoze firim pzobibet : vultterito 
vnlie cft.radwce ipfemaiticafe funt I ioma t \j 
ce clijcatura radiciota ilta facere nouit.3pfa 
radi)cinpulucrcmredacta er impofita pteri* 
gia^ctcrgit. f0alicnu8.j5licori5a afpcri* 

qii 



& 



fo- 



Craftatua , 



taecftremoucmnoToliimartmafedin&a* 
btofci vcfica,jprcr mcdiocrf tate coplenonie. 
€23xodo:»Bp:ifcian9.tlalaprraoiavi> 
riapecfo:ie©ecocrioco£inaqua:crinplcu* 
rdi:erpcKplcumonia.aqua«ecocrioni6du8 
valetptra rufliin.f 3d idgvalctclccruarium 
ftcrum arfucro liquiriciect mcllc.iiquirida 
mofticaraafublingua rctcnra fmmctafpc// 
rirarcm ftomacbi ci gurtuniommgar. 




Capttuumwflt>. 

^L 3gufttci.f m Dvafco.cap\ Xiguftici 
iSL*. m»lfunafcifinliguriapiHncia.vndc 
< sa ^>a nom2acccpif.nafcif ctiu montcvi 
rinoalpitoifed.auespanacem illumvocant; 
tdco q:radi,cciu8aIbacftcrodo^ta(tmu[pa 
nadxuivirtuevnacftcupanaao^rurc. wa 
faT in locie alrie et a fperiect vmb:ofle. virgl 
babtf longatfnodofamfimile amo.3n cj 
virga foua funr fimilia mclliloro.£> cd molli 
)oia a odo:ara:qucfolia in cucumcre ramifti> 
mafunrert>utifaO(n virgc fumirarccaput e 
vmtaaculofum.Ubi fanen oftendit . qrj fcmc 
nigrumcftcr oblongum ficut feniculiguihi 
x ifcjdum cr odc:arum aromancum. 

0pfrationt0. 



fDvaf»a'c^.airtuecftmiaiJslie.*^9d*i)c 
ci9 alba dt ftmilis panaci cracleoimco i odo* 
rara.Uutuecftradictefemini ciue csltda^t 
ftiprica t>olo:ib? oito inrranco?. occum't.3n 
namariongftomaibifoluit.f Jaitovcncna 
tie opirulafrcuna.puocar :meUruie impcrat 
(i bibaf^nridotifcp colicie^pfunr aur mifccf. 
f "Kadijcciuerunfa cr fitffolira idc pxftarxa 
dijcauectfcmcoicipoajeticccflcmifccf confe 
aiowtomat>igcfribilib3Vrilitcf9dbn)cf:qa 
eultomaca di.vitdc mulri ducetpfiuepttum 
ric co.p pipcrc vrunfpditurie mifcentee: 
$ tt mfti feme fifdri? fc iumculiaddutilk $ 
dam vmra q ctv lcuifitcu fcdfabe. 




€apitulum.ffl£ 

*k 3mon.^fln.capi/ftafit}.Xt'rnofrit 
jJL cfu8puUba'odo:atne:plenue (ncco 
< *^*acctofo valdeapro falfamerie.j£r ipe 
crf a comcditur falc ccdirue.nufqj mcmini me 
fccipo lcgific apud a uro:e aurenricumifi ap$ 
3uiccnn3inquarrocanonc©ccura fcb:iuj 
aauanimingcncrali.vbi iubct sari aquata 
acerofitarioJimonie falliti. 

Capttulum.rdjr). 




3) 3naifo£ancfecta.ca.DijC.Zinaria 
3gL cft berba fifis efule vfUno^fqti vo '> 
*^*catur,z ©iifertab efula .qin efula lacre 
fcir. Unaria^o no.untf ^fue.^fula laetefcit 
line lacre linaria crcfar. f £> paarionee. 
^Sfuccusausvaletcotraberifipilasinun^ 
ctus.i cnm fucco pimpinelle mictv. f £ t ipfa 
folavaletad canaii trita ctimpofita.adboc 
fimiliterfucaj8a'u0valet. 




Bt Sjtrbi0 
Cammumt.tdja}. 

^fk 3nu.3fir3.Xinu cc fre nireri fpc o:t7. 
SRm. nomeulpfir a greco. vcl 06 lcue lit ac 
■^^*molU.Bfflu aut eft gcnSqdda lini m> 
miftcadidiac nobiliflimiq^ grcaepapatcvo* 
cat.f i>alf.3nfe.mefe sUquifcmeUnt Uro fo 
lo fpargur.t Una pfeqttuf eulta.f 3dc lib. ri. 
3» mcfc octob:i lemc lini fcri por fi piacucrit. 
qo tn,p fuimaUcia fercdii no cft.q: tcrrc vbcr 
epbaurir.f5fiveU6locopingmTfimojmodicc 
buido fererepotcrl.aUq macro folo fpiflum fe 
rcnteejliaflequunfvtUnufubiilcnisfcaf. 

Bpmtionm* 

f ©eraai.ag.au.0af.nirr5ci9c q fubfiliat 
z .puocat v:in5 z tncftrna.z qiii bibif atir fir cu 
co cplaft? pfcrt aparito epatf z orificio fioma 
cbmpiftoaebo33 ramcufvftiprieitae cft 
aplio: ftipticitar e fior?.? eahdirae cr? cft mio: 
caUdirar c iptf.^tfeiSlliptteir atcm acqrir qd 
admifccf cumedicinisq admUiranf ad fputii 
fanguis.fSaa.au.Dvaf.ilosetfcftfilpri 
cusftipricirarepaucaciilefacriu^jmamrariu'? 
% eft ca.qfi i.i.gra.? cft mediil i bu.t (ic. Er.tj. 
eius $& eft cr mollificariuil. fSef .U.a g. r a» 
bararicbicbenct.Unu emollificatiuu fcdariuu 
©olo?.? pfcrtcgri*dtkointcrio:ito:nifi q: cft 
minus iB 03 camomilla.tc mcdiii inrcr lapari 
uik Itipticiirz admifccf ieo pa^ttut^puoca 
riue v:ine.et 15 qdea jparet in co manifefte qfi 
eomedif aflatu.et tuc e mag^ puenics ad ftrin 
gedu vetre. f fct oij.it i U.oe plcruaticc fanira 
tiscp qnfemeUniocroquifi aqsciSfcecoctio e 
infriguiariua.f^tidcau.pY^^i^femifl 
Uni c fitis ^turi femis fcnugr eaV: qii admifccf 
cu aq melle z oleo z ccdcii: rcfoluit apata ca . 
smolUficarea fiue fintinterius uuecjcrcriue. 
ct qn fit ep eo emplaft? cu f icnto ct nirro •oelet 
pannit z pultulas albas faciei. i.paputas f m 
trafla.no.f pyaf.jBtqn pfiaf eii aq refoluit 
apata q ftit in radicc aurisx-z apata xmra. £t 
qn coqf cu vino eradicar fomtica z fpecies vl? 
ce? q t>icunt" faui/z qn mifcet cfl meUe z pipere 
ct vtif c\e co mouet coitu.-: qn mifcef cum na 
fturtioqnrirateeqUcofmfctTfarievngiuucc 
eo? erxoriaridi.f j£t fit ciiioccocttoc cius cvv> 
ftere ad mo:dicationeinteln'no? •zmatriris.z 
molUtventreqnmfierc8fedetint>ecocri6eei9 
pfertaparifomatric^ficutfenugreai.f'j>au 
Ut8.ca.t)e Uno.Xinu qn coburif. jfunv? eitis e 
fubr it.cr cdfert cori5c et fuifocatioi marru te, 
f Bui.U.ij.ca.rj femie Uni.airt9 elta.puina 
^turi fenugreci i.i.ca.c6mefurarfi in butditate 
?HCCitate.j£t tii c\\e q» ■oaoaio lini dl t>eco 
q it) 










*> 



i 



Kxmtmm 



& 



•&> 



-B 



ctio recctis ci£f 3 n ij>3 cm cft buidttae fup? 
fliia: ? marurariuu et abftcrgit et inflar^ter 
buidicarcfuaTupflu.iara criliudqtfqceo fri* 
tatcft.15 agircu liiptkirareq infrijco manifelte 
comcfura ta :et in no friso manifeltc per mijcr a 
cu lemficatioe.? eftfedatiuufcolo? mutfqka 
momilla/z cr. ipo fit cmplafi? cu nitro z bolo: 
etlcnitpaniirzpfCTtpaioivnguiu z fciflurlet 
fractur$eo?.f £tqnpmifcef cii eqli mefura 
nafturctj z coftcif eu melle : lenit apoftcmata 
c9.cEtmo:asintcrio:a.f£tapoft£inaq?5e 
poftaure8Cu^qcineri8?ap^taT>ura;et£btf 
betfpalmii.?,#:iepcrione vnguiu, cii permi* 
fcetur cu cera i melle.f £t eius mffumigatio 
cofcrt co:ije.-z fitr fumigatio ipiue lint confert 
fuffiflegmattcc^ieq^cfteiccoaffafij, u 




Captmlum.ftlftft 

3j ^nguaauie/JMa.Zunguaauiscar 
WL> , bo: z bjfolia p_ua z acuta . Ugue auis 
^^*?fo:mia:? ein.i.g.carf bu. f S>cf . lu 
ag.ca.lifenbafafir.i.lingua auis. £t earbos 
(ttis arbo:it>irdar:uifi q:foliu ei9eft logii ftfe 
folio amigdali.etfruct9ei9cj[6:Imgua canis 
fntracemi-zpalmitescioiuidunftncberarn? 
filesfolijsoluta^imfi q:fitt mino:a fatisu 19 
tra qullibet cberarnSlcft medulla fitts linguc 
fittis^tcn^mb^^ta^albavwUnaepaii 



lulfi fld citrtnira te.fapo: cius eft a cttt?:mo:d{ 
cntiuu6cupancaamarirudie.j£tqponitci9 
^mrcca.innne.tj.noelongafaveriracauoii 
uenics cft tncerc cy cu calidirare fif bihdirae: 
q: no apparct mo:dicario eius poft cfcbft mai? 
(iicaf.jgr fciendu q cft alia lingua anis qtie e 
fcebititas ItomacbiuT.puocae venrre.et e co:* 
rigiola maio:.£t ilta no cft illa tse qua locut9 
cft.©£f. r RaidcmSrcra.in.c9.t»eaugmenti 
bu8 in coim nicif :cy ligua auie clt lingua pai 
feru.f3tcide©icitin.vtj.inpfectioepilU)la? 
3nda?cyaffimilanfpelliculivelco:ticulique 
eft in medio bacce lauri.f 2luice.ca .T>e a ugg 
tib? in coim.3nrer medullae copurar.non eft 
ergo quaponitSerap.etSuice.bcrba.fcd 
cft pma fpeciee pcr Sjcra.fccfcripra.videqft 
poni tur fimpUater pma t>cbet inteUigi. 

©Pfrattonfe 

f ©cra.atK.SbemefuaY.£6ucnit t o!o:ila 
tcr^rz.puocat v:ina :auget ifpermaterj co:ro* 
bo:9tUbidme.f£tideanc.Damafctni.?cd 
ucnitcardiace.fj£tideauc.' / 6edigurae.ati 
gct fperma f £t ideauc/ft afi8,*£:obibet car 
diaca:7augctfperma.f£tt'dcmauc.3faac< 
£ft ca.s buan.i.g.ett>electabit , :ctt>e > |paetafc 
ci9 eft cofojf are Ubidine.f £t a ugct fperma * 
ct b5 f^tnte bumccfadi comefta cu Carnib? vd 
alti8.valetfttrc©traficcitaiepectow8. 




BtHtthia 



Capitulum.rtlriii), 

•^k 3fimaebion.fm ISyaf.^ptto oi.&a 
5gL ftae bab5 maiozee % frutruofae.drca 
^^*qiiarii nodoe folta minura bab3 Mci 
firiuUa.flo:epurpureum aur aurofum , nafctf 
turlodebumectie. 

sE>pfrationf0 

f Dvaf.Suctfbci be butfftiptid e.Slgtn^ 
ne reijdetito majcfe.pdeft. piflinrericie porui 
T>ar9 1 fuppofft9fubuenit. f jltim matrieis 
mulier} abftinct fuppofitf. iflaritopfluentctn 
fansuinefronriilUm't9ftatIftringir.Oulncri 
buereccritopacolcfimfacir. f&erba fumi? 
gatioe addira vim vcneni U5gi9arcer;ct fozi> 
cee ocadit.f6ar.vti .fim.far, ca. lifimaebion 
pdnanrc bj ftipricam qUtare^jprer qua ct pla 
gaeeoToUdattfemozrofagiaeejc narito fiftit 
onplaftratiT.f £t alia? etia emozrofagiarit 
idoncu cft farmacu ipm.z eria fuccue ciue aM 
buc ma gie er bibinie ciffinrcriae et fenguts 
cducttoneeaflujcnmmuliebzcfifiir. __^ 




hi 



Capitulunutljeu. 

3dum,©era.ca.badarb.i.uciu.:ba 
bet tree fpee.vna earuj eft indica, £t 
alia ft cy berba w ^drur %mb 



fiuc ferr.ab.£era'a cfl arabica 05 noia nt bti 
datbiid cft lieiu.£rideauc.p.rafco.Xiut;m 
accipimr cjc ai bozcfpinofa qtie babet ramoe 
longinidine 'oiio? bzac bioul attt amplt'9. £ 1 
folia funr fimilia foltie arboriebuflirara.? ba - 
b ct frucnl ftmile p ipcri:ct d t niger : amari fa* 
pozieilenie racni.er cozrcjc ligm eft glaucne f{ 
milielicio t>iflbluro.ec babct radicee mulras 
^pcedcnrce a larere ligni cine/Rafaritr loc] a^ 
grdtito.ercjtrralrimrfuccueciue inbiic mo? 
dumXtrunffolia ficurfunr cu rora arboze* 
aur ponunf tri aqua 1 tumirninf plurito t>ieto 
et coquflrur er citpzimunf . £ t fnccue ponttur 
ad coqucndu fup, igne t»onec ingroffef fteue 
meketStfuniUecjcfucco frucrue eiue quldo 
cjcpzimif ctponirurinfolc. £rmdi9ejc eo eft 
illud ofi accendif igni.et quando ejctinguff fa? 
ctt fpuma:cuiue colo: eft fanguie£t cjcreriua 
eft nigr0.ec inrcriue ef t ficut croaie, et non eft: 
pingue:ctcftinco ftiptiatae ctt amarirudie/r 
cjc illo meliue ef 1 3ndfl et fbztiorie oparioie^ 
3 dulreraf aiit lidii cu amurca olri: m admi; 
fccmr in coctura aiie et cii fucco abfint bei et 
fdlebouino.£topoztervreolligarur ejcco 0/ 
nararfirefpogictreponittirad opue medictf 
na^ oculuet refiduu poninir i altje mediaiiie* 
er ii cr indjcu fiic arbo: q t5z licioe. £ r bec ar 1 
boz cftfcc Ipedcto fpine biie ramoe erectos 
logirudinc rrifi bzacbio?jaor ampliue,pcede^ 
tce cp radtccet fiinrgrofiioKe ramie rubiX t 
cuellif ei9 cozrejc facile.T coloz ciue apparer Wt 
cut coloz fanguinie.jp t folta eitie fun r filia fo> 
Iqeoliue.etectlla arbozc accipif liciti fciliccc 
ab illa que eft fpinofa.£t cft apud noe medi? 
cina quafi bumida % Uquida. £t fubftatia ei9 
cft copoftta ejc^mtc fubf ili.ca ,1 terrea frigtf 
da:t infapozcciue eftftipticitaemtfiqz cpati 
ca.^Ua feciida fpeciee eft que fit ejc arbo:e li^ 
doefiuccjcacantum appeilata.folia quercus 
fimiUa atcpfptnofa gcncrane. 

^perationre. 

f j5alicn9fmtraflatione grcca.l? farmaco 
adipopia vtunf ct adftegmonce .quiiri ano 
etozctvlccratideeetbcrpetaectputrcdinee: 
male moztgerata vlcera z auree pue rlueree : 
et paranicbia et vnguee lepzofoe, 
f j£t ide f m tranflatione arabicam.virt9 c& 
cft quc remouer cr i puptila cjc co cv obfcurat 
vifum^ conuenit flutui ventrie.et babentito 
vlccrain inteftinie:et babcntibueflujcu men? 
ftruozum ,£t ponitur in medicirue panni que 
fitinfacie. 

^fitinmedidnie vlceru et apoftanatu quc 
funt in o:c % in ano % fo:miff , j£ t eouenit vl^ 
q titi 



H 



Craffstus 



£> 



ti 



«rfcrtrandiilcft rf mifrcdifo vlce? cf ptifrcdi 
niiurui-zrenafmoni zpananrio :?fo:tifuat 
capillo&^Scra.au.-DYaf.tHrtv Ucrj eilipri? 
xa i t abif crgir ? curar obftorit ate rifue i fca ^ 
bic -z pamru octb?:? ab kindit curfum bumi* 
ditatu ad oculu venictiii curfu anriq* i pucnit 
?aparib?gumtrT.f £tqn liraf cu co paUtu: 
couenir aparito gurtutf . i qu liml cuco pueit 
gingiuis i vlcerifo purridis z ragadijs ani:et 
tenifmdi.f £tqnbibif' tfiteueo criftere W/ 
nar tlujcu vcrris anriquu 1 vlcera tntel linoz.i 
bibif $ipo cuaqvfegadfangutefiujriLslpu 
tu languis cu tuflin ©af in potu moaui canif 
rabiofi.f CUifiutejceo pilluleemra ct rub:i 
ficantcapilio8:etcuratpanaria'tietfo:micain 
ct vlccra fraudulcta.£f quado fit 01 eo nafca 
leconucnitnujaaanri^buiditateamatrifc. 
f £tT>iar.0n coc\f cu ramiseius i accro: co 
nenit apatib? fplenis ct YCteri. tc: z .puocat mc 
ftrua, £ t qii bibif cc fructu ciue lavat flcgma 
et cdueniteotra medicmasvenenofae. f £t 
ide £>er a .auc/Rafis fcUcabaracb.atrtfcft 
copofitacc c6trart}f«.'H3bjvututee J ,tenua? 
to:ia;©igelto:u:ca.et fri.t modicc (tiptici ba 
bes vimvz ideo T>Yafo:efim f acit .paucei po: 
riganc. C'itfacuautadipopii bcrpctae cc 
adcpati8vlcera:etadparorida8;ct putrija 
vlcera:etconucnuvlccrii9oU8aam. 



O n birie f m t Yaf.Xoncbirie I fFc8 
gladioltfolis bn8po:rtiifca:fed Urio 
'raetrufa.mlra8bn8ft»e rflfeiieerir* 
gae fpanfas fug rerra;cr ramoe fug rerra icf 
eliueean c\b? funt flo:es fiUe peiUancfed fotf 
ma co? vr gele eft: ct album bj in medto ftc uc 
roftru et Ubftnfanmet ftcut Ungua i femc ri9 
Unccc file et rrigonu er longu.vndc cr lonibi 
rts appelUru e(r , Radiuft et fifieaauco.na* 
fafioct8afpcri.T>li.ca.Xontbiri8.foliab5ni 
bicuda.fcmenigrutiiccamedo^ccl^o:apatcc 
% oblongu initlirudincUncea? r9iiccvit»au 
cusOtan DYaf.tfttfccmgenus loncbms 
fo.babcrtefiaufcolopencinaetafperio:a. 

^prraricnra 

f l^liniue.Uulnenb? ipofita foUa a*9furre* 
re tw admitrur.Sibita cuacero fplene ficcat . 
•Radiv eiue cum vino btbita vrinam.puocat. 
fSaf.vh.fim.far.ca.Xoncbitl.giusqdefc 
men trianguUi ficur lancee fm figura. *Radip 
quidc fimilis eft aUqlitcr paf; t'naee.cr < fprcrca 
v:inariuueftfarmacii.f£uieveroc\ fimflis 
ctt fcelopendtie foUa viridia quide ad confot 
Udiratc vulnerii fur idonca.ficca rcro E 03 f 
mcl bibita fplcnes filiridoe fanat. 





Bt$)txbi$ 



CapirulunudjEufj. 

2& auc.DvaCXarmii&f.Xijpm&gftit 
**fr-*ex. lapinis qmdamvt TMcumr rcgalce: 
er funt ftlud trce:quo:um fotia funt atbidfoia 
fcomdlicfe.£t qufdam funt tiomeftici.ct t>o 
mdnacomcdunmr poQ coiutn claatfonem: 
et infundunmr m aqua pluribue t>fcbue t>o? 
ijccreccdaramartfudo.t aenerant bumo:ea 
^oiToa6a!icnuari.fun.far.cap. , oelupmo 
f mtraflarionc' grcca.£armS:icletapin9. co? 
medif qm'dc©ccottue:-<:mulrie t>idx> tepo? 
tteno amarirudin-; in a qua.fircg cibue grofib 
imbnnto?vrfarmaaivaobictalieet:em* 
plaftiae eft qui non baber a marirudinp.cteft 
abfterfiuus t ©j a fo:aicus. 

f gaUawe. ©upcrplafmarue uecat mm# 
baeoe.Odfi qui9 ipnimbip.it cummdkvd 
oci^tccaro linc crfent ipfiue t>ecooio nata e 
lumbncos educerc.tmo t fufifiifa tcftaiocd. 
ueitif mo:feis i fcabfct ct cincrenfe cr raa.u> 
gnis vtccribo.tJoc quide abftergcndo alla v c 
ro confumcndo:? (inemo:dicatioct>eficcanl 
do ecp^rsaf^apcriropflanocscparie-z fple 
nis»llbibaturcumrittactpipcrc: attrabit ra 
menftrua qjembrioncecum ntYrrba et mcllc 
flRjofirus. 

<fj .£ft:wtcmctip{iu9 farina fmmo^adtcr 
9¥afo:crfca.non cnfm Uuida folum fcd fcrofu 
lae t fimara wira fanar.nincemopowet coe 
inaceroroqucrc vcl opntdlevcl o.usuccara 
iuoa complcriones.viddica parief iununcc* 
itonpamoni80irTcrcnriain:cogitantceilU!cI 
quod oPo:rcr.non di aurcm p:cfcnns nego? 
cn tiilhngucrctalia.tJiafoWf cnimct liiudaet 
rcf cra omnia quc prius t>icta funr. 
$f Dccocrio cr i am ipfa fa.rina nar a efr faccrc. 
Xatiitosagiioevdktpinueagrcftieffiufm 
iicftric amario: dl et va!idio:in ommbueto 
mclrico eft ei (imilie cri{reii3 fm gcuue. 
ff £t idem f m tranflariancm arabicam. 
4tTi'rrue riuf prima d r que t>d*iccat ffnc mo: 
dicarionc.etfecunda abftcrgira rdbluft et 
madiffcatt aperir.t terria oradit Uimbacos 
quando fit c£ei3em?laftrum eiteriue: ctqn i 
' docomedunrurmdlaaur bibtitur cumvino 
admfea aqua erf arina lupino:mn rcfoluunt 
fincmo:dtarione. 

^fctcurantliuo^ect apoftanata ct fcrora* 
lasquando coquuntur cumaccto et mclle. 
£tquando fitcmplaliVum cumciofaariccco 
fcnwr. 



g £t cofcrt cmpcrismitt vlceribuecapCtfet 
fcabf cictbotbo: ctvlccribuefraudulcnrie. , 
^Et quandobfbiturcumruta erpipereapc 
rit opiUrioneo cparie et fplcnfe : ct piouocac 
tnairua.ct nafca lc cc cie cmu ntdlc am^nbi 
c]cpcmtfcfum.£tfarfnaco»imfacftboc.lnpi 
nueiilueiinsvclrcgalievalctadca quc w? 
aafunr. 



t) 




Capttulum*fd£irifc 

aputu^.3o.mc.ca.ticvolubiKi}ir:c? 
lu pulus fit fpccfee volnbilie. Tiorait 
>dum crgo cr pUirce funt fperies vola 
btlie.oua cft quetucirur nmj'earbo:um a\i9 
foecftatbus.cr dtficuttuba.ababctlar.ee 
vocaturvolubiliemagna.jEtcft alia auua 
ramf rcpunt fupcr terramct fupcr ramospll 
rarum,qnc folia a fto:ce babct minoic&n t>i* 
ctfurvohibilfspama. Eteftatiafpeacs rfue 
babcnsfoUafubalbida ct tanuginofa :cf ba? 
bct lac.Ef cftfpccieealia afpera babcne fof 
tiacitrullf.cu«ue rloecft ffcutampulle adbcrc 
tcs.et vocatur lupulusJDe qua in ffto ca J?af 
baurmctio.£fcftquartafpeciescfuscuivra 
diicdtfiaitfefcireiimtniagfe groffa mocll 
groffftudoaue inmoducuairbiic maio:ie: 
ariiieiiapirccclcujturfttpcr radicau fuaitf 



V\ m 



Crartatua 



drdfcraibCtus^uoerrfottaduefmitftricta 
iwa in mcdtu fagitte alat c:q cjcleui cl fiuut cc 
b5l3c:2TordfT>nstacfiamo^.£rejt:eafitfca 
monca.vf babcf inca.fcamonea t>e.8.£riam 
in ca;volubflimacv.inuenic8t>c^futc carii. 
lupulus $o cft ccjlis ad rrigtditare fcedinans 
^©iufcr-elhnprindpiopami.tfdtveriue. 



a «Do.mc.Xupulu8 fcdatiu^eft t>oIo? calido 
** rum C£tinctiu9 innimattoml cr lenrriuue. 
•a <fl "Rccrificario magna3p_if o:ifu ia vcnariT: 
a fljrcr qS mifcendu cft d altqd ec x>*a ga nro ct 

mafiice.?recti9crTtgo:atogarioneriue. 
c fl iltaqua cafci aim fpica cr maf tirc.£i a W 
*" is vcro volubilibus traaerur t>cea.volubiu i 

fcriueoe.v. 



^ 11 




ilipy 


^ 


N 


m/f^^^t\M 


i /\\yy^j&«wL5Y -A^ri I II i i 


tV^r^^^t^^S 1 Lil 1 \ 


vS^^^^fei^Uil \ \ 





«Capirulum.rrljdir. 

He.^cra.li.aggrc.cap.Xden 9ucr. 
6atXden.id cll lac. £r mclit) lae cit 
i^nu naturalcno bjbesinfcaionealt 
cuivalreri; bumo:i8.aur fup qo* no vincir ak> 
qua qur36.£c dt da? in quo no cfl turbulen 
tiaaliqmecgacuitasnecpfalfcdo.imo eli iit 
co oulcedo pauca.ct odo: dvcft bon9. % lac c\ 
dan qp dt btnoi di fllDqo' generaf cjc langtsi 
nc fano ieparatoab omt maucia.ficfamSlac 
citmulim8:-imartecui9co:pii6dtfanunori 
aruiquefcdiuuati8.puUb:crcperatecopleiLio 
me cur,nummefu cs i bonu gencranuii b Ono 
runt bumo£.£r poii eii lac animaliu c$ naru 
ra nodi tlongata a natura bomie.fcei df#>c 
nartiraboi£,,ctodo; carniti ftgnificat fug bo* 



nirfltclacrfetfanguTediie/Ra fut qucdaro 
aialia :quo? carncefur feride. ficut camcs ca i 
m'e:lupi:leonie;camcU': rifi.i qucd3 catnco 
funr boniodoris ficur camee po:co? ^catdir 
caprarut boum:?cqua?-z afinarii i fcamula* 
rumiacco^qtiecurrurmrfu ifto? quo? ear* 
neocomcdutttetfplurcebolm/Raruranleri 
co^efl^inquanaturcboie.-z.iprcrbaiiccau 
fam admtnflirar lae capza?:? aUo? s U lium 
vr boum? fimiliu.? fireafeiieejceie prercj3 et 
Iacre^ltnino.*f>:oprcreaq:cftaquofumfi.b^ 
rilencbabcegrcfTirudinciac^ovaccarueft 
groflum.£r lac cap:a? dl mcdiu inrer vrrucj?< 
i lacquideeft velocis alrcrarioiequadocan* 
gif a calidirarc aerie.•; fptcr bac caufam %ctf 
pif Q» fugaf es m."milta ncaUerer i£ m acr. 

j^pfrarioms* 

£>era.£ rlxquidccft copoftnl er.trib i ;fub* 
ftanrq8;falica cafcata :btm'rofa cr aquofa. 
£r qiiru cognoucrie bas fubftantiae? fcpa J 
raevnam ab aliacattfa mcdicaficieanucntf 
ee er vnaqucq? tpfaruro babcr opcra not m,p* 
p:iam in via nurrimctter invia mcdirincef^pi 
prcrvicroriampinguedinie fup tacvaccara 
acapinircrcoreco^ra. 
f Ctmru vero acdr irurej: lacrc raprariuvac* 
c arum cr ouium.io cd cafeue eft lac coagula 
tum:T ficcafaie non efi lacntfi cu reciptr coa 
g ilarioacm ct cafeirarcm. 
f "Rafllt laccoagu'af fupcr q6 vtncir gro0 
fidee.tale quidc cft fa i ilie cois gt la t \c ie: i fct 
paraf U dle qn ftf cafcuc cc fubftatia buriro^ 
ia.^nlacrtvacra^cftpUte.-zqnioagul mr 
aufcrair ab co burirum:er ftc r afeue pinguie. 
£ r quado caftue vaerafcic gcncrar rokrcnr. 
cr boc fignificat fapo: i oioi ipfiue. 
^*Rabimovfce cap.t c tacre. 2>ac po:cfnum 
clf magis c onfounc poft lac mulitb». 1 1 tac 
eo:nimpirmaliaam bumomtn malo:u.Xac 
cf iifnum cft bumidiue omnitaac cr n tnoy 
riegrofiicid. £f lacvacanum cftpinguiue* 
£rlaccap:inumdi mcdium.Undelac nodt 
conucnicnscapirincc Uirctibua aptvadren 
roftcatcm. 

f^lmanfozfraaafufertioea.ticlacfc.lac 
reccr er muliti tcperaro cnliir vianu:Uccc fhgi 
dirari i bumidirariparupera|p:oMmer.Unj5 
(O^puebumccrar: impinguar.£iu8 ramen 
conuerfto cft vclo,r.quap:oprer acurc ftb:icn 
fibU8Vclquibu8t>olo: cat ins etbunweac 
dderir.colcricie qt; o q-- quitme fiigidecjc con^ 
fuerudineaccidunt cgritudince nulto modo 
cfttribucndum. 
fpYaf.ia.ccIactc^mclacgcncrafbonii 



BtiKtbis 



cbimM.eteftmn\tintMmcntixtmomven? 
trcmst comicnir ftomacbo .et iac quidem ve? 
rfe cft aq uofine eftiuo . 
fl £t Ucammalis pafcentis bcrbas recertf 
tcscftmagis mollirtuum ventris cp pafcen? 
ri8baba8ficcae.£tlaccap:inum eft minus 
moUificariuum q$a Ub:um aniinsltum .quoni 
am cap:e vr plurimum comedunt berbae fti? 
pticae et.folia arbomm.ct p:optcr banc cauf 
fam eftbonumftomacbo.S>cd lac ouie eft 
fpifMmT>ulcectpingisc.'Roneftadcobonu5 
ftomacbo (Tcutcapzinum.Scdlacvaccijru: 
aiinarum vfequarum funt magie lacatf ua £& 
alio:umanimalium. . 
«ft£t omnc lac quando eoquftur ftrf ngit vcn 
trem.£tmaumcquando ficcaturaqua eius 
citm lapidibua 6alefactie:ct conucnit vtcerib? 
inteltmomm:er inreriomm memb:o:um.et p 
pzie illie quc fiunt ejc gutture ct canna pulmo 
nie-.a retubue et inteftinje et vefica. 
^£tquandoabluituroecumlacte;comjcnic 
vlcerib us eiue ct gargarifmara cum eo confe 
runt vlceribus palatf :fed nouiter mulfum elt 
bonumbibcnribue medicinas mo:rifcra8.ct 
illis quifumpferuittcantaridce. 
fl.£t lac vaccinumcft ad boc mclfue omni a* 
lio lactc.ct la c aff nt pwpric quando colluitur 
oe cum eo confo:tat gingiuae et ■oentce.Xac 
vaccinumctcap:inumctouinu:quandovnu 
quodc&eoquirurcumlapidelirtorie coucnft 
ftujcui vcntrie ct vlceribus tnteftinomm ct te'/ 
nafmonf. 

f £ t quando fit criftere cum co folo aut cum 
aqua o:dcf aut cunujecoctione gummi qttod 
t>tatur ca udarc fiue bandaim fcda t mo:dica* 
rioneeinrefiino:um.etfitcrilterecum eo vlcc 
ribusmatricie. 

f Dmnep:etercalacquado fugirurejcmam 
milla ipfa eii magieiuuariiuimrmlociue nu 
mtiuum.nec^ttaco:rumpitur.j£tlacmulie> 
rietmkiue cft et nutnbiliue omni lacte: ct cd 
ucnitvlceribu6pulmoni8.etponimr fneo liv 
banu tritu:ct •oiiToluitur in oclb m quo cf t vn 
gula aut vlcue et conucnir . 
^Etquandomifccturcumeo fticcue papaf 
uerteeteera etolcum et liniturcumeo fuper 
podagramconueiu'r.£tomne laceftmalum 
iplenietcpariegroranaetfock et cpilentie ct 
fcotomicetcgritudinibusncruoaim et fcb» 7 / 
bueantiquis. 



€apitulura.a1jE]E. 





|]2lio:ona.*f>la.!^afd!? 
ranaebcrbaqaUono? 
miefamfuc9 «5: ca.?fic. 
(n^.g.ffoieetfccifco 
pertlt vfui medfcie.jJgif: 
ineftatecollcctacuno:i 
btteivmtoofolocose; 
ficcaf.ac p annu feruaf , 
^af.vin.fim.far.ca.tocfamfuco.S^ubtiUug/! 
riu et t> vafojctiec ^ruti; .ficcat em i calcfacir £ 
iq.g.Scf.b.aggrc.ca.^crjcm^auc.Pvaf» 
^abacbne^gaecctefaefuijfacietVelifuo 
bo:tu.£ b? folia gua roriida fug cj cbozrafai 
filtae folqe eala mcti bntie foUa fubftU'a.et bj 
odo:c bonu/jlde auc.jSaf.UirtfePelt q" catef 
facit x fceficcat i.irj.g.-: ty9 et'9 cft q rcfolutVet 
fubriliar.3tcci;aromaticirare$rure b? ?fo:? 
tadi.i ejc qUrarito fuie ©ificlucdi: j>fumcdi et 
mudificadi.a uicen.*i£>aiojana cft ca.ct fic.i 
it) .gra.et eft fubriUe cu fo:ritudine; 

Bpmtimim 

f©erap.aucro:itateabcnmcfuay4^iilintf 
cu fueeo ei^lug iiuozes fanguf rtie mo:tui a iV/ 
ferteae t eqpterbaccaufamapponenteevem> 
tofae vngdt locit poftventofatf one cum eo vt 
nd appareant cicatricee fcarificationie. 4f£t 
qn f it caput purgiu cu eo couenit colori capt 
tie majrime mclancolicie? ventofirari ccrcbri 
et agitoptlarionea quc funt in eo. cr p:oprer 
bac caufam cofcrt epilcnrie x paralifQn qua 



n 



3 






Craftatus 



£> 



t) 



^dtttaffrcVapuffuu adpoftcriota.cr atteri 
paralifi.ct ro:rurc ozie? cmigrancc. arrrabir. 
drtoiiidiraresmalaea cerebwrt pucttmttu. 
f £ t fit olcu cu ca ct cducnit ad oia fupdicta 
f £t qft terif maio:ana ficca:t pficifcu mcllc 
cr linif fup. Uuojc q fit fub oculo aufcrt ijpm ct 
ecprimif fuctfeic ca t>u eft receef £t fit caput 
purgScS co:et mudificat ccreb?: •zpucnir e* 
gritucUnib?d9rrigidieamelicoUae.f£tqfi 
imbibificocotuautlanactponifiaurcape* 
ritopilatoc6ci9.Sit*rautfacitoIeumci9.j£t 
caleracit mfiee.f ufi T*a(ie£>tcr aromotici 
tatefimcaliduatectfubnutate pucnit oito 
egrirudib» frigidiettpfotfar cercbf % oia me" 
bxa.f ^U.ca.!2£>aio:ana vircebj acrte 2 ca 
lcfaaoriae ad oem tmriric vt'rigo:e valdc ido 
nca.*z£>cdcf eriacarbaplafmatitoipofiraffy 
uc potut>ata:a fco:pide vejcar i ;« inreftinoui 
tounef vcltufTicuUare micme labo:a»ree. 
f£UKaturari9Ydropia'emcdtf.Urina,puo0 
carato:riditovriUedi.Succ9ei9mcllead0 
dito U'uo:ee ©eragir,*5>co:ptonu ricr9cu acc* 
to 1 faie cdpefcit.Xucraridit» bfi adbibef.ce* 
rofi8vtiUcradbibef.f2Jimo:eeoe6co^i6 
et oculo? catbaplafmatifo adbibira fpargir* 
ma]decupoletaipofita.f3teap;ofitefolifc 
purgaridie marcria,puocar. 3n f«mie**£>aU 
ginaribue ct acopie mifcerur bcnc 



€apiru!uiti.ftl)E0. 



1 M f \ 




SrieXdftant tttf i li.grad»u air, ffo 
|ciemufcarearbo2ier3mo£co:rct <ft 
maci6qabindiavcnir.cui l /narura ca 
' Uda cft er ficca in tcrtio gradu . f *£la 
reari9.*i!~>arie caUda e 1 ficca.inij .gradu.6 1 
f m qfdam fioe cft mufcat e. 00* vidcf fa ifom 
cfTcq: fio:ee aut t>c«duc aut tn fructfmuranf 
£>unr aiit co:ricee quida qui rcpcriunf circa 
nuceemufcafaeificutcirca auellanaep. an? 
noet)eccferuanf.l'5abentcp^tutepfo:tandi 
cjcaromaricifatcioifloUicdizpfumcdicjcqua 
litarib? jEUgcdue elt aut macie roftue vel fttb 
ruffue a curii babce fapo:e cii aUqnrula ama 
riruduie.0m'^o nigricar rerraie cit.i qui fa 
po:cacuriin6babetabtjciedue eft,S>cra li. 
aggrc.ca.fiftofi.3iftofu.maci8.£teftco:^ 
tctnuciemufcarcqeftfup.co:ticcgroflu.£t 
mcUo: er eo eft ilte q eft eolo:ie fufci.a t ef crtf 
o: ep co eft nigcr.ct m co:tice fcuro gt oflo nu* 
ciemufcarendeftaliquodiuuamcnru. £5cd 
ffucrue ciue di vtilie medicincct o:if in o:ien 
te.Brabce tictlt quide cp eft macie.et dt coj 
fcjcquiappo:rarurt>crcgioncquenodtgre* 
to:um.er coto: due cft ftauue. 

^prrattonrs 

f fc>Y«t .ea.macbil fiuemacbir fm tranflanb 
ncm grcca.f.macie.£orin eft Ugni venterie t>e 
barbaricoxoiorie rufrt cuj robo:e folido. cui 
virtuecftftipriea et remo*dcn6c|majcime in 
gnftuXunfaabibuacmoproicie ersilTinre 
rict'ecrfdU'acielingutarcp:eftatcf]'ccrum. 
^£oUeao:bni$tepo:i6maa'8 eftcotfernuf 
a'emufcafc:quiadbaaipfidrcuqnact3Vtpo 
teft ridcri in bait>uUe auclta na^.er mulrorics 
vidi rurufrj ficdTdtcet fcicat t>Yaf.*z£>acbir: 
id cft macis cflfe co:ium ligni crro: dt tranfta^ 
to*ie.quia t»cb ct x>ki co:ium ff uaue: v t par c 
bitincapitulo nucie mufcatc. f0af.vri.fim. 
far.ca.t>e macf f m tranflationcm arabicam. 
£>liaftar ftuc ^aliflfar.i.mac(e: eotfcjceft qui 
po:tanjri*)cindia:tnguftuquideftipricu6fuf# 
ftcientcr cumbicui quada aromatidt ate. 
f £\m autem aduratur eft fimiUe plunbue 
9romaribu8int>Yam'8:afubUafiadurecc^ 
pofira oc fubftanrne conrrarqe: a pturimum 
quodcft in ea fubftanria cft tcrrca frigida.£x 
minuequodineafubltantiacftfubriUecal^ 
dit a tcxt odoz due cft bonue (iait odo: ali^ 't 
rum fpccicrumaromaricarum.queappo:ran 
turabindia.©apo: ciue cft ftipricue ftipri^ 
drarc mulra cum aUcmanrulo aromatictta^ 
Oe. f^JirrueduedtqucPdiVcartnrcrfu) 



Btitttbis 



sdu.f5ca.tfri.nonc(lo2atfoih3nifcIla.pfert 
fluicui vetris z vlcerito intcftino?.. z bibitur in 
emoptoYcasinftuiBibiis bumo? advenrrem 
f ;&uiccn.w virito coidt'8 m.q pfoaat coi. 




(* 



Captftilum.tdfl#. 

>T\ Slua.yfi. , 2£>aluai5: eoq> molliendf 

g I «aluuacfoluedinaturababear.f-fM. 

^l I " lib,iq 3n feb\mefe malua ferenda eft q 

*^ ^^occurfubyemisab incremerirepwmef 

logtrodineloco pinguiodccraf tz baido gan 

dec leramlcXratteTunf ei9 ptace cu cepenni q 

tuo:b:cfoliavclquio3admin9.)7faac;^bal^ 

uaca.cltinp.s.bu.in.q.f'f>la.tftemmalua 

©omeftica-zfilucftr^^aluatJomeftica ma? 

gi8tri.eft z buidirate babet fubf i\iozc.& iluc 

ftr$ aut crefcit a lti9.? altiora bj folia .z qfi fhi 

tct.bccmin9fri.eftr:b5vifcofambumiditatc. 

©ptratiome. 

f P Y af.2£>alua mclio: eft o:riua 03 agreftis: 
f? cacbftomaca dfcventreq? mollit.ma)cicau* 
tcm dus ^gule ireltinis videtur ac vefice.£i9 
foliacruda catbaplafmata cufale modico mc 
dentur egilopis.vaia z apum percuflurie. 
f 2£>alua clipa z oleoadmijcta caraplafmati 
bus adbibitaaco^s*: furfurcs capitis tollir. 
£Upatura ei9 malactica cft.Sd suricies inre 
fttao? atqj matr \c\% ani ncccfiario fujponif , 



folia ci^cocta tipofita cu olco modico cc bu? 
itioftwzignifacro.f^aluaaimradiatoco 
m i iufccllo.vencnofio pot oito f ubuenit fi fre 
qnter bibaf ;f ^la.^alua valctad matura^ 
du ca ,apra:terunf cm folia malue cu ajcungia 
po:cinarcccri2fup,reguiacalcfactafupponif. 
23ccctia valet p suricie fplenio z cpats.fjj 0', 
merii cc aq Dccoctois ef5factu circa pcdee.va 
let ad fonu.puocadu i febrito acutlf £6ftari. 
2£>alua eft fri.i. tj ,§.z bu.in p.d,dda calor^ ac 
cidetatr b5.ioq5 fi in vino itt cocra z carbaplaf 
mcf pfcrofula8:apata:tumo:efq? mamtllarii 
valet.fSfucc9ci*)ficuvinobibafftraguiria 
id cft Trtfficulrare mingcdit>iffoluir: z lapidcm 
fragir.Sciaricepueniesiteftinafanatvulne 
rata.fi cumaccto coqf soloiecapitum loto? 
rummitigat. 




€aptoilunt.fd]EjEiiK 

/T\aiu.*Rabbi^ovfc8cap.iBemalo.j£p 
•"^risquedafutfculaa.qdampontiea.qda 
ftiprica •rt.tJoc ideoicit auerroie.vXolltf 
get.auc.Suen5oar.S5era.lib.ag.e. x>e malo. 
£t cc eis qda fut ftiprica .qda porica. qda "oul^ 
cia.qda acetofa.-z.qda infipida aqTa.^nTmlct 
buseftfubaaclfatEatcfubczipotic^qbvin 
ar fup ea cft tpamerii fri.terreu.f3 ftipricf e bec 
cadefubacufubaaclfa:qinwlcib;.jetinacc 
tofis fuba aquca frigida. r 



£ra«atu0 



i>prratioitf0 

3J f ttabbi movfc8.:£baUi odoie fuo cotfobo* 
rat coi-z avcblp.t iuuat ptific$ -z melancolicie 
f5 eomeftio a?peio: eoim comeltioe fructuii. 
gnafvetofitatcX.qu3snatm.ii. , z.iq.t>igcm'ac 
if a vtfit dictu a fapierito q> gnar ptifim z erbi 
cl.eo crbmoi vctofirafesinftitarrerias-z xCt 

°£ na6«(r5ar.vq.fim.far.ca/ < ^)ika.i.pomaria.'2 
eft arbo: mali.no qlibet cft vni9nature. fic ne* 
epfructf/Ba pomo?. ariafunrt>ulcia.alia#o 
auftcra atiapotica.alia ^o adda.alia ^o noit 
. ;, totalf cpluta ? aqTa.? pdnaf aqfitas in bis 
vt fit coplccio eo?- buidioz 2 frtgidio:. Xcrre^ 
ftre $>o frtgidit ©ftaf i potioo. jindigefiii $o i 
aufteimr&oc z aqueii frigidu fic i tmlci to cu 
aatutmaf .3fta aut z folia fuca ? couiccs ei9 

3C arbor^adiuiceoirTert.fandberbvticiiauf 
fterie cjde x acidif. Uulncra pfolidat:: fiegmo 
nu q fur i giiatde repcutcreid qtftnfiuir. z ito9 
macbu ejtfolubile. z vetre coa*obo:at. cu aqTi 
ozito $o mozdacee flegmces icipieref:? cos c\ 
futi augmro remittcf .f 0m ailrmtra oibue 

15 pomisbuiditas ifcrfpalaef tzeeeo q? nulli9 
co^fuccuofiduratfjacefcufzcoJrupunfoia 
(olucmcifonio?(q vticp^pter pdominanrem 
ftipridtarc minuefunr bumida altj8)%fucc9 
coctu8ciimellct»urarepotdtipfcautElenci 
epira dttHtrabiU6.'^alugranatii.lege cap, 
JDimitCu? mala cironia Ugc citonia. 



Capirnwm.fdjejEuiK n 

/T\ aia maciana.er.pcir yfi.cp a loco tncuf, 
3AC 0uida ^o ctponiir filucftria.vulgari tn 
bYfpanico cria tiomeftica oia mariana oicuf 
piaf.3 ipis^flpjiu fac capfm inqr'z£>ati3na cu 
adbuc tmatura lliptica fut zi$n alio rii ca.cp 
poit cpfifeftiua.aptf Sjera.^oxjtijrbif £>raf. 
bi q> colliguf iverc.7 Buic.i f3 ?co:dare videf 

©pfrationf0 

f Suic.fci.cy nocctncruiejjpe nerualia Sil t>i Q 
jcitpvaf.^£t $ virito coidif t>i.p/ ?fo:rat co: •£ 



^ 





CapituIuttt.tfljEjEi*. 

v**T\ Snnavtait&uicen.eftro8cadc8 fu 

fl I ■pcrlapideaplanta8.ctbabctFlurc8 

vJLz fyccke.z senoiata cft tereniabin/z ftt 

^T* racoft.-zfucca^baufer cft tefpedcb? 

eiu8.£tattSuiccn.*iR>3na t>iuetfificaf fin 

fciuerfirate rep fup quas cadit recipicns ab 

ci6t>iucrfiratc8"z virntfe8,apudno8vidit>u^ 

aefpedce.vnaq^cftgraivulofa no eoiuncta 

granuli8.alia coglobata q artificio magis yi? 

def fopbif tica ta cc juccaro cocta •: folqs fcr.e* 

q? fruftula imijcta vidcnf fapore (c\ fcne)'ofte 

dit.f Sera.li.ag.c.^sen.i.mana cftca.^ab 

ftergit z lauat/z eft ca.inp.g.tcpafa bumidifa 

tcz ficcitatc.f j£t ide auct.*Rafi8 t>ipt cidem 

manna cadit (ug arbo:c q t>icif tamarifcus ft 

cut me l. z qn fac mora fup pianta illa albefcif; 

fcd qri ibinomo:af fed colligif cifoctim foiio 

ciuscft viridis.^eliozccea cftaji9colo:cft 

, clarue ajpwpinquae albedini.x b5paru rubo 

m,% •plm&T&mn* cft oierost adcne ft^ 



C 



BtlnbB 



CUpCaeaat arb©*?.: fit tmlcfe.? eoagulaf fi 
cutmeUcjcficcaf ftcwgumi queadmodu te? 
reniabin.£ftalia fpedes q vocaf tercniabin . 
per qua lege capiruUiXcreniabnw 

JDjJfrarionte. 

f S>'era.auc/Rafi8.Ci.uet>e ipo cadit fupcr 
arbo:c tamarifci cft bona tulTC i afperirare pe 
ctous. CoUigit ci •Rafta-z Wjcit.q> manna ca 
dit fup. a rbo:e q t>icif tamarifcue ficut mel. 
f £t tde auc..t5abip. £ft ca i fi.pmi ficcafl?^ 
quls caliditati.pfert relaicaroi 1 tomacbi i ab 
Itringit vetrerz couenit aq citrine qiibibif t>e 
ea.emplaf iraf ventcr.? ingrcdif in mcdicinis 
apoliematu.f £tecficcatcatarrnm qfifitca 
putpurgiu": qm mudificat ccreb^ ccpcUit ab 
covetolitategroffam.flj£tfoutficatmedici^ 
nas:qn mifcef cu eis ipotioito -z caputpurgi 
i&i ocletapoftemata flcgmatica. i mifcef vx 
pfecnoib^fljrercjccclleeiunamctuqbeft inea 




radicebabctfoima bomte ftmilant g.&ntro? 
pos cm bd ©icif .bui9co:te|c in vino miffa t>af 
ad bibcndu bis qiio^ eo:pue fccandu eft p:o 
ptercuravtfopo:ati©olo:cn6fenriant.'»^>a 
fculus folia babet (imilw bete.*jMini.ub. iqcv , 
jCandidus c\ i mas.nigcr q fenua ejriiumarur 
mandrago:a.«(f DYaf.^afeulus fa> madra 
go:a babet folia alb a i maio:a :lara i (euia & 
cut bcte.'z£>ala eiue tmpucia nafcunf colo:c 
croeeo,odo:efuaincumgrauirareqpaflo:c8 
comedunt.-rftarimfomnucapiuf.auicenna^ 
*^andrago:afn.vfq5ad.i^gra,erbumida. 
OmiH8aiirm3drago:eradicmasnaeft:bo* 
nrinis fo:me fifi8.'<S>>adrago:a em nomen cft 
Ymaginis narurali8.fc5ficut pllra ejultensin 
fo:maboie.C£vberbario.*£>>andrago:aq5 
fo:rilTuniodo:i8eftabboie ieiuno ndcolligtf 
tur.^bafculusautebabet albidio:a folia et 
maio:a:fed vrrinfqjvia clt vna. 



Optwumudftu). 

mSndrago:a vir.)?fir3.£>pe6 &mm 
funr.*£bafculu8 fcilicer? fcmina.De 
mafculo iniifo cap.tracwf.*i£>andra 
go:afiftseftparuo pepni.trictacr bj 
mala fuaueolentia: magnirudine malimaria 
ni.vnde a larinieam malu tcrrc vocant: co q* 



j0pi 



. ifcationfg. 

CSferap. 0fi eje ifta radice erM>cf auctti fn 
potuvelcibo cu paneincidtrfuincs ei» i fuber, 
£t io vmnf CYrurgici qn vokir mcb^incidcre 
%fzx idc auc.D Yaf.OirrSmafciili eft.cr ft coq 
tur radiic invino t>onccminutf rcrna pare.et 
coUf -zreponif <i acciptf qtea qnritae.u.t ad 
miniftraf ad nimias vigtUae.z ad fccadoe t>o 
lo*C8rzqnfuerttnccefictncidercaurcautcrifa 
rc aUqo" mcb? i vol um9cr- no fenriaf :tietur ei 
in potup:i9.f £tfi bibanf ©uo onoloe ejc fuc 
coradici6CumeUicraro:facumraiomerefle* 
gnu i colera ficut elicbome.fed fi accipiatur 
plusoccidit.ttco^tcicradicisingredifinme^ 
dicini8oculo??innafealitx>. f £rqn accipi^ 
tur ct co mcdius onolus i futponirur ^puocat 
menftrua:cte]crrabirfetum.£tquidoponif i 
anoficutfu|pofito:iufacitoo:mire.<!I£tqn 
radic eius eUcatur cu ebo:e fcc bo:is moUifi^ 
cataitn i facit ipm abile ad factaidu quaciicp 
rtguravowcrie.f^tqnfitanplalirikufoli^ 
16 citte recenrito cufanic^ pnentens apoftc^ 
maritocaUdieoculo? .'t apatito fup,Ucnicrib!> 
vumerito z vtcerib?.et rcfoluir apata ©ura t et 
fcrofula8crejctrura8,fj£tquadofricafcum 
coemperigocrbarae zfimiliaeis fcc t>icbu8 
aufert ca finc vlccrarionclo ci. ct coferut atrritf 
tionibjquefiunrinirinere.fRadijc ^o eiuo 
qn tcrif prririoefo:»:': ftt emplallm cum ea et 
aceto curat Ijerifiptla.f qnmifccf cum oleo et 
meUccft bonamo:fui vcncnofo.t qn mifcemr 
cu fanie fedat c^ragras. * ©olo:c iuncturay.-z 
oesaUost^olo^es^itaiitrinucucomceci? 
radici^in btic modu abfqj t>ccoctitf e. accipia 
tur 6 vtiio t>ukt ampbow vna.z^pqcianf trca 
-•' r ij 



21 



P 



« £ 



15 



t) 



Cractams 



2£> 



■H 



magnr radiccs iriea.z Serur fn potu quantft 
taefriumonoIosiUiqu^nncccflccftmciderc 
aitcaurcrifarc.ernofcnriet caurcrifarioncm 
a tt iociKone^rer fubct qtf pttngit cu quaw 
c\o fumiturt>cca nimisfacir apopleciam. 
^f ^uccuspomo^ausqn fumif inpotumu 
dificarmatriccqnadirufceturcifulfur.-zfitt^ 
de nafcale abfcindit rupim marricie. 
4£o!iigif aur l a <biym& butf plarcqn gfo;a 
tur radip eius z colUgtf qtf ema nar cjc lacb:v* 
mo in vafe vitrcato. Uep fuccus er3 fo:rid: elt 
lacb:vnto.?noeftinomigteradiciermfccbu 
miditateJCPqnvulncrarur cmtrtit tactevmrT: 
qttod qitidcm cjcpcricntia fciriporcft. 
^SLia fpfciee quc noiamr narb9adminiftra 
tur a cirurgicte quando voly t mcmbw atiqtf 
inadercer quado bibirur folatrum quod oici 
ror fuftbcane ci cftrvriaca, 
f Et idc aucto."Rafi8.t>tjcitmibiquidI cr an 
tiqnisbabYlonic.q' qucdapuclla comeditqn 
cp poma madragore.etcccidtt fincopifata. a 
rota cfTeaa eftrubicunda.cr quidam fupcrue 
iiiciis elfudirfuper capur eiue aquam ntmio 
©onecfurrejcir. 

f £t ego vidi bomincs qui fumpfcrut ©e radi 
cc eiue ca ufa impinguandi.er nccidit cio iieut 
accidcrc folct boito ingrcdicnrtto balneu z bt> 
bmritopofteuru nna mtiltu. Ha faous fuit 



vultfeo^nirmsrabicudus.^rideauc.pv* 
afco/Radice madragoKmuuwat ad amo;c< 



CflpituIum.frljfjEuft. 

jf^W\ Bndrogo;a femie.£>erap.aucro:i. 
a I HPYflr.£tfcminccolo:cftnigcr.ctno> 
^ M ^ minaflandacbicfiuebandacbis aut 
: lacmca.l^la i foltje rius elt fiiitudo cii 
foltjslacture;: fiit pinguia guic odotiextcpt 
redunf fufjfacicrcrreanmedtofolio? ctue c# 
ufe mcfptli.': eft lofach,? cft citnni colorkbns 
odo:cbonu.? inrra ipm fur gna fttia gnis pi? 
ro^.absradieeemagnasmediocrircr tmas 
vdtrce adbcrcree inuiceejcrcriuenigrae z inf 
feriusalbao.fugcja cll co:tcjcgroflu6.j£tbec 
fpccice mandrago:c non babet ftipit cm. 

BvtmiontQ 

fl*i£>andrago:a fo:f iflimi odotfe cft ab bot 
mine teiuno non colIigirur*A & aja^ iS w>, 
f atriufcpvt'8vnacft.bcccum polenta trita 
f cruo^s oculo?,-: t)olo:cs aurium fcdar. 
fRadiic ciu8 cu accto rrira er itlira igncm U r > 
crumcurar. 

^Buicc.^E>adrago:a fomnu^uocar. et qff 
ponirur invino vcbcmetcr ineb:iat . multufqj 
vfus a'9 ?odo:amcnl faeiunr apoplejcia. 
^J iacci9aieilitletiginee': panu fincmo:dtf 
catiocfoluedo aiit cducit colera ? ftcgma. 
CRadic aSrrira z u caecro impofir a fuper bc 
rifipilam fanat cam.femcn aus marrice muttf 
dtficar .v d vomimm p:ouocar* 





feeffcbfe 



Capttulum.rtlflEuiu. 

ffl2lraa.Sa'apioIl.•^bar^a eft pll 
ta fimilie p&fliomifi quia eft loitgi 
®oi£o cy babetfoUa parua mutta 
©ura er afpera ;bouu odoic baben 
fiat>ulda < fuequ€funtpi'liparui."zbabctHr> 
jsmulta» egrcdientes tb vna radice.-r albtf 
oas^gisp^iutmafarurtoaemonrtiofis ct 
afperie.f £t ide auCto.0af.Sapo: due ctt 
acutuapunguiu^amaru^virtus epeitque 
calefarif fo fecuudo gradu. 

f Scm^.tJirtueciueeftqabitergif z inciP 

djt.i puocat mcftrua.z occiditfetit. 

f £t e|cpeUitfecundinam.babct viitntfmca* 

lcfaeriuarnacuram. 

f Etideo quldobibiturfcccocrio fotfo£ ci9 

cum vino p:ouocat maiftrua . 

f £t faar abo:tnnw cjcpelto fccundinam. 




CapituIum.tdiEjEfe.' 

ST\ Surubium fiuc^jafltu.^erapton 

a D |Ub.aggre.cap\farafion.i.p:auw.£ft 

V 1 J_ bcrbababeneramuloumuttos egrc* 

7%? dicnres ab vna radice. % iup. ipfos eft 

bo:ra pauca.£ui9eolo: cftalbusrr vtrge efua 

funt quadxate.etfolia ciue funt in longirudtf 



. ncpolticiex)baofttncIa'rugorayei afpcVa.fuo. 
quc cft bom&t fcm eri ritie z fi o:ee ritre fTrnc 
t>iuifa perramoedue.-r femen rintj rofuncKi 
ad afpcrifarcm tendcns.t^afcftfirin eampio 
et in cdincqa t>omo:um.0 Yafebrio.cap.ee 
marubio.^&arobium vcl ^:afitutn frnrcp dr 
ejcvna radice.mulrae virgae babatealbae 
ct afperae:erquadrata9.£ffolia funiliatigi 
to maio:u obrorunda a afperaalba z rugo* 
fa .z gulttt amara.femcn cft iili ob:orundum z 
vctticulofumetafpcrum.HaixirurlociemiA 
rio. fautcenna.lib.fecundo.cap. t»e prafTib. 
I^afliiim drbcrba amari faporie, f Jnquit 
oabafiue. fion funt calctaaio due et ccficca. 
tio ipfiue fo:tc8.Blt| auremt>ircrunr cj> eft ca 
lidamrcrriogradu:fiecainfecundo.£ftapa* 
riuum:abftcrsitetUqucfacitctrcfotuttctin? 
ttdit. 

^pfrattoufe. 

fSerapioninc^t.SpcritofianoncsfpIems 
separie.-zmundificarpuliuone z pccruepcr* 
fcrcatu.etp:ouocatmefiJtrua quado bibirur. 
zqndo ponif cperiueabftcrgir i refoluu. fuc 
cus aute fblfo?. riue poftcp dt scftccat? in fo? 
Urefoluif cu melic.ctadminiftraf ad vifu a> 
atendum. 

f £r fit cu eo ftcrnutafon'5 yc fericis. ad mun 
dificandum infecrionc colorie.? adminiilraf 
atm mcdiriraeaperiatritoinftrumcnra audtf 
tue,a t>arur fucate eius iUie in poru qut funtf 
pferunr mcdidms momfcrae.vcru nocet rcni 
bueaveficc. 

f £r emplaftrii cum folnedue? mcltc mudtf 
ficat vlcera fo:dtda.i euetiir panaricui et car? 
ticmputrida.t fcda t t»olo:cs larctuvtrfir cm 
plaftrit cum marubio z falc.t coferr moriui ca 
nisrabidi. 

f Pf aflibua ri9 ft'cc3:velfuccue folioj riue 
velfcmeriueeU]tf sbibirucu mdte prifidecf 
tuffienrito? afmaricie 1 pddt.£o:acc purgat 
madmevriftliricemijcta. . 
f -^urgadis vtitttcr mutierito a dbibef. £>& 
cundinaeeicctudif »iu paticrico fubuenit.Oc 
fice z renito prrariu3 cft.mclle addiro vulncra 
purgat^illa t>aergit.*t>afccria vulncra com 
pefcir.colo^laterisfotlif. 
f Suceuefieeatfmetle': vino addifo caligt) 
neeoculo^tctcrgif.Ycrertcie nartto imtTms 
fcrt auriUa.cu olco rofarum fuccue cius aurt^ 
umt>olo:cmminsat. 

f Buicen.Sncc9a' 1 ; ?fertt>olo:i auris atifi 
quo.-z mudinrat z a pcrir mcarue audtt9. i rc;> 
mouct antiquu t>olo:c eius.© uccue d^cum 
mdlee pucnics ad acuendu rtfum mudtftcat 
r iii 



•£ 



6 



C«ttatu0 



16 



tjecfu&tpHtmonggediHCffonKputl. 
<£ftapmrittiiopa4aonucpatcrpla«^rcni 
bue.puocaf mzitrm.i mucwicar mamce. 
f £'af.vm.fim&r.ca;oe ptffiio f mtraftariof 
ni arabica.fapo: crM amatftf $me ciue c&9 
lida?ftccainrcdo|,Tnabftcrsic*rcfoluiti 





m 



Cflpimlum.fdjrrjE. 

tfT\&mibiaftrii verz£>arrubiil nigru.vd 
^^rrubiufaucftrc.DYaf.cap. , 8u6lce 
rc.tdeltmarrabiaftra.j£rcft fitte marrubio : 
iufi q: folia cius no funtromnda:fed pilofafi 
miUa folpe igndc magne vcl a califejc. idc vir 
gae nigraei quadrae bab^t afpcrae ejc vna 
radiccvirgeUaemulraepferene. 

Bpmtionm 

M Dvaf.£iu8 vireefaciunt ad fcrpcntu moi* 

fuectadfufpiriofoe.ftrumae^uToIuit.-zmcn 

ftruaptouocaf. 

f Decoctio ciue in aqua cu" grano folie i mo 

dica liqricia ftomacbo bn pucnif . 

f 5oliari9additofale i catbaplafmatib? coi 

pofita mo:fue caninoemitigjf.icinerecalulo 

mflTa i marcida facta ?d>lonu ra foluur. 

f aulncra fo:dlda mclleaddiro purgir. 

Capitulum.rrIjErjt). 



arri(Viliia. , f>adccfa.c.ccccciqqcifo'.ma 
trriuliUia Urinc.greccfplcmovel fplcna 
1 ria vcl linealie vcl periclimenoe. l~cr? 
► ba eftcutffolia futejralfcro latcf 1'uW 
albida.t cjc alf cro viridia fc adbcrcne t inttoW 
uee fcpi9.cui9 fructue eft magnirudtnie cubc* 
b J^in t; ncipio viridie.-z cu ma tursuerir cirri* 
ni < olo:ie tcndcriead rubedine pofit i o:dina# 
rict pclufiiii t>uoto folue ftr?iiictie.cnliettf 
bue i capitito ftipirii tupra cu. f D yaft o. ( ap< 
*f>ericlimcnoe frurcjc eft ftmplc): i ein.Citu fo* 
lia bnealba tfttia ederc. z circa ipa folta £gc 
futtcnuee.inclilreftfcmccdcre fite.qfc Ittrcn 
foltjeadbcrcf , ?ux,xt cu vi lcucf /R adit; d i tlii 
grofla/flafctt tn locie culrie ct m ome: z in€ 
rofae:ct intcrclufie locif.t cobercr ftbt vicinie 
fructito vekircuuoluif . 6a l. •^cricumeiioe.i. 
matriiTilua.vttlieellfrucfuextfolia inciliucfi 
mulcrcdcfacriueeriltentiavirrurie. 

©pfrariows 

f Dvaf.S» cmc ciue coilccrit ct in vir.b:a fitf 
cattttn ct cum vinobibitum© ieto.tl. fplcncm 
ficca t.riim fanguinea fetta ©ie p:ouoca f o:> 
tbonoicie et.fubfiUtricnrito mcdctur. 
f Diu parturienrito fubucnit. fimilie virnio 
cftfolijo ipfme.rjc£vrUitto bibira genitsliafe 
mina bominiepriuar.clco mtj.fa -i gurrcta ir& 
go:a pcriodica cctludir. 
\ 6'aOracft vjjnajwactvanam fcngurjc 



% 



* 



Bt%)tvhis 



am ©pcr.mtrbibtta vfcp ptorfmnm fo ptfnctf 
pio $>o v:inatiua folum clK 
^£ttro:fum fa> oim olco vncrikalefacitain 
mt aut fplencricoe et •oiflineeriroe. 
^f:g>>cfura $o po tmoie wagoeeft vn9 eu vt 
no:iiccar aur fperma.tf c\da flitlt.fi plurimu5 
bibafomifaria igencrariuifiiif c^bibur. 
C0imiiaut rcrminii t»ic? i bufrporu fic 0? 
af.facir.]cc,tvi}.t»ic6rc£»iri ab co porumr* jfaa 
afit^inaefanguieaofierivtaqrtaxjic?.. 




Opitulum.rd]EjE)Eit. 

yX\ eu( » a vcl mcliiTa.-{San.ca,icc.^>eliB 

§ I Jf.iUttecftp:aflto:bnern^im'odo:cm 

^lf ca/z fic.m.tj.§.©cr3.li.ag.cap.beda* 

rugie.auc.DYaf.&edariigievelmeW 

fopbi*,oe:qr3 ftc ?i eo q ubercr cl apee madu? 

cc't.bcrba eft rirTos bne qdratoe birtoe pturi 

moeecvnaradicc.t folia fitta bublotcmaio* 

ra tii 2 tenera •: no fic afpa vt ctrp i odo:e.jfn 

alio <3>cra. babcf fic.^dlifopbiloe.i.miu'f, 

(aberbaeftfup.quaapeet>dccranfftarc«vir 

gcipmfoliafilanf^sie-zfolrjemarubqfiluc 

. ftrie.ct^ge riud? ftipiree fut angulofiqdran 

guli.* f olia ciue lur maio:a fcltje marubtj fd? 

ueftrie.t no fiint pilofa ficut folia ipfi9.? odot 

ciue cft Itcut odot citri.6al'. vtj. fim.far. cap< 

mcUifofatu.i. rociilTa . £:a flto quidccft fimils 



©eficit c^ctcab eo mulrih'nj&tWe.T#ferea^ 
cg vrifalicieeo.fupfluu cm c prafliio ejciite ita 
coprbfovbiqj terrariimcUtfonlo vrt.Sn^o 
flliqnnoalfueritptafltum licjlS vriinoitoiri 
quito vrimur iUo:fcietee cp ab actu tcfictt* 

©prranonea 

^TS? cra.iblia ci^cti vino bibita t i cataplaf? 
maiito vim fco:ptbie oprimc curat Xaninoe 
mo:fue ad fanirarepducir. f j£ujcarura e&id 
faccrcpdr.cui9dijcarura fometo adbibfta mif 
ftrnielogtfltmirgie irngat. o:c reteta fcolo:2 
©cntiu mitigar.t>ffiinrericie opitularur.jFolia 
ipa oia fifr ra cereprir.ro:rioTto recre otibibcf. 
<ffj£tvtclcctuanupKbonoiae ( pdcft fak ad? 
«difo.? a nbcjofies 0, no pntifcere. % in catba* 
plafmantoadbibira fcrofae fpargit :vulncra 
purgaKarricieopinilaf.^ £t qii fitcmplalt? 
cu ca fcdat t>oSo:c likfuray.f Jtt idcm auc r o. 
&benmefuaY/£:opcfaeei9 cletiftcare aia^. 
<([£ r idc auc.yfaac.0n comcdif bed arugie i 
ieiunio pfertitomacbo frigido? buido.erfa* 
cit x»igcri cibu groflii.t agtt opilatbee cercb:i, 
•<f £r t>ejp:icrate cV c pfcrre fccbilirati io«Jie 
cc aufcrt cardiaca.? remouet afflictioce folict 
rudinee x timo:ee q accidut a mdacolia % bu 
nwadufto 4ton6pofiuntto?mire.f Suw 
«cna tx vtrtb? cowlie cicit q? pfpjtat ce:. 




n 







i? 



v 



rfiii 



Crartatus 



& Opitulum.ftlftrify 

jfa\ £UiU«a.-j!bla:^bcl!ilotiicfl.cfttfic,i 

M:M l^graXui^remefimiliteratPcUatur.t 

^ T f q: fcmiciratli fo:ma b$ cria co:ona re* 

* ' gia&icif.^emea|co:riatoin mcdici 

nis ponif ac g rree annoe fcruatur. Sdco na 

<gpflruudtsadtereeeo:rici.vtvir.indepof* 

fitfeparari.trufebabctpfotfandiejcflromati 

cirarc.X)iurcticaeicfubtibtatcfubftantie.3dc 

c o:ona rcgia t>icif .q: vaginc feminu riue fo:* 

mate funt admodu fcmiarculi:q cu fuie femtf 

nibu8ponuturinmedia'nt8.^)erba ipfa ba* 

bet foliarotunda vtridia.zrami riusfunt fuW 

tileB maUtin foUaeius rara.i femtna rius bnt 

vacrinasfubttlee rotudae:fiair virge pucro^ 

guulo?an quib? princtur. 1 1 fiit Ola fcmina 

pattca glaucicolo:ierotuda:min©:a granie 

fiBapis.tr qr> oeipfa adminiftraf funtillcva 

. dnccficoq6cfttna8C|cfcminih»velgrani8 

fio8eiu8cftcitrin l >boniodori8.l5ecbabcrur 

eciaaS^crapioccap.aicbdialamccb.C5Ya'; 
fco.cap. t>emcllitoro.'z£)dliloru t>iafo:aicu 
cft i modicu t>igclto£ clt cu nimictate calorie 
j59f.vq.fim.faMap.t>emeluloro.*^)clltlorii 
mfcrc eftvirf urieM>a em quid ftipticu % t>va 
fmcricu t>i0critcp.plu8 cmin co cft calide fub 
ftanriccpfrisidc.aiiicena.ti.lib.t>emcQiloto. 
^cllilocucft fios planrc coloae palcc in quo 
dtnguralunariecurarirarcfuaqucndamba 
benot>uricte..tt cvco quideaUudcft album:? 
aUudcftcitrmum.-zciceomcUus cftquod dt 
t>uriu8.-zcuiu8Colo:ad albcdincm parumg 
t>eclinarz fapo:,riueamario:fenrirur/z cuiue 
odo:dtmanifeftio:.i;ridcmauao.£>vafco. 
*2&diue cic eo eft croceuscolo:. z cft acutiort, 
odo:te:cpui'8ciu6odo:inpncipio fpccici ipfi 
usfttparuue-z sebilis. i fic incolosccuisco^ 
lojfcnugreci. 

i)pfrattonf0. 

i <S> crap.auc.pv3f. '^bdlilotu cft ftipridi 
ctmolUficariuuapoftematucaUdoft majcic 
apoltcmaru oculo^-z ant % tefticulop. 

► f£tqncoquifalrobinrcucocmplaftru.a 
fozfiri mifccf cu vitello ouuaut farina fenugrc 
cUut fcmis h tii.aut pulucrl molcdim. aut cii 
papaucrc foUt cii aqua pfcrt vlcerita? cj nomi* 
hanf raul.j£tqnmifccfcuboli6 c\ afportatur 
t>c rcrra q" ?5: bota,aut mifccnf cum eo gallcct 
©tlfoluunf cuvinoilimunf cu eovlccra bu* 
mida q fuit in capicc:curat ea. 

r ^ct ponif coctu wudu in vinorr cu aUquo 
iltof qt>ijcim9fup.ftomacburz fcdatt>olowm 
Cuie^tqncjcpiimifabcofucaietiDcraeimi^ 



fccrur curob.tfiiUarin aurefedar fcoloieaus 

£t qncpfundif fupcaput cum accr o t clto r# 

farum:fcdatt>clo:cm capirie. 

f Suiccn.'i£)clliloru pferrapoftcmatifo ea* 

Udis i tmrie.T^ttie cu carcno i aia gmiittiim 

divitdlo ouitfarina fenusrccifemte Uiu'.aut 

papauerisfmlocum. 

ffct pfert vlcerite buidie.r,|p:ic Ijriru c0 aq 

tcfi aUcj t>cficcatiuo9 ; 9n;ofiro cucoquod fit 

ficur gallcr luruUnectlenrce. 

^£r pfert apoftcmarito auriu et t old:ite art^ 

cba? fugpofito emplaftro cjc co cum careno : 

ctrdiqsqticta funt.^ t>ifrillatice facrainri9 

ocfucco.ct rius iuuametu int>olo:ito cft vcto; 

i ius.c]cipo cljftut cmb:occ •zfcdant iodam. 

f j£f pfert apoftcmatifo ocVufact o cmplaftro 

dccocumjcareno.etcuriidequct>ictafuntvcl 

t>ccoaacumvino. 

ffcfCofertapoftcmatitoflnictfdliculo^fa^ 

ao cmplaft ro cu ci& q vfeta funt.loco dus po 

nif qnnl cft pondus ipftSt>ccamomilia aut a 1 ) 

mcdiumoefoltjofki. 

^•j^latcri9.tIinut>ccocfiont8au8pfo«af:ct 

vcnrofitarcindufam cicpdlit. ^pilatione rc* 

numctveficcapcrir. 

fl ©cmeeiu6inb:odiopofituipm facftbo^ 

mfapo:ie:riodo:is. 

<ffj£t ponfitmu cft mdiilotumadcmozroidas 

cancrumafiltulam. 




Btt)ttbfo 



Capitulunnffl^in). 

S 1 «Wetnidost/^doismaturifol» 
5JL4, eit flf olfa riitus a9elt cj infrigidaE 
? buinectatin,t|.fj;radu. unde vir> 
ru8mcl6i8maturi'eftcibfterltu3.Dnaturaiit 
tn co frigtda 2 btimida ( 'e6ple£io:non tfi fozris 
ied in.ij.gradu.Diaf radfc t fcmc ei9 qu (ict 
canf no adbiic bumid a.On ficcimr fut in pj 
mograduftcatatisaur inp:incipio feaindf. 
ttinriacftplus&eabfferftocqn fitcanf cfcin 
carneciuo? cp in carnc cucumeris. 

j&ptrarionfe 

- f S>era lib.33.c.*Racbcra.i.mcbn. Ouan' 
61 dofitcmplaStrucumcofcdatapataoculo?. 
» . : C^tcoirc]cej9qnponiffugcaputinfanrt8lc^ 
^ dat aparaVatida q fiuc ine^;ce^eb:o.■^ ponitur 

fup. frontc tlti9:ad cuf9 oclbs currunt bumidi 

taresxr.pbibct eas % t ot a carnofirae. 
£ ^ £t feme qn ficeatur ad folc 1 pficif oi farina 

o:dei:vel cu amido.? ficcarur benc : milditicac 

cutemulic^ qu lauant cfieo facies fuas.zrcd^ 
5 dit eas fplcndidas. fl 2> cd radi^melonie qii 

ficcatur et fumitur x>c ca inpotu.5.i.cum ydro 

incllc prouocat vomitum. 
£ f£r qn accipitur poft aba in buc modu facic 

vomcre unelabo:e.z qn fit cmpldirij al ca cu 

rar vlcera qne eicuntur faul. 



CapituIum.ftljf0o» 

/f\£lon'5ndii83crap4ib.3s.cap > 'ouIl« 
^ACfia fii;ct>uliicba.i.mclon 3ndu8fiucnic 
lon magn«6.Gbi fcicndu q> mclonmagn9cft 
mclon3ndu8.quodpcr Suiccnna parct ©c 
airatcrrtanepure.vbibudat inrertiana p:e* 
dicta melonc 3ndu?.j£tfubdit:'r fo:raifc no 
nocctmclonparu9.ersomclon3ndu6c(tmc 
lon magnu6.fi ftem mclon paruue babena 
virgularum co!o:an cjcrmus cft albus % "oulf 
ci8.cteftparuu8,palia fpcacmdoais.lcgc ca* 
p:ccedcn8 quod iucipit U&don. 

©prranones 

itfScrap.^belon magnus fiue 3ndu« vtrtf 
dia f m 'Rafim cft fo:t ie bumecta t ionic ct cc 
tiiicttome. 

f£t?fatfcb:iteadurcYitorrdtfrtgidio:'aIi^ 
(9 fpecicto mcloau 1 rardioas imutatieio i fto 
macbo 1 longfnquio: a co:rupri6e. 
f j£e p:optcr boc elt conucniene fcbricntibua 
colcram in ftomacbo fuo p:opW I uam grof^ 
ficicm % p:opter fuam clongarionem a cowex) 
fioncet ccHicniens eaiidirati fcbrili. quia ejctin 
giutcsudirarcm. 
^ctfcdatinliamarioncm ritie. 
fEtcucumerqdcfaritoEatione^inquam 
buic nifi q:pl9,puocat v:iua qj inelon^ndus. 




a 



Craftama 



€apttulum.ftto). 

V^Tv &ongettaarabice.grece*i*>>clongia. 
m I 1 ©cra.liUag.capjnclogia.^clon? 
3JLI. $* frncws funtobtogi:medq l intrani 
T ; " bediuetnigredine. •zinueniunf cjccis 
dtrine?att>e,£tide auaoritate filt}2£>efa? 
fluadtcaltda z ficcainfecundo gradu. 



B 



<(ff£> era.lSenerat melacolil % opilatioce cpa 
tis z fplenie;? genaar fodaat generat emozro 
idas. ^Cleru fi ejccapiri to ctus in vmb:a ficca 
ti& a cctritis fiatcpitbima couenitemomndi 
bu8.crcumipfa inolco coquiturfoluit: fed tn 
accto ftringir.f j£ticko no babcr^pomontm 
abftringendu vel fbluendu.^fRabbi moffea 
cap.x>e '^elongena vakt conrra naufeam? 
^otnitum.etcjcctbi8cltpcio7e 




€apttulum.fd#jarin 

XfX £mitbc.bvafco.cap\mcmitte.U£)e* 

4 I Imitbcvclglauciucftfuccuslxrbeeiur 

\ 1 W demnomtnis.folia babentispapaueri 

' fimilia.23ecfblia ealido cinaecoope* 

riuntunetfic fuccum emittum. 2Uq bcrbam i 

oUammutuntsetctrcumliniuntcraaettnfuH 

wumferuenKmniitftmt^tficfoius raacaa* 



tte mtcum $.pilmmv.ct ficcarummfolefo pa 
ftillo6redigtinr.£iueeft optimum quod cft 
<rocet cotonsintueet guftu conarum.et odo 
re graui mifcetur ocularibusmedicinis^ ccte 
ra.£tidem f m aliam tranflationem cap.fup I 
dicto.6laucium fiue memitbefuccus eft ber 
ba nafeentis inSf vriain gaapoli. folia ba 
betfimilia miconio ceraricis fedptnguiota.et 
fuper rerramfpanfa.odo:em babet graue.gu 
ftu amaro.fuccummultum babet:croci fimi* 
lem.fouariueciucemittunt incacabie ain 
cibartj8Coquunr.que cum cojccrint erfuecat 
ctgtauciumfaciunt. 

0pfrattont0. 

f -fSUm9.cap\T>c glauao.jSlauciu in ffria et 

pcTfianafctfbumilisberba.folijs^ecifofere 

papauer^ minorib? tame fofdidioubufq? odo 

ti8tctri.gultu8 amari cii pJtriaioe z ftiptictf 

tate •: gummi baba crocei colorie. 

f '2£>ulti fo crrauerunt in bac berba .qufdaj 

putauauntcpeffetcelidonia.Ouidipmaue^ 

runtcp effet papaucr co:nutum.etfic vocatur 

apudButcennam. 

%£. t ego ridA meo tempoa: multoe in boc cr 

rareamultterrauerum tempo:e pYafcoritf» 

"flam Pvalcoridee cap.oe monre rarideesi 

dt.<pmulri falfo putauerunt glaucfum ibi fie 

ri piopter ftmili rudinem folfo:um.cr aur glan 

autnfit manitbevelfidfeiue ajparamultis 

teftimonne. 

f Ramvbi ponuntSlerandera altj grcci 

glaucium.&ufcennaetalij ponunt ficftme? 

mirberjMaaca apud ©crapionan quicc\d 

witj^memifbeauctoutatcpYafco^iiie.Ho 

cft aliud cr ©icitur apud pYafcowtf. capi. t>e 

#laucio. 

C3nuenitur atam olcum nounmglaucintim 

nen ob boc glauctoquia mbil recipit gtattctj. 

cuiueconfecrionemeriam inuenim antiquo 

antidotario fic vocaram ct fme glaueio.a eft 

omnino calidum.cp aurem ftn verirare glauci 

um fit mcmitbe.legccap.£elidonia.0alic.fe; 

jcto flm.far.cap.j5lauriu.6laua'u ftipricat rii 

quada 'oeleaarionerinfrigidat tame manifcf 

ftcita vt fanet quide fepiuebcrifipitaf a : a cft 

tn compofirionc copom a ejcaquofa t terreftri 

fubftanria.vtrifcp frigidis no tame ejctrancfj 

ad modtim aque fontanie. 

€apituimn.ffljtffun). 

/T\ Enta.-Ji) la.^ent a eft berba cuiue plu? 
^*^ra funt genaa.Jift cm quedi ©omeifica 
q^prie omilana t>iarur vf comunievcl odotii 
f era ,ct bec calefaat % ?fo»at .j6it % Qha fiiua* 



Btfyttbte 




tic3qriTcritaftru&/ocill3 ftatftn poftca txM 
ctabif . £ftalia meta q longio:a ? acutioia ba. 
betfolu.abecirt&3Tioman3Vdf3rraccnka 
tf:.becm3gi95riurcticaeft 03 alic.£t eft alia 
metaq^:aquatica.etvocaffifimb:iuvilbal 
famtta.fift aUa meta no odonfera.et illa eft ca 
lamenty.t>e qua iri feqnti.c.babcf .2? era. libi 
ag.c.t>icb3nacba.i.met3,£t et ea eft comefti 
ca et filueftri9.et ramulit>omefiici qn mafttf 
canf bfit cdlo:e celcftext funt int eri9edC3ui.z 
infummitarifo ramulo^funt qfi licmia.,'et \V/ 
ret etaugcf eftate % biemcef b?odo:e bonuj. 
£t ide auct.D vaf.quida rtoiant ea menri;et 
cft ©icbanacba.et elt nota :bj virtute caufacti 
uam ftiptica ct t>efiec3tina.£ft aua fpeo mcfe 
filueftri9.cur3folia funtafperapilbfa maio:a 
foliis fifimb:q.cr in odo:e (tio eft prriguedo.et 
cftmin^iuuatiuainmedicinacp fpeciee alia. 
3de. gaOnfuoa ei9eR plus fubtilitatt 03 
in alio olcrc.et in fapo:eei9cftparua cauditaf 
ct pdricitae.? $tU8 ciue eft ca.in.n.g. ff D\af. 
ca.t>eediofmon.i.mcta.berba eftoitonofa.q 
^rute babct termant icactftipriclet ferantica 
*f>aulue ca x>e mcta.^&cta eft caltda ct fieca 
in f U}.gradu.£ft emsomeftics etfilucltrie.et 
cftalia q d:meta *JNom3iiavelf3rracenk3 :fj 
t>omeRicamagievfuimedicinccopetif.tavi'/ 
ridis cpejcficcata magnceft dfic3cie.vjrf urcin 
babeteonfumptiuam etoifioluriuain ccpw? 



a 



'& 



pajs qualitaribus ct confojfandi ctfua aro* 
tnaricitate. 

iDpftationts 

46aV.vq.fim.far.ca.j£diofinu qiuda mentaj 

odonferavocat.fiftqdanoodonfcramenta 

quaetcalametuvocant.vtinfeqntiJcap.tMcif 

f£ontra feto:eo:is 1 putredine gingiuarii 

ct t>entiu c% t>ccoctionc eius dx aceto oe a blu 

atur. 2-ldajpaitu .puocandncum impeditur 

cctrigidie bumo:ibus cjciftcntibue ino:e fto^ 

macbi fiat falfamentu ecmenta ct acao.t mo 

dico cynamomo feu pipcre. 

f £ontravomitufactueict>cbilitatc virrutis r, 

contenriue^et ctfrigida caufa. fiat t>ecoctio 

menteinaquafalmacuiaetaceto.ctfpongiai r- ^ 

rincta o:iftomacbi fuperponanir eontratfn? -—-y^T *■ 

copimcct>ebilitatecumfeb:evelfinefcb:c.fi; 

ueetc medicina vel quacuncpucaufa conraaj ur 

mentaet ©iftcmperefur cumaceto.ct fruftum 

panie afli in igne ponatur i acer illo et t>imit 

raturtamdiu q inde bumectetur ctnarifoap» 

plicet ur.et cjcinde frieetur labia gmgiuc 1 t>cn* 

tee.rt ligemr intepo:ifo fug venae pulfatileei 

tempo^etteacbio^.etpariensmaliicet-zbu* 

miditatem tranfgluri3t. 

f Bd matrice mudtftcanda tcttcritafes, mctc f> 

cocjnf in xitio.z fiat indertifpofifouu p cotica 

pafiionefafcicuti mentecoqnf invino 1 okd 

ct fup reneset pcaine carbaplafmcf. 

f £drra eoagulat ione lacf is in mamillis pdi j£ 

ctifafciailimenreinvino zoleosecoaietfu 

perligati inamillie foluir.b5cm filr vim attra^ 

bcdi vencnu:t qn t>af cii a liqua medicm (59 

tra venenu5t>ctur cum fucco ciae. J©ed fuc^ 

cue mente rdne vel faraccnicc vel vinum t>eco 

ctioie cu. melle micrii valet ptra opilationcm 

fplenieftomacbictepatiectnafuraliuviaruj 

ejcfrigido btinuwc: ctia eicca.finefe. 

4S> uccue ctia t>atue lfib:icoe occidit.^ ai $ 

rito wftillatSvmnes necatpecocra bcvbai vi 

no et oleo x catbaplafmata foluit fcelirofim z 

tturicic apofteirarii fupcriomm. 

f ainu tjccoctidis 1 puluie a v ;in cibie t>atus #, 

t>igcf]ionc ?fo:t at.fomentufactii cjc aqus de* 

coctidiematriceinfrigidat3calefacit,©acccl 

latio facta calefarit.^t faccellatio cjc puluerc 

eiue reumafrigidu capitie liringir. 

^"JbaltadiuetJeagricfturalib.itj.^nmcferc ti 

buiario ment3 feri puenit planris vel radicito 

circa aquae vcl inbumido loco. 

^f-fbla.jf^enta tsomeftica fiue o:tulana \r&'> Ji 

giecdpait vfui medicine<$ alie.foabet^tutc 

cdfumedi ecjpriie qualitatito? pfonandi cf 

aromaticttatc && 



Kmmw 







LiK-y^, v --v«M^ 



'-.■ .: .. 



fr 



Capimlum.tdjE-jtjtfjE. 

•T^v gntanoodorifcrafiueealamerii.T^a 
fl I ldeefa.c3.cjcrig.£alamruarabicegre 
^lf cc calamiris.Xarini #0 ncpita vl mcn 
taodo^cra.Sfdcnducfin ifiocap. 
m v» ., tracfabif t>eealamfto.q:caUitneru i5:menra 
^. noodorifera.f iMa.Calameuieftbcrba quc 



«^V^ *^m.w dt?fic.in.irj.gra.^eii9cftm6tanu.q: ma& 



fvCF^X 



L 1 ' ■ "p^^-kv^ 



o^ -P* wivP ficcuXuflo:ce / pducitt>?collisi.acpannupo 
T, J> ^^ tcltfcruari.t?aberaut^rutctiflblucditcon 



ro:tadi.Suice.2£)cra noodo:ifcra fiueeala? 
mentu:aliud eft fiuuiale.aliud eftmontanum 
vfopo fiTc t fapo:cz fiTr eiSfoiia fijt ri fiVia. 

iE>ptrationf0. 

f 0nbibitur fuccus d9 eu aqua mcllietova* 

fo:at totum co:pus z p:ouocar fudo:e.ct rcri? 

rur cum olco.ct coquirur ■: inungitur co:puo 

ct cofcrt rigonbus periodicis. 

f £c qnfit cmplaftru fup_ fciam babcnrito fei 

flticumt>oIo^?fcrtvaldc.rrabitcmrundiru8 

fld tnmnfeci fugficic.? calcfacic totu arriculu. 

fupcrincendit aut manifdte cutim. 

f £c fumptu inpormvel appofiru .puocar me 

ltruacfficaciter:cteftccmedicini8qnfumitur 

magi8Confercntib3lep:ofi8refoIuedobumd 

rco rcfolutoiK fouu aufcrt liuoii qui fit (ub 



©culo ct fpopias fcvafojat ; 

f j£ t tu t>cbcs fcirc q> oranes mcdidnc qttc f c 

runmrct babcnt acuitatcmartrabunt cirocje 

p:ofundo co:po:ie bumidttatce quas recipi? 

untinlodeillis. 

f j£t melius quidein bis cft vino ©ccoquen* 

tescatbaplafmateipmviridcmagiscpficcii 

vebcmenrius polr cp t>eficcatur:et p:ompriue 

adurcndu.ficut quc canflica,ct quecuncp fatf 

macomm calida funtt acria ,z fubriliu parrtf 

um facilcflrtrabcntia funditus ad fc tota ad* 

facentcmbumidirate. 

f Bmaritudoflutqincft ribmriscidcomni 

no cft.opcraf autinquibufda ficutqueviolen 

tiU8.7quodcofiftifvcbcmeticabditaricufub 

ftanria fubrilul partit7.£r ideo qn fumimr in 

porudu8fuccu8.autrTtcriftcrc cuco :ocridj'c 

afcaridcs? lumb:ico8.j£t valct ad mo:fus fc 

rarum^occiditfimilitcrvermcequiscncran 

tur in aurito et in vlccrito p:omndis. 

f£tqnfitnafcalecucoautfumimnnpotti 

occidifzcjcpclliffcru.3simr incifiua quidcm 

virru8incftri,nptcrcalidirarcm dtm fubriltf 

tatcmpam'iun?amarirudfte.folairacMptcr 

omniapdicra confertoitoafmaticist bictcri 

ris^reramaritudinemapieficutspeneotn* 

nia cererapurgando ctmundificando eparis , 

opilarionc8.eltaufemadomniap:ediaaefii? 

cacius quod monftratumdr. 







Bt2)ttbi& 



€apitu!um.«]K. 

yT\ tntaftrom.-jMini.^mtaftrueft 
S 1 ■maafilucftrisoilftresfpafefol^ 

jLAaE o:u W^ fi S ura °3 ,mi colo:e P ulc 
gti^pter qb" z quidam filueflre pu 
legiumvocant. 

f l*n'6 comlducatl z ipofit] elepbaria fanari 
traditii e.fic magni pompeii etate.fomiiro cu 
iufda ejcpimcto^pter pudo:ein facie iliita co* 
pertiie.f £adcliniunf'atcf3bibunr' ivino ad 
uerfus fcolopcdriasi icrus ferpetu. cit fa le cfo 
7 olco t aceto.aduerfus ictm fco:pionu..Dc* . 
nicp aduerfus oia venena bec folia fcruaf ad 
farinemoduarida. C^etaft^qj fubltratii 
vel acccfum fco:pi6eo fugat .potii feias pur* 
gat:f5ptusnecat.fO:tonoici8to:miniboco 
lcricis eflficacifltmu.3 tc<$ podagns ipofitu. 
f Sactfetfaurito^minofis inilillaf . f 3n 
iwuboregiooaf-zftrumie illinif.ola vene* 
nistnbiber.rineaspeUirrJppuiriginevalef. 




fl) 



€apituu!m.rcfr"*. 

£u.DYaf.'i£)eu quodet amantfeuj 
t>icif.in 2£>accdonia i in bifpania na 
fcif.tvrfo z foltfeanifozanerofimiltf 
bus.afcendtfoeterra vfcp adcubifos 



fcuosradioto fparfisac fencris accurufelor» 
gisifuauiqs odo:e.guftu caiido: lingui mo:* 
dcntc.vires babet radicipa releuarcs.f -JMa. 
'^>cueftberbain.t).gradu.ca.2fic.2^ui i ;ra^ 
ditappcllafurilmilinoie."£tpcipuecompetic 
vfuimedicine.OnderadicinmedicinisTicbec 
poniquepertmoeannospotcftferuari.vir? 
rutem babetfciurericamecfubrilitarefubfta? 
rie.attrabendi ct ^iwncdi ejc qualit anto fuis. 
f -0>li.cap.©e^)eu.*^bcuradicula cftberbe 
afpera renuis? oblonga fuavirtutcolestca. 
eft et ficin fccundo gradu, 

©perarionea 

f 0v*afco:ide8.airesa'H8babet radir, rcla? 

jranree.vnde rrita z elicata in aqua'.t>ac in po 

tione vnlitcr ad renu t>olo:em % ad vefice cau 

fae:v:inamp:ouocat. 

f Stomacbimflationes? to:tiones intra?. 

nco:u mirigar:? ftcricae.boc eft t>olo:e8 ma? 

rricie curat.Srririafim mitigaf , 

f £o:acis reumarifmo cum mclle vt elecrua 

rium*oatump:odeft. 

f *,£bcftrua eria Efiamentu.puocat.Stran? 

guiriasinfanriuvtcatbaplafmaimpofitufu 

gpecrinemrefoluir.jEicquo fiplusbibiru fue? 

rir capir is *oolo:em comouet. 

f -|Marcariu8Xlinii vel aqua&ecocriois et'9 

refoluir opilarionem fplenis: epatf cjc frigida 

caufa facta.-z etiam ftranguirianu ©uTurril. 

Bqua vero compefentius in eftate fcatur iu r / 

ucni.ainum aut cm in bf eme z feni. 

f -fSulufe etfcu fcniculi femine in cibo vel po 

fut>atU8CEeluditintel{ino?ftomacbicpv&o 

fitatet ccferr.£6tratenafmonemeE frigida 

caufaiu vino t>ccoquiturberbaipfa. 




Crartatus 



Capitutum.KjEtit. 

j^W"\ fLiMmcemxptima fen.quarri cano* 
& 1 Imecap^ocboiadbationiefcbricirartf 
% B r rium.guiPiaf eptnelcannecft jucea? 
* * rufn.a boc fimifer iueniee lilegee ca 

puululucc^mm.Waminuatieecpeftjucca? 
rum cpfciticctpzoptcr ruipingucdincmno in5 
duraror.t3ocn'mUira vulr J3attcnue feprimo 
fim.far.T>iicene3nccarum quidemrocaru qtf 
qcmediaafdiciarabia po:ratur, £oagula* 
xur quidcm v t quidam aiunt cmnie. j£ft attf 
tem a illud mdlte fpecice. minue auron er eo 
iltud quod a nobiedulccvirtutc auretn fimilc 
eft ci inquantum abftagir et ficcat a; t>vafo* 
rarȣtfimftircr md cannc quodajco rcfiduo 
5tsccariquando ©ecoquitur.vclipfemct fec<9 
£ft alia fpeciee meUie quodtririf mel rub:u. 
. ct eftidemquodfupia.£rfmtftir<rati3 fpcaV 
•ce metlie quod vocatur mcl fto:acie. •: eftiKtf 
mdlubuc.vtfup:a.£ft fiinditer aliud mclqtS 
vocanir melacanum.iinrcrp«rarur mcl fine 
lumo.eteftmelcaflliafiftularu.ettftpulpaxa^ 
fitfiftuIe.£reftmdmirrinum:quodfircE©ua 
bue partibue meUierz vna fucci mirri. vt api» 
paretin atuidorario jSalicni mino:i qui incti 
pir.£enrcctioindliemirrini.f6alienue,vq. 
fepli.far.cap.oemcUe.^dtatirfaar-ziiCcac 
irrfecundo gradu.£ft aure ftmptide.^rcftstf 
ccrc majrime virturie er complcjcioms. t> \M 
fco:idc8.^>eleftfuccue rorie celeftts quem 
apes coUigunt.2 baber in fequali eompofitio 
nem quandam quoniam eje muttarum berba 
rurano:eerfucco coUigiror .jfdeoep omnib 
valitudinibue p:oficicne ommbus anridotis 
mifcmir.f3tcmmelaptmrinplaiftunioca* 
piendum ettfacnosicabuimpiftatim acrdi 
tiregutrae vrilirariecftindicium ;&onitme 
wo p:obatio cft vt fitodorifcru-jsetre tmld 
glufinofumacpcrlucidumXum autem ejrimi 
tur mehapee abigi iumovrftifiimum eft ne 
irafcaruretmelauidiratevo:ant,*^)clcalidu 
dt et ficcum.£onfcruat et mundificar.^n me 
dicinisponirur vr amaritudo fpcdaum dus 
tjulcedtne tempaetur.inclcctuarrjs quando 
<j? cum pulueribue mifcann vt »iuriu8 tn ma 
ioii tfflcacia conferuaur. 

f0Vafeoride8^elv«mcribfo:didt8yddt 
21 jcttq.otebusperunctumcaltgincmoculomm 

©erergit.£argarifmo adbibttu vulncra fau? 
jl ciumafinantc6Curar,vrinamp:ouocar.Yen? 
. trcmmollit. 
# f Cufnentibus p:odcft.nio:fibue vcncnarie 



occurrit.^&oritt» criam rabidi canfsadbtb0 

tum curar parienrcm.Sridii comcftum infla? 

tieneepttftaf.Ue^mclcftarismelraec&bie; 

mis vero minus vrfte efta fpiflum; 

f *i£>dfolu faftidtu roltitjnaufea^btbcr, pul £ 

moni i otto inraiorib? ntedaur. 

f S?aapion.3£>elquando poniroririYlccrt 

btt8 fraudulcntis p:cfundt8 conuenit cis mul* 

tum « M. 

f£tquandocoqmrar*pontrorfupafctfl« P 

raeatrie confolidarca8.aquando coquirur 

atmanerobutntdoxtlimrurcumeo emperi* 

gocurateam. 

fjEtquadomifcrfcufalctrirottJiftillafiao? 46 

remfedatrvnnituauriu:2tinifcueocaput,*oc# 

ddit pediculoej? lcndirice* 

f £t quando indumcnrom ahcuiuecft b:euc 5 

mmie fi cft ejc lana z vulr <r dongetunfi irro:* 

uerttiUudcum aquarodndeltniaturcumcUc 

dongatur. 

f j£rmdabftagirrencb:otttarcmvifu8qnf«t J5 

coUiriucucoqruo:dedmt>teto?rtnui87 fiut 

cit gargarifmara 

f j£tconfatapoftanaribuegu(rurieafan* *5 • 

cium4afquinflnrie.€rfiUniunruraimeogin* 

giucpuao:umrempo:eo:tU8 ©entium couk 

fadt cosfacile nafdct fine oolo^r fi aeciptf 

arurvdbibarurpw)uocatv:inas:aconuenit 

tuflt. 

f 59&cmi8.S ciendum <p plures funt fpcd^ -j ' 1 

C8 mcllia; £ft vna fpccies mdtis quod dtmcl 

vfuak.q i »odt)iuaf.ficarur f m tJtfferenrias fu 

psadiaac. 

f £ ftaHa fpccics meUis q*$voearurjnc! aibc K' . 

m'cnfe.qt5arTafab2ltbenie.£reftmdYcfpa 

ruminlect8fubtcrrand8facru.£tdtideqd 

md pafimaru vel granaru.vr in 3lcjcadro.j£t 

vocaturmd pa ftinatuiUud quodcft md gra 

nofum.TtOribafiue. 

f j£ft alta fpeciee mdlieqtfvocaf melarticu. 2- 1 

idcftntd vefparu fm quofda.-fed falfo.quoni 

ampY^ (coiidce capit Ib ©c mclle t>icir.!gbd 

fuccue cft rorieceleltie.jCui^gcncra fur ctioi 

Qnuquodcupilioneecolligijtapce que funt 

obtonge.Sltudquod fub rcrrainuoiif vd at? 

ficumltmaricu.j£riaaUqitit>icuntc|mdamV 

cum eicif ab attica regione.^cl timum vici 

turaregioneXbima. 

fOnde ^Unius incif ,!^ellie arrici fumma ®2 

Jaueroro o:becfu'marur franflaru tnarrica* 

©ed tbimum magie laudarur^uare in aliq^ 

bue antiquie anndotarue md a 1 1 ku ;mcl rl?i 

tnenuaponirur. 

C8pttuuuu,tfjEriif. 



Btfytthw 




/TV £dfca.fcvafco.cap\£ot.i.medica 
I I ■ ^c«.£oteftbcrbafili8mfoUoq 
y I \ infra fenu nafcif .iblia bj angufta 
x virgull ftmile trifolio. in q $QtV/ 
Ufemceftvtletfcula.iUudfcmeWccfpani.p 
odo:e.yfi64>o mcdica fnf lcgumta fcnpfit . 
^aU3'U.tJ agricultura/ZSbedica tnd,r q fe* 
rndferifqttHwanie pmaetatatyqter* fepri* 
C8 polfit p anu refrindi.ag¥.fterco:at. aiaUa. 
reudt.cwategrota.-£U.^bedicatf:a mcdis 
inctapbella"^crfapqlati^itulit:q»tataeei9 
sos vt cjc vno fituampli?$.ccciani8 ©urer. 

©prrationfs 

i C^didnafltdafuntquidastrocifcifacriejc 

ca.etvngunturinbalncis. 
> €£3ancberbamequietaffoicomedunt. 

■ flOc quo auicen.lib.tj.capi.jCot. Oleii cot 
cftreemagisconferenstrcmoa. 

Capttulum.ffjKiu). 

x*T\ £fpfla.yftf .aft.^rfpilacftarbo:fpt* 

■ I ■nofafructiilirismalof.fjpaulobzau^ 
^t 1 7 o:.an ajpcllata ab eo cr piUulcfo:ma 

rr* babcatci^poma.-^li.li.icv.arbo: mc 
fpito^et>campliIUmi8.foUaci9antcci5X>cci? 
dut rub tfcut.radiccs mfte x altciocp iejctirpa 
bilcs fut.*|>al.li4i£J.!!g)cfpile loc$ calidis majti 
mcgaudct.fjimguistfngidis.pucnuit.mag^ 
tnfabulopingui autglarcofa tcrra cui s.mti 



lctacft^rcnavclargtllacufarieJS^crcndadl 
talis mcfe '^arcfo vd noueb:i.folo fterco:* 
to x fubact oara vt vtrucB caput tale fterc9ob* 
docat.STut riflncremeta tarduTtma^matpu 
tari atq? rircufodto parco biio:e licdratee fe? 
pcfoucri.focriftfcmre:fjtnlongio:efpargtf 
ctatc.Sifmiteoccupafmlo crco purgandc 
(uttamurca.vd buanavetere vnnavelriuo 
calcej)fundcch':f5parti%>terarbo:i8nojca:vr 
aq Oecocta lupini.f5putarbinc arbo: ftcrilia 
fieri.iim^xrinisvitiufiffiradiatoinfundan 
tur fterile rcddut.S5ifo:mice molcftc funt.ru^ 
b:ica cu accto x cinere tcperata nccabunr" .311 
fcrifmcfciebmario.^urcu^tnci^cjcarbo^ 
rc mcdia t>ebcr anumtVFJa x>e fumitatibvtcio 
fus cft.3htrunco fiffa infereda cft.nam coatf 
riain actcs iriuna ml nutrict. 

i>pttatfoW0 

fOYafco:ide8.'ig)cfpilcfoUatco«cjci'dcm^ 

cpradiciacottejctunfe? tmpolire;euicuq; tui 

morifcmo:icpfubucniut.mtatficcacumellc 

cicamcevulncriadducunt. 

f £5aftacumvinot>uldfanguincm reijacn* 

tibueopem ferunt.jftcm cum vino p:opina* 

tawcnefictj potionibus rcpugnant:vcficam 

vrinalargiorilauant* 

f©erapionli.aggre.cap.3aro:.auc.£>Yafc. 

jaro; arabiccid cft mcfpilu ,x cft arbo: fpino* 

« a 



Cractatua 







fa.ciHti6 vnapafQYOcafmefpilifo babct fru" 
crii partjii ftmilemalts partue:bonu ad c omc 
dendu.£ft ftipriaj8.bon$ftomacbo cu comc? 
dtfrcrinctvmrrettardemaruraf. 
q* ^auritfliii.tJe cibl is.fruct&ius eft ftiptic9 
ftipricitatclbzti.-zinfoliistmrtjmmitaritocft 
ftipricira8/U«T9 cft a fri.paliqmtalt'ij omni 
umpam cdmedif .puenit nd vt ficuurssut vua* 
runwopiofe.nect3 em vt alimcnto:fedvt ; mcd> 
cinis ipfisindigemus magts. 
(tfjEtwit in.vq .{tmpti.far.cap.m^pftu^da5 
iricociunotant : co <p tria bj olfnla j ofa intra 
fczc.S?tipficu8aiiteftfurficieterfruct t ;foui9 
arbori8^vt,ccdibrti8;2rcteriu8fiiifia'enarcfl: 
ventri8.£t in germinib? cu»? in folqs ftiptu 
ca qtiaiifasclt ndpauea. 
^DYaf.capjoemefpilo.fin trlflarione gre; 
cam»*z&efpiTufeinc babet cotundtnfructumi 
nurihmariano fimile.triax)fla babes vntrico 
rinu©iawr.ftipricu efteeuftomacbu :venrre 
abitinew tarde maturefcit. 
^&bmmtraa.itj.iu fri.funt 2 ftc. ventre ab* 
ftringut:i vomitii abllinet.j£t cft alia fpccies 
qucinbifpamanafaf:quaniulricp\mel)dam 
vocat.fcme>otundu babesz trigoniLvndcct 
triconu d: Jbonu eft adcdendufttpticiK fto? 
^nacbo apriteifta dt ajarola. 



m 



Capitu!um.tqEfo» 

3llefoliii.-i>li.u.5j:iip . *£}illcfoliu qS 
|?nu'nofilon-3:.£suleb5 tcnc? fimile' 
fcniculojplurimisfoliie.vii-znomeac 
' ccpuVRafcif in paluftrito. /Ep bcrba* 
rt'o.*Z&uTefouu q z amb:ofta vel ar< billea fo 
in locis cul t* nafaT.b3 flo:ee aurofos 1 albos 
fp^^^inofilosnafrifinpaluftritoloc* 
rtrfim b$ er. vna radicemoUc z lubiufumr? qfi 
rnamtoliniatu^foliafimiliafcniculo. 

&ptxmont$ 

^Dvaf.aulncragtotinant-zfinetumoiecuf 
ftodiut.3nt>entiat>olo*c cubutiro iponunf 
in modii emplaftriXdrra vzinc^irnculratem 
bibifcuacero:2valctpcalajlu.fj5ai:vu.fim 
pli.far.**£fllcfbliu ficcariue cft ***n*tj intatfi vt 
-pfolidat.vulncra.*IJi>li:Bib'T cum aeefo ad 
iDirSculrarevrinc vfvdtcc:vr fufpiria papiritf 
tifctjccalro.^fiadcadccriutiolo^crTicacifi! 
fimac.5oliaci9ej;imtivfu8 ad.vulnera eaq? 
aJTtrmar.f^pbcrbarioXomaaSmnfa^ap 
poiita nouis vulncrib>tio!o:c tollit z cadcm 
glurinat.*j!S:ofluuiufangui8ftringir.cadcac| 
potata*3imntm'co6icttrat.^r3fevalctad*6e^^ 
riut>oto:e.ad nim PiftKuUarejadruiiio**. 




CapitulunucjEcur* CapitulunucjEcoi}; 

afco.O»lb^rabice.i ; miUuroU6^teft| I |mef.:^iraboluno£fpcefatq^crj.£t 
bcrba cm^folia fifanf folusohue.mfi 11/ farfruct9arbopijindia enmu :?noit 
q:fatmaio:aa8xmoUio:a? Utio?a. «— ^•cuifdemanerieifatocef^oitjarfoaeffc 
?futeisinfmo:a.occlwatpfue tYavelut Itet ctuuzoiuerfaffoMua^.ankue/^birabolo 
fUjjipam^bj^saeclemtaefnbtiTeelitfquif no?fpe8fatqnq5bono?.£urin9:kebnb;:bcl 
iiltu^ifamitatetgceftfiteiramulot>unfu i uric^emblitfindus.&uidaiucai o/fat oes 
«masEtesicifatfoUamifiuta^iuijaq^libec abeade^rbo:epducri.ttattarrinifatt>ep:tf 
foUuefemealbuou^fercvtlapisro^du.ifi mogermtc.Etnigriindifutinqtofpiienitco^ 
magnitudineozobiEui.nafcifin lofime et pleriomaturario.mrmcy arbotcos eoe 
alri8.DYaf.ca.iicofEmoa^iluifou6eracli biefermte.t^cwinifutoepmogcrmincct 
on vocaf^fo:titudinefemi8.avfoliafut ty nigrifirr.TNebul9germefcr3m tuUt.f3falf0.im» 
milia folU8oUue:f3 latiota 7 oblogio:a/r vir? mepduaif a t>iuerfi8 arbonte.: m c qd crc* 
fia6tmue6ingronitudie.iunalisnofa6.tin dif.©5alicivolut'q'cmblicitbeltirtanoin<: 
fumo ^ga oiuifaeiq 1 foUa minuta fut. vbi ec mVetur infmirabolanoe.qm Suii. z Sera. 
femerotadutlapidofu^ftzalbupifefile.na^ ©erisTMUerfafaciatcapfa.vtbabtfure.tKb. 
fafloc$afp.unalt$. O^ttrrnf ifim 1'n.c.beUmvbitTactatoebeUiricie ?embu> 

cie.£> 31'n ifto.c.t>e alustritofpeo^jfteSe 
rap..lib.ag.faa't cap.oe cmblicis z beUiricj.et 
facitcap.t)ealii8tritogfe.oeclt)iat2^aUlig 
td eft mirabolani.cut9tre8 fut fpes Kebuli Ci 
trini z nfgri. £t fut ilU" c\'noimf indi et feni ct 
Kebuli.3de auct.aben mcfuaY.^jeUo^sfut 
et eie 4?- colo: eft citrinSanxoicimae viridita} 
ri.5ue8.pleni.finenjgi8.j£tt>icttaua.)?faac« 
£t fat fri.in pmo gdu.ficci in.q /Btgrif rig. et 
fie.inpmo/i&irabolam indi velnigri/: t>e fe? 
m fu t (ffr ej: fpcto bntito coztice fubt ile nigr & 
tco:tej;eo?vergitadcitrinitate.tfutfife8oIt 
tiis i fo:ma fua.fitiuuametu eo? eft minSutf 
uameto aUa?fpecie?.mirabolano?.£t idan 
aucabenmeluav.^irabolanifmifurepfpe? 
cieto oliua?.:q qn pdiurur co:robo:at ftoma 
cbu z incoriat rii incouarioepauea.tnp eft in 
cisiuuameta qnrii i kebulie.t ejc Kebulie qdl 
fOtcitrini qda nignV: nigredo q eft i rie eft^tf 
ampUo:e mozi q? fcccriit in arboic fua .z func 
pinguio:e8-rcarnofio«8citrini8incolo:e.qt 
ipifeceriitmaturarioneampUo:c,tilU c\ coltt 
gutur an fat cirriru':? qn fumatur t riti induait 
labo:ein ftomacbo:qmnaturalabo:at mul* 
rii circa ipam .f$ qn infundif aut t>ecoquif ej& 
trabif ^me a^tjcif ei9fiiDa.t eft leuio: na 
ture.-: oTcedit veloa'9 a ftomacbo.£t ille trea 
fpes mirabolano?.mifcenf cu tamarindie qm 
tamarindiejcringuut calo:efeb:ile. nffi q: no* 
cet tuffiaito,ff>f acetofitate q eft in a'8. Buic". 
©e ^ruritoandieait.^irabolani (unt(ri.et 
ficf IJobanneemefuc^irabolani funt t»c 
medicinis bndictis.no cmrabihtant cufoUtf 
tionefuaamo?fo:tantftomacba / |p:ie: , zvifc^ 
rap:eparat.ercoadunat parteeeo?..? pfortit 
i«« ctcpar:etco:p9totu« ftocmmfiad vnum 
a it) 



fpYaf,tJirt9ecimictuaU6.'rfemeei9bibita 
cavino albocalailoefragit.tvrina .ouocat. 
f •f>iixap;BatangUfco84.miUu folis. eft fe* 
meneiusberbequcoicifaftowe.qdftquis 
biberit fragit lapide:z jjuocat vrinam. 
fl>aux.jt:atebi.i.miUavelgranufoli8: ( puo^ 
catvunltmeftrua.-rcftca.tficin.iq.gradu. 
ffitvinattecoaioiseius-rpuluisipfiueicd 
bisfumpt^foluitftranguiria-r t>iffurrilx \lm 
cam paitione.-j oia iUa foul feme operaf . 




Ctartatus 



Mdcnf nocvuCJSlc^cjFem ©ffpofitio adB opi? 
tario.et,tprie paratio cadere in ipa.fj funt t>e g 
^fecto rcctificlrito mcdtcinas q bntacuitare et 
purglr t>iflblacdo.'^>agntfice em adinuenit 
q eos et^jprie citrinos cu fcamonca mifcuit.re 
p:iinir cin ea^pter obuiarione fubftatia^ % qi 
litatuaditiuiccieteainfoluedo iuult. 

f^peratiotm 

gj f ^era.tlirt9cifrino? cfterpficKtlrodbeet 
^bibetcurfubumoyadipoo.^tpferutlebcl.et 
pfo:rIt ftomacbu et incorilr ipnur pferur mc 
lancolte et cardiaccer clariftclt eolo:em. 
T6 f Oirt9kebulo£eft Q> pferiirano.ercmo:rotf 
dibo et inco:iar ftojnacbu et pfo:rat cit.? t>igc* 
rutcibu.^diccltbumiditate.leniutnaturam. 
pfcrut vetofitari emo:roida ?.et pferur melan 
cotiao.marimequcucioadmifcenffpeaee. 
£ f £o:robo:Ir fenfum ? memorilttpferunt te 
p:e ? colice.Q» 5 feni zindi vel nigri bnt coitit 
ccmfubtilenigru,etco:te]cco¥.ver0it3dcitri 
rotatcd,qn coduritur co:robo:It ftomacbit 
crinco:ianrannco:iatfonepauca.erndcftin 
cisiuuamcnrit quantuin kebulio. 
I? f 3obIneo mcf. ^irabolani funt cp reb q 
fariuntvtete0feimiencfcere.et acquirunc eie 
colo:e bonii.etbonitateodo:i0 o:is erfudo? 
rio.et gencrlt gaudiu. et pfb:tant co: et cpar 
^t ftomacbu.£t pferunttrcmo;ico:di0.? mu^ 
<Jincanr ftomacbum.-z pfcrunt emo:roidibU8 
ct ejctinguunt inftlmationem colerc 
B f jocd citrino^opcratio in B eft pccllen0.ipi 
cm folutidceducunt el et pfcrunt cdplejcioea 
ca.bnrib. £t co£ fricatio aim aqua agrefte 
ctcu aqua ro,3ut fucco feniculiabftcrgir ooi 
lum.et aufertfug caUdiratceiuo.etfactoinde 
alcobokftringir lacrimae.et puenit mollifica? 
ridi octb£.et pfcrt tcrtiane fccoleririe. z ptrtf 
tccumalticc fanltvtcera. ert>eficcanrea: 
,4 f Kcbuliquocpfolufioeeducutflegma.-zad^ 
duntin rarioncct clarirKcant vifum.e5jpM"cco 
diti.ctmundificantftomacbnmctconfo:tant 
ipfum.etconferuntvdropiftctfe.antiqui0. 
£5 f 'Rigriautevelindi folurione edncunr me* 
lancoliam ct colera aduftLet cdferun t mdan 
colieet trcmo:i. et i larificant vifum et colo:c 
ctcdferunt lep:cettriftia'eet quartane.Dofis 
porio citnnomtritoru a.5.q.vfcp adquinrum 
ctmfufo:uma.5.viq.vfcBad.]C]c.etindowmcft 
fiairkebulouim. 
t> f £uicafim eben abcn 33arfn.itb:o qui ©ieif 
feniiro:.'^bodue aflandi et calliandimirabo 
iano0 opo:tet cp imbiblt mirabolanos in M 
qua aronio?.autin fucco agreftc aut in ace? 
lofitarc citn.aut ia aqua vbi coctc funt ictea. 



autvbicocruc(tl!S|paciuacuritm.t>cindeioc 
ficca eosbn-zmadefac inolco ro.velolco t>c 
letifco.autolcomafliano.autcu butyro. aut 
oleo oliucoeinde afla fug pateUI ferream vd 
rerrea.quacumpmocalefcafti •zabftulilti ab 
(gnccaucncadurafiDeftruafvirtuoeo^. 
f StTaflanf fcmiaqadmiftranf i medirims 
finp.fct mod9 aflaridio eo?. e tftc&ccipepa* 
rctllfcrrcaauterelautterreaautlcbetecuia 
to orificio i calefacbn.Dcinde aufcr ab ignc 
ct ftarim fup. ponc fcmia t>u ipa cft catida an? 
tccp i nfrigidcf ,z comifce ca fcmg «ooncc vidc^ 
ao aifaridcj coq. cdplctl ad volutatc tul.j£r ft 
nd fuerit pplcta vna viccpdc itepz fac vr pifr 
f £r friao cp ndofitct oia fcmia eqlircr aflare 
q: fitt qda qbntmulra vifcofirarc q t>cbcr aitt 
pli9aflarcficut pfilliu.': cauc nc cdburanf • 




€aptto!um.rt]Eartf}; 

yTTv 3rra.^era.Iibag.ca.bccaucro< 
S § ■t>vafco.t5ecara.i.mirracftgum 
3 ■ Z miarborie quenafrif inrerrioara 
bum fimilio arbo:i quc tiritur iti 
gr:co fpinababvlonica.^Ramfiunt fciflurci 
Itgno arborio.vn!5 egreditur gumi quod cma 
natcadenofupcrfcjctona qtte fternunmr (ub 
9rbo;c; qucdam pcrfc coaplarur fug liipitg 



ynvzty^- 



ferftrfbfe 



t eftioeipfa res quefciVfturbacatifcue fiueba 
tanafae-rgrofla eft aqua egredtf merb. i. fto* 
ra;:iiquida.qncjcphmif(tcuta{parcttnca.fto 
ra]c.£t arbo:eiu8 cft t'n rerra q t>icif prinia. ct 
eft pinguie/r qn ecprimifTuccue rius egredif 
velut fto:ac mulru/r mclio: mirra cft illa q t>tf 
citur tarbalud.zcancbiVznoiarur 15 noic:eo cp 
Seferfecrem'eqt>icnmrfi'c.£tcolo:ri9eftad 
viriditate tendens.pungee lingua clari colo? 
ri8.etecea eft q ©icifliri eteii litba glutbicbi , 
eftmolliotactudcutbdclIiu.inodoKfuo cft 
pingucdo.t arbo: rius eft m lociefoli crpoftf 
ri9.£c ca eft q t>idf poadie.t eft afpcra mutnt 
n(gra.?afi?arettneaveftigiuigni6.£rsete^ 
rio: cft ttla que tMrif argaftn. z cft leuis no pitc 
gw'e.actm'fapo:te.fiftegum( arabico in fo:ri 
t udinc^tute<£c qcmirra cft q t>irif crumu:(i 
ueamini.Teftmala.J&tfiuntquidirrocifcicjc: 
fubftacijs mirrcz li mirra pinguiofuerir croci 
fcici e]ccaftutbabetbontiodorc?pinguem.ec 
fi no fuerit pinguis q«5 fit ep fubftaria riusno 
babct bonu odo:e necp pingue.? babec virrttf 
tcm ©ebileqpter qtf admifcef ei oleu qit c;c ea 
fiunt rrocifci.Sldulteraf mirra .qn admifcetur 
ei gumi qo* infufu fuerit'in aqua mirre.£r me; 
lio: ec mirra eft noua.leuie.munda.q qn ran* 
gitur cft aliquantulii afpera z arida. i cito fra 
gibilis.z qnfrangif remanetm ei9fracrura rcs 
alba.ctfigura ciuscft ficut ftgura vnguwxtq 
dttofroftanopaim?colo:ei9e(ivmfo:mi8 
non aiuerfiein ectcrioribue riue.fed interius 
dt rrabes adrubcdineparu cu linrie fabalbi* 
dis ficut t>ijcim9.z odo: eiue eft odccc abilie a* 
mara.f$ illa q cft gtu'8:cui9eolo: d t ficut colof 
picismo cft aU'cui9vrilitatie.<oed mirracj eft 
cctcrra:q©ia'flaboteroabfcindifc|cradtcear 
bo:ieqeftinrem'eiUie.£ugif cmccea illud 
qtf cft finiile mirre in odoie.z virc9 ciue d t ca* 
lcfactiua xmolltficariua trefoluriua.-cingredi 
rorfocofecriontfcovnguenco?. 

0pfrariont0. 

ff5cra,auct.aibugerig.^irrapucnit ad 

aquaa'rririiqnTumifeceainporu*aucqnftc 

cmplaftrucu ea fufivcntrc. 

f Etqnftt caputpurgiu cuvno anocb cjcca 

mudificat ccrebam aufert ab co vcntofitatcs 

groffas.xincouatgingiuae. 

f fitcofimat&entee.tcftconaboUce quado 

fitliniriocuca. 

f j5alicn9.^>irra abftergireu tfiamento :ct 

glurinatfragmeta ofltu copirievzoaidit luntf 

bricoe z fetiuecpeUene cos. 

%£x ingredirur fo confeerionito colliriouim 

qucfiunt ad 4 vlcera ocultaad maculae quefi 



untineo.zinmcdiciniequebibunfuf ad tnp, 
fimantiquatwrad afma.'Ramipfa ejcafpe? 
ratcannam pulmonie/z boc quia noncalcfa? 
cit necfc t>eficcat calefactioe z t>eficcaride fozt 
iti r fine fugfluitatc fuc amaricudinis t fuc ab* 
(tcrfionis. 

fl£ftalia mirraquc trabituraradicearboif 
ri6buiu8.ctvirtU8 duscalcfaat moUituatcc 
rcfoluit. 




<rapttulum.rfjr:rijE. 



(D 



0:acetfl'.Suicen.lib.tj.cap.t>cmowi 
^borifuntouefpecice.nnaearuj eft 
alfirfedu:quodeftt>ulccr curritfmfe 
mitam ficue in maturarione. S>ed eft 
tetcrious nutrimenti 1 minoiie % eft ficcion'8 
■z magis oeftrucne fanguincm.-z t>cteriue fto 
macbo.^RdiquasverortcustJifpofitideeba^ 
bet.dttameninfetiu8 eaamarum aucequod 
rtommaturmo?.t>efceniftcnuncilludt)equo 
plurimumloquamur.Oiiod ergotmmaturii 
dt cum ecficcatur ftat loco fumacb. twlce dt 
calidum^umidu^ acetofum.t t>e (ceni citstd 
ficciratet>ediue.in ipfo cft ftipricitaez infrigi 
datto.t fuccue mo:i c(t ftipricue.-z^rie quau 
do ©ccoquiturin vafeeneo. 



0prrarionf0 



8 Ut| 



ftaaatuff 



WL ^Stiiceita.SiUCCus moii.pbibct flupu mate 
rieru ad meb:a.-z imatu^- e ficut ftimacb. 0n 
coquiitur foua eiue % folia xitie. % folia ficus 
nigre cum aqita pluuie:t>entgrat capilloe. 

23 ffHcerofum remouer apoftemara o:ie 2 gut* 
mrie.£tfolia eiue funt vltima ad fquinantia 
et pfoca tione.&uod acetofum efi cofert vlce? 

* ritofraudulcrietpftuefuccue. 

X ijf -Rob eiue acetofum eft pferee borbo: 021S; 
et t>ecocrto radiris eiue mollificationi fcentiu 
et©ccocrtoradicie*i9cftbonat>eri t>olo:ofo 

^ f!^>o?malueftftomacboco:mpif ,fp:ie in 
co alfirfedu^ qii co:rumpif alfirfedu i itoma* 
cbo vclocircr nonoccr.fetogter qmdemvt co 
mcdanfocefpepaUeanre cibito rccipiantur 
iuftomacboun q* no ftt co:ruptfo. 

£ f 3llud #0 t>e fent no nocet ftomacbo colcrt 
co n ud e!t in ipfo t>e mala cduenictia (toma ? 
cbt quod cft tn alfirfedmcpuieftr in ea maticia. 
'jnocitnaufcainipfo.inutrimentuei^eltpar 
uum.etfacitappmriicibufaattpmUtb:tcu3: 
1 Cjctrabit ipfum vcloctt er.z omnino oefcefua 
ciu8t>efacfofitveloater.fedeiu8t>efcefueep 
inreftimseftrardue. 

$ f^aa.lib.ag,cap.boc,l3ocarabice.i.mo? 
raccKt.airtuseiueeftqreritictvcntrem.zcjri 
do t>eftccaturterinet ventrcretcntione fb:ri. z 
couenit vlccrito int cftinop.? flujcut ? omnib 
egritadmito quc fiunt cf fittrito bumos. McT; 
mifcentur pof tcj? terunf cu cibiefiotj fumacb 
£tquivuUceeie fumcre inpotu:poreft cum 
aquazvino. 

fl£> ed arbo:ieetue vtrtueeftcopoftta crvir 
mrererenriuazlapariuavzplusquodcfticor 
ticebuiuearboasclt virtuelajcariua cii ama 
rirudtne pauca.quoufq? occidar afcaridee : ct 
funt lumbaci cucttrbirini.fed!in foltje arbous 
et fummitarifco eft remperamenru medtii illarii 
tHta^operationum. 

§ £t mo:a marura qrt iueniur ftomacbu pu* 
ru.fi comcdunf ante cibu egrediunf a (toma* 
cbo rito.-zppararefaciunteriru alio^riborii. 
qfi $0 comedunf poft ribum: vel in ftomacbc* 
funtbumo:ee:cito acccleratad comtprioneV 
% co:ruptio co?.eft mulru nociua. 
§ ©edaccrba qnscficcanf funrbonamedtf /TV 
dnazinuatiuavlceritointeftino? zf\nm\an'/M B 



& 



ti 



fiigida fuman?;£tpauctfnMcoJBft>3t «otrt 
mentu cofimilepeponi to. no tii nocumentum 
adeo ipie.necp malu (tomacbo vt in illie. 
f Saf.vtj .fim.far .f m tranfla.grcca.cap3£oi 
racelfi.fructue maturue fubducir ventrem^ 
nonmarume $ot>eficcatue pftipariuufurttf 
cienterfitfarmacu.vnde adt>iffintericae con, 
uenit ©ifpofirides-zciliacae 1 aliae queeunqj 
funtflujobilee. 

f £t tota arbo: in oito ei9partito mipta qn* 
dai^turcvidribabereeicfcermriua-rpurgari* 
ita copofiriua.^cualetaiir in comce quidcra 
radias purgatiua i? tus cu qnada a marit udt^ 
nevnamploelubricosinrcrficir.rjnalne^o 
pa rtibo t>etetiua, 3n foltje ^o % pollulatioito 
mcdia vtraqjeftcomplqcio. 




ftquo.£rmo:aqnt>efcendutanrcq3co:rum^ 



panf no inferunt nocumcntu.nifi t>eeie arl coi 

meftionem nimie fumatur. 

f j£c ide aucr.0at'.j£]c ete funr matura : z ma 

mrifapo:ie.':fapo:eo£ert'oulciefttpric9.vir 

018 co^.mollit ventrc z nutrimenru paucu co: 

po:tpltat « faale co:rupunf. no co:rupta bvti 

mctit penitueO nfrigidat aut nd pcmc> niii 



€apitulutn.ftt. 

D:abacri.y(l?5,^o:u8grccc: latine 
vocaturmbue.eo cp mbeant trucnis 
ciue vel virgulta. <o ilueftris mo«fr« 



ctibueinocTerto.lSaftommfameeac 
penuria confouemr. 

Sprrattonrc. 

f Sreltotilcein Ub:o t>« plantie. Jtuctue ty 
damciro;maruranmr.vt mo:a tccrafa.-zfuc? 
comm qui funt in fructibue.qutdam funr po> 



■& 



Mftbfe 



tAMcdMeft&icaiQmoiomml 

f -|iUuiu8.lib.icr.:^o:i8eftfuccu8 utcarne 

vinofua.:£rinicolo:€8.pniofc5cadidus.mo]c 

rubcusmaturie^o nigcr.^nnouifiimis flo? 

rent.inter pmamawrd"ciu.manufq5 fucco tin 

gunr.^atura rmmwcaba minimu. £arnc 

et fucco conftant mora^ 

f #;>o:aquidcm?piro acjniro fuccuseftvt: 

nofu8.colo:cqjfuccimo:i8accerafi8cft fan^ 

guineus. 

f -ji>alladiU8.li.j:.adt>iamo? conficicndum 

agreltismorifuccufaciespaululum &efcruef 

re.ZlWK fcuas eius fucet partee % vnn mcllis 

adnufc&is&cmijctacurabtsadpinguedine. 

njclti8t>«oquerc. 




a 



<D 



<Eapfai!um.rrtf; 

Oifus galline fiue anagallus.^an; 

decta.Bnagdlifue funtfpee.una cft 
aurtcula murie.ct c\\ maiosvz atia cii moztm 
gallinc.ieftmine:» 

i>pfratione0 

f SmbefpesanagaUiivutnerit» pftane dfc^ 
cruXumo:c no admittunt ,t infijca co:gi euo 
canc.pafcentia vulncra abfu%nr. 
f Sjuccus ca?. T>eritiu solozepbibetjfi.p^c* 
&tro vcnte in finiftro nare fucrir imitfus. tHc 



foecuecu mellcafrico cocmz adbibitfcaUf 
gines octb? fiue riciu co$ qb" vocaf argemon 
fiucargcm3derergir.mo:fit0venenari8btbtf 
tue mcdicaf.f 'Refreucie.bidroptasrrcpatt £ 
cie:z renali paffioe scfccris pzcftat aujctlium. 
Bno tumcntiimpoliruemedtcafur. 
f^tefuccusnaritoinmfusputredinecapirts t> 
purgar. ^abetem ©eftccatiua ^tutem abfqj 
mo:dicarione.vnde?vulncraglurinaf. 
facnrremquoqjfccducitmulfeadmijctus* £ 
potuitiatus iberba conrufa ximpofitaltipitce 
cductti>eco:po«. 

f ^cra.©pc8 anagalu'minojfe.fc$mozfU8 S 
galUfiefacitanuingredi fintcueaanplaftru^ 
f j5ar.Bmbe fpee anagalli btit occulta caltf Q 
dirateaftraaiuavtxrtimulo8infijL08cuellIfi 
^a^o fuctfa narib? flegma purgat^jpter 
demcaufam.£tvniucrfaliter loquedoficcart 
uam babet vtrtutc.quap:oprer ctt a vulnera f© 
iidant;? putrcfcentitopferunr. 







rwfiv*nf»"j!? *» yrVT***' 






Capitulum.rrr$ 

^ttttsUtine-rgrece.Srabieefcer.to T tT? 

mefitcavelbes.Sera.lt.ag.cocicto^ **''** 

mcftica.?eft©eeafom'8viriditatf©e* *^At-<^^-V»^- *?.^ 

clinan8nfgrcdini.ett>ealia cftquese v&trvtf** c*- *^hJ* 
ctinatadrubedinem.-zqucoeclinatad nigre* ^»vk.Vi>c '<*+*-£& 
dftrcm^fettmagis itimedicinie.etfimilifU 

B V 



Emmtm 



a 



% 



3 



&> 



H 



grana d9 gpgfed? quc <# ca eft motana ,:fu6a 
ci^clt copoftra ciE^turito prtieat iUud q# vin 
cit pl9 i ea cft fu&a rerrea frigida.-z ein ca cu 15 
rcs calida fubtilie,et fapo: eiae dtftipt icue. 

jE>ptrattonf0, 

f £> era.auc.abcn mefuavio uceusd9con* 
fcrfDoloJipcctoriectpuImonie.ctltringitflu 
jcum vctrie eolericu/zpfotfat ftomacbit.: cft 
bonue vlccrib?meb:o#mterio£.fo:rificat vtf 
fccra.rctinct ftujrij menftruo?,.: grana ri9 cctf 
ferut fputo fanguinie a pcctp« z pulmone. et 
pfcrunt ftomacbo fua ponricitate. 
fpY3f.©anguinc^rearitot>af.ftomatict, 
puentce cft.vana mouet fcoqnoie moulii im 
pofita atcppotuit>ata 1 pddt. julia ei9vireria, 
cataplafmati aipofita medcnf vlccra fluetia « 
f 2lrida $o ptrita afp:cdine t> yafoKfim fatf* 
Unt.^tc bacca?. viridiu fucc9aptaf fanguincj 
fpucnto.ipequocpcomefteeadefaciut.j£)Cvi 
no tiecocta: inmoducataplafmatie impoftf 
ta ectrema vulnera fanat . 
fauic.'^irt9rmnetfolurfone?fudo:em:et 
ocmfturii fanguiejz oem flutii ad mcb?. 
fj£tqncueofitfricatio in balneopfowatur 
co:pue.:t>eficcanf buiditatce q funtin cutc. 
f £t emb:ocequide©ecoaioied9cufugofla 
ctfundunf'.vcloci i ;fitipo?reftauratio.zqtfe|c 
cavftucft loco tuticponif adB vt bonue fiat 
odo: coigie.z pfert omi fliijnri faguie unitu.t 
loco emplaftri fuppofirfi sbibitu.t fifr d9rob 
^robfructf d9ctipi9d.de nutrimaii eftguu. 
f £ti fvrupis cide no dt q" reftringat:,pbibtf 
att>olo:epulmoie7tufltm pter fynipu ri9. 
f £r cut'9 oleu ct toc&z secocrio tpi9pfo:tant 
radicee capiUo?.ct pbibet cafum. et .plongat 
eoe;:t>enigrat:et^ueipfiusfemina. 
f £t oecocrio feminu due i butiro .pbibet fu 
do:e et rectificat rafura venaru. 
f £t folia ciue ficca.pbibftferoie^fceflc: in* 
guiuxtipftuecinis loco tutieponif .et cofert 
panno.fedat apoftemata ca.i berifipila et fo i 
mica.tbof bo:et vlcera.ct c\t eft fuper ambae 
voUe:et aduftione ignie cu olco. 
f fct fUV ci9fvrupue 2emplaft?.factu ejcfolqa 
ip(i9cu oleo et vinorx p9 ipi9 c6mijcrioc$cu d« 
etfit'rd9oleu.ctvnguentufactueicd9oIeo.ct 
firrpfmipi9fucc9fi j ptjdaffup.pannaricut. 
f fctfifrcCrotufactuejcco:: cu ©ecoquif etil 
duefructuecu vino etfitepco cmplaitru : fo? 
natvlceraqfiutinambatovolie manuu et m 
pcdib?.et aduliioncignie.ct.pbiber eosa vefi 
cationext fttr dus dnis euccroro. 
f fcternplaitrofacrucjcfrucrito ©ecocrfei ri 
noeri,?uemesmoUificatioimncturap rainct 



fun;u fanguis cp naritott abftcrgitfurfpres.7 

ecftcca t vlcera capitis : vlccra aurie. et ipfius 

pusejcipfiusaquainu/amfciflfllatur. 

f £t pfert ipiue fvrupue mollificarioi gingtf 

uc.ct rius fo.cu vino seeoquunfofit inde cm 

plaftru fedane fodamet obtalmiam. 

f ,£t cu oecoquifcu o:deo:fanat eop apoftel 

mata.etipfiuecinisingredif in mcdicinisvn 

gule.pfo:tat coin aufert tremo:eco:dis. 

f £t cofcrt fructus dus tufli^jpter tulcedinej 

fuaxtretinetventr2vtenti8co:fidtfolut9fua 

iiipticit&te. 

f £tconfertfruct9ipfiu8 fputo fanguinis.et 

cttamdusrob fimiliterconfowat ftomacbu. 

*Robdusetfemia f pbibent curfum fuQfluuo^ 

rumadftomacbum. 

f S^ucc9fructun dueeft.puocatiuus. i tpfc* 

mct pfert ardo:i v:ineet ardori vefice. 

f £t elt bon9 in,pbibedo meftruo^uocatio 

nc.et «iue aq ftringit narura et rctinet folurio 

noncoledcaetmdancoltca.linitaet ipa cum 

olco fvfamino ecpcllit fiegma.: folutoe emtW 

tit ipnut ©ecocrio fructuu riue confert flurui 

bumiditatu matrids.t pfert emplaftro inde fa 

ctoemo:roidibus. 

f£tpfert;apoftematitefticuli::ci9©ecoctio 

pfertmoauirutcUvjfimiliter fructuseius cii 

potaf invinoxtfimiliterpucmrc fcoa^ionie. 




BtDtibte 






Capimlum.tcctii. 



0afticfiucmaftitl3tine.grecefcinue 
velacbiaevFcbias.&rabicemefcebe. 
£t eft giimt arbous rini vel letifci.q a 
lcnrifcusgrecevocaturfcinus.fiattin 
uenics tn capXercbenrina f nfra ?>eX.fc>Y 3 
fco.cap.oe 'ZJbafticc quedam malhc emanat 
ab arbo:equefcinu8?>ici?.£t queda eceacft 
alb a.qtiedafubuiridt'8. £>3 meUo: ec ea eft cu 
ins colozeftalbus.perlucidu babens granuj 
graueficci(Timiietcttofransibile.babcn8bo^ 
num odo:e.£t cft x>e ea qucda que cft nigra : 
ct queda am'na.^5af.vtj.lim.far.c. t>e!g£>a 
fticealba.eteltillaqueioictturglutenroma^ 
num.er eft compoltra ec virrutito 'oiuerfis.fcj 
ftiprica et molltficariua .£c virtus eius eft quc 
calefacit et t>eficcat in.rj .gradu.vnde moUifi ' 
cat et refoluif .£t idco ftomacbi eparis ct ven 
trie flegmonibus copetit. 2>ed nigra eft quc 
Sidtttrcapiri velegvpriaca eft.et eft maio:is 
©eftccariortis q? alba .ct virtusfttprica eft i eo 
mino::et ideo eft pucnies vbi opo:ret refolue? 
reampliu8.£t ( jpterbocmuUuconucnitapc» 
ftemaribus t>uri8 que funttnetrerio:icoeo:£ 
, pou8.2>edoleiimaftfa'8eftfimilevirrotima 
ftid6.CS>erap.lib.ag. cap. *z^efccbe. i, ma* 
fttc.'Z£>3iliteft pamueinter omia glucina in 
bonitare.£rarbo:m3ftict'8 eft compofitacp 
fuBaaquea et terrea frigida no mulru in fapo 
reommuparttu.buiu8arbo:t8 t>ico radtcis 
ctfructU8.etco:tt'ci8eft ftipricitas pauca.ct 
vircueduscftinfrigtdareetcalefaceremedto 
criter temperatcefoeficc^t in fine fccundi gra 
dus vfcp ad p:incipium rerctj . 

JDpfrationts 

f £> erapi.3nea eltoeftipticitatcqua conj 
fcrt •ocbilitari eparis ctftomacbi': intcftinoui 
ct apoftcmatib in ris eciftetitoin eo eft ftiprt 
ctra&ct no babet acuitatealiquam.et eft mul 
tum fubrilie.et fit emplaftrii cum folns malti» 
ctsou funtrecenria,et eft in eie virtus manifc 
fta.etideo quando bibuntur fo.aut cum alqs 
medictnis advlccraintcftinoutm.et adftucii 
vencria conferunr multum. 
f £tconfcrunt fpuenritofanguine.et flutut 
merrftruo?. et ani.et non eft in eo tnueruras a 
fuccoypoquiftidos. 

f£tideauct.pY3f.Cotabecarbo:eftftipti 
ca.ct $tas folio?. fructus z couicts z radic* eft 
cquali6.ec ©ecoquituKco:tec eiuerr co:tecra? 
dtcisecfolia ©ecoctione plurima. 
f £t quando fucrit cocta colaf ab ets aqua q 
itcro coquif vfcg ad meUio fpilfitudine.acou 



nenit fpufofanguinis&ccoftio Ola bibita/eC 
ftucui vetrie z vlcerito tnteftino?.? flutuima 
trictsct ani.£t vmucrfalttcr quide ponirur p 
acacia z YPoquiftidos» z ponif ©ecoctio ftla 
focofucdfolioajm. 

f£tqnptKiwr©ccocriotltofup,vlccrfl,pfun 
da^fuBonafracfardrauratcarneinvlceri^ 
bus.treftauratoflatftringit meb:a laca. et 
abfdndit buiditates anttqaa matrice z$bi9 
bet vlcera co:ro(iua ne siUtef in co:pe p:ouo 
catva'n3\:qnficcoUutioo:i8Cumcaftringtc 
©ete8comot08.£tejcrami8 but'9arbo:i8 fit 
oleQ ofi dt bonu vbi coucnit ftipticttas. 
f £t ide auct.J5umaY.^baftic rdcluit apo* 
ftemata ftomacbi:": coucnit tui!i:2 no eit pau 
ce ac tractionie flegmaris qii mailica f . zfpter 
boc mifcctur cu aloc r t pparct ipfam ct attra; 
batcuconcgmaacapitc* 




Capitulum.fffti^ 

2lfturciu.OYaf.cap.Car 

damus.id eft nafturcium. 

0uodda eft ©omefticum 

etquodda eftagrefte. £t 

i, ideofncit t>iU> capicula 6 

I ds.uniiqtJ tcipitXTarda 

| m^Tenaftur.tJomcftfcu^ 

- - _ r ^4 2Hi?5 q6icipit£arda.ag. 

% cft nafturciil agrcftc. £t idco atdt cardam? 




* p> <e 



Ctaftatus 



3 



\6 cftnafturctu ©omettic&vhtfo^icif bab? 
lonicusomitofcmencmecaltdilTjmucft cmf 
fiic^parricipasvimite.vifcidumeoftoma'; 
tbum venrrerofbans.fSerapiiib.ag.cap. 
3o:ralbatbcfc.i.nafturciu.Tciccoelinafturci 
umcomuncnotii.-zejccocft nafturciu tccto?. 
ctepco eftnafturciu onctalcl^afturciu tccto 
rum eft plata babes folia ftricra z longa ©uo 
busoigitioinfummitatcacuta-rfcinactpin^ 
guia.teictendunffujjterra.xbabetinmedio 
virgam fubrilefcuoto palmis longa .paucos 
babmsramulos.fuperquosfunrpilebaben 
tesfcenfam fummitaremanquibuscft femcn 
fimile fcmini nafturctj.cuius eft virga fieutfi 
gurarurelerira eftt>ep:clTum.nafcirur invijs 
ct parieribus t>omo:um.13alrorcium oaen* 
talc eft planta t>uo:um b:acbio:um loga.ba^ 
bensramosfubtiUsetmulros. inqutto funt 
foUafimiliafoliisfcitaragimifiquia funt atf 
bio:a z molliow rr in fummitatib us ramomj 
funt capitella fimilia plantc actis: z bflbet flo 
resafoos.fcmcnbuiusponifiheibislocopi* 
pcris.Sednafturciueomunenotueft meli9 
illud quodt>efertur ababflonia. f &lmafor 
tractaru tcrtio.capitulo t>cnafturcio.'Haftur 
cium calidumeftt ficcu.ajperitil adiuuflt Uicj 
inflationem z cflpitis efTictat t>olorem t>igefti 
uam.p:eterca retardat. 

!0perariottf0* 

f Sferapion aucto .fialicni. ©emen naftur 
cq eft ca.-z fic.ficut femen finapis.? inadit in'/ 
cifioe fo:ri:z fldurar t fcdar t>o!o«s fciaricos 
er t>olo:e captris.t qulliber egrirudine i qua 
opofrer calefacere:er mifccf femen cius in me? 
dicinisflfmaricis.quiaipm inctdit incifione 
fo:ri:er adurir bumo:es groflbs. 
<d£rt>icirurcpquando nalturcium fceficca? 
rur.fiteiU8virrusficutfemini6 cius.ettm eft 
rccens p:optcr bumiditarcm aquofflj quc cft 
in eo babet virtutemt>ebilio:emvirrutc femtf 
niseius. 

% Ovafco:idc8."Rafturciu lumb:icos ejcpel? 
linctvcrrcmturbar.Splenemattcnuatcum 
accro.-z abo:fum faar.ventrem ftimular: fimi 
leeftfinapi-zeruce. 

fl £t unpofiro lepras z jcrnas emedat. melle 
addiro ©uricics.fplenis copefcit . S>o:dida 
purgatfifuccu8adbibeaf.*^>o:fito 
naris bibitii occurrit.^migario ei9 fcr^ 



%a fljD/. / e~ Vcnenan«oioiiwoi-turru.jri»iiub»i»w«7icri' 
/f penresfugerefacir.ael Aeribusprofluisfutf 
E *W>n*%U4* colinitooccurrit. 

£ f£arbunculos riipir rii polera iccto eoctu. 
S> ciaricis vriliflimc cu accto z polera auciua 
cur.wmoH8? "ouritice fpargic 



€ 3n©olo?c cwdts coquitur in lacte cap:ino 
ctt>aruradbibendum.Polo:cm omnis loci 
tollit puluere fcminum afperfo.fed plus mclk 
vnctoloco fcabtcm cum acero fanarus. 
f £>a lienu8.yq .fim.far.c.t>e nafturcio.S?e* 
mcnnafturcqbabctvirtutequecalefacirttJc 
ficcfltficut finapis.frapterea fciaricos z t>o* 
Io:c8capiti8.ctquodcucpfllio:ii indigcntiuj 
rubificarionccalefacircumco ficut eft ftnapia 
mifccrur aurecumcis quecucp afmaricis tan 
turfarmacis. 

f Suicenna pnmo canonefen. quarra. capk 
vq.ttafturctj femina to:rc factamijctacuad 
og:coftringunt flujum fuperfluu prouenienre: 
eccararro. 




(Tapitulum.rrru. 

Oairorciuaqricuvelfmarion:vF£ar 
damus agreftis. Serapid li. aggre* 
— garo:! cap.bcrocbacbav grcidcftna 
fturciu aquatioi..£r cft planrfl q na fcif in aq& 
baberlliptrc rccrii z rflmos.-: e tora plira pin 
guis.-r bjfolia filta foltjs a ptj v>icti vpofcllinu 
nifi q: funt mino:a cie.-r b? odo:e bonu quan 
c)o maftieamr/zeftcali.-z ftc.-zcoucnitcalcfa 
ctis quando ro:atur fuper ipfam aqua fri.aut 
aqua rofa.tt quidam ^icant cp citfrt.ec co 
quia non nocet babennbue firfcn. Ctr idcm 
a uct ojirare r f aac babc aranucft ca. in'p:imo. 
2fic.in.i}.j£rit>caucr.j59f.tUrru8ei9cftkalei> 
facicns:t? Yafcoridcs cap.fenarion.id cftna^ 
fturciu aquaricu.fiafarur in aqua.frurice ba 
bcnspingucm.etramulo8longos.? folia mt 






**f~ Ay** 



Bthttbte. 



nuta fitfa ypofellino.nifi q: funt minowcoqj 
mnfhcara odo:e luatitfnmu baber . 

j^pfrationfo. 

f £>erapio aucjtfaac babcn aram, S> eme 

ci9(btngitvcntreq.ftatrfl?tcrcalt'ditateqnbi 

bif ejcco atircns vn9cu aquafrigida. aut futf 

co citonio?..? ipfnm confojratmemb:a. 

f Dya fco:ides.S>eme cius crudu % comeftu 

calculooepcludit.vrtnapuocat.mcnftruisim^ 

pcratailTinteria'8 p:odeft. 

f £ateb:asfapie8 buic fibibet teftimonium: 

©icens q> coquinatiin aqua foluut. et cu car^ 

nibusfpiritualp miidificat fomentu cp aqua 

falfasoleosecocrionis eiusvalec &d -ooloic 

vUaeum. 

f StraguirilstHflurria i vino t>ecocri:z ca 

tbaplafmati ad idem valenr.t>uirerica funt» 



ba qu*eft vcnentimpcmfatat^ifiminw 
caUditarisxficcitatis. 

fDpfrationfO. 

fauiccnna.Rapellu8t>clctalbara8linmlt 
confen lep:e.vndceft vcncnuceftruee biben 
tem fe.'^aio:^o ipfius porio clt medietas.j. 
vnius.-z bec interficit z fimilitcr minus. 
f itt ejc eococurnicee bibunt % non moriun* 
tur.£icomibu8 confccronfous x> yamuf cue ei 
refiftit. 

f £x eft alius qui vocaf napellus mo vfis. £t 
vult ©ieere napcllus mus.* eft quoddam ani* 
malquodaffimilaturmuruquodmo:aturin 
radice napellunafcens atm napcllo.ct q cum 
co|ajp»pinquar.n6crefcitarbo:.etc[ttYria 
canapdluzdimaio^co.-nneofunt omia i\tf 
uamenta quc funt in napdlo. 



£ 




Capitulunwrrot* <rapituluuurcutf< 



^»v 3pelIu8.*j!Sandccfa. capi. cccccljctiq * 
«J f ftapelluseftberbaquefacracftficut 
-*• ^eUeboutsnigcncuiusradiic cft onH? 
nata ad modu rberis.eft anrbonomarice be r 
ba vcnenofa.-z eftpma pars aconiri. f B uic^ 
nalib:o.ij.cap.t>enapeUo.'BapeIu38cflbcr' / 



n3rcifcn8vcl bulbus vomiferusiVct 
cepcmarinum.f £>vafco:idcs capi* 
tulo*Rara'fcu6.vclbulbu8 emaricue: 
velbulbu8vomicu8.folia babj po:ro ffmilia 
fcdm!nuta.etbaftasbabet tuo:um palmo* 
rum que inanes ct concauefunt ct finc folus . 



Kmtatm 



& 



•£> 



p 



& 



^oecftaKalbueingifofitmeaiocroccoflrct 
cft quedamfperieetcuiue iliud mcdiurti purpu 
rcum eft/Radiccm babct albamrottindamfi 
cutbulbus.ctfcmcnmgrum-roblongumvti 
membtanttue.Ouiinlodemontuofienafaf 
tur eft melio:.aiiue ctiam floe fuaucm logc ta 
ctatodo:em.3nrcliquieaute po:ri babet w 
miurodmcmctviridieeft.turmedueeft que 
abftergit et incarnat x ©eficcat ,£t illud quod 
t>ceoadmimllraturcftradtK.f->liniuelib«> 
vicefimo pamo . Barcifci tuo genera in vfu 
mcdicircctpiunt.vnumftotepurpurco.talte 
rum berbaccum. f )?udo:ue/fiarcifcue fa? 
bulofc nomctt impofirum babct a quodl puc 
ro.cuiue mcmb:a inbunc fUKenttranfierunt 
qui-z nomcn narcifci in anpellattonc cuftodit 
ct ©ccue pulcritudinie incandote rerinet foU 
o:am.fScrapion.fiardfc^eftcalidadficJ 
cainferiidogradu. ' 

©ptrarionto. 

f pYafco:idee.*Radi|eriue bibita* comeJ 

fla i cocta vomiru ptouocat.trita cu mdle co 

buftionitomcdfeatur. ficruoe incifoe cofoli 

dat.Xaicaroe componit:anriquie toioabue 

arriculo:ump:eftulatur. 

f 2£>cllc miatte dfeiidae et omnce maculae 

vulrtbue tollit/z&tctue (emini v:ncc accto t 

melU. 

f £ t bcrba mijctfvulnera fotdida purgat : a* 

poftemata ©ura nlpit.3 rsftca co: jji iinpofita 

cuocat cu Yriftlirtca melle mijtto. 

f 3rcm elccnonee cramptt atcpfiipitcc eue^ 

car. ct fi qua funt alicna cum farina i oleo ad 

mitro melle. 

f©erapionaucto:itatcj5alieiti.atrt9aue 

cftcjtJcficcatt abftcrgincjarabitct incarnat 

vlccra magna.iincarnat indftoceinlaccme 

factae.£tmi]ctuecuo:obomudiftcat fotdee 

co:ponstapcritapoftcmata.'Z qn comccif 

ejcradtcenarcifciautbibtturcomouetvomt^ 

tum.z trita cu melle conferr combulltontbue 

igtns. £ 1 quido fft cjc ca cmplaftrum cogluti? 

natvulneraneruomm. 

f £t idemauaoritateSbcn^efua^-Rar 

cifcuefacit operarione itfiminunifi q: cft t>c'/ 

bilio:conconfertt>olo:itoquifiuntafiefima 

ccct oleum due eft bonu ad bocet radip due 

incarnatvlcera ncruo:um:ctbabctvirai|cm 

lajcariuam. 

f 5au'enue.vitj. fimpli. far.cap. "Rardfcuei 

*Radic due fteeatiue clt vtrturie inra nrum vt 

cottiolidet plagas m trimas r fcg ad abciiio^ 

ncm quc circa rcnanroe ibabet aurern qirid ab 

fterftunm ct attractiunm. 




Capim!um.rmraK 

nabacbcftfructuefmauiccnnlJirt 
boue«ictc afadanque apud Dvafeo 
ritf.vocarur agrifolium. amtm aptJ 
£jcrapi.cft aliud nabacb.fdlicct couejtarbo 
ri8qtiea£vafco.vocarornafcatimon.£rtf 
citS>erapioncapi.Habacb.cparTcift>c3n 
dia , cr di in eolotc fimilie crocco. et funt ftcut 
cotriccs mouboniodorie.ctbabct virtutcm 
caldacicntcm. 

jDptrattontg 

f £> crapi.iiunr cnm co famigationce z po 
nitur in confccrionibue vnguenrojumrr inali 
iecofcctionibuecaldactotije.? baber vtrtute 
calarmaromarici. 

f £tidcm aucto.£alic£ftcalida intcrtio.t 
cftccfpcdebue jTndie.Etquandofit rumtga 
tio cum co valet comtptioni mamciext con/ 
fcrt fuffocationi ciue quando cft ftccum. 
f 3remfciabiwrcynabadxomparatur ntf 
fpilis ct jaro: quod dt magie odoriferum ne* 
fpilie^titafimilitudoeftinvtrtutcquoniaih 
frUCtue agrifolq cftftipricue confottane fro* 
macbum.ctfimilitcr comparantur ndptU et 



?aro:. 



Capitulum.rmjt. 




gradti frfgida i bumtda. babee folia 
Uta.in locif rcpcrif aquofif s in eaW 
disrcgionito % in frisidieOrcT»uplejceft eiuff 
iim ncrics.vna cj purpureu fio:e pduat i mcli 
o: eft.aiia #o cj croceii: et no adeo bona ef t * 
5lo f» e\m medicine eoperir. £t meUo: eff iUe 
quiin eaUdisregtonitorcpcri? qsin frigidis. 
J n fcpf embri collectue in cfficacia miUta fer* 
uarur.f Huiccn/Bcnufar noiam> 6 licnu» 
caulcm aquc.fo:tiue eft illud q£ babet radice 
alb.i q? qrj nigram. iloe ek ft igiduscft ct bd 
micwsinfecundo. 

iE>pfrationf0. 

f -jbla jEjc fl orito peipuc ftant fvrupi p feb:ea 
acura8?calcfaciide6.ca.epatie:calidafq-©ir 
fcpcratiasOracpftotts inaqua tecoquunfc 
etccraUaquJ juccaro addiro fitffrupus. 
flCdtrat>olo:c8 capifis eccaknc farrar cni 
fio^g nocre in aqua poniit.t ma nc tate aqul 
bibut.fto:efq$naitofui8 ajplicant. 

rincrioisclt etfubfiUai iu^ralde. £6fcrt tuffi 
i pleureii:? fcb:ttoacuti8.*Rac'itciu8 eonfert 
bofbo:apoftcmantocaUdi8 fplenie.£adcm 
cum a qua conferr mo:fccfuppoftta. cum pice 
vero alopicte. 

f3dem.'Bcnufarfomn5faaf.fodacalidam 
tf(olericamfedaf.fc4tamcn9cbiUtar. 



f ^olumoricflitm'n«fcctfraptt^cTic!cnuc^ 
tus tum fvrapo t>epapaucrcbibiru6.cr coge* 
lat fpcrma p:op:iec$radn cuhu. adenicp ra$ 
dipconfmfolurionianriquettvkeribueMc* 
lttno?set 'oolonto vefice. 
f©cmenciU8fo:fiu8€ftinomnire.efpu>bf 
bcthup mcnftruo?..'Baturancnufari8 Jn 
di:clt natura madrago^. 
f^onftantinueinltbwgraduuin.l^cnufiir 
cttfubtUcacpcnerrabtfctiolotcm capitis ep 
calo:c placar .appofttum nanbus coknue ct 
fauguinu8.ctomnibu8 congmtf pafiionito. 
f @\rupu6ctU8 caUdatufltfiim etri»guit.ac 
^cstolmcasacfanguinokntas auicrtvtf 
^tUa8.t>lcumciu6t'Olo:cmca|:it:8 cufcn fi 
carbaplaimerur.aurlieo itermuatio pwta» 
cerur 

f Suicennaiitoo (camdo capirulo tcTienu 
farc^Yrnpusciue Unitremrcm :ctcontett 
feb:tbu8 enarie.et el t vebcmentis ejLrincttoie. 
f ^t idcm sevinto coaiis ait % piMmtQi*- 




<^t^) r ^2?**\<sgi>grW 







Capiftilum.ffff. 

Igclla.-JSla.^RiiJcllaeft fcmcncuiuf* 

dm berberonmtnm:fubnigrumbaf 

> bens eoto&fabamarii fapo&virmte 



©aoattMf 



fotbcttriurcrica ep amarimdtnetKlTolutiUaj: 
confumpriuS cjc qualif arib?ifuie.folia ei9 funt 
pant i :minuf a et mollia:fimtlia corule.? flos 
eiua eit figure ftetle.coloue eeldtie,? babet i 
fummitarifocapircUaficpapaue^inmedio 
a int rinfeca partefunt aliqua ordinatim *otf 
ind enda femina. £(t calida 2 ficca in. iq .gdu* 
^^a-a.li.ag.c.£arum.i.nigella.eltplanta 
paruababenevirgae paruae cirotcr tmos 
palmos adplS.-zbabctfoliaparua minura-j 
moUia:ftmitia foltie planre. q t>icirut carna? 
baon ftuc ranobaon,niu quia funt mino:a fa 
ti6.tinutmmitatefuntcapitellafubriUa:fimi 
lia captticopapaueris^oblongan in medio 
eius funr parictee fepariree femina .0$ qutf 
dcm fancdtmgriiacuru boniodorie.f pya 
fco.ca."^claucbiu.i,nigeUafmtraftarionem 
noftra.',£)elancbiii berba cltmino: foUa mi* 
nura er tcnera.etfcmc mtnutu bne. cufv fru? 
te 1 ilo0U6citt>uo?palmo?.ctt)cfuE babcns 
capirtUJ fimile miconio.fcd oblogu itt mcdio 
vetuti pariercs babcne quibue cifcernunrur 
femina.qrcmtnafuntnigraet odo:ara? vtf 
fcida q mulripaniti afpergur. ^Saf.lim. far. 
ca.'i£elaiKbiit.i. Hgelta. calcfacitt ftccac 
f m tcrcitl gradu.:&oc idc tsicir-jMateariue. 

BpmtiomB. 

ir-fela te •Rigcllc dc fa rin a cu fucco ablinrbio 
cmplafe^ctucircavmbtlicu^pcipuepuerj 
luittbricoenccar.Blti6Cotificiaruradfcab^ 
emcummetie-z&arurperoe. 
•A ^unsucnruadfcabicpulucrtsnigellc imul* 
- ra qntitateftafDCCocrio in fo:ri accro vfqs ad 
^U, <&V*fa {*Jp\U> aliqnmlafpifiifudinc.-zrucaddiroolcofiat 
' ( inderngucnrftbonuadfcabiet impcrigines: 

lcr.riginffacieitoUir.iarinanigellepfecracu 
A «!>Tv-rv^A n>r&^' acerotaidoanfuiiteauritovermeenecar. 
WM^^MoY »"ftt fton-aftraguiri^itutrrta-zv^apantoj 
.71 - ?'-) i.rrJ^l ncmocturviiiinnfufiontbuentgellcfinocrc. 
M*r*r aixC * rzV // ^ (edantecoquaf.q:m'miufierctviolenmXon 
)£? tcJlU f*V^^*Hratem<p fiinmlra qnritatcfuitocadir. 

' "t&fiiisks ^Siautinmulraqnrirarebabef;poneifac 
l^ch? ceUo^fiarnccoaioeiueinvino^oleo.-zfup" 
\ 2w|^ene8-zpect5fiatfacccUario?rrapcUcta.cteit 
t& farieejtperra odo:ara ptiacatarrfi-z cbouja^ 
£t f3 babetnigclla a ftti coplejabne. vt 23alie 
nue.v:.fim/ar.ca. , oe'fScomat>iar. 
P fSera.aucpvaf.ca.^igdla.quidaadmi* 
^ fcct 15 femein malTapaite? facifitindepane.et 

qn fit emplaltrurronti cu eo pfert fodc. 
* f£cqnfitcapurpurgiucueo^4caoconfert 
** aquequcecfcenditadoculum. 
« . jQfit qn fumif inpotuo.i.cu aq; eofert mojfui 
■rutcle/i qufit fumigatio cueatugar vauua. 



a 



f £tfit cmplaftf cu ea fu t> t>uria'ee q fiuntf n 
iunctufiepcdu cj Tricunf catlirz auferteae. 
^jEtidcaucro.Bbcn^efuaY.lbJopzietas 
ei9eltq aufertfeb;cftegmancaz melacolica:-; 
interficitafcarides.z ?fertmo:fui rutele. 



•$r 




Capttulum.rtfjE!^ 

4 ^\y- , mpbca.-jSIini.lib.)o:v.'Fivn i P' 3e3t51, 
^ fatradifanYmpba^clorfpacrgabctf 
"* -^culcm rbopalo mo:tua.vndc aliqui 
beracleon vocanream.alti ropbalon.Tlafci? 
rur radicc daui (imili.Pt^'Rlwt* ca vl v£ 
t^iciit alti cacabum venerU.papauerpatuftrc 
fiue vtlatini alga paluflrie.l^afciruriaquie 
(tantibue vel locie non culrie.babene folia ci 
co2t'e (tmiliaifed mino:a et oblonga.capur al^ 
tiue fuper aqua m p:oferene . multa 03 capita 
infra aquam c% vna radice babene. P oe cft il 
lialbueulio fimtli6:cumpallo:epanto.fcmen 
eiue in medio croccum.fcd cum efMo:uerit ni^ 
grucrTicifbafta lcnie etno grofla^nigra.ra^ 
cHi c\} afpa nigra z nodora. 3n autumno ftc^ 
carur.fRora o/nvmpbca babetp:op:iuca^ 
pinilumXimiiireretnenufar.quarcno.funt ide 
ficuraUquivolunr. 

Bpmtidttm 

qptiti® ltb.]tj;r i.Ucnt rc in rottl adimir n^m^ 



pbea bmdta.2tlnie8\d\mo '$$n in cibo 
6 fumpta.^T3llita radijc (jeniralitd inOibetnoii 

feliivmtrcfedctilgentturcaffluentil.-zobifd 
£ to:p9alerefcatCBvoce\^DYaf.Siccabibi* 

ta rii vino ciliacis medef .fplene ficcat. catba* 

plafmara.t>olo:efqKdpefcitftomacbuimpo* 
P pofita.fl"Radi]cci9bibita ©olo:eveficemiti> 

gatXozgis maculaa ©etergir. i feme* eittsbtf 

bitwn boc amduc facere nomt . 




Capituuraurfitft. 

Oapvfuali8.dtilla qttacomunttervtt? 
murad edendu.S?dendumq> nuris 
multa funt genera .fcd qfi fimplicifpo 
nifpvfuattintdlijgif.6ar.vqj"im.lar.cap.£a 
rea We.t.nup vfualis vcl nut arbo:. Hut ar 
bo: b? ode ctdto ptrtlularoito? frodito ftipti? 
m cuides.ptimu aut in nacl coitice recetiz fic 
co.twmf aitt eo^tptcrca •ztinctozeo.no autejc 
pnmeteoeos.-rfuccufilrfuccomowutrubo 
ru coqntcs cii mcllc ; ftomar ico vrimur pbar? 
maco/zeril ad alia vniuerfa in qtofiit cogrui 
pdictifucci.Hunc^o ipfi9 aliud c\dem eft dfa 
bilcaliud oleaginofum i fubtiliu partiu. quo 
ctrcatfuccifitfaciliter/z magisquidc? ftttaie 
quantucucp repofitut>iu ma nct oleu.naqj ep 
pzVmereeftpoflMeeteoantiqtiaro. 



^Pfrattont0. 

fauic.liij.cap.t)enuccca.eft;in.iii.(t'c.inpni 
fecudi gradus.tin ipfa cft bumiditas q t>clef 
cii antiquaf >etmficaeft nud ftipticitae.pluri^ 
ma % folia z cOztecipfiusoia fttnt coftringen 
tiaflupumfanguinis/zrius cbttccaduftus c 
&diccariuu8 fine motdtcationc .0 leu f>o vc? 
tufte cft fieut oleum vetnm abfterfio antiquc 
eftfotfis, 

C Epeceritito fift cmpla ftrfi fitp, veftigia p,cuf 
fioni8.mafticatameduUaei9ponif fug apo? 
fteinatamelancoucu?vlcerofura;?e6ferrd9 
fiuma vlcerito calidis fperfa fuper ea. 
^Et in emplartria cu mellc t rttta pfcrt to:ft^ 
•nincruo?^acitfoda.zt)ilh'llaffuccu8foh'o^ 
rumtepidusinaure.-zpfrrtfanidinaurc. 
f Dictt alcan8.q> ipa. guat ungul: z eft facf* 
ensbotbozfnaure.Eiusoleu pfert berperie» 
ftiomeno ?bmu>ileerfiftuu'8 in parte oculi. 
Sjuccus co:tid6 e&zrob eius pbibenr pfo* 
carione z nocent tufli/z ocuul antiquaru Wt 
cit vcnirc t>olo:c gutturis. 
4 £tecu.nnitoquide fpedcbuB nuctstntic 
aicausficriemplaltrumamtllcapoftcmofez 
,nniect regali magna. eft t>ifticili8 tMgefticns 
et mala ftomacbi:fed nutrita z recens eft me? 
lio^rtomacbominousnooimeri.-zillud qtl 
frangif a tmoto co:ticito fuis/z nut quide nn 
triracu mdle pfert ftomacbo frigtdo. 
^fpYafco:ide8cap.t>cnuce.'Ru^fimaduca 
tarucritcacoftomacadttndigeftibili8:tcotci> 
ra nutrit.t>olo:e capirl comouet. £iiflienrito 
paa eft ficomefta fucrit. £> umpta cii caricis 
lub:tco8 lar9 eccludit .jCatbapUfmatito adbi 
bitarumozfisuiammau copcfctt.lucationito 
cn meUez rota bene adbibemr. 
^aeterca autcmnuccecarnes earum catba 
plafmatibusadbibitc^cancrosi carbundbs 
tollunt.£gilopa8 limpidant.fi caro maftical 
fazimpoutafucrif. 

f 5tt etia cc tpfa oleu II tunfa z ecp^flaftierif t 
xiridee aut nuccs cacoftomaticc lunt qtiafi 
olcomijaerucrintetusactiozcm tempcratzti 
uo:c8co:po:i8follunf. 
farbo:nucariababettnfolq8bocvrcini8 
ftipitum.nuci8aufem viridjs co:tcc tunfa ec 
pKflazfuccotquieuciturcoctodimdle^vtfo 
lct fieri t>emo:ieodo:i8vitiabonueft:etvo* 
catur t>f acarcon.^temcoaet nucisftccata -r 
vfta leptomer is z Dtficcatiua fine mowJicatio 
nefitmedicina. 



i 



td 



§ 



ti 



Crattatusr 



& 




Y r VXlicaiicIlaiia.0i>lic.vq i fim.fai'.ca. ©c 
1 jF'»i»cil».£ft^3ucaliudigcn9carca? cc, 
"* "»iwc«paroa:g.quevrtcg?p0nticc n«it 
i'upi»nfamplion'partKip3tc8ferrdtrifub(iil 
tia.-quo tirca ? magte anftera. al guftaf tpfa 
jrtantattfrnct^coitejcaiparerOn alqgfa 
firte eciftit magne ituci q vocatnr ab auqbus 
b aft Uca /Runcupaf afit ? bcc parua nujc a pui 
libns lcptocarw vcl audlana. 

(0pfrattont0. 

^fauiccn.li.ij.cap3ueliana.aueUana ratf 
tribilioieftnuccqmcft magie foUdaxmin? 
rnctuofa.-z tardior$ sfgefticie ©ediuiecft ad 
calidirateqiiandatficeirateparuf. 
f 0cncraf cc ca colera.t in ipfa eft ftiptidtaa 
maio: % in nace.i i ipa eft inftatio. z gencrac 
vetofitateinvetreinfcrion.zq^ cjcea aduftii 
cft ringit capilio8.faa't fodaVjaflaf xcomedif 
cu pauco pipere^ matnrat co«5am. 
^ypoancit.aueUanaiceretab facitangme* 
tum. fcptimauef t quidl c$ ipa iUinfta fug ver 
ticepuero?. varioe bntiu oculoe. ©clct varid 
tatc.comedif cu aqua mcUie:z pfert tutTt anti 
quwadiuuatadfpuendu f £ft tardesigdrt 
«ntsteicficcatvomitu^efttardious^igcfti 
onis 03 nuc vfuat^ £iti8 ;o:tcjc cft ftipticue: 
z pftringit vcntrcrz pfert venctiis z mo:ftto. % 
jp:iealfiaito? rota tpiicwrc» fcoapiois* 



f pvafce.Suetlane in dbo^mpfe ©oloig 

capirte incntiut. ftomacbu inftarioc t>iftedur. 

co:poafano pinguedine pferut .©iccc in ra* 

fcfiailiconftitute ©iftillationibue mftigartf 

dtevUimcofterunrur. 

«ff£rife ejcaqua mulfa potcqj vctuftiiTime ruf 

fiemoleftiamfedant. 

fSujmtaecumpalTobibendaefccdcrunta 

pulmonieticcoaevifafananda.^nUirri* 

casaimpiperemifcueruntcumvinopzopina 

tae contra catarrum^t roanenta verrie z v:i 

newltillanrieanguftiaevaUrc fcnfcrunr.cii 

flpmgiavel adipevtfina contrite z alopicrj». 

UmtecapilUottamnarcftintunt.tiicuntauqui 

coaa eiue cum olco trita oculos gartineoa 

iuctainficerczcapiUoe.t^acmultiUptocou 

am vocat cacoitomatica cft q fi aifara fuerif. 

4)£tcupiperebibifacatarrumarurefcer« fi* 

ctr.-z tota combufta z ajcungiemitra vt fupcri 

uefcriptucftfacit. 

f3obaneemefiKcap\t>eolde.Oieiicuteva 

let corrat>olo:em artaicum % neruoujm . 




Capirultim.fffri!!"r 

*S*\ H)cmnicafa.©erapi.lib.aggre. ap< 
*3 w3 a»3bane arabicci. nujc mufcara : « 
■* -*>arTerf $india.£rideauOfaac.;£>e. 



Bt&abfe 



Itozcs fut ep cte rubee pingues graucs. £t ?>* 
teriozes nigre lcuee: ct funtca.ct ficcc* 

^?3?cfa.£5rringitveutr£ct aromarfcat fto* 
maebu % odoii eius facit bonu^ufcrt fup,nni 
tatcs a I tomacbo ? fcigerir cibum. f £r erpd 
utventofitatcs ct co:robo:at Itomacbum et 
cpar .et confert lentigini facici i ferpigini. et et 
tctmt fplcnaet moliit apara nura eparis. 
fljcrnaruraaitsciificurnaruragariofilo:». 
ct eft ca.ctficiu.tj.gra.bona cftftomacbo et 
cpatt frigidOiCt contcrt ©cbilitati eccum. 




camc ftta & in q cft aqua Mcis bona .iftta a^ 
qtta q eltintraipamcltfignufncreccri^.ijse* 
betejccoriari illud qo* clt albu ejcea cjciftcnt? cp 
rcrius^iftccotteiccftTmrus grauts ftpma* 
cbo loginqitf a t>igeltionc fl£t IV aliundc ©i 
ficritnoinuenftcozpuein coaliud.nifi nutri? 
mentu modicti.-z ipa quidc mip comedif cu juc 
caro tabarjer aut cii penidijs albis.-z jprie ab 
ci8quiluntcaUfacri.rlegmatici ipocu patiro 
mellc i celerici nd vtaf ea. f £tfumant ea fic 
gmaticiiniciunioT ccpectent t»onec ©cfccn* 
dat a itomacbo et polt eomedlr.z qn tpfa ve 
terafciteepclut afcarides a fua^paetarc? ole? 
umeiusvetulru pfmvcnrofttanto lumbotu 
«t uolozito genuu/z cmotroidib? cj fiunt a fS 
gmatc qn bibirur ct qn littff errcrius matime 
admifcef cii olco nnclco^efico^quaclo admi 
niitraf x>cvnoquoq5illo?..5.i.9utanreu6.t. 
^fOleu^o eute q noita cit pfert 2 flcgmarict: 
« ctt mclior^ cbimi cp buri£ vaccinu vel oni* 
nu.q: no piigitltomacfou ftcut facit bntirum 
vacctniivf ouinitnec moUtficatcu.Dleu $0 
ciuo pfert vcfice. 3f3o.mcf.rracrarut>eol«e. 
£> lcu ctVpfercoolo:i ncraof z lentt pcctus ct 
pulmonc.cLirificat vo ce % imptitguat :? addtc 
ifpermatc<|[auic.li.q.ca.oennce3!tdica.t)i 
cit cf augmcf arcoiru/z cum antiquaf come/ 
fta :afcaridco % vernies nccar. 



<rapttulum.tfttn* 

j^^Ucindtcarceftmijc magna.Sera.lt. 
H[ § ag.cap,ncregil.? eft palma infule q cft 
■* -» inmariaruirziptibjtnfula? $ing.£t 
& Cf ncregil eft palma t>e mocbol. i ifte infule 
jtoianf t>abgcta ab eis fceferiif t»abig:t cft nc 
regtlXllria $0 tfta^cft faranbib a?aran. £t 
idiauct.Saf.inli.tJcabie.Hnctndicaeltcai 
infecundo graTm.bumidainprimo. 

©perattonre* 

f £>era.S> ignft bumiditatf eius cftcyctfo 
cozrupfotoa eft groffe 1 giiis fu&cnilt q: ipa 
no eft m..lt cbimi:ogrct vtcaueaf abea q nou 
6ftrecen8.^fctbonaqcftmultealbedini8in 








Kxatwua 



€apifu!um.rrtjEra. 

V*\tljc votnica pcr vafco .cft fructue fc 
^ f ciindi fpeciei. 2orimalli carficctt . fm 
■* -*> quofdavocafcaftanea3ndica.£?e? 
raptoulib.asgrc.ca.3eu5alkci.auct.t5abi]C; 
facitvbmerefomrcr.coloJriueeftintcrslau:* 
ccdincm z albedine.sclt maio: anellana pa#. 
■zluntineanodi. 

^pftationto. 

<dp^afcoM'!5. Ouando accipitur t>e cottfce 
eiusrterintr z critcarmvz accipitur t>eipo.js 
ij .cum tmobue aurete anifi triti.aut femine fe 
mawvz conftcitur cum melle fuffictenri.j£t btf 
bif cii aqtta calidamouer vomiriitf etpcluc ftf 
perrluiratee coiericae-z flegmactcae. 




Capttulutn.fffjfutt. 

Odpmetd.Serapionaib-asgre.capi 
3 eu3 metcl.vacbie , £onalbacbaricb: 
Sreca idcm funt ,z funt ntu; metcl. i eft 
rractusfimilisnucivomice.-zfemeeiue cftfio 
mitc femtni madraso:e/z cozrejceiueeft afper. 
•zfapo^eius eft t>elcctabilie -zvncjruofue.j£t 
vtrmseftfrisida uuiti.sradu.- 

0ptrattonf0. 

v 21 f^i&ewrt>eeainpomvnaKiratcumvft 



no inebriat ebzictafe fojti.fed fifcenf tnto au? 
reicueoftatimflccidit.<Jj£tideaiK:to.*Rafi9 
^fcuj metbcl eft nareotica.? fowafie occtdit et 
orjtUnzfactteuemerc/z fi t>etur rj ea quanri? 
tas:?.? anebaat cbzictate foif tVzopottct q? fttf 
mene el fumat butiru cslidu.t ponanf ejctrtf 
mitates ei9 1 aq calida:? fiiar q> cuomar farie:i 
curcf cura illiue c\ fumpfir madraso:a. 
famc.lib.tjWupmetbelfacfubetb.-zeltma 
lacereb«>.'Zp6du8t>auicb.i.e|ceaieb:iat.£ft 
inimica co«lt.5.i.ejcca elt venenut>iei fue.. 




CapituJum.fffiEuttt; 

| T*deS.Ser3.li.as.Cflp< 
1 £>abact arabiee.Lo^dcii 
iairt9ei9cqinfn'sidatet 
; xxftccatin p.g.2 t>eficca 
{ tio efveftamplio:pa£t>e 
|ficcar6e fabajqftaffte 
cafefferi9.ac£o:dcum 
^Jcoctu eft mcli9f3b i g cp 
0mn6inrlar.£rfi5beqncoqnunfscncrit in$ 
flarionc.qtri fobftatia ea^eftsrelTio: fubfian 
tta illi^vtprcr 15 funt masts nurrtbtlee q? o:de* 
um.zipfaambotJecIfnatpars arempcramm 
fO;£5edfanico:det cft magfe tnfccaaiwm 
c| o:deum tpfum.f j!Menue.vn.fim.f3r.cap. 
t>c ozdco rracbi.i. oideum p:imt sradue cii m 




iBfOjfrbia 



cando er mfrfeidando .eft aur b: cuf qnodl fe» 
ciue cg farina fabaruXatia vcro o .a fttt a fuuc 
inbis qtu vtunfe|«rinfecu8.Cuvao comcdtf 
fnperar fabam.quonia inflarionepeponirOn 
faba vero qualitacuncg coquaf pmanainfta 
riuftae.jSroflTioaimcmeftfitium 03 bozdeum 
a^pterea nurribtlio: co ett:quonia aure modi 
<jum a mcdiocrirarc abfcenerunr.fprcreafunt 
in mulro vfu.bmdi cnim ftirmaca mulris alijs 
gmifceurur ceu marcrie queda j.fer^jprcrca ce 
ra.et oleum non paucis romifeenr ur farmacis 
Blftra aurem multa o:deo ipfo funt ficcatiuio 
ra criminujara nominarur quod cc groffa prc 
farineo:deier jea:que cppartefarine fubrilis . 
^ft autcm niimbiliin quidcm a IfitavtJifiicili? 
vcro 'oigcftibitc . £coicit in ltb:o t>e cibis.5 »t 
dco:deo pant'6,qui quando cftrorfureus vo t 
caturma^a 

Bpmtiotm. 

f £>aapibnauao:itare D?afco . 2lqua oil 

deicftituuriua adrcp:imcrtducalidiratc5 bu* 

miditarum calidarum £ r eonfcrt afpcritan ca 

ne pulmom'8 er vlccrito ct us. 

f £t cu femine feniculi,puocac xMS.ct cft ab 

fterfiua z marurat apoftemara calida. 

^ £r quado mifccrur cum femine lini ct fenu* 

^recoerruraconferrrumo:ibjrefticuloni5.£c 

quando adminiilraf cum mirto er vinoerpi? 

ri8filueftrib?erfrucrarubi:«co:riccgranari 

ftringirvenrrem. 

^J £tquado fircmplaftructco cumaronrje-i 

accro conferc apoiteuurii» c.ihdis quc acct* 

dunr podagricis. 

<(J £t quandomifcerur cum accro foir£:cr poni 

turfuper fcabicmvlcerofam.mjfurat cam z fa 

rinao:deiltringit ventrem:etfedat t>olo:cm 

apoi icmarum cilidonnn 

CapttuluntffffiE 

/'•VXeander.Dta.fco.ca.lRcreo grerefcJ 
I leftoleandcr.JTureiteftpmnibuejno^ 
^*-^ta .jFbliababcr fimilia amigdatis fed 
mato:a er piguio:a:a flo:em rodo ftmilcm. ftf 
men aiam pariensltcur coim vcturi latm t>e 
inrus babens fimilem iacinro /Radit e tlii ob 
longa et angafta :guftu falfa.n afaror loeis act 
fisermaririnis.flBuicen.li.tj .ca.ve olean* 
dro. Qleandcralueftfilucftris.aliafluuialis 
Stlucimababer folia po:rulacefimilta:fcd 
funt ftrictio^: er eius tyrfi funr longi tj.pm(i 
lup. rerram/z apud folia funt fpmc £r nafcimr 
inoeferrie^omib.iUuHalisaurcjonrurinri 
pis fluuiow^uiuotvrfi a terra cleuanf. cc fptf 



tip, 




nc cius funt occufre.rt folia due funt (tcur fblia 
falicis er fiplia amigdaii.? e fapotf vatde ama? 
riropJomtrisaus.sflosausdtficutrofaruP 
beabonii8V3lde.rtfupipm cgrcdifctdda fifc 
pflis.ctati8 frucf ur eft tmruepUnue afpa. ec 
inru8cftrc8fiairlana.£ftca.in4ii.fic.in.u. 

BpmtiontB 

f Dvaf.oirrueeft illimomfera.Tlaromefra 
ab animalito mo:re tferr.fed bomini rcmcdiii 
cft faluris. mapecu vino a rura bifctta mo:fi 
bus vencnatis occurrtt*JlSeco:a minura fi ocf o 
re a'9racra fuerinr mo:iunf. f 3 ui.3 ntafu it 
puttreetvermcs tenenoe.fucfU8 folio^eiua 
vaUtfcabici'Zcjcco^ationi.ac6ferttoIo:i©o: 
fi anriquo mo:c empla ftn. f £t flos ei^ facic 
JternuraribncVjeft rcnenu boito z belirjs.vc? 
cofcrt cu btbif cii vinp oecocro rii rura z poraf 
crlibcraravenaii8vermiuvcnenofo:uj. 
4 £go rn r>ico cr I? cft rimowfuj. £t ipe ciu8 
flop eft venenti boi to a bcl 1 1]8 z c anito.Ucntf 
ramecofcrt qnbibifcu vmotecocto cu rura 
fm crt>icif. f 6ali.viti.ftm.far.capi.*Rodo 
t>afnee.i.o!eandru:vclncreon.nora eft oif ito 
frurciccarbaplafmarat>Yafo:at'ce vinutiecft 
^f 3nrra co:pus vcro fumpta panic tofa e.no 
t iq 



a 



23 



£> 



Kmmm 



€oTufflT>omtbus (cd pluribbcma? ftn copld 
ponemrerw eft gradue calefaaentium incipi 
pUmispuim vcro ficcantium. 




Capttulum.«tjEiE. 

OXiuarum arbo:.?3a Wi.^vOe cibte c«i 
•oeohuis.Oliuepaucu ominoalimen 
t um t>ant cozpon.^maicime cj fiir ma? 
tureXomedunr aut boice baecii pane quide 
ma gis.fine aute panc aUnadae? fcolomiadas 
ficvocataegratia fubdUtrionie ventrie. £uf 
garoautemantectbum.ficautcmqucfutma^ 
rurcinfltt>o:eputrimumvncniofumficcefti* 
pticum cbimum ba bcnt.proprer quod i robo 
rant ftomacbunwciranr ajpenri).quo idone 
iffime aur ad bcc funt: qui cum acero rcpofite. 
•^ulripliciter aut ipa p:eparar quiltuducrut 
circa pulmeraria er.pericnrta. £? aa.li.aggre. 
ca . £abit.i.oliua?. liua^ queda eft s>omeft i 
c&quedam fiUieliris:q grece vocaf a grielear. 
^ridcmaucto.0af.fim.far.Oliuarumoomc 
Uicarum folia z cime qn funt bumida babatt 
fapoicm Jtipticum.et vutue carum pzima cft q 
mfrigidatca quanritatequa funtftipricc.£t 
idanauero.pYaf.UfrmefoUo^tomeftiecaf 
fimilarur virruri folio? agreltie.nifiq: foliom 
©omeftice eft t>cbilio;;? funt coucniecioa ocii 
lo -q) agfdlis. 



©prwttonra 

f)£tfdcm.S^era.agrefiiumoliuaru5folia 
funt ftiptica qn pifcarur.? n't indc cmpbftam 
fug berifipua z pfert :nccp finir ipa.i augcre. 
f £t ?fcrt fonnice et Hcerito que nominatur 
antrajcetvlccribj fraudulcrieet panaririo. 
f £t qfi fit cc cie cmplaftnl cum mcilc octidit. 
afcan'dee.etccfertapoftcmari qtf noiaf t>uo 
vlccra etapoftemarito eaU'die.et facit adbcre* 
re cutim capiris qn fejgaf ab oiTe.er qn maftica 
tur cofert vlcerifc orie? alcole. 
f £t qn cjccisfiranplafiru cu farina orde(:c5 
fcrt flujcui vetrts anrfc| et bumidirarito anti 9 
cje q a matriee cmanir :et rlujcui fenguinis. 
f fctfanatemincntia oculi^t ccfcrt vlccrite 
ciue q nominatnr alcatalia et altjs vlccribusi 
f £ t ccfertflujori bumiditat uj a ntiqiiaqad 
oculu.? ideo |?onunf in rob q adminiftrannir 
coiroftonipaipetoa?.. f j£tcdfertauiibiis cp 
Cjbue fluitfanice:ct aurito vlceraris .f K t qn 
voUieris ejctrabere fuccuipo? fcreea:er ipifca, 
tione afpergefug ea vinu velaquam.et poftca 
cjcpume ct ©efieca ejcp:cfiura in folcet fac tvo f / 
cifcoest qnfit cii vin o eft foaio: eg ct-m aqua 
ct melio: adreponcndu:et pfcrt faniei aurium. 
f j£ tiam quide ccburunf folia ipa aan f o:c 
ct ponif cinie loco rutie.t fit in biic modu,*f»o, 
nunrur iolla rerrea cruda.et obmratur oe ci9 
z t»imitrirur in fojnace t>oncc i!ta coquaf t?e 
inde p:otjce fug ea vinii quoufq? infngideruri 
ct confice fimuU itcru cobure ficut pzme.i pc* 
ftea lauafiairlauaf ccrufa :afac rroafcoe.et 
crcdirur cp qn ccbururur tn buncmodum noit 
efteiue virtue mino: virtutc tut ie in iuuamcng 
to oculi.^tidco ccceditura; virtue fcuius fit 
ficutvtrtusillius. 

f tt idcm aua©:.f5alie.vi.fim.f3r.5"ruct9 & 
qneftmanirue copletccft caiidne caliditare 
tcmperara.-r c\ eceo eftimmarur9eft frigidio: 
et ftipricio:. f j5alie.ij .t>c ca>ie.cap.t>c oliuie. 
0tiuepaucuomninoaU'merti5t>antco^o:u 
macimequefuntmarure.comedutaurbomief 
baeeiipanequidcmagie.fineaurepancali^ 
nadas? koluniadaeficvocarasgraViaiubditt 
ctionie venrrt8.£um garo aute? ame cfcii .fic 
af; t que funt mature i arbo;e pU>rimu vnctuo 
fum.ficceftipticu.cbimii bsbet.^jptcrqb et xcfi 
bo:anrftomacbujeicctonrag)tririJ.idoncttTi^ 
mcaiit adbccfuntqueon atcto rcpcfite.^f 
tipUciterauteiftapparanrq ftuduerunr ctrca 
pulmcnrariam ejcpericntinj.f % Unanfo: rraf 
crarurertio ca.teoliuie.piiucte aqua cah li- 
dcfuntaficccccplcicionie.qucllanre ati.m 
fc } cpmcdantur vcntrcj moucnt & oe i ipmafr 



fMabis 



tWrobtrilitmredduW.0luteaut©eolco caU 

dtb:c8funr.c)?osftomacbiminueco:robo£ 
rantacvenrremnimioflucrefaaunri 




<rapittilum.rffjEirt. 

OX.eum oliuarum.£>era.aucro. 23ar", 
0leu^oTitmitureicoliuiem3turiee]d 
dam eft nouu.quodda eft vetue £iue 
veroquodeft nouiicalcfacit ca'efacrionc r# 
perar3crbumeaar.fedveruee,ceocalidi9ect 
magisrcfolutiuu.f5iUud qdacctpicejc oliuie 
receutib) immaruris ©irituroleum c,cpcfarur< 
et eft oleuj onfancinu £t i nouo a liqua ecill tt 
et co ©c frigidit are quatitae que eft i eo t»e \\i 
pticirare. £t verue cc eo t>um in ipfo pfeuerat 
itiprieirae e virrurie ■oeficcariuettouec ftipri> 
citaerecedat ab co.q: rucfir fimilequod olep 
accipituraboliuiGinfummitaribus.fimilee^ 
^uquuinvircuteoleoecpeTarum.ervniucrfa 
urerponccpliderarioneruam inomioko qd 
guftabie.quia cadgm quirirae qul in eo inue 
lUea^eftipticiratecibi-Dcfrigiditate.ctfinc» 
muenieeineoftipfia'tatemoinntno:fcdinue* 
tiics tpm t>electabi!e vere pelectarienio ucip 
fum calidum cuin tcpmmcto .z ft ru inue nics 
cujn boc ipm fubtile,? jllud qd eft cjarujpe q 
fiacappeparumftpontotpfuinfupjarhem* 



bniin vel cdjpuo ertcdif ttrftrpra corpu ect tp 
latat mtrttu abfcp eo qd imbibimrin co i abfci 
dirur.fcia8 er illud cft bonu valde . i tonm>s 
quecouuenitoleoeltinipfo.etquando ablui , 
rur oleum nou mo:dicat. 

©Pftattottf0. 

fl Strfcen.Piatm qncp ccpnmif ec oliitic im 
marurte,": t>icif onfanciml qircpcr. mamr?:qn 
cpcp rubcie imerithemcdtje.fcr buiusopera. 
rio eftinrcr illao tuiae rcs.3rcm qfi q; etjpzimi 
rurecouuis ©omcfticis^qnqscc filucftrito q 
mo:dicanrlinguam. 

f O nfanciitu frtgidu eft ct ficcum in p:mio. 
£>leumaurant>eoliuie vltimo marurie cqU? 
dumeftcSincnfuratci-zocdinatadbtmiidita 
rem.Omnee aut cius fpecies co:po:a confo:* 
tanr.'z£>orum alleutanrecrin:re funr. 
f £>leum oliuarum filueftrium cftficut olaij 
rofarum in plurimieinrenrionito ilofa-uar ca 
pilloejer.pbibere vcloctratan canicicicuj am 
miniftraruromnit>ie. 

f Confcrtjringiucfanpineccallucdo o&q: 
eo.£ofirmarcgt>enfeemoroe.3rccjcp^rluiJi 
©eoliuteftludtribueimmaturiscontcrtvlcd 
ribuebumidiecr ficciocr feabia. 
f OY3fco:ides.Oleumqrjfirec oliuienobc 
ne maruriecft oleum qcpaifiiru.cr cft conuai 
ene fanie.a,#wie tllud qd efrnorumerasfitx 
putrefacrioncboni odoae.etccillo qd clxrinf 
modi fiunt olea aromarica .et cft bontl ftom M 
cbofpt er ftipticirareque eft inco.erreftrin£it 
cnngiuaetcofottarfcenree quandotcncntr i 
ojc cr p:obiberfudo:em. 
% cx oleum vcrue oliuaru mafuraru ccucnf t \ 
medicinie.ctotneefpeeola funt lcnicree ctVt 
pue/z.pbibentaduentmn frigoue co:po:i.ct 
faciunripmabilemad morii': molliur venrrcj 
cr t>ebilitant virtutem rnedicinarum vtrinal 't 
rium. 

f £tt>atur in potu contra mcdkimemoit V, 
fcrae vr otomarur atm ete. er fir cum boc aTr^ 
dueqn bibunturciceo.j.iiccum ranrundesft 
aqueo:deivel aqttccalide Ujca nrvcntrem.ct 
quando t> ecoquurur cum rura ctbibuntur cc 
eo calido. j.i|C.conferf toifioni vctrie ct cjcpel^ 
UrlumbMCos. 

C Etqnfircijcocriftatcdfcrt colicccj firab 
apoftemareinrerio:i:2opiIar iotte cj fit a \ Itrco 
re:?anriquuereo ecaitdiusT pluorcfolunuij. 
•: fir ctim co cobolad actiendujvifum .-: fi nd 
babeeneceffaiio iudtgceeo:coquc tpmi>oncc 
fiatficurnKUvrcre.ervirnjecutscifficurvn' 
tueveraie. 

f £t olatm oliua ru filwftriuefi ft ipnafm.it^ 
t m 



X> 



6 



n 



CrafratuJ 



namctit^rfue cin medif ina mtnueiuuflmenro 
"iupi Jdicri ola.tujuflmerii ciuo eficut iuuame 
rii oleirofa?.-: Jtringit fudo:cj ?#bibetcafum 
pilo?.ct purgar furfuree capit iei? confcrt fca 
biti i pozie.?,pbib5canoe qn qc eo fitcolluro 
o;ie vaUtad apoftenutfl gingiuazz. z confcrt 
©cntitocomotio.f j£tiam pparanf cpca eptf 
tbim.ua adgingiiusqfi bumozce curriitad 
eae .ct opoztet q> accipiaf lana ? inuoluaf fup 
fittnmimadcfiatinolco feruenritponaf fug 
0*]giua8fepet>onec albefcant 




Capitulum.rttjEiEt?. 

OXibanum grecc ? larinc vcljbue ara 
bice "Rondef .£> cra.ub.flggrc.cflpi. 
•Ronder fluao.Dvar.g ft gummiei; 
Cflncbi(iuc'Karccb.£tfuntct9fpccie8citfuoJ 
" Ona elt mcltbweejc rcrra indie.cuiuecolo: e 
finaragdin*: ficuteolo;m,c4cgie.? colligitur 
in concbrje;; figura ciue l rorunda,? f ractura 
ciue eangutofa.t ponuntiUud bomicf in olla 
icrrca.? agtrar olla tamdiut>oncc figurfl eius 
rotundaf .£t pott tps fit rubcum. ? fcaindu^e 
dticrriearabuin.? efccundum inbonitate .% 
mcltue cc co cft ma fculum. ct cft illud quod cft 
totundumalbum.-znonfacilc frangibile.£t 
qnfrangtturqteit»ntcriu8€W8etcnaj:.ctqrl 



fitftimigarfo cu co ec6urif cifo.-r fcrtut? cft to 
bonitarcftfutflratiahsil» tre fn ftts; tnr.ofr 
ra cp ipmri ©ecUnarf UiGfldf olo:& aro:i . 1 1 
quarruettt>efolo:c albo.tqnfrargif mgit 
colo: ciue ad ealozcma fttcie Ode aucfclJfl 
lieni.Sapo: olibanieft ftipricue fJtpticitafe 
multa ^lc^ fllbu ejc co no babj ftipricif aie ma 
ntfeftani.uirfue ciuecft q calcfacir i fn5o gra* 
du.er t>efieeat tn pzimo.vn cft fttpric ii.D yaff o 
ridcecfl.tcolibanoXbuevclohbanujlacrt 
miecftflrboriequegrcfe Ubanue ticii .06 
flutcm©ear-biat>cfcrturcandidHe.qc5vcro 
fceindia rufum.fcd vtruct; mafcuUi5cft.£ fttcr 
tium genue minurti5 valdetrufum q# manna 
tburie tstcif .j£ft ergo optimu tbue q<5 mflfcttf 
lii t>ia'f .fubzufum ctrotundu etpigue i narura 
Utcrlcucetfragile.et qtfflb ignecifo tnccndtf 
odoze fuauecopiofe cmirtcne . jSalien ue . vt|. 
fim/ar.ca.tc rbure.Xibanu4.rbu6 calcfaeti 
uum quidccft in fecudo gra.ficcaiiuu fltltin p 
mo ttabcr aur quid ftipticane paucn minime 
vaomamfcltadtftipriataeinalbofincolo* 
rcm.towccaufeeiueltipri^avirrurcmanifc^ 
ftampofftder.quoarca ficcar gcncrofcvttn 
feutnde gradu ftceatiuum erilf a r. 

Bpmtiome 

f foafl.aucfo.£>raffo.3bftcrgif cbfcuri* 

tatevifue.rcplctvlcera,pfunda ? inc arnatca. 

confoUdatvlceraracntiacufuofanginne. 

<tf £ t qn bibif olibanii ccfcrt fputo fanguinis 

tt abfundit fiurum mctiruozt et cuiufcuq? fan 

gumievndecucpftiiaf;effan'gtiimequtfluita 

cercb:o qui ii mcfc bm eftatte rlut.u6 fan? 

gninienariu.et^bibcr vlccra fraudulcnra q 

fultinano ? iualqe mcb:ie.0n mifccf cuj la* 

cteetfitindeUcinuimctadminilirflf. 

f j£t qn admifccf acero et olco.et fir limmcf u 

fnprincipio fo:micc.aufcrrea .er empetfginej 

cr mifccrur cum adipe a nferie cr pozci cr cnrat 

vlccra fraaa ab adufticc igni6.cr fc ifiuras pe 

dumqucfiunr afiigoze. 

f j£r qfi mtfcef cumpicecttrat conaiStoncm 

flurium:iitqnmifcerurfumvino t>t;lci et ©t; 

ftillatur in flurcimconferttiolozi eiue. 

f £r qn admifc erur cu ( bimolcajT olco rofa 

rum.ct liniunrur cu^co apolicmata calida ma 

mtllaru quefiuntpolt parru.runccclerr cie.ct 

fpfum admtfcerur a;m mcdicinie confcrcntifej 

piilmom 4.cmplaftri8 rtfoluentib apoltema 

tflintcriozfl. 

f j£t qn bibif pfcrt fpufo fflnguleas t iffotuif 

liegmflaaufattrifjicirmxtaugct mot o:iti) 

£,tqu4do bibuntte co fani pflrum mcUo;at 



Bt$)tvhi$ 



cos.fj (t nimfe ctl vfoo bibcrint tdudt mania* 
•: amphM vino occickr.Et coburif olibanu* 
qn accipif frttltu cpeo.z mccAit i irmama f. et 
pontf in tcfta ftf&rili i coburifoqi comburis 
cii oetct vt eooperias cfl altq" alio vafe:q: fa* 

i» dtall?q>ndindncraf.f©erap.3uao.j5a& 
Uirtus mmi olibara eft caUdio: et ficcio: vir? 
tute oltbarn qufcprcponaf in tcrtio gdu.-r ab 
ftergit z replet:? miidificat vlccra ocll qucad* 

;» nwdufaatitfuin^myrrbeifto^ds.fEt ide 
aucto.Dyafco.fum9olibani ( C $ M apofrcmo 
ta oculi. z abfandit airfum baiditaru ad iptm 
tmudificat vlcera j&n gencrat carne iu vlce* 
rito ipfi'9q ©icunf cbilomata. : z fedat apofte* 
nwta q fint in eo q -oiainf kanfcri. jaimus aut 
invrre z fto^aas code mo colligif ,z valet vt s. 

[ ^ttideaucf.BbemcfuaY.Olibanu^eftruJ 
Itflegma z aufcrt trifticilrrauget memo:iam 
Buicenna -oe vinbus co:dis "oiac o? cofo:rac 
coi. 




Cflpttulum.rcri$t'f. 

O^opanarlatine.fjgrecepanaie.er** 
:lca.arabice3enllsvel^enftr 3U 
dozns lib. er bvmologtarum. i>anar; 
eft bcrba fragranris odoas ryrfo ferule fimi? 
lis;ejcqua pwfiuit fucais qui oppopanacis 



*icifur:rro<:cuett pftigufet odo:cgrauiBet 
amarifTfmus.f pYafco:t6.j£lt pana*: era? 
cleavndcopopsttaiccoltvsimr^ccbabctfo >v 
lia cvpanfa fuper ferram : bozribilia ct afpcra 
valdcinquincpparfes^iuifa.virgijmionga 
u'attfauilecolo:isnlbi.<afupcr ea capitcita &■? 
nefo fimtlia cumflo:eme!ltno.^cmcn odo* 
ratum z calidum.radiccm vna m folidam quc 
©cfemulfascmittitradicesalbasodoic gra. f 
ue8etguftuflmaras.3pfac|5radi-ciacbr\-mu 
cmitrit qui coloiem crocetim ollcndit . 
«flScrapiolifoo aggrc.cap.l&enfir.atiao? 
ritatc.pYafcozt'i5.arboz 3enfie vcllDenfir: 
ic\ cft opopanacisplanra in bo:ris ct ponici» * 
rfjs inuenitur.cr eft planta babens fotia afpe? 
Vaitcutfiatsnoninagnj ctfpanfa fuper ter> 
ramviridiarotunda^cfoiuiia. inqmnqj par? 
tes.fimiUa foliisficusinfiia fimtlitudinczfti? ■'- 
pesciuscftlongusttmHis liipiti gjlbani at» 
bus.fupcr quein funt ptli albi fimtlcs ptjlucri 
albo.in oiius ciycumim fuiic folia paru&et ist * 
fnmmitatcciusfuntcapitella ftmilia capitd? 
lis aneti .in qtiibus fnnt ftoies croceum colo; 
rcm babcnres.ec b3bcnrcsodo:cm bonum. z 
baba fcmen odoriferum/z babct radtccs mul 
tas egrcdicntcs ab vna radice.graiiis odouc* 
folida fuper qnam eft co:fer. groffus amari fo 
poris Oijod autem qc femtne buius planfc elt 
meLius:eltitlud quodeft fuper liipitcm . 
fHnicennaliteo fccundo cap.t>c opopana? 
co.Opopanacumcftarbo: qoe no elciiatur 
fltcrra.ctfimilanfuripfiusfoliafolijflfiais.z 
funtvcbemenrisviriditati8rubea incita.ba? J 
bentiaparfesrotundas.et auscrus e!i fiatc 
cucumcris.fuper quod funt pili puluerulennV 
j£t eius fotia fumparua valde fuper cuius cp 
trcmitatem eft cowna fimtlis coione ancti.ct 
eiusfloseftcifrinus.et folia rlous (unt bori 
odous.etveneipfiusfunc plurimc. ramtftf 
cantur a radice vm .groffum babenres co:ti^ 
cemxrinteriusodouseftgrauitas.^ius au ■* 
temgumma ejctrabitur cum incifice fue nndi^ 
as m pnmis cum cmsarparer. 

€>Pfrattonf0. 

^auicenna.£ffaufan refoLutuiumvenfofi & 
tamm:lentftcatiuum:abftcrfiuu5Jenificat *ou 
rictes^botbo:.j£iu8radijc eft ad mcdicanduj 
orTamjda.etcnmmclle cltconucnier.s vlcci i> 
busantiquiset igniperficoj-z quodfug ipm 
eft eriam vulnertbus et botbo:.ct ad fumrouj. 
omnee partcs eius confar vicei tbns fraudu^ 
lentis. 
fjfetbtbiftirajmaquaetalcaratm.-ralvuio ^ 



Kmmm 



6 



X % £luidamcnim vipcmt o/ ipfum cft malum 
ncruie.ct viderur cr fir malum neruis fanie fft 
ne bnmcct3tie.£ t confcrcneeft fctarice: etre 
mouetlalTifudinemjetconucnit^dldliiunctu 
rarumomnm.etpodasremo«:empla!irt fup 
pofifum. 

*> f £cfert co:rofioni fcentiifcatm co tmplcmr; 

: ctfed3t©olo:eeeo:um?ccuem'tfodectcr.iie 

ri'e.et matri infantium. 2lcuit vifum z ftt cje eo . 

eollirium. £ p folus eiue fit cmplaftrum fupcr 

•oolozeslareris. 

jg, f £ t off>«ponacu couenit ©olori vrroalcE U 
teriiu ruiii cu fint frigtdi.£ut8 fuecue couenit 
iDuriciafplcniemozecmpIaftrifnBpofitumet 
bibirumcumacero. 

4 f -psonunrur aur cjc eo scccm aurci in t>uob> 

•* vzfeolis mnlfta clarificarurpoft t>uo8mcTes 
erconutnitlplenivalde. 
f£t muftil boc couenit vdropifi.lenit ©urtde 
matricie.? co nucnit guttationi vune/r a ucl? 
lanavnac)ceobibiturcumaquacalidaad,p^ 
uocandu vrinain et menlf rua;? iuuat matric? 
frigidam. ; 

**5 f jt rdusfrucruefaatabundarcmeftrua:? ,p 
p:ic cum abfimbio * interfiatfcrum:'Z p:op:ie 
radit eiue.jjpfa nancpfacir abo:fum fujpofi 
tactbibita. 

-a f £t pucnitpfocationtmarricT:t ejcrerminat 

J vcrofiratetTnmcieetue.': puetiircoiiccz fol 
ucde;educitcrudumbumo:em. 

•fc f £ t conucnir pmrtriuivcfice (i bibitur cu aq 
cartamiadri0o:cmcr fcb:em;paiodicae.cic 
€ocurapiccfiremplaitrumbonummo:ftiica* 
niersbioficumaruEologiaadpuncturaebtf 
bira ef i ririaca.-; fimilirer eiae fnccue. loco ci9 
ponunrur/icue.etejttimocj' armouiacum eft 
dp:opinquum. ";' _ . . 

f Serapion aucrontate DalianT<a dtjc aus 

3L eft mcdidna quc seficcat z ca lcfacit .? t boc eft 
melto: cpipfum opopanajcXomci aur ciue in 
eft virrue abf terfiua X o:rcj; eius valcr conrra 
©cnudarionem oflium nudaroutm. i nos qui 
dan eo vrimur inmedicimsoflium t>enudaro 
rum.etinmedia'ni8vlcerum fraudukntouim 
quia generantiitemedicine carnee invtcertf 
busgenerarionefom'. • 

gjtt auao:itatepYafco:idt8.0uado t>atur 
t>eeo inpotucnmelltcratoautvino cofert ri^ 
go:ib m f cperiodicaru i cocuflionito neruo? 
rum et t>olo:ito taterum:i tuffi; z tyiftiflationi 
vzincnfcabieiveficc. 

f fct idem aucto:ir atc 3 ben mefiiav. Contie 
m ad ca ad que iuuat armoniacum, ct %>o(io 
cfta.3.f.vfqiadaureun>.i. 



» 



-B 




0"Romia quam mulri onomidam ar» 
Mlaucrunt.DYafco:idee.ca.0r!o* 
mia virgc funt tuiouim palmou; m.z 
nodofe.folia illi funt minuta ficur leticule.aut 
ruteaurancbtifefubafpera cringuij tfptfla. 
banc mtilrt in fale componurer comcdur fua^ 
utffime.virgepKdicrcfpinaoarattfitmasba* 
bet.albefuntavirtutt'8calidc. 

^prranonr^* 

f £o:ium radicie earum cumvino bibirum 
v:inam p:ouocar .lapdcm vcftcc ejcdndtt. 
Uulnctibue fozdidie medicatur.ctim aceto 
cocta ro:erctera tolo:ct>cnnil,f biber. 
f6alten9.vin.fim.far.cap. ononie. Ononia 
radiccm babet calefacriuamiam fm rerrium 
gradum. 

f £o:tcjc^o riuemapmfcft vrflif Ericipans 
abfterftuif arc t inctftoc.vnde nontanriieft fib 
fterfiua fcd lapidcm fracriua. 
f £adcautevirmte^ efcarasrito finif.vrun; 
rurautfea x ad^entiumtolo^m coquenree 
tn ojticraro er gargarijantce. 

Capitulum.f«0ii. 



Btfyttbte 




foicmefvetcrfcfamfanafo' 

f Sjuccuseiuscumlacte muUeris auribiis 

©iftiUatue T>olo:em mirigaf . 

f ^uccueduebibinisvtridtBftjmole fatta' 

unvz vue rollif .bibita cum mulfa nigram ccfc! 

rampcrventremfceponit.^erpenre8quoq5 

fugar.ventrem tcmpcrat. 

f2S>accr.p:t6anivirc8caliclc(tca^kfitin 

tur. ^tmiusbuicinvtrocggradu peedttefte 

3lU9invino euratsccoctio fumpta.Oue fuf 

io pcftiferos mo jmp (I fcpc.bibatur. Cu raulfa. 

fumpnlpdcft aconita bibcntt.j£u multis alas 

pSt obftare vcnenisXoqua ffata iuuat manJ 

fum vcl fcpiue bauftii.Ydropicoe repamit bi/ 

bjtum jficcarq-rtiraojennc. 



OT*ig3n0.C>raf.O:iganu dt omnto 
notu.t eftfcuplctraomefticuvidefeec 
fiuteftrevtrilcBca/z fic.in.iii.sra.uluc 
ftremcalidiuseft.f lMa.O:igarMca,clt et 
fidnaq.gra.£ftoH'gar«ftlucftre q6 lattora 
b?folia'zfom'n80Batur.'reftt>omeaicumq5 
vbtCBreEimrmbowis^ide^zinpwtis.-zm» 
nuta b?foliaXuautufcpoeatur q55 i mcdianta 
ponif.jn f£c,pductioi8 flo?, coEigif tfcii fio* 
rito in vmb:a fufpedif t ericcaf . ea?w« feruaf 
^o.cu rloMb? abiecrto llipitito i medicinie po 
nunf .virtute l?3 triuouiedt :a«rabedi:reb)cadi 
pfumcndi.3temo:iganunafciturmioclaA? 
tisintervepwzfruriars. 

Bpmtionm 

fOvaf.Ongano^tuscftca^eiuaeUjcahtra' 
moiftto vcneitaris oecurrit cu vtno •oata. bi* 
bita quo03Cuoulco:cpftatcrTcctum. 
f £oftam.O:iganumv:inam?menftrua pf 
uocat.Uentofitate t rugtmm ftomacbi z imc) 
ftino^umej^ellit.-rmaidefifuntepgrofrtebu^ 

moribtieautitidigeftis. . 

f iumbricos t afcarides occtcht et qcpelltt U 
cp eius apojimate potetur. 
f 'ZJbafticatu t>olo:e scntiu mirfgat . ftoma* 
cbum ct epar % pulmone t>e grofiis bumotito 
mundarXu ficub? ficcis maducatum fttdo^ : 
pw>uocatXo:po«cf; ct9apojimat«loco fca; 








Capftulum*fff#t# 

OTCohvfSalladMij.jfn mcfefebrua 
t io vttfo ferif nopabuli fcctMf} coW 
ligecli femie caufa.3ugerii occupant 
modu ferjfe.Sjeredaeft aitt in rerra pzofcuTa 
poftf»:Itciti3Vclfa5am.curo8tffc fccfiait 
quf farcnopcst.f3 ftatimcoor<ieda eft an no* 
crcVRafinuda mafaitbiio:eco:ruptf noctitf 
Obferuadii eft ne ante luna.tyv.feraf .q: (icfa 
taIimacc8fifequimf.3fld4ib.efvmologi3ril. 
t5crbu a grec o rrarit vocabulii.D em tlli 0:0* 
bumuient.Ouodcultt quibufdsm peco:ib9 
infcftum:fbauro8tamenerTtcitpingue8. 
f acro:.0:obtim (vtfugius sijcimiOipfum 



SCraftatua 



!5 



^ftbttbaliitc ftfro&cuteftffrurffub teruicurn 
afpirarioeVcl eriit fim afpira ffoc notfco iam ejc 
magnaerefupcriuelocis pgruis pofuimue. 
tionullimcdico^noftro?' illud cirepurauerut 
owbuqBno8ricupicimug.Sfcd3fii5.bcc 
ponir;p •ouoto.-itJicif anonulliecfoue fpcci 
c& fum quafj vniue getteris.vna videlic? ma 
io:,quco:obuvoea?.alia$o mino: que vicia 
1 vulgarirernceereonaipellarur. 

&pmtiotm> 

fDYaf.P:obuomefiueberbu<uEreamari 
tudini6dtcalidH.3z5ofplenuacrene8z epar 
purgat.fcabic8 empetiginee fanat:vulncra 4 
cp curat: cum mclle impofttu t>cficcat . 
^t5abudanterincidit:aperit:pwtjcitparofi^ 
da«:indurar ofq? cefticuloe aigerif . 
f 3 faac in sicrie ericularito.£>:obu eft ca.in 
pmog.fic.in:ii.vitmudificariuuelt'zcollariuu 
miidatu cotticito iuf c& $ eivfarina facto vetre 
bamectat. <fl Urina % meftrua^»uocar.cutecp 
clarificat»notnplurimuafuefiat:ne fo:te fan* 
gaincmtnscrefaciatf Sliqn b nares fangui 
riisetTicitftupu.farinac^coctacu fepotia qo* 
dtfpccieetburievdropicieYcrericifcpvaler. 
^£gata $o cu vino valet fug rabidiffimica^ 
nis mo:fii poftra.CRurfus cu mclle teperata 
lenrigine.mudificat vulneribn aparito valet. 
«Q3(ccaiculofi8 magna cit iuuamentu. 




Capttulunt.rrfrtfri). 

OXus latte.arabice facbilicmcnic.grc 
ceblicocivclblifon.S?era.li.ag.cap 
ioacbilicmenicfiue facbalaiamena 
auct.0af.5o arbiliemenie: id cft olue fcmenii 
oifco notu/oirtue dueeft frigida t bumida in 
U.gradu.3iit5.0lu8aba[endoT)ictueft:eoo7 
primuolenbuequondaalerenf boies anttql 
fruges cdcrcncr carnee. £anriimodo cm ote 
ribus alcbanf :et arbo^ pomie ftcut animatia 
berbie.Dtaturoluemotlequoddaberbeo:* 
tulanegenue.f acto:.£>lue itacp generali* 
tertHcituromniebcrba p:eeipue o:tu[ana q 
itt cibum ? alimentu bominieaffumif.f %yitf 
3ftf.^alua?rapam:napunnrapbanit:la* 
crucam:palrtnacam:eepam:alliu z frmiliat>e* 
putat intcr olera.lnibilominuecum afpiopii 
ato vocabutotHciturolueberbaquedam fpe 
aalisomrtana. 

©ptrattonts 

f3utce.Ol9auameniqtSciitntpofmf fa 
fco:idemedtcine#tU8 oino no eftvz cft acjfum 
ficut a ttriplejc qtf fapo:e no bjJ^r in B abuntf 
dat plue irioifco olerito J£ft em vcbcmcrioue 
buiditattecplactucascpcucurbira.Butrtme' 
.tUm;eiu8paucueft.j£iu8pcnefrationocftve? 
U»c:eo # penitus nitrofitate priuam eftXd|e 
£>alieno frigidu ? bumidu cft in.u.gradu. 
f£|ccorttempyftru calidie apoltcmaribue 
?eweradi]cmaUevlcerirx>.^©uccu8eiu8 cu 
elco rofeo pfmfoda ctadulrioefoUsocciden 
B.pferceriatuflicalide^p:iet>ccoctucumolco 
amigdalino z aqua tmlces granari. 
f £>era.auct.£> vaf.:J3erba ipa comcdtfur ec 
tnollu vcntre.z non eft omntno virtue.t ea cjc 
rebuemedicinalibuesbabet in fe aqueitarcj 
multa plufcpomnia ahaolcra a quado fitentf 
plaftrumcumcafuperapoftcmatacalida co 
fert.zfec^tfirimttumm quefiuntaca liditate 
cttpfumcftpaucinutrimetiquldo comcdif z 
efttardepenetratiois. 
f £tidcaucto.3fi5^0nfif cmplaftrflcum 
radiccipfiusrlccrito qnicuntfmi aqutbua 
cmanacbumiditasfimiltometU. 
^£tideattcto.t>9bi]c:cftfri4t bumiduutfe^ 
cundo gradu.£)umidira8 ctue cfi amplio: c| 
bumiditaslactuce cucurbitczfubftaria cius 
cft aquofa non btiein fc grofl1ictem.q:ato t>e 
fcendit i mollit vcnrrc,: ideo modiccreddifur 
nutrimentucvco. 

fl£t ejpMmit ur fuccus folioutm z mffccf cum 
©lco rofarum.-z confert coloa capirie qui ac^ 
ttdicacalo^folte. 



Btttmte 



f £t qn coquif beit 3 ipa t,pqcif f«e fpa j ok 
um amigdala^s fucd malo?; granaro^&ulci 
um pfcrr culTi ' iiccc que clt cum caltditate zaft 
perirace pectoas. 

^T ypocra8.CUH08.i.po:o8pcdBmimpofi> 
tp coUmrieccompnmicredunc. 





CapttuIum.ffff]Eout. 

Spauertarine.greccamo 
nevVmiconiu.araxbaictb 
apvf cac bili . vlcbafcbafi. 
S>era.li.ag.c.cbat:cbar;. 
> atie.Dvaf .'ifSapauerie mf 
ceftitfpee/Ba et eo cftt o 
mdticu £t tllud epapaner 
albuq6femiafio:tl.c9capifaf«toblo0a.-zfc^ 
med9ealbu.zeiceoeagrefte.£ffuntef$ , i>ue 
fpcs.anacbnecapuctJepirujjtftmceiVeftni 
^gru.t ifttf vocaf papauer rubcu.£ c alia b? ca 
put I6gu.min9 tn alt ero .1 noiaf feiU ec eo eft 
papauer pcuffn^o q> fcmia ei9 co ?cuflo ciro 
cadut/z illud c papauer m'g£. £r cjc eo ealmul 
, car 3 qtf nafcif iujcta mare i lirronb?. ? illrj epa 
pauerco:nutu:qSb?folia albafiTiafoltjs pla 
te:q&flomo6.fctflatii •zfumitatesairas fieut 
foliapapaucrlasreftie^ftiptfcdmilcilli^fiipi 
ti.£cb5flo^gta«cu.i:b3f<:mcminucuin vatf 
gintsfubtilitoilogteicuntieficiomua.? W/ 
>Ki^fcnugrecu5.?yfptcrbiccaufamno uhu 



"KYraridostalmico.? n9eitpoffrjo ccointirtt? 

papauovr feme qt5 e induur? in illie vaginie c 

minucu nig? tafpe^.^Rafcif in locie marinie-r 

afperl/z tatinc vocaf meminc.f 0af:vtj .fim 

far .c.*z&ieon cbirares.i.papaucr comuru no 

minatu3 elt quide ficca fructu bmic conncjcio 

ncbabete:ftcut2fenugrea'.'r alltmilaf comu 

botrino.vocaf aikab aliquitopapauer mari; 

num.qm vr plur imu?,{pc mare nafcif.uirrure 

autcbabetinafiua-rabtrerfiuam.Dpiumau 

tcm qb ec uiceo ipfiuf fit frrieft in qrro (ici ter 

fio.1$apaiier coponif ab aperto zvcnro >indc 

papauer qtf vero magia aperit flo:e.3 dcm li 

b:o vto.lSapauer vnu? quidc ell iriae id e fiui 

©um noiatum.cb q> ciro ab co "ocfl tu"- 1 ftmina 

ctf.vd q: ab eo euo t>efluit floe.Sliud #0 cft 

fcomefticu quodeft o:tcnfc?cjcco!irur.2i?ue 

ro z alia tmo fut papauera filud tria vltra bec 

vnuquidcqfifccp:ena?bn8eodu. aUud aure? 

oW6gio:e\bocroruaurcftobl£gine?aridiuf 

buv9 papauerie opos.i tacriciniu ©cfluitondc 

ctqutdanominat idfluidu?.virrueaiue oim 

papaueru eft inrrigidariua.£>cd o:tcnfis qui 

dcm.qo et calacbftidam nominar modcrarc c 

fomniferufemeaprucfui^pterea quidean pa 

Uibu8mifcefurtd.etcitm mdlopumifcetee co 

medunt.^imir ero cuiue ciro flo:ct>efiucre 

ti]Ctmu8:fcmefo:riueinfrigidar.quo circa ne* 

qiiacl qs eo vrif incelTanter.ficur eo qo eii 0: 

tcnfe.arrame ponur id in ribts qui ctl jteiU (ti 

unr m nitro et in pamtoXerrio vero trieri fa> 

■mennig^ejtiftcetamfarmacolumeftii-ta >cn 

tcnitfrigidae.0uarto atltoicti faruiacoiius 

omico evz ?m fcmcn:et f m codiaxr fn. fo!ia;et 

fmopium.i^tuslacriciniuvcbemctertnftigf 

'datvfcpadto:poJicouce8ctmo:tificattoncm 

vndemedicicftvtico:bcncmifccndoc»>nifar 

macie obtundentib frigtdiratie foMifndincj 

jt: ft cm iic quai ro 1 vltimo infrigidantium. 

'% ^aridect a cap.c^vi.airru8 papaueris t»o 
ineftici^icre fpecici eft q infrigidar frigidirate 
fo«i.eriUtid papaucreft q^plueingredttur t 
mtdicinie.ttnde qii papauer fimpucucr ponif 
an mcdicinie.illudtcbetinrdligi . vn valer in 
mcdirini8 fcmc ciue :folia :ca pira:er lac .Otn 9 
ciue cft frigida in quartogradu 
<^<Serapion ub:o aggre.aucfo:iracc. fc>w(. 
pomefUcipapaucriefemcn inducic fomnu? 
tcmpcrarequadopulucrifarurciimpane.aut, 
mtfcemr cu^mdlei comedirur.fed contufu? fe 
mcnrius infrigidat frigiditatcfoui.^cgumi 
ciueipapauerieetfuccueeiuecftopium. 
C ^cdfciUi.Uquiduingrcditurplt)8 imcdict 



a 



-&: 



Ceacmms m 



rumcft qwcinfrigid« fo quarto gradu .iilla 
cft virttts narcorica ? mouifieaftua. 

a> « £mc)c5 aue.0aUUirt9t>oincftici'Z agreft} 
«1t infrigidariiia.t.flpfcrea fi coqttanf foliaci9 
<u capittto i aqrz fundcf ei l >&eeocrio fupcr ca 
pwt facit ooanirc.-z qn terani ciusfoUa cotriri 
onefom:? mifcenf cu?fanicb;xfiMndeempla 
-ftrum apoftcm arito calidif ? berifipitc: ©amr 
cc co in potu nan pot cnrito ©o:mirc. 

£ ff £t terunf capita papauer^ receria.z fiut rro 
cifcidi ©eficcanfsr eponiitttr': adminiftrarur* 
dj £t qn coquutur capita papauerisin aqua s 
fco!iecc6fumaturaqueroediefas.t>eindead? 
mifcctur iUfoecoctioni meUet (tcrum coquttur 
©oneccoagulctur.tfitindcloboc€valdebo| 
«tim tuflta fnefluCracfto que^efccndut ad ca 
nam pulmorosrz fiutui antiquo mcUmouim. 
qttanrio autcm admifccmusciacacias.s rpo* 
qaiftidos ftt fo:tius ad boc 

« 4 S5emcnvero nigrtpapatieria teritur fo:ttf 
ter-zt>aturinpotu cumvino inmicu ventrie 
rtincurfubumoruanriquoejcmamceXaue 
dum tamcncft a nimietate vfus cius ne indu^ 
catMbetb:autUtargiam:auteriam mo:tc. < 

%) •• CJ £t terirur cum aqua^ut a qua ro.fir empla 
fmjmfrona i tcmporito ad nimm vigilia&; 
zadsotoKmcapiris * 

3 ; f £t qn fumif t>cipo opio gua quaritasficut 
cftgranu o:obi.facit t>o:mirez ccdatjoolo:e.z 
cofcrt ruflt zftupt antici.-: ■oecoctio papauerj, 
albi qnablutfcueacaputfacft t>o:mire tcnt* 
perarcz fi altqs vrif eo nimts Cducit fubetb» 

*K f £r fi fumif in. potu cofert mo:&6, fiiit ab bu 
rnoztto c\ t>efccdut a cereb:o.q: rcpellit eos .et 
mati e qfuumtf cii aq pluuic z vino .z qn ct; co 
fumtf cBtitas magna facit fubctb.t pottca oc 
cidtt et tmfcef oi mirra z olco ro .? croco:t t>i/' 
ftiUafinaurc.-zpfertapoftcmatitoca.oclbruj. 
£t qii ©tlTbUiif cujaccto cefert berifipile. 

% «J £t qn mifcerur cti lacr e muticris z croco co 

fc; ferrpodagre.ctfitcFco fufl?ofitof &im ponif 

inauo ?facftt>o:mire.£(tautcm vfusopqin 

colUrtis.vtt>icif idcm Serapion. 

3£> f D vago:as aute3,pbtbuft vfum c& in cgritti 

dinitoocuio^auriuquonia^^cbiUtabatfua 

H frigidiratemembwula. 

f andcradaetititcpnifiadulteraftducitc^ 
■ ctrare? qutfo intromittercf .i t>itft c\> tuuamen 
tumciuafolum cftinodo^andofaeicns tso:i» 
mirc.altjs vcro omito modic vfus cius c ma? 
lus z pei tculofus vatdc. fjbiocserrauerut. -t\9 
nia opa tio tutsvcrificaf g tf perientia. 

4\ «J £t tdem auctoritate Dat^apauer coinu 

M - ta!niajcatmm^iaj^tioiu;Uyi.vndc4ibftcri 



gittnridifrioiffolufti^fminuft ' 
f 0al'.vii.ftm.far.ca.mi!.o cataputicos.*Aa ) ■ 
dic butue bci bc cocta in aq vfcp ad mcdtcrate 
epaticos iuuat .ct fio .a fo.vatdc fo:dida •: ma 
lemongcrafavtccrainuarabfccdcrcarifgbctfr 
opouct atria fact a fucrtnt vlccra nulda.inta> 
tucmabiiergercnarttrarimf.vttipiusmiide 
carnisn6t>ereUnquaf qd^ttr nacp fccrimdi 
ne ncdu fo^es (jetia cfcaras JvlcerS aufcrunt . 
^ am.Spcs papaueris funt in frigidariue t 
r»o c in ipo cogUtrinario pc q fit curandu.t illr3 
qutdeqri e nig?:cft ingrotTatiuucriccariuum 
ct flos eius % folia pfcrut mulru apoftcmatt to 
fo:didi8.-ropo:tef cr caucaf poftcp madifica^ 
ta ruerir.q: abftcrgit abderfick fomquf^if 
foluitz ©tininuitcarnc.xipa cv aufcruntefca^ 
rasaduftascjfuntineis.fit qncocitur radijc 
b9 pfirc cit aq vfcp ad pQiprioc? medietatis.et 
t>af inpom t>ccoaio e»9 pfert fciariccz t>oloa 
buscpatis.zcoficrriUiscibritiitvrinisfuisvc 
luttclajarancaquo^vrina cftgrorta. 
f £rfcmcci9qn f«mifin poruin qnritatet>ua 
rii cafuf cu melticrato lacat vcnrre lapatioc lc^ 
m.i floetiuectfo.qn fft cmplaltru ctimcis ad 
dito olco auferuntiraudtilenria vtccrum. 
f Scra.auc:Ra fe.Optii pfert rl ujtui vct rts 
z vtcerito tnttfttnor;t t>ofts c :,b vno t>auic b 
vfcp ad t>uoe.-z qjrit atroccides cjc co c.j.q . 
^ £t vip.t Uzct opiu illis 3& virt^ fcilTolutfur 
^pter vigilias curatcoo.coq' facit tsotmirc. ct 
licfacitrcuertt virmtcco¥.£t tiitif j5jl'.tnU. 
teingcnio fanifatts.cpopium mar»orago:az 
iufqutamueccficcantvlccra. ' 
4 pY^cotcapir.tJcopio.^oteft autejopiu 
lacrimas rcftt ingcrc coiUrqs admiictu:-! circit 
linitum refrigerare.ct attriumtiolotcm et tori9 
.co^isnungarculiavidclicctrationeqfomnri 
faccrecicttur. 

CapUu!um.fffjEriif; 

•3r^Sritarialattne:Tgrccealfmcn:9tifpaV 
•i W£cmon. aut perdirion. mt (tdcritis. aut 
#^ eraclia.atit qui afiri agrcfte.aut Itbati 
am.aut poUomino.arabtccrugrcgaria. 
4 •£andecracapiful6.,ttir;. •fbaritaria fiucvt 
latini aUqut vuriola vtrid s babct vir wtc. k 
nonficca.foU'a ci9 funt calri a i ficca tn.&gta 
du.Virtutcm babet ©Yafotericam.Scmc et? 
cftfrigidum-z bumidum.fl Dvafcori.capitB. 
Stfmen fiue parftari a berba elt que naf cftur » 
tcctia autparterito.baltcTunriUiminureet rii 
fc i^oUa fimilia allinos afpera.': circa iptiie ba 
ftas femett afperum babene rebus adlxrens. 
Uirm eft eiuc fcmim friptica % fhgtda ^f &x 




C£tpodagricfe mcdic^turcnmccrofo ctofi 

no aut cum ajcungia apmio. 

f Succus foliomm ciusin quanrtfate cfar f 

vnweaceeprostiifaitoantiquieopifulaf. 

2~umo:es faucium gargarifmo aut fugunct? 

compcfcir. polo:cm auriumctfm olco rofco 

mitrusmttigat 

f Sar.Scmcneiuofanatvniucrfasflcgmo^ 

nes in pjtnopio 7augmeto vfoad ftatum.-et 

papuccobumomtofu E piafmatu6^cd7fuc 

cu8au8ignifacroxt»oto:ibU6auriumflcsmo 

nofts conumir. 

f Succu8du8foli6?tumo»sfauctumgaf 
gartfmo compcfctf.je tqu idam mcdico?.2?i8 
qm longo tcmp o:e tufltcrunt^inaucruntcuj 
cf autem ao Itergat cuidentcm p:ebet ejcperie* 
nammvttresyaf^/ 



Itcn9.vi.ftm.far.c.eupmcn.0uidam em cjdi 
rionnominIf.aiqautpmbcricu*aiq autcm 
fidiritan.^untautaltiquinommIfbacera* 
clcam .ineft aut fcmini ci9 virtus ejcpurgatiua 
leutrcr.?ftiptica.frigida? bumida. 

©perattonfD 

f -jbandecta .cvts/jSarira ria in tcfta calefa* 

ctafinc liquoKlocooolenrifuBponimr.vcleti 

amioecocta in vino qdmeliuse.zcujmrfurc 

in vmo albo aliqultulu acido multu conferr. 

«CiSiratcfiamlicpparataparirariafrigiditate 

ftomacbiec inrelhno^ct t>olo:ceo?-, 

W £6fra ftriguiria i stflurrii paritaria in aq 

falfa eoquaf ? olco ■zcarbaplafmef.jjpa fimm 

ter coct a x comcfta valet cotra t>olo:e ftoma;> 

tbiz int etimo? ejc ffigidiraf c z venrofirate £t 

trifpdlc cjc ca factc z comeftc valcnt cotra piet 

cttctaadcoscifangmnercqcimttparitariam 

ieren cjctrabc fuccu z bibant . 

f DYflf.Semectusearbaptafmarib? adbi* 

btmigncfacriiejtinguif.condilomatafpargic 

c6buftionibmedicaf'2Cumo«8omc8Com) 

pcfcfclbuftulasemedar. 

f Swccus rius eu cerufa mijcta igne facnim 

epangmr.erbcrpetasfivnausftierit. 




m 



€flpimuim.rrrw 

»3Uma cbuftilannc;2lrabice 'Hakala 
Sjcrapionli.aggre.ca/Racbala fiue 
nacbla.Diuiditur »iut'fionibu8 mulrj 
"Bam funt rami riua z fuccus ramo? ipfoaim 
etcipbiloncs ciw-z fummirarcs tpius ftnc ca? 
cuminc.2 co:rejc cacuminiG aus.-z ef t Kafri z re 
cetieejceoimmattirujqtfeftficuragrefla vue 
cft balacb. 3dem auct o:if atc £>altem' . JSub* 
v «i 



3 



45 



Wtmmm 



Itantiafucdrflmo^cilfilibmnfummitartse 
cdpofira ctfubftanria aquofatepidaer terrea 
frigida.fedcomciefummitariefubftanriaein 
v fe^aficcio:.etndeftineo bumiditaealiqua . 
etfapo:totiu6arbo:i8cftltipticti8.airr;;ci9 
eftoeficcatiua. 

©ptrationts 

B ^-^andcctaca.cccccljrfi.Confcrtvlccritepti 
trids/zftringitiuncmrae.ctedfmcomtprio* 
ni co:pozis "zoTisftomacbi ajplicata etreriiis: 
a.tt tnpotufumpra.£>ed fedumactina&idcft 

' niKleusliueosoactili.qncjjcobiirifinollafi 
cUt atie medicinc.? cum ectracrue fucrir ab igf 
ncejctinguif in vino.ct poftca abluitur et poni 
turloco tucie in comrije.que ponunf in oculo 
ct (i no cdbttruncur peima vicc comburanf itci 
rttm. £r virrus co:u cft ftiprica cdglutinariua 

*£> ^fOuado mifccf cu lardo cducnit viccrito que 
fiunt inoailo? epituioculixcafuipalpcbrarii 
crincarnatvicera. 

£ «ff £ t ide a uc.&bcnincfuafairtus cifiliomij 
eii frigida mftnc p:imigradue.? (iccain medio 
dafdcm £onfert acuitari fanguinie t colere.z 
ftringit vcntrc $.et nucrit nutrimento pauco cc 
eurar$olo:em ftomacbi. 

$> fl £tide aucto:itate "Rafis, Ctfilio ccdat ftajc 
um fawgmhie z cokre.z ftringit ventre.et rar 
clcvekcndii a ftotnaebifundo:t ad ciue •oefce 
fum muat siwibcr conditum. z facit ea que fa? 
cit kafri.ideftfummita8ramo?palmi vcleoit 
tepfummirafum eo:um. 

&. <([ £>alicnu8 vui .fim.far.cap. finic arbo:.? cft: 
palma.5tm'j: arbo: cft.id eft palma ftiprica^^ 
ticipat virtutein omito cius parrito. ramo:u> 
igttur fuccusaufterue cft ec aquofa fubftaria 
tepida er rerreltri frigida cdfiftcns.fimilircr ati 
tem buius naturc eft.ct vocatur eenogcfaloei 
4dcftcefalionu8cfibili8C]ciftcn6,5tuctu8^c» 
cius z matimc Dulcis jio pauca ptiripat cali i 
ditarcefibilis ejciftes.ad multupjucnit vfujmo 
folumcictrinfccus atpofitus vbicdfbuare c\d 
ctficcarczcdgrcgare.xoenfarcrconftringcrc 
indigcmus fed &m afiumpf us vt cibue fimul 
cumaltie-jipfeperfc. 

%f C O^od vero vocarur alacergcrmen cjtt ftcs 

J mottc paltne eande cu cenogefalo babct virntf 
tcm.quod vero evelutrecria ei^ftiprtca virttt 
te polfidef .ficcat atlt plus pdictis ceu et ronftf 
Itcntiafubitanrieftcciusctscjctftens^minime 
participane bumiditafe. 
.& ^aiidemuUiinputridinalibusvlccribueco, 

' Vfuntar.^tsifarinacijscoUigertbplaiasartiV 
q&qu % cp .] tiez I tomaricio vtrturito cjctrinfe/ 



cus.£ft aufem fadijc buttte ptohfc ficcahucfrfi 

mo:daciter virtutis. babensqmdtipfa ftipri 

citarie. 

Cttabbimo\fc8ca#erjalmaXo:palmeati 

getfperma.tiuuaradcoitum. 

«tf &uerroieinfuo £olligct.Ome8 ptcs t>a* 

crili liipticitatcbabctmanifdti.©? frucr5ci9 

cummatuni8aliqu3babetfiipricirafc.Co:ri 

ccs vero arborispdicrcmaio:cbabcnt ftipricv 

tatem alici to prito ipius.-ft :o fructu bui9 lege 

fup:a .pactilus an ca.cliit) . 




Capitulum.fft]rj^. 

Daiacium kporisJEjc bcrbario. 1*iht 
cium kpo:is berba cft cndiuic fiinilie s 
nifi ej- folia eitis magis acura . radices 
ipfiu6fatifragcfimi[ia.5loK8paruccffcmcri 
rorundumanagisfamencpfa^frage.^affif 
longitudinct>uo:ucubifo:um.2l!iquinomii? 
nantiftambcrbam Comum IcpoJte^iuepaja 
rinm lepou's:liue bcrbam lcpo:ie .*|!b:opferca 
cr ilta berba lcpo:em a mclancolia fua ctifto '% 
dit. "Rafcitur i\\ loris vmb:ofis tiuc arcnofie 

0Pfrationf0. 



Bt$)txhis 



f^alladukpotismcUncolidsmultucftco 
uenice.ainu t>ccocrioie ciue valet paralittcj 
?adcolicapafltone^riunefumptii 
Cftadijcewsinvinosecoctapuoat vrtna* 
sbibitumcalcalum rrangit . jtem potatum 
ftranguiriam curar.t>iln w ericie multu pdcil 
radicem cum vino fumpru.23ec bcrba mdan 
folismagnupttlratauriltu.ttadice in collo 
pcndcnte generat audaciam.toUitcp timo«m 
•fcalladumlcpoaecu vino vecoct* quar.fc 
tollir.t omnibuapaflionibusfplenisfingiUa 
rcp:cfidiumdr. 




CapituIum.trr#iEit. 

*8T\ Zantago mato: vel arnoglofla vcl 

•I JqufocBnemiavellinguaarierielarine 
4N-^ grcccamogloffo8.;arabi.Ufen.alba 
meU1^andecta^l)tn.2lrnogtefla.i4>lantago. 
cutustresfuntfpedes.ana eftfemina.cuui8 
folia fut lata babcria quafi fila in tractura fua 
aiia eft babene folia ftricta quc lanceola vo 
catur. ct eft mafculus.ct babct hla vcl ncruos 
in fractura fua.7 ob td quinqvicruia vocaf.z 
babct ftipitem mcduj fcmimco plenum. fri. eft 
i ficin.t?.gradn.£ft alia fpedes quc vocarur 
planrago aquarica.pzo qua legc barba filua* 
na.Scra.libaag.cap.Xifcni.Xin 



.Aingua anctie 
«dtpUmago^t fubumgit aucro.prafotf 



citur auteSmogtofla.tdnsV^polifCo eftlin 
gua agni.^deo q> grcci amon agnu vocanr: 
2 gloflbe lingua.£r tricif cria eptapleuroe. td 
cftfeptecofta8babcne.nain folije dus funt 
fcpte cofte ab epta tn greco. t.fepte 'Z pleuroa 
cofta,q:babetfcpre ncruofitatce manifcftae 
tnfimttitudinccofta^lareruanimaliu.^uiua 
t>ue funt fpccic8.3£>aio: x mino:.pc minori 
tnfequctfcapiwtofcicef.i^aioj^ote^gas 
afperio:e8:?folialarafimiua oleribuecj cc9 
mcdunrur.svirgaciuscftangulofaadrube* 
dinem t>eclinfe.cuiu8 logirudo eft vni$b:a0 
cbn.fupquaeftfemcinfigurafna amedicta? 
tctpfiu8fup:a.j£tbabct,radiccsmoUc8 , 2plu^ 
rcs :lup quae funt ptli albi vr groflitudo t igt 
tt.trcperifinlocislapidofistbumidia-ztvfit 
M»?o:ttetp:arie.£ttUaqutdemato:eft.ma 
toaerirruris cp'mino:. 

i>ptraricnf0. 

f 0aucn9.vi.fim.far.cap,&c Srnoglofla fiue 
plantago maio:.23ecplara mijcte coplccicia 
cft.l?abcr em quid aquofum frigtdum. babct 
a uriquid t aufteru quod cft terreftre frigidum 
ct ficcum quarc infrigidat •zfcdiccat.? f m am 
bolecunde cft abfranrie.0uccunq5 aut cufttf 
ptidt atc farmaca oeficcant omito malis vcte 
rico vlccribuB treumarito z putrefacrionibue 
conueniunt.? idco erii oiflmr erijf. nam Mujcus 
fanguinieftgunr. 

^fcrfi q^puftueftrcfrtgerantz confolidari* 
uafimulfuntmalo^vlccrum.tamrecenriuq1 
vercrum.3 n ommto aute buiufmodi farma? 
cie vclp:ima vfntiUa vltima amoglofla cft,p 
prer.jpomoncm complejrionie. 
< Ram er ficritae partidpat tfrigidiras non 
ftuprfacriuc.fcd^frucruectusetradiccscon 
fimilis virtutis funt nifi q> ficdotfe et minus 
frigide . fed fructue quidcm plus fubtilium 
partium eft.ra dicee vero plus groflaru"3pfa 
autemfolia berbeatficcare plue fubtiliu par* 
rium«minu8frigidefuntvirruti8.eiu8eical3; 
ta i cuapo:ata fugfuritatc! aquofa. jfpfamm 
putercaquidemcrgoradicitoquida adt>en* 
tium t>clo:cm vtunt ur mafticando. i lotionif 
bueipfarumfcecoctarumadopilatiocssepa 
tie-zrenumvrunrurde. 
f Sj l folqe z mttomag^adbuc fmctu.^ar 
tidpatcmbecoiaabftcrfiuerirturisiquantu 
tecer ca ftn efle.£t in ipra berbaputaf fup,ari: 
tamen a mulritudinc bumidirarie. 
f -fcandecra cap.vt e.arnoglofla.i.plf rago 
vtilie.dtadficcanduvnlnera^mundificadu; 
putredincmeo^^parpfo:rat.rcpugnatfacro 
igni nc co:pue ambtat.valef. cria cmo:roidtto 
v iq 



n 



-& 



Cractfittra 



£ 



2) 



fc 



omnemt>ok»cm qnieftetfgnie aduflioncVc* 
frtgcrar. 

f 2> ucc9eiue cu albumieoiii fitmptue libe* 
TatYctm'cu.vtiu'eeftemoptoicie z ©iffintertf 
cis.t c\to ftuut menftrua vel emo:roide.vuwe0 
rapulmomscuraf.T^adicciusmaquacocfa 
t>olo:c t>cntiumirig3t:fi oe ct illaaqua lauef, 
£5>ucc9ei9valet ?opilationcrenu.peletma* 
cuUemgrae.tftringufanguine.&erba ipfa 
mafttcata t>olo:e t>etiu tollit.£> ucc9eiuet>a 
rosqrtanario ante t>uae bo:a acccfltoio con 
fert.Tlaletctia ad vulnera recetia cu ajcungia. 
f 2> era .auct.0at'.airtueei9 eft q incarnat; 
/£t?fmvlceritoco:rofiuieoibue?putredint 
«o^.-z,fl?terr5pfertvlcerib?intelh'no$.'rmcar 
natfiftulas? alia vlcera antiqua.£tfemc ei9 
^radicfunt.ffinquabuic^tutimiitquia.funt 
ficcioia z fo:tio:a.£t femen eiuseft multu fub 
tilctradit eius eft groffe fubftantie.? ipa con* 
fertioolonBentium quant>0 mafticatunzqfr 
ftt collurio ons cum aqua ciu8. 
f £t femina quide x folia i radic funt aperiti* 
ua opilatioie epatie? rcnumrfprer abfterfio* 
nemqeftincis.nifiquiafemeeiue eft fomus 
inbocfatt'8.q:inoilx> ilt^eft^tus qabftcrgit 
fatis.tfoMafleeft^tueinbacbcrbatJucftrc^ 
ce6.nifi q: vindf ab bumfdit ateq eft in ca; vn 
116 eft manifefta fua opatio,pprer fua victcmaj 
fcumiditatie.-z qn ©cficcanf folia due Ut vir* 
tue ei fubtilio:? minue frigida.qm aquofa fu 
perfluirasqcft iuea refoluif tt tjcfiruif. 
f £tidem auct.&lcrandiiSmoglofia mtf 
net ventrem quando bibttum fit crifterc ctsm 
ca.tconfertfebnbustatiancet quarrane qfi 
bibiturfuccneeius. 

f Of af.coe &rnoglofla.Smogloffa cata* 
plafmatibuf adbibita fo:dida vnlnera purgat 
i reumata ficcat .*|i>:ofluentito fanguinem oc 
currit.^aculasntgrast epictidas atrat.ct 
cica trices vnlne^ factle t>ucit .£> eme ciusV un 
fum % in puluerem redactu z vulneri afperfum 
fanat.xaftionib? fingulare p:cftdium cft. 
f ' #>>oifib? caninis autiliu p:eftat.? tumori? 
busz fcrofis matime fi cum fale imponafX o 
cta^o folia ipfius cum aceto i fale ttiflinterns 
% c iliacis opirulantur.maiume fi cum lcnticu* 
la adbibeatur ydropicis cocta fuccurrirXpiJ 
lent ioezafmaticie.pdeft aeecpta. £>ucc9ei9 
vulner a o:ie purgar gargarifmo. 

CflpituIum.fffjEiEjEit) 

DX3ragomino:.£5cra.Ii.ag.c.Xifen 
i eftplaragoXuivtmefunt Ipeciesicj 
maionmmo:. £>e maio:iiam t>icnj 
cu.£p ed mino; babet folia fubtijio:a % mmo 




ra i f cmtfoia c£ folia maioJie.? babct virgam 
qucinclinafurvcrfu8tcrram:mulfoeramu? 
Ioe babentc.-z floe eius cft croceus. 1 fcmc «9 
effinradicelingue.fDYaf.cap.ariiofilof^ 
foeXiue getiera funt t>uo. tJnu t icif ur poli? 
pleuron.£ftetiam aliudsfed imnu8.*£>,inu8 
\ babct mir.ura folia? angufta 1 lenia. \\v) 
ga ci9 multoe babet angtiloe indinara sid ter 
ram.flo:emviridembabcne.?f<menfugipa} 
virgam.'Rafcitur ^o in cardiarqe locie. 

©ptrationtB 

f DYaf.cap.t>e amoglofla inqt, T&inoiie 

plat aginie fucc9coUuttoni t» af 0: is rt fo Irj e 1 

fanguinateegingiuas curat. 

f 3 te fuccus tcpefacr^fomfto xitrie * oloie 

rollit .©uccue btbcdue cft cte § purulcta rc^ 

qciutcufanguine.3nferpetiemo:fuplanta^ 

go mino: trita cu vino ftimif. 

f £omeftaaut fola vel cit lcnticnla cocta et 

oleo viridi cu aceto fciffinterir oet ftomati^ 

coecurat.©icuivi)lnuefecueoajluvclna^ 

fumnatum fucrit : fuccueciueium lanamcUi 

impofif ue p t>ie8 nouecurat. 

f 3 tc fuect ei^cocleariu vntl bibltum uuriwtf 

cos etcludit.fifr facit piftaura i vnbilico pofi 

ta.0i qua wickein co*po:c nafcimr bcr^ 



Btfyttbte 



bam piRmm cum apungia fti* falc quafi m 

laginaimpone.Succu8ei9inquamulfaan* 

t c tmao bo:as acceffidis potui t>a quarrana* 

nistmirabcriseiuscrTectu. 

f Bd podagra-z omne neruo^fcoktte vcl tu 

mo;efolia aus piftaracij modico faleoprimu 

eii.vumaareceriaciiajcungiavereri curat fic 

zparoridas.Sjianpedcsoolueriteririnerc 

cu acero impofira tumote? ©olo:em toUit. jft 

ftulas tunfa z impofira facillime fanat . 

^OesDifticulrareGveficefoliazradijcet^po 

tara fo:t iter medenf.q: abundatcr tnfrigidat 

et ©eficcant z rep:imur.fl>rer quod ad vlcera 

maligna z reumattea z putrida iuuat .;tocrba 

ipfa t>iffintcrico8iuuat:t emottoidae repmit 

Uftainfrigidatzgiutinaf.seficcatetn abfqj 

mo:dicarioe. 

f £>emen aut e{9 z radip fiTia fut faute.^rer 

qe5ficcio;afiit^min9frigida.©emepterea 

bjfubnlildi^tute.foliae]ctenuadi.radi)cim^ 

pinguadt q mafticaf in t>olo:e fceriu.Sd o:io 

etialauatione.facit-repariBTrenuemfrafim. 

. f ^bulti t>t'cut radicc a'9 collo fufpenfa fcro* 

fastiafdnontJimittfre.&ec pzcdictsi eriam 

Sferapionrefert auaoware pvafco;idis;li 

cetperaiiaverba. 




CapituIum.ff^iH% 

DXatan9arbo:/fcandecra .ca.ccjcj.vtj* 
Dulb vel bacca arabice.grcce fuffice; 
re.larincplaran9arbo:velfcoranum* 
13bifciendu cp fcotanu qua in&tfpania rin? 
gunf panni/znos vocantfea barjtVz cftpfara 
nus arbo; vt pt^p pcoidia &uicct\c ciue cap d 
cn Dvaf.cap.t>eplatano . s,pfertvelut nuces 
paroas.vt 3o.£>erap,c.t>e t>eti frigue. 3te 
in Dvafco.fmtraflarionearabicaca.tJelbla 
tano.&rbitro: plaranucffe tmlb.jfre SotcO 
pban9cap.t>eptatano.^latan9eft t>ulb.£> e 
rap\lib.ag.cap.puU%aucfo.jiaac.pulbeft 
arbo:magnaecfenfa.babe8fbUa magna ftf 
milia palme man^bots fimaia foltjs kerucni 
fi q:(iit mino:a.quo? fapo; eft amarus ponri 
cus.z co:tejc Ugni eius eft groflus rube9. £o* 
lo:#oUgnieiti8qnfcindifeftmedi9tnt'glau* 
cedine z rubediric"»'; bjflo^eparuti lcnemglau 
dcolo:i8;3ncuiu8 loco qn cadit nafcif gra 
num afperum gtaucum vergens ad rnbo:em« 
pulucmlenrii in (ugficic ficut granii earapucie. 
beciniJripaniavocafpalma tb:ifli.cu qua 
ibide ringunrur panni.fimilirer folia eius fimi 
lanffolns ellcbori nigri.£>a{.vn.fim. far.cap< 
t>e *jMatano inquir .Stabftantia eius eit frig* 
tbu.nonlongearebu8temperatecoplejLtoia 
pYafco.cap.tscpl3tano.l!Slatanu8bab3vir 
turcmfri.ctbtt. 

0pfrattont0 

f jSaUen^olta eiSreceria qn ferunf i ponuf 
ficut emplaft?.fuB apoftemata q fiut tn gentf 
culie:fet>atea8fedati6emanifefta. (cd coiticl 
rius virtus cft q t>eficcat adeo q> co:tejcipe co 
quif cuacefo.t pfertt>olo:it>entiu. 
f 'ftujcfa eius qftadminiftraf cuariigia^ 
f ert apoftemarih? qacctduf a cobultioe tgnie 
£o:tepdu8,qnccburifureftmediana , t*efi'a> 
catiuaabfterfiua.£onfcrt egrirudini ciiqua 
eUuafcuris^ciniseiuecuratvulneia iu qui^ 
buseftfotdeetputredo^pternimiabHinidi 
tem ejctftcntem in cius loco. 
fj£topo:teto/caueaturmultumapuluereq 
eftinfoltjset'U8tinfructu.quiacftnociu9val 
decannepulmonisOdco q;t>eficcat mulruj 
crinducitafpCTitatcm. z nocet voci eriocutio 
ni: ct eriamvfui z audttui: ficadit in auribua 
velinoculis. 

f p Yaf.j£mplaft? a' i ;fedat apoftanata csttf 
da q fitjt in genuXt qn cotfejc ei 1 ; z nuic er9c60 
burunf ,z% cmplaft? cum as-z adipe pcccina 
tuit arietinapfert vlcerib? putridis . Sumli> 
t&z ciuscinisfadtfolusboo 

v Ui) 



H 



» 



V> 



ITraftatua 



f Bt quando «roquutur folta dusrccentia di 
vino.ct fitcmplaitrumcum cie:pjobibct curf 
fum bumotum ad ocutom.t rtfoluit apofte* 
mata flegtnarica. etquando eo:rcp coquitur 
cumacefo:ctntcoUutiocumco:confertt>o* 
lo:i©ennum. 

C^tquandofactuetfuerccee bibiturcum 
vino confmmo:fito venenofie.t quando ad* 
mimlrraf cu atungia curat cobultionc ignie 
fctpuurisfolio^ciuequando cadit in ocuui 
aut aurcenocctmultu.^imilitcr^pului8 c\ 
cftfupcrfructudue. 

f £o:te£ ciue cum vino fcotpionum icmerct 
ftringir.Xanugo fouoajm ocuUe % auribus 
dttnutilie. 




CaptmInm.tff)0E^ 

D^Uurue.jtfidotf/fraUurueeftberba 
afperrimatfpinofai0tefarufi £fai£ 
wia.c/fc>Uuriu8 tanta fpinarum cir* 
cindarioefcenfcir. vt pio afpcritatc vic t angi 
poftt.^liniusli.piq.£iraiaicarcgio.lotbonj 
p:epofuit fuepaUuro.iructicouoidtbec fra 
ctacftmagisrubcuo.cuiuonuclcuenonfimul 
manditurOJocudueper fcatcpuwuioi vitw i 
qumzviiiafuccofuoicomendans* 

.3, C^^Ub.F|cut).^9Ui)riquodcltseii9fpt 



««femen efue afari mram vocant.£ontra rct 
pentcecificannimficft^tcmcakulofie^tufli 
foUa vim afiricto:iam babnet. 
f*Radi]ctifcutitpannoe:collcctionc8Vomf 
caevanaetrabitpotata.pecoctum ciue in 
vitio aluum fiftif .S> crpent ibue aduerfamr. 
■Radijc ptfcipuc fcarur in vino.">6acce purga? 
tioniinulicrumpwfuntXiliacia.-oimntcricI. 
eoltticiepwdelt.Tadipsecocta % ftlita ejctra* 
bitinficaco:po:i .Utiliffimaquoqjtumorib* 
eftadmarie: 

f DYafcorio^aUurtiecft queab alqe acue 
paUariepidtur.vd dcerfcomefticumvocaf. 
fotiaemeiradiicftipticevirfurie funr.itavt 
ventrem fluentemconftringant.jm boc quol 
«^©vafoxtice virtutiparticipant.vt in vcfica 
lapidee frangat.? et rojacc atcp pulmone fpu 
lamina.flegmarica eum bumote cducant.£>i 
rirur-zlauaria.eo cppleriq?cpca lauanr.Sc; 
meniiUucbibirumtufllimcopcfcit. 2Lapidca 
rcficefrangir.moifib5 venenatie occurrir. 
f £ui8cucatura bibita venrre ftringit.vtinl 
l^uocat.ucntnisacccptie obuiar. iolia ciue 
vtcatbaplafma impofita cnrantapoftcmata 
fi fint rcccnria .radicib? quocp ficut ? foltjeeft 
virrueftiprica. 

eapimlum.fffjEjE)Eu?. 




Btimbfo 



DMiWCH fcomdhVa3« :do:96f : co q» 
radf]cei9fitpcipu9boiBpaft9,£ltcm 
odo:atu iocuda.-cibo celeerabilis.^al 
ladiusu.itj.*|baftinaca verefcrif.*p>:.mo lemi 
nc ponif i platis loco pingui? foliiro alri'9 pa? 
ftinaco.raracpltarucdacltroburaccipiar. 
«j ^lifti9lw#.% ignofio:a funt omilana qd.i 
a nobis pofita in carrilaginu genere.mirumci? 
fapctis vebcmenri a omito ind ie. tc bis vnuj 
cf t gcuiie paltinace fcd agrelte qri.pucnir fpo* 
tc fcbapbilims grecc tncif .3 Irera vero fc? fco 
ineftica:fcrifradicevtlfeminc.^:imo verevf 
autuno vr placetbigino icbuiario Bugulto 
£>cptemb:i0aob:i.foio qjaltiflime refoflb 
vrilisdTe inaptt annicula vtilio: yma . grartf 
o: flUfumno.parinifq5ma1cime.j8 f ficcjj vtrtus 
cieltinrractiMc 

f Sfera.li.ag.ca.Xe5ar. id eft pallfnaca . £ ft 
ejc ea t>omdtiea et nludrris. Domdlica quidc 
elt n .ira.£ r illa babet radiccm in longirudine 
vniu0palmi:boniodo:ie.qnccomcditur. 

Bvmtmm 

f 0a r.vui .fun.far .c.©rapbtUnu.i.paPiinaca 
pomcftica quidc©cbilio:!faudirio > 1 o rb:rt» 
0: cadomia.Domdtica vnnas mouerr: mc^ 
ftrua ( puociit.2rota C{dcbcrba.maicime^o ki 
mc % radip iDabjaur? qd abikrfiuii in fe.quo 
rirca % fagedenofa vlcc?. c\de cu rblijs viridito 
z mcilc catbaplafmanf aur mundifican r. 
fl£r idcin lib:o t>e c ibie.c.t>e pafiinaca .*£a* 
dices&i^omcftica*: comeduf .3 limcrii cjdc 
minus rapis bnccs calcfadur aut manircftc.u 
in medto fcaldi grad9:i bumectat in p:imo §'/ 
dtt.-z alicjd aromafi$as:indigd libilitas quidc 
igiffimiliteripfioinelt-ralrioradicito.tuinati 
tieautfunt.£tfiabundat altquic tn ipfarum 
vfumali cbinwgcncranttir 
fl irnludtrepaftinaca qda vocatfcaueihma? 
gic v:inariuu c\deeriftete.magi8 aut medicina 
leia-z multa t>ecocrioctndtgenfefit>cbear qs 
comedcrcipm.pcillalcgeca.Daucus. 
«ff Pvafco/fcafiinaccvieoirsis inr2diccctfc 
minecoftituraelt.pilTtntcricisquocpvctuft^ 
vrmsdt.Denrcsaitsradicearcumdaricredu 
rurat>olo:il»releuari. 

Caprmluro.ffrrmn). 

3nt8po:cin9lafinc.21rabtce , Butr;or 

marien . vcl aibarincba vcl artanita . 

grecevcro ieucopodtonvel ciclamin9 

- llbifctendum cr HnKen.lib\i].ca.t>c Brrantf 

nxkit e? ar< bsrincba vcl artanira ejt ctcla i 

rnenjct clt panis po^-inws» 




#? £?era.liD.aggre .c/BrtrbormaricnD idt 
burbo:maricn.id cft £ tctafnc . Sfmanfor ca* 
t>e Bpoplejcia . 3 n crifteri namcp quod facir 
ponit arranitam erbttrbo?maricn.crcdocpfit; 
crro:in fcribf do.qrn btif bo:marte r% £>era i 
eftriclamen.£t artamrafmiautcamam eft 
ciclamen. f tmde 3 erapion tib" . aggrc.au? 
cto.Dvflfco/Btirbotmarien.ixiclcmcn.-zba^ 
bct folia fimilia pla nte:que ctcif ( iffii6.i,edera. 
nifi qnia funt macular a maculis albedini tra^ 
bennb.xbabervirgam adnigredine rendcr^ 
t em fine folns.cuuis longirudo cft quart 0: t»i; 
giroaimxampliu8.ftip:aquamcftflosf[mili» 
rofcrubcusautpurpurcus.etbflbctradiccm 
nigram.groflam.rorundam Jaram et p:tflam 
itmile rapcnafcitur in loae vmb:ofis. mapc 
advmb:am arbo:um.£t incidii bcc radi|C cc 
ficcarurficutfqnilla. 

f VwUatoccicl&mimfmtrat\f\ationq>r.Q4 
ftram.£ulamcn.i.paniflpow'nu8.foliababj 
fin.ilia ciflbs.? vario colo:e ptcta.tnf er q func 
ct alba folia ,rv t fue ci dt nudus fine foltjs vra 
uopalmcbabene in fummo flo:cc rofcos vcl 
purpurcos . cniue radijc nigra cft.tnrus vcrc» 
albaergrofla alaraficutrapa. 
f jSalienus .vu.fimplt.farma,capif. ©c£icla 
rr.ine. £iclaminus varius virmre elt .ercnim 
aWtcrgjt % incidit t attrabit % t> vafora r.palam 



Cractams 



*cm cft er, Mb>§ f mpartc.€t fubdit, 2Ui9 ve* 
ro cidamwus:que quidi£iffancbomium no 
minanr.co q> odo:e?fto:e alTimiiatur. *Rad» 
ccm inurilebabcs.frocto' vero bab5 opcratiuu 
fufTiamta.f^liniu8.ca.t>cciclaminc.£ida 
men id eft pants po:cfnu8.in foltjs elt fimilc cif 
fos in figiira.£t funtcolo:e varia.radijcnigra. 
et rotunda M medio t>ep:effa £lt ei tvrfus mi 
dos cum fio:e purpureo.Eft aliud genus cida 
mmi8.quodanpeUantricl3temon.folia bab* 
ciifos ftmilia:fed minora baftam groffa^ i m* 
dofam.quc bafta ftarbozejpwjeima babuerit 
adberctilii.fto:cmbabeta(bii2odo:atu.feme 
butruofuj i fimile vuis:? velut ciffos. jSultuj 
babens mufcilaginofuj z vifddu.fedinufile.lp 
cieafperia^artdisnafciturOdem.ilidamen 
ca.dt*fian*ilj.gradu.quiet caffamus panis 
po:cinu8 z malumterreaipellatur.T\adi]cei9 
tuburol'a.qucquantomaio:e8tantomdio:cf 
fic cp ipa radtjc reccnset etficcara magnabab5 
df icaa'am.fcdreiC!t9maio:ein babet . pcbet 
autcm ctrcafittemautumnicoUigi.sin qtfutf 
o: partcs kinduz cum filo fufpcndi.? partn ad 
folem ponatuni in vmb:ofb loco cdiccctur . 
;babet autcm vir tutc ©iffoluriuam et confum 
ptiuam. 

tDpftarionfe. 

^*|Sandecta:ca.i;iui.adcmo:roida6tnf!ata8 
z nd rluctee&dccferi^ajparentesfus afb.gaf" 
puluis ciustvdiUiniafa: fucco et9fi intenMat ( 
tantanqciantinmodicaquanritateecriftcre. 
CSdmcftruapuocanda^matricemundif^ 
candafriferlmagnarcfolueinoleomtifceUi^ 
no vd comunivibuUatin igne cu ricla mide et 
t>ebombaccin 15 inrincta fiat fujpofstomij. . 
,f Lontra tmafmonccjcflcgmare vitrco fuctf 
cu6radici8ci9a1olco coiinipo pomo buUat 
>ct bombijc intincta fuperponarur. 
^£ontraTictiunfplcni8.maiumterreinmul 
( taquantiratcmundatu5^contrituj.perfei; t>i 
' €8 in vino •: oleo mo:ctur:vt vbi maredcatjOi 
iue colatureaddatur eera z parum scetiiz pe 
coquaturad fpifntudinem:p:ecedentf to alrjs 
-moUifiarim&bocefficajc cft fi poftea tnunga 
junvclejcfucco riusvel ejcpuluere.fi fceeft fuc* 
cu8.confi cc cum olco z ccra in modu vngucti 
^tinungeegrumfepe; 

^ £ontra apoltemafa epcaufa fiigida»q non 
poffuntrumpipjefpifiitudinecutiapomuip) 
fumcontcraturiinolcobuUattcalidumBfup, 
ponafurautpcretterio:apurgabirur. 
<f £ontrafiitutercnta teradiceeiusfactafi 
imporaror oe ampltficar.': os a liquod fi inre^ 
rius fuerit attrabu vt mcliuo cum tenacuUs at 



trabipotertripuUifedus cariieinfugftiia cotf 
rodit . £6tra polijpu puluis ei9 fug afggatur 
fugftucUuinquiinnaribusponatur. 
4 jpvaf.Tladipewstuaquabibirajfkgmaz 
tumoH» g ventri! ©eponit.meftrui8 imperat 
fuflpofita z bibita.£t 6: fi fup. radices duemu 
licr piegnans tranfierit abo:fum facit. 
^ piuBturietitofubfemo:apofitaciriu8pa> 
rerefacitXum vino bibita venenis cotraria l 
quamajciebtbetiblepo^ mariny carbaplaf> 
matito adbibita mo:fus vcnenatos faluberri 
me curat CUuo mijcta aut bibita cum paffo aut 
cum mulfa aquata in modu.5.iq.Yctenco8pnr 
gat 2 fblencticoe.i fiin oleo calido coop,tifue^ 
rinrvrfudarepoffmtboiwmeft:quofudo:efr 
uenks colcram rufa m ©eponerc 
f ©uccus dti6 mdU mijctus z narib? immif; 
fuecaputpurgat .Zlunfa t ano fujpofitabu^ 
mo:e8t>epontt.£>ira': vmbilicoimpofita eit 
fup pecrinem vcnrre molUr.Ca tbaplafmatjto 
adbibirammentefpleneaftenuaf:etfucdd9 
j-.q .acccptc cum modico vino bcc pcrifiimeto 

Clti 

^f j5alfenu8.S^ucc9cidamini8 emonoidas 
aperifz.puoeat violeterad egdtioncin ucinio 
ajpofttus.ita aur 7 cu bie q in fcltrara •zfcrofu 
lac iet omee aiia e ©uridee euapo:cr,Opo:fct 
autrvtpurojcffebibenduaquamciuevfcpad 
tre6.5.vd cu m vino ©ulci vd cum mdlicrato r 
£t fubdir.£lt alia fpce ctdaminis cui5radijc e 
tnutili8.fruct5veroeftoEatiuii8fufficicnter.cl 
drcaiai5vinialbiciati8t)ucbu8bibifU6plu 
r ibus ciebo fa nat fplcnee.moucns z vanas et 
venrrgfubducene. 

fButccnaU.q.ca.©e2lrtanita.t,pam'8po^ 
nue.Brtanif a lllud quod t>e ea admiriiftraf g 
radijc ciae que dt incifiua :refolutiua.t cft bo? 
na t>olo:ico iunctura^.: vtriufcp a ncbc.-z facic 
ftcrnutatione.tvebcmefcraperitopilarionej 
et coflrict tone naritim i coUtto:tj.et ccfcrr Itn^ 
gultui.-zcucitfanen.fitdustiecocriovalspW 
cturisvcncnofie.-zfimiUter fjrupueciueloco 
eim ponitur in tuuamenro quod cfficit xcnci 
nieequalcpodustseariflologialonga i fcmi 
neritmmcnraftro. 

^T ^obanee mef.c.tse arta nita.^rr anita epa 
«nie alcuruir:vd patiie $oicvmis.z &b aU|6 pa^ 
ni8 fmniii.i inuajiutur ep eo paru z magnu3 
^agna aiitriidiccfi m modurape rotunde : 
cui9E8cicrtrio:eIt terrca ntgra.intcrio: sntc$ 
alba;£rdai3tur radiccs fup.frondc6 z fioics 
fm fcmit a vtols^ftjbalbidarum ftne clmatip 
ne ftipuie fup:a rsdtcce.^aruu? aiitcbab3 ra 
diccs fubterrancas plurimae m modum aueli 
tincn cicaum. ^a ,i fic . compiejcionie dtft 



Bfflttbw 



fopricipio ferra gradiis. i d*incuM fubrflia 
riiw.caltf4rtuiujdbliniuu:ablicrfitiii.mud^ 
ficariu&iaperititul opiUrioiui.£r eqc rcbue 
fudo im ecuberare fa cim&o.i ejc mapc mun 
ficaoiitoctmmJctrefolucncitofcditarcmciue. 
f £-tt>iicit^erapiou . Bccipcfuccts ci9.j. 
iiq.i oiflbluccum juccaro i coque' rfce, adrcr? 
riam parrcm.er,}pBtcrur inmane.cftenim mc 
iKcia certa ad vCtmda^.fcr tnicit grccue.Sntc 
cu8etU8njmmelUcr.iro aur fecaniabin.crp^ 
pac^c ciuolibct parrcs cquaUe cocrez fumprc 
rm fupcrioKmt>ccocrionefunr medicm epQ 
ta ad Ycrcriciam cftrin5.*t>ontr c\s mcftn code 
capiruio tntae Dcfcripriouee vnguenri t>earra 
nita.quastbtrequirc. 

f 3dem jtebauee mef. £> ouittoeeducitflc* 
gma mufcilagtnofujfumpru i fujpofiriirr eri 
amUmruTupJeinur.£rc6ferrcolicefiegmattf 
ccrciqucfirccrerenrtdefccis.i ccjcrete mudi 
ficantib caput t oculos/z ,fp:iepurgat caput 
purgtocpcofacro.sabfcindircmigrancafrigi 
darn ; fodam,? coferr rremori.? paralifi. 
f £r t>icirur q> II ftifpcdaf in collo mulieris ra 
dic ciue tpa w co nctpir .tUnif ec eo anus i co 
fert egrduricius. 




CaptruIura.rrrjEHEuuj, 



Dtoflia laticara/^imifcr grtfcpeYere: 
bon vcl peiuabocam. vd peniia vcl glt 
kifidc.£?era.U.ag.c.pconia.auc.£>\a 
fco.^eoniacft arbor.-r cfc ©ucfuntfpce.fcfc 
mafculus i femta,£r mafculi funt folia fimilia. 
foliio nucis.et radic ct'9 e grofla finit ©igirv^c 
loga lcgttudie pa lmi.colo: ei9 c alto . ^cmine 
ipao folta funt fimitia foln^fmvrmon.ctfupcr 
fiimmitare6ramo?ci i )fi'itficurcamcn}lc.crap 
parer in eio gna rubea ficur fanguio parua W* 
milia grania granari..£t uircr tlla grana ftit fe 
mina nigra fcu purpurea. er radri iHtuo e ra* 
mofa zradicesoPfunr fitcs glandibj.vq .vd 
tit).uTc8radkito aftbdiilo?.3de aucto. £af. 
©ubftatia riue e (ubriUs.-z iapo? cr) c ftipric? 
paucallipricitare cn twlcedincct qn tuu ma£ 
ftkaf fljparcricaacuirae-zinordicatio i smA 
litudo pauca vtrt9 eius cft quc calefacir caU ) 
ditate pauca.er ©dicear oeficcarione fo:f i. 
f auiccn.li.u.c.t>epeoiiia.-jSconia alia cma 
fcuhm altafcmina^afculus quide radices 
bj albas groflas vt cigiru .ftipttrii babco gu> 
ilum.crfcmtab?radice6t'n pluriinasgres t>tf 
uifaeer ramoe.eft ca.er fic .vcbcmctcrOn i?a 
lunr ejcicca rio cr flipncirae cft refolmice et ag 
tione-zfubtiliariciecrincifioncerabftcilione. 
j£r qn maflicaf vna be:a ajparcr poft ea acui 
tuae adftipriciraret>eclinae.f 3 fido:v.-|b co 
niaticif a pcone mcdico a c\ inueta gbtbctur, 
J?acqtrideglikifidevoC3r.co cr "oulcte fapo^ 
risfir.velpenrerobina amimero grano¥-ycl 
vr alq *oaailo8 a (imilitiidine ^igiro? . naft it 
' atitininfulie.f £.}. babario.-jbeonia infuiitf 
' mirarcbjmaligranari magnitudine q nocru ui 
cerqfi luccrna.crb5§nucoaiItmtlc5.nocru k 
paftorib? iucnif.ree eitfaUibcrrima. 

0prrarionf0 

■ C i^la.*0>comacaicftcrfic.i.u.gr3.t5cc ?rr.t 
cpdcnriab5^mrcocculrIcolIoparict5fufp«ia 
vr rcftaf 3al'.oe c\dl puero.c9 collo x>u fufpcy 
fa crar no paricbaf .ca vcro fublara mo:bo af# 
fltgcbaf.S5Adat>icurRn6t>ecihbcrve^dTe 
ftdt>cquadilpccictw.3didcmvaletptjluia 
ciustJatueinfnccopiganiXotra paralifis t>a 
tur fuccu8riU8 rii vin o^ecoctioniff caftora. 
Xotraftraguiria ert>ifTutTiam t>arur vinum 
tKcoerionisduspulueris. 
f Conltainub» graduu5.*|Scjoma eftin.tq. 
gra .ca.ct fic.0uidam babcr ponricitarie.t 4 
dam oulccdinie^a maflicara feivrirur to« 
amarirudomodicacum aUquanro acuminci 
Undep:ouocar menlirua cummtUebibtra. 
j£paris cr fplcnie opilarionem cum acujuinc 
apcrft Vcntrem.caiiiparcum fua poiittrirare. 



a 



«- 



Wmmm 



t> 



2> 



^deocBcusvino bibit fcvarriainintcftinia cn 
rat.epilmttxosquocBiuuat : ■< 

$ Suicrfceonia e ca.t ftc.vebemeter.3n »pa 
funt epficcario i fhpticitas cu refolutoe z aper 
tionc ac fubtiliationc z incifione 7 abfterfione 
ct qtl mafticaf ajparet poft ea acuitae ad fttf 
pricitatct»eclina6.Sbftcrgitveftigia nigrai 
cute.c5fert podagre.cofert epileticata o/eria$ 
fufpefa.£t vt ind,r 3ude9 c^da : fuffumigario 
facta ca efi femie cofert tjcmoniarie? epilcri? 
cie:et fanat cos.£go aut t>ico cp bcc e fo:ffti 
fpccica peonie romane.flailla q cc 3ndia fer 
turadnosnobabeterTectuinBcaptb.. • 
^j£tbibunft>efcmineilli9^.granacuvino 
aut mellicratevz coferutincubo valde/FJatura 
rerinet ©ecocta aijTvrupis ponricie.,pbibrtcfc 
mareriae cffufae ad flomacbu.et moalieario 
nem ipiue/Radijc a'9 pfat Yeteriac/r apjt opi 
larionccparie.-jbot^vuna.puocat.-zei^Dc 
cocrio cu5 vino venrre ftringir z .puoear . £>c 
radiceiptfqsrirao auellanepfett ©olo:i renuj 
, flcveficc.0ranaa9alvinoc6ferur pfocattoi 
matricie/z abfcindunr flujcum fanguinto. 
■4JI DYaf/fbconia gidco t>actiticti5 vocat iz r a$ 
dicca9peonia.baltaeb5ciiriimul't6ga8t)ua 
'buspalmio.? cmafcul? sfemia .*z£>afcul5b5 
fouaiunaregalifilia.fania $0 foua viuifazi 
fummo emitrit ejc fe virgao qfi cucurbita? ca^ 
riola8.folliculo6 b5 velutamigdala.in quito e 
fcmefciuiftrj 1 minutttfac rufu^ malogranato 
fimile.f^inmcdio funtquiqjvelfejt grana ni* 
gia 2 fubpurpurea.radip mafculigrofiitudine 
b5t>igiut>u.otopalmi8.l6ga z guftuftiptica . 
^eia^oradiccbjficutbslan^ infcjcivcli vit?. 
partcs oiuifa^ affodillo fimilc.* illa & pionia 
©e qua in fequcnti captb t»icef . 
f Daf bec mulierito vt facile purgari poflint i 
modii amigdale.cum vino bibitasokceitra* 
neo£ copefctt.tctcriae acnefreticifi vcficefco 
lo:ibus in vino elijca z btbita majcic fubuenir, 
veutrcmabftinenftomacbocp comefta fani? 
tatemp:cber. 4 

fiotomaric^otoJetoluVr: abinfantitoco 
meiiainiriucalcijto?epcUidit.nig?fcmeacc^ 
ptu I6gi9 arcet pflura fomnio? z offocatonee 
<g *Radi)c mcftrua mulru mouer.£u amigdalo 
^oimulfapotataeparpurgat.rene8plttpat. 
% £c q: ftiptica i coftringit vcfris reuma cu* 
vinoauftero cocta 2 porara0ntegra ^ober* 
bafoztiter t>cl"iccatiua e.ita vt radita^fpenfa 
pueros epilenticos fanat.£ft ern>tue fepto '/ 
m cri8buiueberbet)efic.tca.n6manifcfte. 




D3onta,Stoa.auc.pYaf . *f>eom'a.i*. 
pionia/z e arbo:. z a'9t>ucfut fpe&fcj 
t mafcul9?femia. £t mafculifur folia 
I ilta foltj e wcl.z radijc a'9 e gfofla ficut ©igitf: 
z loga "ogirudicpalmi.colo: ei9 e alto .femiie 
^ofoitafur filta foltjefmirnio.t fug fumitatef 
ramo^e^ficcamcrule.tappentineiegnaraf 
beaficfaguie gua fitia gniegnari.xintailla 
gna ffit femia nigra feu purpurea.-z radip ipi9 
cftramofa.-jradice8ei i ;fimtfite8glandito ' 

©ptraticmre 

^[0af.vi.fim.far.ca.t)e T>ionia.ghMide. fiue 



cfi qda tulcedic ampU9 autmafticatalogo 
recajparet fn ea aatmecupauca amarirudie 
ctcu acredinevipterea igitur meitrua mouet z 
v:inaqnbibif in cptitate vni9amigdale cum, 
mclUcrarotercreopo:tef:p,tractare.7itacm/' 
plafirarapurgatopilatumSeparirenceTjbec 
quide inquiru acris z amara facere nara e.t'n 
quatu vao alicjd ftiptiatat^ b5.ifquide c\ f m 
ventrcfiup9 babetee fm veritatejfiftereapta 
cft cum vino ftfptico potata . a virruoeiue cfl 
multum tseficcatiua.cf^iprer boc fperamne cp 



CapimlmnVfffjE^ Sfi^&ST*'""**"' 



*Bf2}frbt0 



f£tcgoq^v'aipuf£otfomcTttoncqciotf 
cupasu ec4 P°tari cepit radiee.vt attjeridit 4* 
qiio mo a collo qn erat ajpUcacii fiatitn fucrit 
epilcricar9.2Uia ire#fau»b:fter febabebar. 
f aifu k fuit mibi vt itqi aufcrrer el ca qcperi 
cnrie z ita facierito qtf itqz fuit occupat9.r6na:> 
bilc eg vt aut aliq ptes radic*, affiucres. ©ein^ 
dcattraercp anbelftu5fanarct.ua patfctt aut 
toca aatipo aeremutatotalterato a radice.fic 
cm YrinSltquo: pfert gutturi flegmone parierf 
f j£t torcefacru rnalacbiu.t. nigclla manifef te 
catarros z coii&s ©eficca t :fi 0,8 ligas illud i 
pano raro atrrabit frequeter p nares calidtca 
tcq cpeo.f £t fitr fiacapiaf ftlQ lane:i pcipue 
flU9 lanc q rcperif f pcfetlqs marinis.f.purpure 
fe 7 tigaf tictura„q & gna.t>einue iuotuaf ifitf 
ftlujieollovipcre.tftrigaftJonecftrsgulcfvi 
pera eumco.t>eindcfilu inuoluaf arca collum 
babetis fquinaria.aut illtfctdcucg apa i gutrti 
re a ut i colld vidcb cjc 15 magnii tnirabile ilirSfi 
li.S5Bqdefonefemoriu8alibitracrabimu8 
f -p>fone$o ppletioncfciedii c fubtiliii etium 
et ficcariuu3.n0 tn infignircr calida:fed vcl cot 
mcnfuratamvclpaulo quodammodo 
f &uice.t>e virito co:dis t>t'cit cr pfo:tat eo:. 
•jWuseapit .t>e*fbionfa :tiarcr eft calidez 
(iccecoplqcipnts in fecundo gradu. 







' 



(CapttuIum.fff0. 

Jgtrofilinu.3(i.in li.ctbv.i:i. Iktrcfilft 
num <5: co cr a ptofit fit'i8.et nafcif i pe 
triemotibufcppmpris.qn nos tricerc 
poiTumuspetrapiu.Silenon tmgrece flpiu? 
©iaWjdtfumuac^babilcmaccdonicHgtsilti 
fuauerrodo:earomatfa>.f l^la.-jbetrofili^ 
nu e i.itj.g.ca.i fic.jEft at ©uplcp.Comcfticu ct 
agrcfteXui^fcwematiccopetitvfuimcdicie 

^pfrarioim 

f ^liniue li.-jcjc.-tScr rofilinu ajpdlar quodda 

genus apn in farisnarum ad vomiras coclca 

ribusbiniscumfuccomartjbq adtiatujet aq 

ca .tribtts ciaris p:eetpue. 

f IDYaf.l^crrofilinuinmaccdonia nafciftm 

pi8velinfpdua'8.femcnriti8eftminufU5ane 

fo ftmf le,odo:arit z vifriduet aromaricij: uir* 

tU8et'llit>iufcfica.*^eftrui8imperat.v:t'nam 

abundanrcr,puocat.ma)ciecuvinot)ati1ifia; 

tiones liomatbi ct collt ccpefhr fceftccado 1$ 

mi8Ctcalefacicdo:to:rionib3ci5fubuaiir.t>tu 

reticis ctiam mifcerur antidoris. 

f jCoftat in ti.gduu .t>ctrofitinii t fomf a prj 

gotf.qricalidue-zfica^ infineterrii gradus 

f Uri 0ali. ^etroftltnij tnqt eatfca pla fmat a 

pultulis autmo:fee velfcabiciea mire mtldat 

f <o eme ei9 vrina 1 ; meftrua puocat . vcntoli 

tatct inflarionct^iiroluit.valcrbYdfopicis ec 

periodicis ftb:ito.t)olo:e renu 1 vefir e ampu^ 

tat:epar miidificat.opilarione apcrif .mspk fi 

fueritinrcnib::vtntofiratccohc£psl!ionis?>jf 

foluit.OuUicfuppotitii meflrua.puocaf rz fcal 

dinam et mo:tuu fertl ejtpdlir. 

<(f yfaactber roftlinu5 ca.e et ficin finc iti ,gra. 

*3dcocptittrericu5 cincides v:ina •znieiinta 

ptocans.ac vent olttate tnfibluem? ct infiat io 

ncXatbaplafmatu^fugpuftulasfcabicmac 

mo:feammiro modo raundificat.vnde ftr by 

dropici8iuuariuu5.et£iodJC9mfeb:e5pafi£nrt 

bus.*Renum tolo:e ac vcficcplacat.quia coz 

po:is po:os aperit. viafqj ratificat 1 bumo^s 

cctenuando cum foule % v:f na proii cit 

f £par t vulncra mundificatu opita tfoes co 

rfli apcrit.fecftdinatfefu mowuii etpcllir.0juo 

ctia pomi t>ato mundificatgroiTos bumofcs 

f -j^lateari^Xotra eafdecaufaser codc mo 

valetc] *seuccdanu.etc6petc8 fitt>e tsomelii^ 

co falfametum.2Derbaq5ipa ibtdcpofitacige 

ftionec6fo:tat:vcntofirareejccludir. 

f Bartbolome9i li.tieiprictariborcy.^etro 

fiUpu e berba o:refi8 odoiata. fic tii eo q> i pe 

tris? locf petrof fepe o:iaf £i9 fpcs fum plbs 

f? optimft i macedonium ftwueguftu ctOdo:e. 



& 



& 







Emmm 



*3 1 cm vt fcicitjf li.aromaficum e.vfae ci9 c5f 
uenirefui ? etia medicini8,£ft cmbet ba caltf 
tla -r fieea 7 mulru ©iuretica. agitsua .t>iuifiua< 
vctcofumpriua.tajpetit^etcitariua.tidcolapi 
de frangit.meltrua educit .bYdropicis fubue* 
nit.opilari6e8fplcni8erepat$ aperir.x admul 
tasaUaspanlioefvj.vt^icut^lMijPit 8 ^*!^* 
f •jbcindcc.ca.ccccclicictvi^errofilinujqd^ 
dam eft oomefticu.c]ddafttueflrc:q^ vocatur 
tnacedomcuDeci inferi9t)icef ©e £o .£?3t>o 
indhcuomito enotu.cui9 virtus e tnuretica « 
<S> atis meitruis imperatO nftatioes ftoma r t 
cbitollitXalefaciendo etftccldo tomotubus 
fubucntt.Etejceofitcopetes falfametu vndc 
Sigeftione cofo:tat:t vcrofirarem cteludit.£t 
valet adomnia ad quc valet filueftre . 
f j5alie,viq4"im,farma.ca.pctrofilinu.*jSetro 
filini femen eft mapie vt ilcertrabif ab berba ,z 
fiCrradicib3fimili8,t>ebilio:i8^ovirmti8.£ft 
aut ficut in guftu acre cu amaritudine. ita et in 
operationito.fimiletameninedendo.wterea 
menftrua.puocat copiofe 
f £ltautet venrofiraru t>eftracriuu.eritaute 
ipmtcrtq sduacalefactenriuetficcanriii. 



ȣ8Coaifn9latie.0rccecKnopodi{j:V(l 
clinopodium.Dyaf.ea.t>eclinopcdK> 
5rutcjcefarmenrofa nuafcopalmisaf 
cende0t>etcrra.nafcifloct8fa]cofi8.foliab5(i 
nulia berpillo.zflo;ep:aflio fimilanre.talio 
noic vocaf pcs co:uin9.jSaf.vrj.fim.far.ca.cl( 
nopodiu. calidee^tutfnodu caullice.Eft aut 
ctfimpliciu parriu ftu fubftanria7J5>onet vcic^ 
quis.iq^in calefacicdo et ficcando. 



f t>vafcori.:berba ipa bibita et cocta mo:$ * 

bus venenaris occurrit; 

f pe alto caderibo opitularur.ftranguirq'8^ fi 

ftaterreaum.mcltrui8imperat.abo:fumfadc 

potuiT>ata:acroco:dina8 mulriefcieto tolltf« 

vrineo#iculraritardt'flimitempo:i8mcdetur * 

5lo6etu8lccripedi limilaf.vndetnomen fum 

pfit. 

f SuiceJi.tjvca.t>epcdcco:trinoX6fcrtfoIii £, 

rioni anriquc.? cofcrt eolice/z efficit opcratw* 

nem bcrmodactilo^ abfcpnocumento. 

f •jbaulus ca.x>epedeco:uino.^>ederur »0 p 

k>:emiuncmrarii:cofo:fandomeb;umxtma^ 

rcrianmfoUicndo* 




CapimImn.ff(0K 



Capitulum.ffffli}: 






Bti)nbiQ 



D£s colitbinus.vcl pes cplubi.eft: tripli 
asgcneris.Sftvntigenusqtfvocatur 
amomu latine et greccfed arabice ba) 
mcntc.T eft aliud gen9 bns folia rotiida parua 
•oinifa magnis z ptiisincifurisftipites fubti r > 
lestteeues.colorisfubriibekbabetesnodos 
raros.in qto funt fcuplicia folia z femina tria 
vetquattuo:vel quicp piucta.inmedioeilcut 
acus £ft aliud $cn9 qt> vocaf anagiros.De c\ 
*it j5alie.vi.lim.far.e.anagiro8.3 nagtr 1 ) fntf 
tec eft fetidus et acr is ty&foicticez ealefactiue 
vjirtutis eft.attamc viridia folia^rer bumidtf 
tari8admiictionemt'n9acriast>cp:driua?>Ya 
fozantiu funt.ficca vero incidnc et ficcat iue vef 
bem&ervirturis.fiVisaiit quodamodo naru? 
reeftet co:tepipfi9 radicis.fetne" vero niagte c 
fubrinum Efium.f^ etia eft vomitiuu. 

Bpmtionm 

f j5alienu8»j£Upatura femini8eius aceepta 
ftcgmafceporit.Qicifabo vno aijmulfa acce 
pto flegmat>eponit.£>jcifabo vno cumtslfaac 
cepto colcrat flcgma t>eponit.qn fumunf cuj 
aceto in potuattenuant fplenem. 
^f £* qn fuffumigantur cum eis mulicres ba* 
bentes fuffocanonem matricis cofert ct'8 
«fl ^tillefumusejccluditfecundina.-z quandc» 
fumtgacepilenrfcu^epdtateum. 




Capitulum t fffflut* 

D£licinus l"m tDraf.bcrba cq nafcif i 
triticea fegete to:deacea ctl lamtnie (i 
uefibris feminepleris amara fiattts 
baccis fitito/Rafcif cii plurimis z tenuibue ra 
mi8.folia bjpufilla.-z granula in folliailis trf r f 
na fubuifa? amara valdcqucnoftro vcjeoma 
te vocatur luparia vel faba lupi. 

©prrationfa 

^ £>idf pceptu nccarei meftrua.puocarcbec 
berto noiaf abBlejcadro.f £aUri.fmi.far.c; 
vdiafmu pelidn9vel Ydiafmu.but9 frurids k 
merubicundi colo:t8 eft.ama^ aut z fubacer* 
bii a$parer,vndee£purgat opilatioiicsi vtfce? 
rito.jdememfariuntramitoriusfrutids. 




V 



Capitttlunt.tcfjElif. 



£ploBfeupepliim:fm qfdae ccjuocu** 
ad illud muUe£.-z ad manutcrgiu.? ad 
qddagenuocardtii.incuiue fumitate 
nafctitur qfi folia fubriufitma,cj cft qlibet spuli" 
fuventi volant per aera:fedfalfo. qmpeploa 
fm £>ytf.in$p:io capitulo.Eftfrutetplena la 
crimo albo.folta minuta babes ficut rutatfed 
lario:a .Oe^ omnis frutep ob:o wnda cfl et in 
terra fpanfa.fub citefolqsfemeeftminus ro* 
tudus ibimti miconio albo. na multum femen 
ic 9 



Ctactatus 



-*& 



tintrmtesA a parrearearu eoUigitVzi vmb:a 
ficcaf.itavtaffiduemoueaf.C0ar.tnU.tuna 
midtiy. ait.cpeftcTula.-rl5 vidcf ■oicerein lib. 
vij.ftm.far.-Ha t>iaf£eplu8.0ufda aittmi* 
con.i.papaucr fpinofumt»icunt .ctbicfrucn; 
cutue opiii b? fife ririmallo.-z f n atne purgado 
fitHUV£:o 4lc6ecaplm.clicicviq.t>cfc 

0prrattonr0* 

f 0Yaf.i£Utarorafemin{6eiu8aceepta h"e& 
maseponit.£icifabo vno cujmulfa acccpro 
colcrametftegma ©eponic 

. ^£tiuflclli8mifcetur:ctvcnfrcmfoluit.Blt| 

■ tnfolecomponunt. 




Capitulum.ccfjElu. 

ȣntapbflon.3(ido:9ub:o. jc.ct bvmo* 
^cntapbilon a numcro foltomm isV/ 
cta .vnde ct a lattnie quin cp folium eft 
vocaca.bcrba vidclicct adco munda vtolim 
purificationiet tempueadbiberia genrilibus 
cfletfolita.f 'jbliniu9libw.]qcv.0uino3foli^ 
umnuUieftignotu.cumenamfraga gignen* 
do ccwedaur.&ancgrccivocanrcamejetco: 
fuiepcnraperon:fiuepentapbilon.rubeamba 
berradfcemcucftbdif.23ecmarccfecnenigre 
fctt et angulofa fit/Bom^ a numcro.folioj.b5. 



ctfpfa bcrbamcipfttt»cfi'nff cuvife.aauctf$ 
ferpenteemedicaf. f t>Yaf.c.-ftentbapbllon 
ant petaptee aut petafco. bj baftas fcmieple? 
nasct logas t>uab? palmisjin qb? feme e.folia 
bj mcte fimiliarz in qutq? ptito t>iuifa.fmgula 
folia in fingulisbafiie flo:e viridem bnt/Haft 
citur inlocie bumidieet in vtje/Radfjc edru* 
fasobtonga.f -jMi.^emapbilonquinq5fo7 
lium a numcro folio? tnaa . vndc z eam latini 
quincfc f olium a numero foUo? vocant» 

j&perationra 

f^andec.ea.cccce.EUicafuraei^ticcocfaaci' 

tcrtia$oolo:eocnriumitigat o:c retcnta ; q(i 

gargarifmo adbtbit a.pufrcdinem o:ie tollic • 

afp^dincmartcria? tiflmir.vencre^ftringft: 

wflintcririe neccfle adbibcrur.aHeria'8 % fcf a 

ricieptfftarerTectum. 

f £li]car ura cum aceto fli cafaplafmarito ad 

bibitajberpetaecuratXcrofasfpargit.ourci^ 

esz rumouie mededo foluir.igne lac^ctriguit 

apoftemata cr panariaa impofita ad fanitate 

gducit .condilomata foluit.fcabicm rollir. 

f Succueradici8ci9acccpt9caecparfca6Z 

puunonis coponit.poribnffco vencnatis occur 

rir.^blia ei9 cu vdromeUe a ut vir/o bibita ad # ; 

difopipere.quartanarqs rcmcdiucft.fi rame 

quatruo: fouabibcrinr .tcrtianarq #0 tria cuj 

aqua fola.efTimerans vero vnum. 

f £pileticie $0 accepta 1 rrigita Sieto pftae 

cfrccru.S» ucc9^ofolto?ei9 vcrerfcis majde 

pfidium e ciatis rrito acceprie.Tjutnerito cr ftf 

ftuUs pftat famtate.f nrer oceltfcte remedium 

ebibita.et catbaplafmatito .pfluente.abftinet 

fanguinc.ZxpUe bonori additur.ttsomib? 

pofita ejcpiamenru eft. *Radijc ei9 caUda e non 

abundater 2 nimis acris.? idco vriUflima e ad 

ventris flupm :et fccnrium t>oIo:cm. 

f j5alten9.vin.(im,far.ca.t>epentapbilo.*^c 

tapbilon bcrberadip ficcat quidefoairer t nfl 

tniumveroeacrfe^pferqdinmulriecftncttt 

ctomfa a lia quecuqjfubtiliu parrium cri i fic 

cancabfcpmo:cUcatione.£ftaute raditTicca 

tiuacctcrtiofamgradu:mtnfmcverocaU'dita 

temanifeftajjticipat. 

f auicen.U.u.ca.pcritapbflon . •ftetapbflon 

noiafquiq3foliu.etcftfo:ti8 ejtffcationis fine 

acuitatetaduftione?mo:dicatiottc.*fitcicco 

cmplaltrum ad flujrom « fedat ipm. 

f ttfitctco emplaftruetfedatt>ubclcfrfcro 

fulasxcuriciesflcgmaricas.tJecocttoradicis 

ci9 valj ad vlcera seambulatia.s qtf t>cco co^ 

ctuecuaccto pfert berifipflie-zpgnaricus et 

fcabiri.-: pfert tsolorito iucfura^ fciarice.tco 

fcrtramicibtbit9^mo;ecmplaUrifufipofit5i 



•-6 



fet$)tth\0 



f £t folia eius cum vino valent ad epilentiaj 
accepta rbibitafcccefcieb? .Sjuccub radicis 
riuevalet adt>olo:em epatie er pulmonis ec 
Yctericiam:cumbfoiMrperaliquo8t>ie8. 
f *Radic ei9 cofert cofolidatidi % vleerifco fnte 
ftino?-2emozr6idib>.tfitrioecoctioef9radict 
f;fol& ei9cuvino pferutqrtane ?e]ridiane. 
fuccus radicis eius eft medicina perniriofa 
f -f>U.U.]C]CT.c.1i>entapbilon.3paberba inci 
pit z ©efinic cu vi te.aduerfu8 ferpetee bibitur 
ct ei9radijeqfpargamonvocaf Cjcalbo vino. 
f 3dcm li.]cicvi.0uincBfoltj fuccusiecorisec 
pulmom8virij8fanguinecpreiicietito:etcuicu 
qjfanguievicio occum't.&uinq$foliu?medef 
pectoaavictjs.velriq^grauiffimuefttuffi 




CapituMtn.tffW. 

ȣucedanu grccerarabtceberbatufum 
velberbatutie.lattnccauda po:cina 
S>era.u'.ag.:toeifcaroti6aucfO.£>Yafi 
JBftplantabnsfoliaftmilia platecapfte.etbj 
velut capillos adberetes ,fl>e radicci z fiipites 
fimiles plate maratrw bjfloiecitrinu /Radif 
cuis ewfoiie nigra .t>eint9alba.graui8odo 
tie;groffa plena bumidiratemafcif iri montito 
vmb:ofi8loci8.etobumbtatitoarbon'b3.*Ra^ 
dipc\de€t"9feindtf cuaitrcUo t>Qc(trecce? cp 



trabtf bumiditae qe in ea x ponif in vmbza^i 
^tus ei9 t>cbiliraf a fole.t qn eolUgif bumidtf 
ras accidtt cte c\ ca colligitt foda i obfcuritas 
vifu6.nifi ponaf in naribo fuisoleu rofa^ -z fun 
datejceo fug caput fuum.qn $o ejctracta fucrit 
bumiditasaradiceillapoftea ndrenianet in 
co aUqtf wuametu.ectrabif bumiditas ett'a3a 
ftt'pitcci9:ficute.ctrabt'ffucc9radicImadrago^ 
re.f5virt9et'9 e ©ebiUo: ^tute bttmiditat^ q ejc? 
trabifaradice.'Ba^tu8ei9velociterrcfoliuf 
*Reperif at gumofitaeadberce radici filteoli 
bano.j£ t mclioz ec ifto fucco b9 plate eft illc c\ 
fceferf a. terra q dicitur fardinia.et ejc terra qua 
Wcitur farmabacbi £teft grauieojdone.? in 
coloze fuo eJt rubedo .? mozdicat lingua quaV 
doguftaf.£tmeUo:radi;;enoua no corzofa 
©ura puri odo:ie.f JaaF.vitj .fim.far.ci5 fbcu? 
cedano.fmtranflatione^rabica:^Ummuqt$ 
adminiftraf ejcbacplanta eftradic4prie ,t iaj 
admifiraflacb^mue-zfuccueei^. ct olmvir 
tus e vna :nifi q: lac bzvmus eft fomorie virtu 
ti8.et virtusei9cq calcfacitcalefactioiic fo:ti 
vnckrefoluitfubttliatetincidit 

BpmtmtB 

f ^cra.auc.Dvaf.Xacb:imu8ciu8 mimis 
olso rofa^? acero capiri fomcto adbibt>;:ltf 
targicis z frencricis medctur.ftomatici8 et epi 
lenricie plurimum p:6deft. 
f Oolo^ capitis mifig.it.fciarict8 ct ?tract$ 
i paralittcie majrimum pzefidiuj e.oce neruo '/ 
ru caufas cu olco t aceto pcrunctus ccponct, 
f Onmatriciefumigio ajplicacvofTocatio!? 
nes ftcrieae foluir .fomnu ptimis c oo:micrito,p 
bibct.fumigatidefuafcoim ferperee esrlucif. 
fOlcorofa?admi]Ct9:^olo:catiriiffoUtr.3n 
icctti fo:amt nioctte t>olo:eno admimr. 
f XLuffictibD opitulaf.Ouo foMiaddi£9t ac 
cept^t*ifnoic^to:ticitopitatcrfccti!.vciHr(.? 
lcntt.fplcne atteuuat,©olo:c llomacbi ppektt 
f t>olo:e vcticcz rentl bibif 9 .pbibcr. matrtct 
falutari8e.p:eftado euftomatica .•Radijceiv ct 
eli?:atura omia fimtliter iHie facerc poteft $ o 
mento adbibitavulneracurat. 
f *Radic eius ficca 4 impoltta id facit.offa fra 
etacjccludit.aulneriix» antic]8 cicatricee t>u^ 
cit.cerotisneceffemifccf^imiliterctmalagi 
naribue termanricis. 

f "Rad^eligeda cft odo*efuaut6 fo:t ie et no 
vetue. XacbWe cittc confect ionib? mifceri 
pt :mapiefiamigdaf amar^rute: ancto-r pani 
caUdo triticco admijct9 fuerit.t fic t>ari pr.3te 
radijcciuevulnera antiqpurgatet incarnat.z 
tncenfa viperaeet fcrpeteefiigar. 
f J5alien9.*l!>eucedanu cdfcrt cgritudintbus 
^ iq 



% 



ti 



Emt&tm 



&> 



& 



Wiid^.etcgrfnj3ihjqflfd(Juntp«ro!ftpuU 
moni ab bumorito groflie Trtfcofie q fumtf i 
poru ca xino.x ficramigui atm co.et attrabic 
odo:ando cgcr fumuciuettfacitidcm. 
f £ t qnciceo pomT foeotfofiOmtofccnriufc* 
datt>olojeco?R9tim.qmfubft'liiipariU€.':cu 
rafoolozefplcnisincidcdoetfubnliadofirofiJ 
foebunKttee.ttadicietocalcfactto Imino: 
ctt>eficcariocraseftfo:rie.3pfan9^calcfa* 
rirtnprincipiorcrctj gradue.£rvirrueciuee 
qne abftcrgit z incarnar.ctpotcft adminifira 
ri iomnibusfupradicrts 
4 £tqn pont&|G co fugo8c9 co«iccj volu? 
mu8C)cpcllcre:eiqKllitcum dtoct incamat ip* 
famcouemtmultuvlcerito frauduletis malis 
qnocficca^tcfiturzpulucrtfatur fugea.co cj> 
mundificat z rcplct carne z eofofidar . 
f i>la.T>eucedann efr berba ea.? fic.alto nolc 
fcniculue poicinae ajpcUara.:£jiiU8 radic itt 
mcdidnaponit)cbct:quiap:inripaIiter fm ra 
dice fccudario f m bcrba effecru b5.*Radic col* 
lecta eaniiu^eleriagwiosferuaf . fsmeliuee 
vt annie fingulisrcnouef ,bj $t ureaiurctica5 
f £6tra ftranguiria ? oiflurria z opilatione^ 
fplcnis-reparisoaturvinii vel aqtecocticis 
au8.^crbactuipfaoecoctainvino rei olco 
et pecrini eatbaplafmata:foraentu ©ecocriete 
riuemenftrua^uocar, 




Capttulum.fftfluit. 1 

ȣrficup.3fido.f n lib:o ct bTmoIogia$ 
•fberficum sicirur co q> riue arboum 
p:imtifin egrpto fcroit*£erfefe.a quo 
fe o:iundue fcrtbant ptbolomri. 2?ec in •pert 
fida fmcniumgcneratforerfeero:ium. 3pucl 
noe aurcm fuaucm ri iocundum.£ft aurcm ar 
bo: faninim gmcris pctficue.^Serficum mte 
ncutrigcncrie.3tacBfierficu8 arbo: ecutb:c 
uieadmoduvitacocciia cft.Zjium gcncrum 
cflefcrrur.Duracenus cteriamarmcniac? ac 
•£erficwe.£araccnueeftnuncuparue:co q>i 
guftu accncm rcfcrarpomum riue. Brmcnia* 
cue:co cy p:imu adiecfum fitab Srmcnta ge* 
nue riue.-fcerficue quid fir iam tierum i fup:ai 
f •f>liniue ltb^>.rit}.£grpfuepcrficamarbo 
rcm fuigencrie baber.^iro fimikm folia rcttf 
ncnrem.t?niu6fcrtilira8cft affidua fubnafee* 
te craltino frucmmamritae etbcfiarum afrla? 
tu.f>omum longtue p:o inclufumamigdale 
puramincrcorio.colo:ebcrbido.fcdrbi nuc i| 
lijbuic pomii oifferee brcuitafe ac mollicte.jt t 
ctjtiieblandiamrpurdulciefuautraend tame 
mnocuum.^areriesvcrobonitatcfirmitudi 
nemigriciaqqocpntbaoirTcrenea forbo. 
C 3 dvin Ubw.)cv.T>erficc arbo:ee fcro z cu 
©ifttculfatctranftcrutadloca rcmota apcrftde 
vtqueinrbodonibilfcrant.quodp:imu5a(> 
^gtpro carumraitbofpitium. 
4f 1bandccta.cap.]C)cv.akanedi vel alfabota 
&rabiceperficu3.£rcce vcl milca perfica.Xa 
rinercroperficu.f DYafca.t>c£crficie.-£cr 
fiea eufromat ica fiint .f SJcrapion luaggrc* 
-ca.afeanedi.3nfapoKarborie perfici etra* 
inmumctfolioaimcftamarirudo crabfkrgit 
«r rcfblutr.f 3rricenna libu> fccundo eapirttf 
fct>cperfirie.^crficefuntfrigidcinfincfccun 
4i gra due.bumidc in primo .infineramcn ri? 

Bpmtiome 

f OT fl r.T>crfica moluutverttremarimefi m« 
tura rucrinr.3mmamra vcro abftihct vemrc 
matimc fi ficcata fuerinr. 
% >£lt)C8mraeo^rcumafTomflcbf ctr&riec» 
pefcir .^olia eitie coftrictiue funt virrurfe: quc 
ficcataafq?lociepaticnritoafpcrfafluo^faJt 
^iniecobibet.^bicroccr^idcftmino^ pcr^ 
ricaeuftomatica funt.ctfaftidium follunt melf 
ue cp fup:adicr a.vt in fcquenti capirufo. 
^^crapion.3nfoltJ67rami8-^crfiacft^ 
marimdoXridco quando rcrunrocciduntlg 
b:ico6.ctponunfur fup:a vmbilicum. 



&r2}frt)for 



f ^atura # cfefuntboita fromacbo:?mol 

litwcvencrOnmacura ^oftringuc.TqntK* 

fkd£urftringutfoztt9.^©ccocriopcrfico?qft 

bibicur eofcrc bumidicarii curfui ad ftomacbii 

ccqn^ccacapulucrifanrurfujj locumvn fluic 

fanguieabfcindunccum. 

fl j£t idejauc.3bcmefuaf.On tcriimr fblia 

eiue ecfloe ci9:cc ecpzimif % bibif eppzcffura tt* 

la cikit afcaridee ai flueu.Cc qn fucote folio? 

t&iwiafin aurcoceidic vermecqui func in ca 

j£cqulimf fuEpccnneabfcindit ardoze pftlotf 

cri.£roleu5 nuclco? perficozu confett ©olou 

auriumqnliniturcuco 

€ fitidem anct.^efclxb*.^crfica'rcmouct 

fitim faccam a «liditatcet fctozcm ozie. et co? 

foztantftomacbum. 

$ 6alic.arbo:ipfa perfteoyinpuUulariontf 

bueifronditooominanre.babctamaram q 

litatcm.z.jpcerca eiuefolia lumbzicoe inrerft'; 

ciunccumtcruncur ^vmbilico afponuncur £t 

aliqn ovafozcciai eft farmacu :frucroe f o ciud 

quiefteltbiu'evocamrperfimm.bumidccftct 

frigidc complejcionie, 

f Buiccnn rf>erfica quc bu.funt vdocio funt 

putrefaccionielentficaciua.iinipiedhiiptici 

caealiquatula/jefeieftipcicafunceaqfunti 

cifa ecficcaca.t inipiecft pzobtoirio curfue . et 

infua nacura funt fhprica. 

f £tfoliadueqriecd8fir linimetitu abfcinJ 

dunt ardozem pfilotri.? t>i(ttllaf fuccue fo!io*f 

riueinauremtinterficit vcrmce. 

f £tc6fertolriinuclco?.eo£ cmigranee:tt>c* 

lozito aurie calidie ffrigidie.? pcrfica funt bo 

naftomacbo 

f £cindecftvtrmefadendi3||jerim5 ribt.et 

opouecquidevcnocomedamrpoltatiucibuj 

qisonia cozrupunf pofteu:ct cozripuc ipmiedl 

prccedant ancccibuomnc:? ea queficci func: 

tarde©igeftt'om'efunr:?n6funrbomnutrime' 

ri.cguie func plurimi nutrimenri. 

fccidcmm quarroca.tKquarcanaaic.crva 

lcnc contra quarcana ©ecolcra adufta* 

f 0alie.li.q ."oe cibie.ca.t>c *fccrficieatc. OidC 

cc bancarbozcinaiccandria magiiam/ftar* 

ra nc aut frucmm riue fic pzauu cjciftcre in pct f 

fide:vt perimatcomedctcean £gYptum aiicg 

telawmeftbUcmfieri:c6fimilt'terqjcomcdi:vc 

pira etpoma. £r 4? fm magnitudine c q fiuc 

pomavocarc voluerlfiuemilca fittcpcrfira frti 

cmmiftum.fme fimpliciccr periicaeodcsmc»; 

do modcmie grec$ fiue aiiquid aiiud anriquii 

veliequcrcretnipieltccbictibibocascretmul 

lo Itudio.iam auccm fciae vnliue nomirubuft 

m abo:umfoccus veluccaro fadjecpjrupri* 



bilie e.ercfl im quihbcc ptfoe.quarcno oporfcf 
ficucc]dampolcauudaIimcncu orTcrrecozruiJ 
Punmr cnim fuEnatancia. 
f ^cmmiflcaucopozcccb9qj5cftc6munc I 
omtbquccucpcacbocbima bumidacptlubzi 
ca i farilircr fubirc porefia .tpzoptcr boc co fr 
medereipfa pzioza alnefic em tpa cclcrircr fnb 
cuwtaJueviamfacwnt.vlrima aucaflumpca 
fimulcozmmpucialia vimieco£eftfri.?bu. 
f £fidcli&.vtj.tiefimphcttc>mcduinie,capi, 
t^^erlico.^tliaEfica.tddtpcrficuqucvo^ 
cafaflutrcabonntotampcrficitmfouini^ice 
litobocnmilca 




Captailum.fcfiuitfJ 

DErfica ftitc mejaperiica inue microccf4 
grcee.Srabicc£efme6 vrbefmcevef 
aifonuila.Xarine $o £ojula vd barj 
ocba.-^andecta.ca.cltjc.^dapcrf4ca frucma 
iftecomitonocue. 



fScm.U.ag.c.t^mco.airr^cozjtefHgicIaT **< 

bumidairi.ii}.gradu.'Rampzopo:tionanfpef 

fide.£ttdemaucc.Btcau5i.X(i]canccolcram 

crgetmrtfbumozcegroffos. 

£ ifo 



txumm 



* 



<f cttdcm auc.^afie.0ufdapattebaf rurnc* 
firarce ab aliquo buozcqcntc m ftomacbo fue 
ct t>edi fibi a liq fr> vicito t>e crifomuUe rccef ft 
buG:? fcdat9 c illc fum9.£ t ego no crcdo q> i# 
periaf db? aliqe frigidio: z mag$ iuuariu9 fto? 
macbo catida cp ipa. t idco fafiidtum follunr* 
^Buicc.ti.q ! c.t>c crifomulie.*i£beUo:a funt 
armcna.no emcifo aducnitciecomiprio ? m 
ectofitae.-r cu fumutur crifomula ogret vt acri 
piaf mafticie 7 ani 1 1 : cqliter.5.i.vfcp adij . cum 
vino puro aut vmo tjepaiTieparum etmdlis 
Suntfri.-zbu.in.tj.'z:olcttjnuclco?co?ccari? 
dum .1 ficcuin.rj.£o?bumo: eftfaeiUeputfd 
factionis.-z eo^ mfufio fcdat firim 
<f £tcrifomula qdcfiit puem'etio:a ftomafd» 
q3gfica.tt anncna no eorzupucurt ftomatbo 
neq> accfcut veloctter. £ 1; cie $ q cjcpctlnt co 
runoCumctuc.-vtpmo fumaf aniun matiijccu 
miua aut vino ^epaffis-r ?fia.if cu mclle pui 
oleu3 nucleu ipo£ ctii pfert cmoa-oiVibr.gra* 
uatcrifomulajpterveloaratefuepurrefacrio 
nie.ve£ infufio ftcco?. cofert fcb:ito anriquie » 
f 3obanneemefuein amidotario fuo.Pleu 
t>e crifomulie fedat ©olozcm ani 1 cmowoida» 
rom.etrefowitmmo:eevlce£:impedimcntum 
lingue.z t»olo:em aurium. 
q ttabbi movfeeX efmi fimiue cft fcrule:ba; 
btus femen atbum fimile lenricule. 




Capttulum.fffrife 

D£rficaria.i>Idec.^Scrficana & eo q* 
folia filta p.ficie b5.iut:ta aqui nafcitur 
Puas b?l pce. vna m medio folio ma; 
c ulafufca bj.alta caretmacula.filla adnuiua. 
^ftvatde.quidaptperaque putaucnint. 

€>pfrationf0. 

<tf P vaf.uirrue ei9cq inrngtdat infrigtdat fo 

nevltt^a.^au.jFoUaci9ficcavelfucc5-folio?i 

civvcifcmc^i^clijcu^bibirucumtlUptificie^ 

tuffientito-z afmaticie p:odeft. 

f 3 de fsbiito peftilentialito mire mo uuiat* 




Capttulum.fffl 

DErfoliatafiuc bcrbavmbw'co#.3fra 
berba babet folia fimm'afaliuc:£rfo* 
lia circudant fe ramte. Wdtur inutf 
cis arenofie x fajrofie. 

©Pfrationr0 

f •^uluerccfolio:umcu5vino fumatur curlc 

bcrniam.t5erbafufi vmbilicum pofiracurat 

ciuevlcer^rione* 

^£tpfolidatvulncra caraplafmatifo adbiV 

bita. 

4 3ftaberbavalde curatvmbilicii puerwuj 

cumdogaffu£pofira?cmplaftraf«« >. 






Bti)ttbte 




Capttulum.fttlt. 

*5T\ "Rcmula vms.-fSadccfSzcmula vcr5 
•1 Pfiueartertcaidej.&t eitberba ficutco 
'•7' folida mino::nifiq:foliaquafimgra 
st pinguia aim ftofatlo cetefti 

©pfrafionf0 

L €^def«oh»itoartfaiid^cftca.ctto» 




Cfeptatiumiadit; 

^J^V £po.*£apias. ^eponcs crcfcunf fh II 
•I fmtli'tudtnecnairbitc,fri0idifuntt)i(fia' 
^Vr lc ©igcruntur. 

^prrariones 

f 1^lint9.li.|cip.£ucumerc8 eu magntrudfe cp 

cefferonnpeponcsvocatur^ireolcuoderut 

flec mtn9aqua8 t>iu'gut. ©efecri quoq* ad eas 

modicc ©f ftanrcs arrepunr.aut fiquid obftet 

vcl fi pendcant atruarur. 3dq? vct vna nocre 

©epzebcnderur.Sji vae cum aqua fubqciaror 

aqitarwomgUo^inreroatloantc pofterum 

iptemT>cfcendenrib?.ac fi olcum eodem modo 

lirinbamoscuruatis, 

f 3dem ;3nfiftulaflo:ct>imiflb mira longtf 

tuduiecrefcunt.nouaco:umfo;mauicampa? 

nia malt citonij cn%ie<g. 

f 3dc$ li.]qr.*{bcpone8 majcte in cibo rcfrige? 

rant-zemolliflt aluuXaro eo# cp\ fo:is ocu? 

lo^utt>olo:ttoimpom'f.£crravomitcfcsfic 

caturc i fo:ma tufa saf f a q mulfa cjttuor obn 

li8:(ta vt o, bibcrit quigcrospoftea pa flus am 

buler.£o:rqccij vomirione mouef.faciepur* 

gar.bec % folia cutufcucp fartui illit a cum vtnc* 

canis mo:f9bo8Coctoft>erafo comcceroleo 

aceto 7 mellc iocuduwcs cfle certttm eft 

f Dtaf.*Jbcponi8quidevfu8gratio:cf5t>t^ 

fidlc coqttifipfer naturalerigo:c. £ r ideo no 

nullicum acero fumunr pulcgium mifcctis. cj 

nocirura viafrigoristcmpererur. 

f 3tem pepo in cibo leuio: cft.q: t ctracta cu 

tc i obiccto fcminc vfuioatur.ftomacbi comtf 

pefrir ardo:em.2lluum Icnit z mollit. 

f £octus ejc aqua cu olco acet o et mclle tocii 

dtlfimefumtturXaroaueimpofitafronrioo 

lo:cm oculo?. miro modo mitigat. 

D£ra paftoris fiucburfa paftoris.DY* 
afco *fcera pa ftoris bcrba e q bj virgti 
laf rcncrafi z moilcs.i multas nodofas 
ct fpanfas fup. tcrram.^olia babct rutc fimilia 
fcd oblonga et molIia.er femcn in folns fingu 
U6 .flos cft tllt alb aut fcniccus.Utrtut em b> 
frigtdam et ftipricam.£t eft mafculus ct femi* 
na.pemafculoiamtwta.jfcminaverofru? 
tcjccftvnusvirgambabenscannofamimol^ 
lemfpiflamtnodofajin quite nodisfolia fitt 
pint fimilia/Radipeft flli inurilts /Rafcif locfe 
bumidis.Uirtus eftilU ftiprica. 

0pcration(0 



n 



i.i 



CnMtan» 




H € Dvaf.Stocus cf9 bibf"r9cmopfoic$ medty 
caf .aaris abRinet rcKmafifmu.coUc^ ftraii^ 
guirio£opifulafo:fna^uocar.mo:fftovcne$ 
natis rii vfno bibft9 mcdica f.cu vfno coctus ct 

'£>} mellevulnaanouacurat.^atodfcTfcb:ito 
an vna bora accept9 mapie,pdeft fujpofifl7.fiu 
lcummuticrtsftringft.tJolozej aurifi copefar. 
fagutnerctjcicritofitbuenit.bcrpetescurat-z fi 
ftulas/jfgnefacrp erringufr.tumo:es 2 $urf / 
acsipofftuTpargft.recerito vulnerito majcimc 

>£ pdeft. $ J^aQuuat ftaq? ejtiuftes ftomacbo 
cpfcri9ajplicata ficberifipilata.-realidos fieg 
mones feu eria talia crifteria repcurif renmata 
1 cjctnde $>o ficca tiuu crifterctjpter qr) berpe? 
ru bonu efarmacii 1 vlce?. 1 alf a# eutdctifftmii 

p $oftegmonofo¥.reumaro?.Cj£ftaute?fan? 
guinofopulne£c6folidatiuu.3uuat vero z 
vlcera q \n auri bvr fi pus in ets furTicfcns tW 
rit id ftccar 4pt er eafdej^o virtuf cs? flucu mu 
Itebre fiftit/r t»ifff nt eria et fangufnis cductio? 
netqa1cgimoderafc3lumdecaufatu.j£ftaut 
adomia pdicfa mafculus fercfna fo:rfo:. 

Capttulum.ffflttt>. 

h| lcapaabarurauriahquidminutu. Ra 
4K-^pi8e*:aum.i'5ecmime mflat.3o ma; 
gts egei ■iaiwpii.li.peiq .-piium in apricis feri 
t>eber.frt'go?impaaettmmu.3deoq5feritur i 




vtalta.ctinaufteriottYelo.noniTifcmecvaiio 
terraqjfactli i foluta.5rumetu qufdeet o:de? 
um ac vftfa 1 quiccjd in fttputa eft fn acumfoe 
vnu foltu bj.multtplida vcro fut ecetra ciccri 
etfabe acpifo.frametis efolin arudfnatiufa» 
beromndu z magncleguminugrelcgto:a vt 
pifoStliquerotodefuntciccrf.ceterifqjlegu^ 
minu I6ge:-r ad ffgura femislatcpifo fo cftin 
drafce.£je lcguminito vomcrc ferfi Icnticula % 
ingrecia pifa.ZMe acpifa funt efufdegenerr, 
cjc qua in o:benoftro fftonfa.^allaJi.ic. 3« 
mcnfc feptcbripoftrcmo fercndu cft pifum i tcr 
ra facilf 1 foluta locctepfdo;£e[o telectafur 
bumecro.et quattuo: vcl tres modioe fparfitf 
fefurTicteriugero. 

^ptrationts 

f Scto:.2£iror # fn ltb:o med!tco£Bfo:tim 
autcticis manifefte t>e pifo? natura rcpairur 
f5Beftfma<a.damefieqt5 alto notcrobcUt&fcii 
tur.vcl fo:tafli's eadej ro pot aflfgnari fce pffa 
qua fupafus aflfgnauimus x>c auena. 
«ff •frandcct a /fbffum cii fpccies otobi. 
f £>alienu8t>ecibis.*jMfa pffmfle ahcldfal? 
f m foraj fubfta riam babenria. comefia c$ ftn 
eofden modos cu fpfs.f n t»ua to bis vartaf ur. 
qufa fnflarfua Cofimilfrer fabfs no funr.s qufa 
abfterffuavirtute no babct^tcr 15 tardieris 
fcigcftfoms fm virtutcm fabts funt. 



BtWAi 




€apiniltim.rrdu* 

»3fcacca grece.arabice*£iftacb ftuefitf 
Itccbvflfifta6.larincfifttca.©era.lu 
ag.cpiftoeb.i.pffcacca funt fruct9 qtii 
vmiut&e©amafco.OYafc#ca.pifcaacqiKUi 
Styia nafcuntTimiuaftrobflitofunt. 

JE>prrattonr0. 

^ pvafco.£uftomacba funt cum xim bibira 
moifitovenenatloccurrut.^tuspifcaccauau^ 
fterailiipricaeVjJdcoq? eriaaecomodacredil 
tur rojariipulmoisi ieco:!viria purgarc. 
f £tidc5©era.fbiftocb.ideftfiicefubftan^ 
tiaeftfubtius,ctfapo: eius cltfcrc adamari» 
tudinemocclinaswvir^e^cca^tficampli 
oris calidiraris efnut aucllana. 
% 0af.li.t5 cibi8.ca.?>epifcaG]8 .•jMfcacfena* 
fcunturapudaterandria incgvptoanulfo aut 
plura inbo^alifvrie .alimctu quidem paucift 
ftmii babctia.vtilia funt ad eparis eo:robo:a 
tione:fimutipurgarionc" infcrto?. bumomm 
iPm meatus ipfius.p,ricipant cm fub amara ct 
fttprica qualitarearomatisanrc. 
C S5> cim9 aur z alia mulra epati vrtlia ficut in 
liegocio fimpUciumcdicina?ofttfume.S>ro^ 
iracboautticq^ccriinecp nocumcrunotabi 
leejciptsbabeoteltaruficutneqjreltrictiuive^ 
irisnecgfubductuji. 



f£tWe.viq.ftm.far^.6ptT«^8.iSiu:acfu.^ 4t 

f«ica.infvriamulfunafcit'plarabec5 : ruct9ac 

ciSfubriliiigriu e.fubamapqtf zaromarijans 

bab28.ccobftruir x mudiftcatmariequidejea 

fmepar.cteacjfmfo:accctpuImonem 

f Bui.t>c virfto co:dts aiat q> cofoaat co« £ 

4 Bucrroi8.v.li.£oUiget.c.t>e pifcacea t5t q? t> 

confo:rat ftomacbtl x epar a rora fubftatia i 

fRabbimoYfcs.c.cepifcatqs.^ifcactefut 

inc^oKformtofructito4co:robo^rftomacbtt *> 

ctepanwntcalidcificcecemperate. 




Capituluuuffhfr* 

D3nicum fiue *f>anf eum.pfaac ih tia$ 
^anfcujmroana crnarura fimfle mi* 
lio .minus tamen co nutrir. 



■if ^anicum vetrcmagis conftipat. coquiror 
fepc cum pingucdinc vel cii lacre. 
f £oftan an pantegnf/fSanicuj 1 milifi fri. ct 
fic.funtin.q.gradu.pa?.nutriunr.fitpticafuijc 
ctpanis inde facrSmulto pluseft conftipatiu9 
Qrina3 aurernpuocant. JCumbutiro vcllactc 
£ocrafunrmclio^quibusadmi]cti8bumecta> 
tur .et co;u^i ficcitas ecpeUitur, 



£ 



Crarcatua 



'f i^linfue U.icjcq.^anicu .pvccleo mcdiats 
mclfrugnj afpella uir.cftea < ; b? 4s nn!iu 3 n vi 
tio pom5t>ifunrma8,pdeft.£> ili- bieq vapo* 
rada funncalefacrum imponif . gyiiiit aluum 
in laae capzino t>ecoctum:? bie in©ic bauftii 
ftcprodeft-zadtozmina. ■'■ 
f Pvaf.^anicujinefca omftx» vtileeft.vnde 
fi panie ep eo facr9 z c6meft9ruerit .vetre abfti 
ncr.vyna < puocat,affum veroincacabo nouo 
et impofitujinfaccello ficutetmiliuj pzodeft. 




fl -fMoca min9 e alta 3|larit .fofis pankulie 
minozit» arcp graciliouto.baber nuclcos roini 
mosacnigros.jptcrqtf greci ptbiropboron 
eamagpcUabant 

fl 3neadeq;nucamefa funtmarib copreffto 
ra minufcgrofcida refina .tlt at pijc eceat aperi 
mr picea a gte folartcu plurtmtl btaru bipeda* 
luvt a terra cubito cuj minimu abfit,'F;ec ipfo 
cozpiptif .vt i ceter^.qm afiula vl baliula i fntf 
ctu e.^Uepbcc terre^pjcia laudaf .Slrio: ama 
ritudineaftert.lioftea bumo: oie c tota p Auit 
i vk9.23abetcp picea folia pugetia nullocg flo 
reejclMlaraf.ptin^crnfruct9aflontogignimr 
f 3bief qde circa folftiriu flozcf *jMn9 z pieea 
germiat6e.tv.feret>icb?pueniBt.Sieme^oet 
tpepoftvigilwsredduf.^tccatpin^taln^fld 
aq^-ouct9 i fcoboscauanf obwteterra pluri* 
tru8anm8t>uraf.ciro fo fcnefcutfi no iregaf. 
f 3 dc> in li.tvrj .Omb:a picca?. quacunep at 
t igerit e venenuj.3 dej in li.jL-jciW.^icea rjc la? 
ricisfblio trita z in aceto i>ecocta;t>entiu5tio 
lo:i pzodeft^Lims comcuj eius intcrtrigini et 
ambuliispotusaluum ftftif. 
f arina moua.S»uftitu vuluascozrigit . •&' 
cea foli.i pziuatim iocino:ifuntvtilia.t>:agme 
pondcreinaq mulfa pota.penicp filuasillas 
Dumtapatq pice acrefinegrariaradanf vtiitf 
fimascffcpnlias auruma nf.Uelbis q longa 
cgritudinevircsne recolligunr. 



Capttuluuurriut?, 

D3cea.vft.u'.«bimo.jarj.lMcea e% pino 
rii gficoiffcfr tn vt pinifpene^Ha aliaj 
pici n greci. alia vodr pcucc cp nos ptf 
ccat>kim9.eo cy oefudatpicc.^Uni.li.ppi.^i 
cea earbo:ramofa.cuiramo? co:do ficut et 
abicti.^iceamores amat?frigo:a.feralie ar 
boi.i indicio funeb:i ad fo:es pofita rogtfq? vi 
res.iatttiintiomoetonfilifacilitaterecepta, 
becplerucpplurimlinreruenietecandidage^ 
ma ftmdir refina:tburiram fimile vt mkta a vj 
fut>ifcernin6poffit.t5uiu8arbo:i8co:tepcft 
in vfu magno.fiait abictkn fagi ac tilie. 

©ptrattonfe. 

f -isii.inli.vt§.j5ignitcl5 picea cancb:vn ve$ 
pillulaj in medicina vim v«ndi babere.q poft 
&3foliaceciderint:biemct>uratxc6tinetnucleii 
pinei8filem.3nbicmecrefcit.ctaperifptUula 
tota.caditcp cum foliacrefcere cepcrint.2?uic 
etia; arboti folia funt b;eui feta z craffio». t>« 
racpficut cipfwe/Rara^o pene ftarimaradi 
cemodiciKtatb;acbia lateritoinberenc 




&rijafif0 



Captru!um.ffcluiiT 

D3ra.3(ido.li,ctv.]cv.'ji>ira vidcnnir t»ii! 
cra .eo qnn fpectagniefintfounara. 
ttlabamplo incipiut:i iu anguftum 
* fcefinur ,t)zc fumcrie impofita cril (i panca xti 
bemenrer onerofa efle t>iamf .f i>alladi9 lir5. 
t'rj.£ondieda funtpira ira.Deplaciro t>efccri 
denteluna;a.]Cicq.vi"cpinoctaua«adepomalic 
ca?manulectabo:afecundainquirtta5 vela 
feprimaint>ecima.a caduci8t>iligeterclecta.in 
tegra zjppe ©ura t aliquanto viridia implicato 
vafe claudunf ,qtf operculo tegitur z t>eo:fum 
osciuseiinclinaturatcpobmif co loco eircay 
que perbennis aqua t>ecurrir. jftem que t>ura 
funtincarne? cure p:ina m acetopofita vbt 
femollireceperint.infictilevaebenecoctujpi; 
catuqj ponutur.z operculo fuperneniente gip 
faitturvz vas b:eui fcrobe fcemergitur ineo la 
co qtii qndie fole tangaf-fMurimipira obwta 
i&terpaleaeautfrumeta feruarunr. 

©Pfrationre. 

L f D¥af.c.t>epiri8.*£irimultefuntfpe8:f5ftip 
ttce oes.vn ad reumaticae paflioee carbaplaf 
matifo adbibita faciunr.z reuma comaefcunr* 
£licarura eo? ad otapfara iunat.g tfiipa pira 
a ietuno comeftafiierint abftinec ventre. £t pi 
rifiluaricifpeofuntq rardemarurefcere pofiut 
ptuefttprice cp fup:adicre:f5 fimtlito caufis.p? 
funr.gbibetcfc alict rongos venenu amirrere (i 

: cu piri8fuerintcocti.f Sutce.ti.q .ca.t>e piris^ 
3nipis funt terreitast aquofitas. z m noftra 
quide terra eft fpes q tncif fenabwd.z bj mag ♦ 
nlcapaatateVz e vebemerisrotuditatis z fub* 
rilio co:tKie.ert boni cotous quafi p:euiu.qua 
ft ipm fit aqua 5uccari coagulara pturimu5.fed 
n6,tpter fpiilit udine fubltatie boni odoris val? 
de.qo' cu ab arbo:efuacadiffup. terratKltraif 
et ilti funt in quito nd eft nocumet u t>c fpcaeto 

- puowm. f -fMra q nominltur fenia funt rrigi? 
da in primo.z ficca in.q. SJerabaid rero (ani 
remperata bumida:er omneefpeaeseius func 
ftipriceintrlreoinemplaltrisretentionioma; 
tetiqz.z qncpabftergut paru.zeo?bumo: cft 
plunmuo z laudabilior bumo:epomo?.f m <p 
t>itit rufus f t a a ufc que t>icta funt fcnabmd 
m terra £o: afceni :abfq$ alqs oicta funt leni? 
tiuanature.z boni cbimivalde cofoudat vulf 
nera.-zfl^Mefiiucftriaejciccata.tfuntp^parari^ 
na ftomacbiVz abfdnduntruflim.z fedant cotc 
ra.z ftringuf vcnrre.z.jprie q funt ejciccata. 
f.Etinpirisqutdceltpprietasfacicndieueni? 
r€cotica:quareopo:tetvtbibaturpoftipat>c 
fdromeUecufpccicbttsqfunt vtpipcrt qnW 



momuibtofimtlta.f £f co?robccucm't rlu^ f 
n^ivciirriGcolcrico.iZiniefpcacico?- vcteme 
tisftiprtcitafie.-zrardemamratiotnsc.icura: 
furtgo^momficanrifi.': qn iftifungicoquutur. 
cunipiri8mino:afnociimairumco:um. 
f ©era.li.ag.ca.£ume{b:c.auc.j5ar'. £ume j5 
cb«.i.pira.©ubftItia£i i ;eltc6pofiraepfuba- 
terrea t aqTa.,£t fi vispof eft atiter tiici.cr vna. 
f.riusparseftfrigidat alia reperara .sfapor. 
ptrig ftiptic9cu t>ulcedineaqfa.'zvirt9 piro? 
eft t>eftccatiua.z coglutinar vutnera.ftnealiq! 
mo:dicati6e.£r qn comedif fo:tificar ftoma^ 
cbum^tfedarfitfmfSiiueftreverocltmag? t& 
ftipticu.z ptueinco^at-z co:rugatftomacbu:t 
ideopluecogiutinatvulnera^pmbibetrlujcu 
humo:u:f ;£ t ide aucHbcn mefuav 0uado 3 
quodcitcp rotu coquirur vcl t>omefticu vel fil^, 
ueftre cummngieauferr malicia eo^.z maio:a 
C]ca8funtfo:rio:t8virfuti8 cpporua .*i>arua 
aut fun t nut ribitio:a cp ritoma.f £t rob piro % 
ruabfcinditflu)cucoleiicum.?cicco:iatftomaj! 
cbum.£tpira ( ppiiegenerantcolicam.':opo2 
tcicpfumatur poftipfumvinum mctlis factu?, 
cumfpecicbue* 




srVCapitulumccritf. 

^ > -^3pcrt^rine.arabice7:greifalfel.S'cra« 
pion libro aggrega.caialfel.i.piper.£f eft a'r# 



Examm 



a 



b 



^narcceinrfgioifoCnclfcbjfcmc qtffui ot* 
f n e iongMmue fa feolien clogaf in forma fua 
«t cfi macro pipcr:z iutra ipm funr grana pua. 
$fia garguee:q qn mar uranf fir pipevzl? c#fe 
parflft fit fkutraccm^tn qtrib? funtgranafi? 
m.i fimr grana pipcris . £r qncoUigif gfecte 
miturii epiper m'grii.fj qn coaigif antc mat u 
-ratfonccft pipcr fllbir.na eolo:Ci9eft atbv. no 
TcapiturcOlotc Fuo nigrcdine anrecp maruraf 
*4Etradi)c bur? arbousefimflis cofto.EUgcndit 
€ aftf epnigro q?5 enouuin c] e res fimiltsnirftt 
•ngraucTPlcnu.!©3albumcli9ciHi?d q#no e 
tugofuj dlbu ? gra uc i iogii c cligcdu fUnd *|t» 
tqfi fragif ajparct tcnru?:bns granatj funt itra 
ftnrimricc iucta.t acuriiaporismoidicas lin? 
gua cfrcakf acriocrRadtjC arborisbur? vocaf 
falfanuc.t cfimfris roftoibcfcrf adnosct rcr? 
ra indic.f 0alic.vn.fim/arxa.pipcri8ftiifra 
^fla.no.^tpcrisradipcoftofliaicunc fan virturc 
ftmflaf . 5rna9vcro ci9qufc|damodo ;gci mi* 
nat c pipcr I6gU3.vtfa bumidi9cicifliMnaturo.fi 
gnuaureft bumiditatis ci9 <y fadlitcrcuimpo 
mtpcrfo:af.tn6ccfeftimmojdctJf3paularim 
inapif.pmanctveromuUu\quiveroqfimaru# 
^rii8frtKr9atbupipcre.acrt'9c)cr?snigro.idcfit 
^fifufiatfaiucft.vfracpaurfufficiercrcaUfact 
:«nnficdr.f SaUe.couVzca.fm rranfla. ara: 
£5apor pipcrisc aait9.?f llud qt5 nc ma mruj 
«cli jptper albu cvripm cacuttfnisro/: mag$ pQ 
^eslinguaVz Bcqtnisru ^prcrca q: maturaf* 
sccidir cr no rccipiatadultione? tcficcaribne 
fo:tc.q: minutfar Jiitae illa.quc quide rcmanj 
Jin albo3ftc rirt>ue fpes funt teficcatiue i calc 
'facriuc fecarcr.? fruct9 cjuide cius qn incipit cf 
ifecftpipcf loguvrjptcr d accidit cp piper lcgii 
<cftbumidt9 alro piperc.jEt fignfi fupj q* qua* 
=do clcgat tps fupipm co:rodif f £fo:af criam 
■ep rcrif no inucnir rriro: in ptinnpio fuc corriti 
oniopucrioncmuira.cc^ticipirmo:dicarc.n6 
-apparcr mc:dicato ris mulra afic£guftef .fccin 
dcrcmancrmo:dKarioct9t£cn6pflruo.fjp^ 
sper albu cmcli? It6a cbo aUis t uato Jpccttbue 

i[3cra.!Radi|;pipcri8ccferrcoiicc'itolo:^ 
touefrigidi8.£ ft csw ficcfi fr cna rottcc? vcto 
Jirarito talqeaolotitofri.-z cfimilisccftofm 
viirure^pipcrnigru sairi9c4l albo.t albu etc 
tJtuyco.Trtr^pipcri8ecaltfaaiua:flrtraaiua 
cibi.^uoc3riuav>:increfototiua 7 sbftcrfiua 
obicuriratisvifus.^f £t qn fumif inporu aur 
urinuncrio cuco.aur mifccf irtaltc|Yngucnfo. 
cofcrrrigwib? ftbjtu pcrtodica?..a:c6fcrrmor 
itbttSvcncnf^s.crcicpcUitfetu.tpoiifltmcAin 
fomfumaf vclaflidue comcdatur 



fEtqnftfnafcfllccucopoftcoitu^fjtbctfm 

Pkgnariottc.tbocfimilircrfaarafiiduecomc* 

ftu.Ra ircr pftar gcniralcT adminiftrafm \o\ 

boc tfvrupis t\ funtcoucnicrcs rulTi t t>oio:fi» 

bus pccto tis.-: fit hnttio cttco i mdU4confcrt 

fquinaricf >£rqnfumifinporuma]ciccugra 

nis lauri aut folns ct9-pfcrt totriotte verris .ct 

qn mafticaf oitlafifagriai cum paffultsfaat 

fcefccclcreflcgma cpcapitwipm fedattoUacj 

tc6fo«atvirmtet>igcfttoa.t«igrc<lt'finc6fcc 

rionite fpcric?. quito vnlturfaniin codtmetio 

cibo?adjtuocaduappctiru.f £t qti mifccf cu 

picercfolm'tfaon;la8.jetqrimifccf rii nitroab 

ftergitmotfca.-rno eradic piperi83iri3ibcr.ficut 

put;uicrut qda.immo radic cv) cftmilis cofto* 

quequidecalcfacitimoklicatiittgul.jflttra^ 

birbumiditatcad os.qn mifccf cii accto.£t Wt 

nimcmncu5corcfoluitapoftcmflta fpienie.-j 

ftfumiffaciride.f J£ttdeauc3bcnmefuay. 

•fcopnctae pipcris cft <p p»btfcet impMgnat i 

onem.-z mapime qn fumif poft coitu.'z p:obib j 

r o:t ioncs tverofirarcs qucfiut in ftomat bo i 

inteflinis .t ericcatnegma vifcofu3qi5 aggrc^ 

gafuruipccro^pulmonetinrcftinisrttige 

ritcibiun.tnocctfcbriatanfibr.f £rfi qsvtif 

mulfu prpcre.pttocat vrina.jCt fi vtamr co pa& 

rumptouocatvctre.^camonca cftcotraria 

inboc.tfacitbominemacreficri.? teficcat fpcr 

ma,£tinpipcrealboaiacuit arcfuacftj bttmi 

dira s cj anflct i n fpetmaf cTct irju ndiftcfltc part 

vejweerjjulmcme? ftomacbu jt cctert mo:Gi? 

busvcncnoTu^caUfacitncruoscr mufctfloe 

etplusomni aliare. f •pauuisca .tepipcre. 

-t>ipcr cft calidu in quarro gradu/iccum in fe^ 

ciido.Tjbi fcicndu ne alici crrorie marcria re^ 

pieanmr.^ptcreaq^tnptcfcnrilirraa.Sfcrflpi 

on^ prafw^idcnf cufialicno no mcdicu ti 

fcrepflrct>icctcscr pipcr nigriim acuriSc albo 

f DaUcrmevcro aif ,cp pipcr slbii acufius tft 

wgro.tjprerea ficurcrvetbis £?afco:idie be 

neintuetite et auide/cft manifcfttim er pipcr ai 

bum cR t>upliciegcncrie:f € ft quodda pipcr 

album.q^ fit quadogrflna muuita que fnetut 

inpipcrcU7goAncipuifmgroffati.?vnu38bal 

tero incipif fcparflrisfcd no facme cfi bott5 vc! 

raccmue.f ^fi almdpipcralbrm qbutcu ii^ 

la grana que ftterunt inptcdicto fipcrc albo 

im ticbita quaritaf€3 fuctmt aucraiet inrra i< 

totaUr afepflrara.fiaitqucfunr pofira in quo* 

damborrov4raccrro.t funt^incjmaturiraj 

iu^:imuvcropipcralbu0Tirflpiradbucnai 

turipipaieiogi.q: vicinaf parriapat fldbuc 

*cciu£ ; bumtditatc.cui9grfltifl nocft nutlmm 

atutum.^iper aliurl aftum te quo t>ijcinu:e « 

<$od cmnmtioimir mattiritsxcm % p«b| 



IBeSjfcbia 



dpiuin geticrattbnf scfl fatie acutm*qtiarc cu$ 
ranoueaturctclongaturjapiperclottgonon 
participar bumiditatem eius : ct eft aattius fe 
fpfo cnmvenitad mararitaKm : pzopter quaj 
amittftt>eeiusac»itate. 
C£tbocidem vfdonusfn fntctfl» acctofisq 
funt in mcdio tempote acaofioHSJ. boccriam 
tofemimtoeftridendumjfcilica.fcniajlie:^ 
napib^t cetcris.cr- funtacutfotes z caltdio:cs 
quifuntinmedio tempo:e:q$qui funtineicfrc* 
mo.S»ic crgo adjpoiitum piger nigrum aeu* 
itus cft albe,fa'lica albo quodeft f n pandpio 
fienerarfonis.quia nonbabet ntultamacuita 
rcm ptopter bumfditatem quaj partictpanvt 
tictumeftJjuncrcfpcctum babuit Serapio 
et t>Y3fcorfde8* 

^ £> ctendu infup, q> in maiori quanrit ate ini 
itenirctur ©e pf pcre albo : nifi quia fnficfrur 
ptoptcr fgnem.fedillud quod non contamraa 
rur ab fgneremanaalbujtnonntgofum : qo* 
nonpotcft cfle nffimodicc quantitatis:quia 
modicum eft illudquod ab f gne fmptcmoncm 
nourccipft. 




Capttuumuttte 

»3pernigru?latmc.arabiccbabcljdim 
velgranae?elem. 
©prcattonm 



f locrapion U.903re.ca,babc5ctim f d cft gra 
num^climjctcftpiperetbYopiumvclnigrotuj 
et cft granum piuguc in magntrudmcctceris: 
ct cft citrinum etferfus: aibum interius^et Wt 
bet fapozem bonuj.wfcrtur ej; tcrra barbaric 
jff Etilludquodnominamr inbarbarta cro* 
trt:cft fimilc fafcolisfn fotma ftu.tufi qufa gra: 
na cfus ct co:rc^ efus funt mino:a fafcolis. W> 
bentnigrum colo«met acurum fapo:em ficut 
pipcr.ctiocferturfimiltteratcrrionigro:uitj.ct 
funt calida in terrio gradu. bumida in p?imo. 
€ £tconfert©olo:ioenttum. 
flBugctcniminfpcrmatc. 
f £t factunt bonum oclo:cm oiiz 



& 




€flpitu!mtwtfjE& 

Djjpaclle tarine. grccc baerma.arabfce 
baerinta.Sfaapionlib.aggregaro:* 
ca.bam'nia:fdeftpfpcrella « cft figura 
ftcutpipcrfeminotisfignramifiquiaeftfnco^ 
btcfuocitrina. 

^ptrarionra. 

fSfaapion.jmea&itefunt vimues cotttr a 
rictfcut frigidftas ctcalidftas.^T £t ide aucto 
ritatc Sben mefuav.2>aaiha cft granum par 
uum mfnus pipcrcctcft in eo cftrfnitas pauca 
ct eft odoriferu: cuius odo: eft ficut odo: ligni 
aloee.cftc4liduabumidttin.?inc0eft abftcr 
$ 9 



EtmmB 



& IrVparua.f 3&m *pwamt nimm mntfaj 
** fctidi quando coquitur invino zbibimv illud 

vinum 
*. <f £taufertp:opter fetozem afccllozum-etfe* 
*^ tozemtofiuseozpGZie.Etoperario inbocea 
tota fua fubftanria.zquando coquitur radijts 
bibitur :c6ferc ficut ptper nigrum. 




€&$im\unua\n). 

»3 retrum tatinc. grccc ©cnranos. ara f 
bicct.ctacbiraraba.fiue acbara<bara 
ba.£>crapionlibzo aggrc.ca.2kbr;: 
raraba.auctontateDvafco.Scbirarabaide 
piretnnn.cteftpla.nta cuiusfolia funt fimilia 
folus&audagreftisaut maratri.Yfnpirce fi* 
wiliter ficut ftipites illiue/z fuper ft ipitem e col 
•ronafimtuecozone aneti.sbabet radicem in 
grolTitudinccigtti. 

f Euicenna libzo fecundo capiritto fce pirtf 
tro /kirerrum piurimu quod t>e bac plata ad£ 
n jiniHratur eft radij: cim. mcliae eft illud qo* 
" citacimimsmozdicafiuumli.ngue.smagntntf 
do eius eft fm quaitfitat ein t>igiri 

** M Dvafcwidee.-jjbungitlinguam qttando gitf 
ttaturpuiKtioneto?ti'jattrabttflegma.2idc0 



cmando coqn it ur eu af cf o ift couitfb *zfeeo 
fmfcoloa'senfiuj£tqu2domafticafafrrabit 
ficgma.f £rqiiSdo tcrimr % ir.ifcef cu olcoet 
Hiungimr,jHiocat fudozem.-zccfcrt membzia 
fuper que vincit frigus:": conferuat co:pu8 a 
nfmio frigoze acrie ne noccat ct. i a mtfiione fe 
fcts-z moturtfcft ciueiuuaincntum magnuin 
bomine.etc6fcrtparalifi^rigo:ibu8fcb:ium, 
f J5alicmt8 vtrj .fimplicfum farmacozum ca* 
pituloJ5pirctroplurimumquodteeoadminC 
Itratur eft radit eiue.-r pzopzieras v irtutis et'92 
^p:ieta8 adurcne/zpungit linguam quado git 
Jtarur punctione fozti:et artrabit flegma. 
f £t fedatsolozem t>entium qut fit a frigidtf 
tare.tconferrrigozifebzium qnadofft iunctio 
cumcoT>iffoluto inoleo anreaducnruparotf 
imYzconfatiUi quibabetltupo:c5in mftmsi 
anterclaicarionem.f Sniccnna .•fbiretrttj t\i 
dam ejtrimaucrunt effefrigidu5 Scd non ett .intf 
mo catidtim i ficcum in tcrr io qcsc\u. cnr abic 
flegma mafticatum^t vinus ciue cft a duUiua 
( £tpzouocatfudoze:ctimer;co fu^olcoabftcr 
gendo inungiturcoipuf .fimifccarur cum cLco 
crabftergendomungarur cjcco pzoiibcatiu* 
do:e5.5ricatio facta cjcco ct tecocnone ipius 
ctoleo eiusconfcrt molltficationi nertio^aa 
tiquc:tftupo:ieo¥.etp:obibefgcncrati6ca^ 
CU5C5 ab eo in quo generarur a!cti5c5 vcbcmen 
ter aperit optlationes colaroztj. uonftnt riot 
ncmnarium. 

f £t riuc "oecocrio cofert tsolozi t>em itrm .1 p 
p:ie frigido.£ t cius acetu confirmat t)etce iv.o 
tos fi •oecoquatur atm acct ct r enearur in o:e 
f £tquado fricatur cum eo cozpue anreca f t 
ro]tifmurigo:i6cumotco:confcrtrtgo:i facto 
cum febze-z abfepfcbze/jiaulus ca. li ficcum 
inttruo gradu"Z£)afiicatum aftrsbirecgma 
per oe.-z rcmouct , oolo:e •z ftuco:an pcnf ttim. 
fl aucrroisqutnfo Itbzo ^olliger.cs.tsc ^t> 
retro..£ftcaliciainquarfo:etfeeaadminiura 
turradijcXonftantinusltbwgradtmmcapi^ 
tulo •jbiretrum . *f>trctru5cU iu quano gradn 
caiidum 1 ficcum.Xingua vzir .1 flegma nimtf 
um attrkibit.3dcocg ©entito vala t>e frigtdita 
te et bumidtr a te t»olcnato. 
f Blecandcr 1 ia tcpbanue. ^llud trifr.mct 
cum mellepotaninucpilcnt icts valcre feftanf. 
Xollo fufpenfumautnanbueatpltcafumfirb* 
ucnit infanfttocpilenricisXumoleo mtjitumz 
t>ozfo fcminco itmncmm ante rigozisacccfuo 
neinventre^bibeteam. 
f oa lc t etia m pa ra Vtfcta a c ncrcoi; molticici 
tefngiditatczbumtdifafefof^cozpo.Me.^e 
nicpin cojpoze t ofo cf cozum pemncto jwho* 
caturfudoz, > 



BfSjrrbfe 



f •jSlafearius /£i rctru cft faffs cois berba ui 

rmiograducalidaificca.T^adiiceiuoinmedi 

cinis ponif.que in bYcmc colligitur.ac per aiv/ 

noequincpfcruatur.lbirctruwbetclisiconfi' 

nuum?noperfo:atufapo:c5 babcnsacurum, 

ct cum frangimr no pulucrifaf. Scumen rius 

no ftatiin p,a'pirur:fcd ocbct aliquanrnuijma 

fticari?ino:ercnm.0uoedringitp:opre:ei9 

leuirate:vel fubftanric foliditarc.uirtutebab?. 

t»ilTouicndi:confumenditattrabcndi 

€ 6argariftnafacru ejc vino tmlci-occoctiois 

ciu8.ccrcbjuafuBfluifatcftcgmaticamundi(i^ 

caw bumo^s vitc confumir. 

*C 3ntcr ©cntc8mafticatut>o(o:c5tollifiocn^ 

nu5:ct ftomacbircuman'fmu.^aft(afu quo 

cplingueparaliftmfoluit.Contrituinvinoct 

oleo t>ecoctu5 z ad loca paralitica z podagrica 

catbaplamuru5 valde pwftcit. 




Capitutom.ffdjEitK 

^pW3mui8latinc.gro:cjCalidarifcbocbi9 
•I Ivel a^ct.Srabice cinobar.£5erapi.li . 
*-* aggregaro:i8.c.£inobar.ideft pinn9 
arbo:.£t cft mafculus ctfcmina.^gbafculus 
nominatura^ctvelcinobamnonfacitfructii 
magnum:fcdt>cfudo:cc)ctr3biturpijc:vtpat5 
in lirtcra pip^t abidcm imjemcs dm virrurcm 



i cu5 ugno fit tumen.: eft illudquod voca ntr t« 
da vel 5appinti8.t t femina e illa que facit fruc* 
rummagnum.it>ecaeftmagnaer parua. 
f £t idcm aucto:itate 0aueni . *i2£>ino: cft 
infapo:eficurfapo:maio:i8.?cftincaatiquI 
tulum amarttudims % acui taris. % virruo cius 
cit caltda cum acuiratc. 
f £tidemaua^lbcn^efuav/^)3gnc cp 
pinnis funt calide m fecundo gradu:l iccc m p* 
mo.0uccubtbun^curobmudificatbumo:e8 
grollostvifcofosquifunt inretrit» tvcfica, 
f £t idem auct o:itate pYafcoridis. £alida-; 
ris vet calicaris elt fructas pinua maio; : z nc» 
minatur cocfoia* 

iE>pfrationf0. 

$ S>erapion."£inu8 maio: cofert fanieiin Pe 3*4 
crowrr omnibus qufto coueirir educi fatriem a 
pcCToie.-zfacircjcpuercfanguine.rquadomnTI 
dtrur in aqua:rccedir acuitas ? punctio q funt 
in eo ttelogatur a mo:dicationc. £t tunc e co 
glim'natiu9.-zmediu8inrer qualiratc calidaj 
afrigidamrrinrerfubftanriaaqucanmerrel 
et fubftantiaaquca in eo clt pauca .fcd fructue 
quatum adnutrimetum cft t>ure t>igeftiom'8:; 
etnutritco:pu6iwm'menrofo:ti. 
f jfdem aucro.Dyafcoridie. Ouandocome '& 
dttur i bibifcu> fcminc cucumeris z rob pwuo 
car van.i;: cofcrtardcci rcnum z velice. £t qft 
bibitur cum fucco po:rulace»fedar mo:dieato 
nemftomacbi^trcdditocbibbfouitudincm 
confertoeftractiombumiditatie* 
% £t quado acciptf ecfructu. pini firutreceft J£ 
ct teritur -z coquirur cum rob . i aecipiurur t>e 
ipfius t)ccoctionc.5,iiu.qualft>et t>ie confcrt ruf 
fiantique zvlceritopulmonis: 
f 3de5aucto:itate6alieni.^>>ino:c|cei8'nc* *> 
minatur calidari8.tQ'rtu8 ciuscft calida i ab 
ftcrgir.fapo:eft ftipricu8:amarn8:aairue:ct 
conferrfpurovenieriapcao:ctpnlmonc.tcft 
ftipric9.a conferttuflh ?>oto:ib> pecto:i8. qit 
fumiturfola autcumettcf £tidcmaucto:ita & 
rcSbenmcfuaY.^agneecpiniefuntcalide 
in fecundo gradu: ficce in p:imo. Oue quado 
btbunf cum rob:mudificanr groffos bumo:ca 
i vifcofoscl fuminrcnite-zveficanconferrfa 
niri conim i lapidi.*Rdtna eius ©cftccat i calc 
faat:ctcftt>Yafo«rica.l!Swqualegccapimlu 
rcfina.fl £tidem aucfowateSalieniXoacjC 4 
ctfolia pini quecft mino:ie.quc clt nonrinata •** 
calidaris . babcnt in fc virturcm fiipticam » 
quccurattenafmoncm quando %)onimr (it 
attcmplaftrum.t noneftmedica men meliua 
in bocetquando bibirur ftringir ventrcm.-zfe 
confercnecobuftiom aque bniicnrie .citwn0 



IV, 



£ra(tatu& 



Iitfl , fo:tc)Citliti8ftJccidqitei5lcfl f cocbta.ctcft 
m afculue cdfimilio in virrurcnifi quia virrus 
dt ci oebilto: $»turc itltusXjfolia illarii arboia 
quequia funr magisbumida co:rice iparum : 
b&entinfevirtutequaincarnantperculTione 
« f £5ed piniinagnerOirtnefolio?.^ cotticia 
cftfoztisin omito iftieSs fumusqui clcuatur 
a ligno pini confert multum ftujcui pilow pal? 
pebzaruinxtcomiprioni lacbrimarum.uurt 
miUcbrimarumabeo. 
^5 f £o:tcparbo:i9pinimiorf8ctco:tqccocbic 
ct eft acj:omes funt iriptiee t cdfcrunr paneti* 
bnstcnafmonem qaando tcntur z pmucrifac* 
fop:alocum.tquandot>cipli8 mifcetur aultf 
targiro i puluerc olibani confert vtcerito quc 
aiparciuinco:pozc zcdb11lhonibu0igiii6.ee 
quando connciturcujceraoifiolutacuj oleo) 
tnirtino.confolidatTlccraquc9icunturfouni 
cc ne a ugeantur in cozpoze.? fit cum co fumigi 
ummam'ci:tejcpetUtferummo:tuiimct(ccun> 
dinam.£f quando btbitur Itriugit ventran.ee 
mouetvrinam. 
3 f 0alicnu8.vrj.fimpliciumfarm9co:tim<api 
rulo scpinea.Pm trartationem grccamXomi 
fructU8.idcirpineaquamfcrobiliamiiominac 
cota quidem viridi8.babct qtrid amarituduiis 
i acredinte/z pzoptcrea quidcm empiris % ali 
isqtiicuqjindigenr ea quefm pulmoncjcj; to 
race faalitcrcjctuirircetccpurgarcidonea cft. 
cftbiUo vero fruetoe eius . t It quidem cibus 
*>ifttale fctgeftibius et fbme.dr autcm vt far ; 
macnm : et ad leniendum afperitates tdoncu? 
ct macime quando in aquainfufus :t>ifpofuc 
ritincorotamquantambabctacrcdine$.*Rc 
Kqtiumeminomneimmo:dicacMmuntinme 
dio cnim calidumt frigidum cqualirer conftf 
1 ftcns cf aquofa ct rerreftri fubftanria babct 

c- «ftm:accto fa autcm minimc participar. 
& fl it idcmin Ub:o vccibiecapituto t»cpinca 
%bs &\c c% tiu8 cucbtmic i groffc cbimi genc 
ratuie.fcttdco nurriunr cozpue outrimcnto 
foutnon tamcn bene tfgd hbiii. 
<* fl Buiccnna lib:o.i}.ca,t>c pino.airtue coif 
ticis maioiiQ foitioi cft. £t co:rejcciue qucno 
minatur fufinc dt ©cbilio:Ow coitkc eiae e fti 
ptiata8plurim9,ctvcrmi8 qui iqciftit in ipfac 
4nvirtutccantaridi8Xo:t^ciu8confcrtvlce^ 
ribu8co:dicatibu8.ctinipfocftviitu8Confo^ 
lidaei»a.cti:i comceipfiuect>c fttpricitare qo' 
pcruenitadbocvtfanctabrafioncro quando 
Juper ca ponitur vt cmplattrum. 




DtJmpmdla.-fSandccta.^Sfmpindlacrl 
bcrba mulrum fimilie fajafrage. Undc 
rerlue.^impineUapiloefatifraga no 
babctvlto3. 

©prrationro 

ftliitueciuscftcjabftcrgittfoaiftcattmu^ 

dincarcpafzrcneeqfi inciefunr opilanonce. 

f Ouando btbitur &cradfcceiue quanritae 

amigdale a mulieribue quc no benc purgatur 

mparcu mudificarcaopcrmcftrua^ 

f £t quado bibiturcum vino :confert&oloa' 

ventrie % YCfciicictt>olo:i vdicc % rctm 

f £rqn coquitur cu5vino ^btbiturftrin gic 

vcntrcj.j£rqnbibiwrc]cfcmincciu8aimvino 

ftiptico confcrunt flujcui vcntris. 

f ttadttpimpineUep:tfcraatapeftcmaftica 

tam.cr incollo fufpenfumOtejabftergitvcfti 

fiiantgrain cutcJConfcrtpedagrc. 

f ttadijcpimpincllc mafticat a longotempo* 

rcajparetmeaacumencumpaucaamarirodft 

ticctcumacrcdinc.p:optcreaigitur t>iurerica 

etvzmarumpzouocariua. 



•B 



C 



Captmlum.fffIjEtuJ €apimlumMm 



BttovAi* 




»£ridcmon.-£an.-£eridem6 grccevelK 
cco&vd ecacanton.arabicc grimatbk 
i3tme£apufoluim.i.marafilaam$ 

^pfrationes 

f £>Yaf.ca.liceoeveleiccanton fo.funrbuflo 
fimiliaafcptpinofa.granad^vmda.Taimatii 
raucrint cerafie fina/Bafa? in filuofie loc? cii 
iuefo.ctgrana tradfcinvnu comndurar.et 
aimaqitatJulcicoquuturvfcpad groflttudtf 
nemtiec aqcocficcatuie virtufie» eccotrarf 
ie opofita.q: fcj eettenuatozia.sigefroiia ca« 
ctfri.(iipticlbnevitii«ideowforcfimfactt 
f f&cit aute ad berperae:t ad vlccra cpatie et 
adparotidae.tputridavlccraecfuccofhictuf 
ciuefitlicium4)w quo legcca.liaum fuperiuo 
9cl.ccl.cv. 

€aptmrara.rrrl*ra 

D3narialatinc.grcce fcalonee.arabicc 
2)aijcorT.S> cra .li.ag.ca. tpaicoff e ep 
fpcciebjpinearum.fo^raefum nimlia 
camclcontc albemifi quia funt nigru»a.et ba ♦ 
bet virgam longafolqe plena.x fuper tpfome 
capiceuu fpinofujrrbjradicentgraTfiroliam 
^qtJtcipfaplltaadmtniftratur.aar.X3ir 
ttte duee3calctacitin.q.graduin vltimoci* 
iin principto fc6i«©cficcatin.ra.->lantailU 
«praeditur reccneficw fparague. 



tbpmtimiw 

^6aItcn.1!S«>uocatv«'nammultamfefidain « 
quadocoquif invinotbibifilutdvinum 
f £ tquldocoquif radit? bibif.ai&rtfco?€ 25 
afelUruet faoic tortuecojpoue» 




1 CtS 



Craftaros 



Capiroluffl.ralfur?. 

a *5J^©illiu latincgrece pipcrfilliu . arflbice 
•j lba5ara(bonavclbcftercaron.£3-cra.li 
^- , b:oag,ca.:£-fl5aracbona auc.Dvafc. 
^bajaracbona :id cftpfiUiiheftbcrba bnsfo J 
liapilofa.virgasbnslongasmcfuravniSpal 
mi? rota berba pilofa.£t ccitus ramulo^ co?. 
cft a mcdio virgcz funt inipo capitetlfl t>uo vf 
triaromnda.inqfcocftftmenmilcpuliciton^ 
gru % twu.i cft illud qr5 cr eo admiftrarur.ij&a 
uc.viu.fim.far.circfl fincm ca.t>cpfiUio fhn trl> 
ftfltione^ecl.-JbfiUwfemeetfmacie vfileecc 
fct)O0raduinfrisidantiu:cjccople|Cioncvcroq 
cftfwfircarionftbumcctarionemediuequod 
dl i modcraf u*0jaf.f m tranfla.grecl,ca.t>e 
pfillio/fciguTliu aur qutnofoUon queficuUvfr 
<untcriftalLu^utfquinnomclla:foliab$carno 
poclionftVia<tafpera.tHrgab3©uob3paImi0 
longacuiuefrutecpilofuofpinofae.coma ci9 
a mcdicf ateincipit virgcin qua capitella *ouo 
ycI rria funt conltricta.in quito fcmen e pulici* 
bus fiienignnt>uru.nafcif in clpis, Sutce. li. 
q.ca.Depfillio.-Jbfilliuquidee-ouoymodomj 
, bvcmalc ct dhuii.i potio cuiuflibetebm fit po 
«dus.ij.5.mclius eTlludqtf emagi8grofl'um.q*5 
fubmcrgif in aqua frwft et bu.in.tj.grad.lMi. 
*«a.t>epfilUo.'£ftUiu berba e fiTis amb:e: b} fe* 
mina ficutfemina Unifed mino:a *zfubnigra q 
fi tendentia ad purpurettat e.qtioul fcmee mcf 
Tiusqtf fubmergifinaqua .oictaeft berbafic. 
eo ep femcu fimile pulict babeat:et idco iftfl ber 
baficsirirurinfra a quibufdam pulicari8;eo 
cp femcn factu eft ad fimflitudinepuUas.vndc 
pfillo8.t.pulejC.3oba. mef.ca.t>cpfiUio ?£>Sm 
umeft t>e alteranttb? coplecionect folurionej 
facieurito.tci9folurio fir.iprie lambufieando . 
£ius aut aliud eft albu.auud fubnigru.aliud 
ad purpurcitatcfceclmlft^ehuseqri eeom 
pletum et grofium.et eft grairius z fubmcrgif 
maqtta.cc^ofltuejrouabusfubftanrosquefe 
paranpolmntrintcr qufl8cftco:tec feparans 
£ftemt>uplecineofiMlria:fc3:^eduUflr$. 
etmeafubftanriaecpanfa fup:aco:ttcem ipfi 
us.fubftanriaautemmterio:medullflriscfl.eft 
et fic.iniiu.gradu,et eft acura vcbemerer.inctf 
fiua:rubificattua ctvlceratiuaKt eft^oe gchere 
vcneni. SSubftantia flutcmcius ecterio: fup 
comcem cftccmulruminfrigidantito .£tt>i> 
cit *Rurtu6.£ft fri.et bn.inij .gradu:ct cjcecflrt 
£t oiicit Pf afco.tit in fceundo.eteft vcrius. 
3 nquit cm brpocraemepidimqs/Ron enim 
cicuarurresfngida umcracumbumida fup:a 
fcoTngradu.£tt>itit j5alicnu8.2?umtdfl res 
«oit tranfgrcditur mcra vfqjfld quampotelt 



cttcndi rcgttne bomihf ftptopfcr qt3 inucnfatf 
bumidueflecaufas-oolomjinquanrubumidu 
fed inquantu poteft efle cum materia:que qul 
ritatefuflmouetur .fld folurione cotinuirfltis. 
0uod ejceo conquaflatiim eft cum aqua fonttt 
um frigida.? fitmufcilaginofu; et bibif ficut eft 
ct ppric cumoleo vf olaru5 aut fvrupo violarii 
foluit ventre5.quod aiit cc co fricu5 eft et con *> 
quaflarur cttm olco rofa?:cft mcdicina flutus 
venrrts 2 •oifiinter icXontritu^ aur c5 nullo mo 
do potui p:opinandum cft. occuttat cm con *> 
tritio fubftanrifl5 etus.mcduUflrem v lcerauul 
etcjccoriatiuam 



f Qferapionfluc.OYaf.'t?abetvutute infrf^ ^ 
gidariua^quando fitcmplaftru^cueoetoleo 
rofflrumet acefo taqua.ct conuenit t>olouto 
iuncrura9.eiapoftematitoquetiuntmradicc 
fluris et coculTioni ncruo? 
fl ^tqn fit emplaftru adramicepucro?.et ad 
eminefilvmbiUriinfantiu:curateos.tcouenit 
adfodl cu olco rofaru^t pauca aqua ct acero. 
^£tqnopo:tcteceofieriemplaftru:acripia^ 
t ur t>e co quanriffls abqua etferatur et infunl 
datur tn flqua.ct qntnfpiflata fucrit: aqua ipa' 
non e;f endaruns fiat cmpla ftru:qm u3m infrf 
gidafinfrigidatione f6ai:etftringit etaufett 
lacrimas oculo?.ct conuenit obtalmie calidex 
•ooloacflpiris qu Ido infundirur inaqua lim> 
fapcnna.fronfifljponifur.-rqnaquaeiusbtbi 
tur.cum?uccaroje)cringuitfcruo:eflcutarU5fe^ 
babm etfitim:ef foluitventrem. 
f EtidemaucforitateabenmefuaY.Scdat 5 * , 
t>olo^8pugiriuo8vcrttri8.*zlenitflfperitatcm * : 
vlceru5 ttnteftino^.-rabfcindit tcnafmon ?cd 
ucmtt>olo:i capitis qui fit a caliditatc.? fucc9 
fOU'o:umcius cftccmedirinis Ifltatiuie p:op? 
tcr frigidrtate^-zbumiditate que (untinco .et 
cura nocumeriei9ecu medicinio ca.z fic. 
f j£tideauct?abicfcmepfillq eftficutco:ian 
dru bmnidu.qn t>atur eteo pa^. fedatinflario 
ncmcolere:zcbulifionefanguini6Cfl.flduftio^ 
ncm fccflltdfl $ acut aru.jEr (i t>amr in poru t>e 
mufriliagine ei9c6ucnubabetito birfcnnkt 
datlitim eoru magnl.t lajcat quide vcntrej 
•C £t fit>fltur in potu erudum et aflamm ftrih' 
git vcntrcrmfimilirer etiam faciunt fcmina Uni ' 
ctfeminfl marrubmm.-r grana mirr i: cft fcmcn 
po:tulace:z fcmcno3imi.lajLantenimcruda ct 
ltringuntaflafa.j£fquflntifa8riu8queoau!r 
t>e pftUio eft.5.rj.infufo inflqufl *oonec egrediaf 
mufallago eiuejctbibatnrcum^uccaro albo 
aut cum iulep. f£t folia pftllij qmndo 
cmplaltranrar.fuperapoftemafain^wcijpio ' 



jBfHjfrbta 



apmnontscourcfrigcfantca.ctlipoftiijrcic 
rb param:c6iKnitcgrif udutito qucfiunt a fart 
gHfne.z nimiscjceo acccpru inducit fineopi5 in 
o:e ftomacbi:et fo:taffe ocadir :quowam nimi 
ttmcpeoeftvencniim. 
<*T £t c ura cius eo cy t>eturtnpommcl buttfru 
cumaquacaltdaetaq aneti ft, f.jlobj.mef. 
■^ftlliu cdcjuaffatu aim aqua fri.iicut oijamus 
folitti6eeduatcolaa.xc6uem'tfe.multeinfta? 
mationisetfiri vebcmetcca .etfedat infiam 
mariooiie fpiritaliii:et lenit pccrue . 
$ £tconqua!Tamfiaitt>i):tmu8 coucntt flttf 
jtuicolerico et ©ifiinterte:? fluaii meftruali.-r.p 
p:iepoftpotuTcamonceetmedicinarumacu2 
tarum .DoIiset^a.M.vfqsad tre6.rimeat aute 
tpmbabens Ocbiliraremvifcerii. 
CSuicenna O.6etco frijcii z inuolutuin oleo 
rofarum.-ftipticu cz fedart>olo:e mo:e empia 
frrifu^pofitfjcuaceto.Bdminiftrafeiiacort^ 
quaffaw cum accro fupev apoftcmatacalida-.-r 
fosnica t berifiptlam/r,jp:ie quefuntfub aure 
etfugftegmarica:fitei;eo emplaftru? tenfionf 
nemommttipfoMjmfpafmorpodagrc.too* 
lo:itoiunctura? ca.cum accto z oleo rofarunt 
couenit fi ti vebemcfi colcrice.etfq^ et eo friicii 
cft pondi is.ij.5.2 fniiolumm in oko rofarfi ttri 
gsr et conuenit oii1tnrerie;z,jpn'£ infanriu:? q<5 
e.dpfo mufcillaginofum cir . i ipa mufcillago 
ipfttss oimoleo violarum folmint.fi bibatur^ 
tnncfedabitinfiammarionemfeb:i«macuta? 

Capitulmii.fftteuiff. 

DOkguim.DYafcoadcs/fbolcgtiiom* 
nitoeftnotul^uiusvirtustermantica 
cft.cpbcrbario.^olcgiumsfculuseft 
et fcmina.*/£)afaiiue ftorc babet albtl.^cmia 
rubcum vmicp.<"i iMateari 1 ;. i>oleum ealidit 
effaficcuinrertio gradmcuiuevirms cofiftitf 
folco et in fioavEempore flomm colligimr; et 
perannitmferuatur. 

^>pfrationf0. 

^Dvafco/^oIcgiiTcalefadfnimis-rcjrfenuat 
t»e fo:acc et palmonc pingttcs z vifcofos bu 9 
moice factlce os fpuere fa cit.'Haufeam z moz 
fumftomacbicumpufca bibitum feparatni? 
gramcoleramperventrant>eponir.atmvino 
bibtrum mo:ftto vencsiatio occuhr. 
<fT ^iccusn-rcombuffuiii giiigiiias eofirmat 
cum polenta adbibimm omtbus tumo:i to vti 
le eit S>oti«n impofimm medetiir podagric?. 
f Ccrort'3miwtmpapulasltmpidat Sple? 
nericisimpolittimcurn fale p:auos bumotts 
qcurif.3nbaIna'8infric3m5p:uric»nemtoUit 




Jbmento fumo!C8ftcricosmifigaf:0do:ct9 

naufeamp:obibct 

fXuffientitepwdcft.-zcioiurstiaivaldc.l^i 

iusgcncra t>uo funt. falicct mafailtie qui flo:e 

gencrat albuin.z fcmina purpureti^. 

f *J>lateariu8.i>oUgiu5valetcontra frigidu 

rcuma.tiinu^-oecoctionisciuscotcafrigidaj 

mffim ep glutinofo vtt aejfo bumo:e.c6tra 00 

lo:cm ftomacbi cpfrigidit atc ct veiuofitate 

f £cberbario. Simfansin vtcro momius 

fiicrit.buiu8tre6r2mi reccntc8fritt:etin vino 

vcteripotatimircfanant/aalcfradveficcvl' 

calculi 2 ad co:di8pecton9:ftomacbi;to:aci9 

vet>olo:em. 

f i>liniu9 lib:o wcimo.^bagna eft cum mc 

ta focieras ad recreados animo fcefccros, 34 

o:is vlcerafioie zad tuffim cfficajc baberur 

$ 5k>s recent 18 incenfue pulices odo:e nccat. 

2ld bvonan cumfatc eft vrilc.£ftarc caloJcs 

ftdati 

tff ^accr.fcruida pulegq visficcaq? fcicifur 

cflfeZlertius a mcdico 'oartieeft gradus bnic i 

•t?troq5.S>epiuebancberbam ftp:cgnans fu 

mitabo:tit.*^cnltruat»eduataJ5vinoTtim^ 

pta rcpente.^occe modo tardae bec ejarabit 

bcrba fccundas . 



$i 



&\ 



r. 



iC-J 



ftattattts 



"*m, 




CapiralunMfdjEtjE. 

*2jrVOpuwearbo:1!Sadecta*f!Sopulu83r 
•% Ibo^maebabsfpee.vnlDvaf.ionofa* 
.♦^ dtcapiMa.tmu fic incipit.-fioputfcjs 
ImcefciciiftfcSuudficSgirioe.i.^oputtis 
arborquajalqlcucevocat.-jc.infincca.Sllici 
jnqmtpakibefarborisriuelacrimumorida 
num & ffttllatum fuccinum facere.tNrabe xl. 
Buicen.fimiliter faafouo capla. unu qt$ inct 
pitbaurrorranuvolee©icaeagiroe:vt!^af 
co.t>icit.3liud akirofa. *£Uni9tria gcncra po 
puli f Jctt.alba.nigra.et que limbica vocaf mi $ 
nimafolianigerrimaalba foUobicolo: fuper* 
necandicae:infcrioiiparfevtridibinc.nifira.q 
muemacircmafcrofunduaa's.fo.funtvctufti^ 
oratnanguioeejccunteecontrarioedcreangu 
lofa rotundantur 3fi6*-p>*pul9©ictacft:eo q» 
cpciuecalcemultitudo nafcatur.Cuiuegcn9 
duplejc.1Hamaltcraeftalbaalteranigra.2lb 
ba populus 'otcta cft: quia fo-auevna partc 
funtalba.alfcravirid!a£ftgbicolo:bne qfi 
nocrie eroicinotae.Scnerat ertareftnl:q elec 
tru noiatur circa eridanu fluuui.vel vr alq me 
mo:anf i finifo fyrie.Bmbw.SicoIo: elt fljfe 
arbozvicsco^nievmbwfavicmcflw.^ltni^ 
li.U .*4£>6ree amar jpfe ficut i bup9. nec nifi in 
ac]fie,puenitipfs,ficutnecfaliEnecam9.un^ 
caeyo folio^cuwfq5£manet in fup giie.ptc 



^populo-recTcreXriauJrJtpopuKgfiajtfcDJ 
alba z nigra i cj limbica aflKllaf mintma folio 
ac nigemma fungifqjcnafcenrito .iJccctiam 
mcns clt Buicenn e et alio^auf o:u. 

i&pfrationra 

% DYaf.*fcopuluearbo:calcfacit? bumectat 
mcdiocrirer.&uiue co:re)c bibira tftbtadicis 
mcderur.er ftranguirqefubutnu.^ulti efil 
siciit q? cade bibita cii rene vel v:ina burdonif 
gnare no pmittit. fl £iue folia bibita poft pur 
gationemeftruo^ fimilimococeptuno admit 
tunt.©uccuefolio?.eiu60oloutoauriu fub? 
Hemr.<J Succusfianintsei^mellemiittusca* 
UgmcsocuIo?t>ctcrgit.3tefoliacuacctoca!? 
ibaplafmata podagricis medenf .f £5 emen 
vero cu5 aceto bibiru cpilctieos curat. *Refina 
«iue virture calidio: cft.et malignatito vtilirer 
mtfcef .Sliqui etii perbibent buiue arbo:ieU 
crimiirodanutriftillaru etcoagulatii fuccinii 
t a< ercquod rrirum ac bibirum folutionee vc? 
tris conftringir % ftomacbum rcfic tr 3 c fluo* 
ron fanguinierep:imif. 
fl ^onltanrinue.-fiopuuiscaUdacitetficca 
in^iuno gradualiquanrulum babensponrici 
taiieXoleram rubca m purgar.*£:oddt eie t\ 
*soio:em babent in capite.aut apolicma vcl 
$dropifim.conftipatos etim vcntres purgat 




©eSjfibie 



Capituttmitftl#. 

DOlipodiularincgrccctiipreTie . arabu 
bifbevg.vdbiftcvdnUaca.Serapion 
U.ag.ca.bifbCYgaua.pYaf.;6ifbcrg. 
Cdeft^oUpodiadtplaMnafceetn rupihnin 
fatietinmurie bumidie antiquietfup. Ihpi* 
tce.niu;ta radiae antiquay arbouimmapmc 
quercue,cuiue logttudo cft vm'9 palmtVz climi 
Uebcrbcocccbaracoe.tfuBipmfuntpiU.tdt 
alra Xy no ccicauatio ci9 fubnlis ficut baracoe. 
cc b) radicce fug quae funtpiU a qua egrcdiu^ 
wrrami.tradijccfimilieantmaUquattuotdO 
cim pcdu.qd nominaf fcolaca.i4colopcndrt» 
ct firofltt udo eius eft ficut ©igitue.t co lo: ciua 
infcriuecllviridisadalbcdinc^ecliuiotoul* 
ciefapone.tcftilla qccdit in vfum medicinc 
pvauca.t>epoUpodio.'j!Solipodtijmnafatur 
in parierib? bumcaie z circa mdicee arbo:um 
rcniftariiinqucrcub?.*RadiceefunttlIiafperc 
ctilU0atcftcutpoUpue.groflirudin€t)igitiba» 
bentcs/Rofa vcro t>rinrue vii idie ct fubaibi* 
da apparer.*£lini9ca.t>zioptert8vcL t>iptcri9 
inarbotibue nafaf filici fimilis tenut foliomtn 
fub sulriujincifura radice birfuta.xc. 2bocno 
men vidcrur copoittucc t>:io quod cqmrct.z 
ptcr ie quc cft filic.fcriopt crie fcri pfit £> f epba 
nue.t aU'quit>icut q> voeaturf iltjc mafculue.f$ 
fiUccmfcminainuenieefupcriue scf.in.ca ,ec 
0alicviq,fimfar.capi.t>cpolipodio.infapo; 
reeiue cft t>ulcedo a il tpticirae.airroe cius c 
qucocficcatt>cficcarioncfo:fifincmouiicatio 
ncctcft lajcatiua . ct babet vim putrcfacriuam 
vndcetpiloenudat 

Sptrattonre a 

f ^obaneemefiicca.sepoUpodio/fcoltpodi 
umcftradicplantccin9 ouuscftfijfi arbo:ce 
ct fup. lapidce.£t vocauit ca grccuef ilicej atf 
bo:ie.ct ilUidqn nafcif in lapidibuebumidita. 
te babet fupcrfluam indigefta faciee ventoftta 
tcfubuerfionej et nanfeam. Ocru mcltus cc co 
cft arboieum.ifinie quado nafcif fupcr arbo ♦ 
remport<ueglandee.«ftcu ( |>piietatibu8bo* 
nis^oiopacqtJcftgroiTum folidum inodo* 
funi.za«'uecoU3:participat aliquid nigredio 
acrubcdiniejfedparu.icuute confractum cft 
ficut colot fiftiri.etinquo cft aliquid er aroma 
ricitatcaluideftincui^fapo^cft^ulccdoajj 
tnfipiditsrc oercUnqucne th gultu aliquid ep 
a inaritudine vlrimo.fr qttod e recens 
* f £tideauc.PYaf,ca.eliin.iitfic.in.q.£t id£ 
flac.t?ali.ca.cftetficinfccudorefolutiuujbu^ 
midttatum groflaru ac vtfcoferij,et etficcati* 
uum.a 3bftcrfiu»?refolutwu.ctcft cjs matfmc. 



tcficcannfecfci«cfluantiteco?pu8.':facitfub 
Ncriionem tnaufca.t efteiue opcrario scbins 
ct tarda.etroUiturab ce nocumcnrii primuw. 
adminiftrando illud cujaqua mcllie.et aqua 
paflularumctor. 

f j£t ide aucttumav coquif cu farc gattopi) i 
crgaUinaru:ctfit folutiuubonu.t fimiUfcrcum 
aqua cafd.t fit fo lutiuu eottcniee.? aufcnint ei 
nocumcrii fecundu.fi admifcetur daliquidt>c 
confowantibusftcutfuntlcmmarcdoicntia^t 
fpccic8ficutfuntt>aucu6pu>p:ic(tanifi.etfe'/ 
mcnfcniculi jinjiberct fimilta :t>ecocticnc au? 
tem fufltcicntcm fuftinct 
f Serapion auc.p vaf.llbabct virtut e folum 
t cm .t>amr vero cocta oi turc galuna nl . ct olc* 
rtbueaut cu pifdbtte et cujmulfa aut ficla aut 
fimilib?.ctmelancoliaetfic0mat>cporiif. J Ca^ 
tbaplafmarito adbtbir a condilomata anifol '/ 
uitxtqnticficcafetterifefoafinporucumelli 
crato purgat ficgma % melacoliamxt quandc» 
fitcmplaftruaimcoconfcrtattruionibue ncr 
uonmttfciflurietiigitoiumtcmotroidib?. 
4 j8tideauc.BbcnmcfuaY.^p:iciae ciue 
dtpurgarcmdancoua.et ficgmaftnc punaio 
ncetmalicia.ctmdui8 eccocftcitrinum. 
cuiuefapo^vcrgitadcopuncrioneet grofltttt 
dinem2t>uiccdincm.'rgroflimdoeiu6cftficuc 
t>igitU8.j£t qui vult ipm fumerct>ccoquat in 
flquaficlettecoctcetpoftcabibat.quandoau] 
tem vie poncrc in oecocttone no opoaetrt rc 
criftcceipmaUtcrnificptcraftmifccaturcum 
cie.pofi8au8t>ccoctiaufinfufiefta.j.iiivfq5 
ad.v.rtfineticcocfioncaijtfincuifuficnca.j.i« 
vfcpad.ij. 

f ^tidemauc.mdcba.^op^ctae polipodti 
dt purgarc Uuitcr mdancoitam.et bibirur fimf 
plicitcr cum juccaro .aut m ijctum cum aliqtit^ 
bue occoctiombue aut cottfcccion tfcue.£ t ir/, 
gcniarifunt aliqutmcdicotujad illoequi noit 
potcrant aliquae medidna c acapcrc.p:oij cc^ 
rcipfum tritum in aliqutbue dbis if fo:um. et 
purgat Uuitcr mclancoUam.P ofte ciue fimpli 
riter cum juaaro eft.j.ij.tccoctiautcm cu mc 
. didnic.j.tiij* 
f 3obannc8mduc©olufionc cducit colef 
ramnigramcttjfadlitatcxtgroflujficfiroaet 
mufciUaginofuj ct mataiae iuncturar uj.t ca 
fctt coUccf m omnc modum adminiftrat ionia 
cuiect tmriciri fplcnie.ct p:op:iecum cpttbimo 
crf.Ucindo. 

f j£tc6fcTtadfcb:c8mdacolicae.T ( np:iectan 
aqua mtUis.tt fanat fofiurae quc funt tnmani 
bus.pofis ci9 « a.^aureie vfcp ad.iiii. 
f SuiccnnamUb» cevinbue co:die t ictr <g 
coLfo:ucco;. 



tr 



I 



CtartBfus 




: <Tapttulura.KdjE)E|. 

£> Ucaiia. larine. grece c oni^a . arabicc 
'. p gafir.pvaf.ca.fcejConija.aUa emaio: 

arq> odo:e grauiorva to parua ? odor^ 
jioaldajinrcrbae aUacftmcdia grariabilioris 
bderie.qua?prima appeUata econi^a lata fi? 
pcvani ie.vcl vrlarim armcnraUs.jfrefctfa vo 
catur eria iaba noris.fiue vclatim piper marina 
yelftWfcar9,inedia appeUaf etia eonija caCale^ 
O6.(tucvtlafinifbimu8minor.maiorauczmi 
no:com5abmfolia fimilia oliue fed afpem 
putgiiia z vtfccfa minorie £o fo.odozatafunc 
maiousgrauieodorie.queeria infruticc ma» 
ioi eft.virga ma)'o:i8cft Iongitudini8 cubiris 
©i!ob?.minorvero vm9pedi8lp#rudincpor0 
fccta e.flo:efragile z mellinu babes colo:em;t 
«maru fapore.rcu florucrit velut. capilloe fat 
jQt/Radiice ilUinuttU8:0alie.vtj.fim.far. cap« 
f£onija.i.poiicaria tamaio: cp mino:fiTi8func 
jcpplejctois z virtwie.tnfluftu quidcm aereeet 
4imareapparefe8.caUraciutvaldc.afitcfruc# 
tiiolaeft plat a.£lt aut et tertia fpecies polica 
m in bumidiorib? locts nafcee fetfdio: amba* 
,bU8^x>cbilio:.f;tucp:imc sicre tree gradus 
funt in calefacicndo z ficc ando* 

. 0ptrattonf0. 

3 f O i8 fruct? cfi foltj 8 fufe f umigio adbib iu\ 



ftippoftta ycncna logt9 arcet aq ei9 fperfa putf 
cesnccat. ^olia ci9 in carbaplafma tite adbfoi 
ta mo:fus venenaros mitigar:tto werito i pu V 
ftulis medicanf.f 5Io:e8ci9tfoliacumvin6' 
bibitameftrui8imperaf.Sbo:fu5faciutvrin5 
puocatXo:riottou»bum'ut;frctcTict'8bnad 
bibenf Ca accto bibita cpileric] pftat effectur» 
f t lijratura vcro eo?.fometo abdibita caufae 
matrictspponcr.f S5ucc9ci9fuppofit9abot 
ulfacit.olco mijcta -zfiucta tuta co:ga ? frigcaa, 
fuat. mino: fo ipofita adbibita catbaplaf; 
matib? fcolore capiris mitigat .mcdia vero co- 
nifa bafta babet grofia3 et teniafolia . ct paulo 
maiora.'i&aior veronoptriguia ncc maio:a 
bjfolia.fedgraue^aaatiaodo^eguftufuaucj 
z itturUe oito.f tUperas* fcrpcritcs fugat . £t 
vuluc vitia remcdiat.maio: z mino: comfa caf 
Ufacit z ©eficcat.occocta igiiin oleo ad perio 
dasfcbuii? typos z maltciofo8rigo:c8gunc£ 
ta facit,f $\oe cu foltje in vino potat9 fet9ep 
trabit.z vebem&er mcftraa purgar. f 0aUen9 
£5i quis folia cu mollito ramufculie appofue 
ritalicuiparticulcfiue^ecoqueeoleo^tafuri 
f Uidcf aute z rigom 4 f m periodu aUcuiattf 
uu b^oleujlo^eo aut co^ fimtlie virruris funr. 
f 0uocirca quidact bos cii folijs tcretcs oleo 
p^opinant graria mouendimcftrua violcntcr; 
eteduccndiembjionee. 




■ 



Briftrbfe 



Capituutm.frrl#i}. 

DDu'goma.*£adecta/|!Soligonia a go* 
mi qtf eft genu/Ra": multi genicttfara3 
ctcditiinodia vocat. feu agoniqtfeft 
feaie.^Rapyaf/f^olicarpoe vocari ©tcitq^ 
roagie cft credendu.t bcc fanguinaria z coivit 
giola a multie vocaf/z l cp virga paftozie ara. 
vocat;vtpt? p. cocozdia ?5vafcozfdie ca.o" po 
ligonos.z Suf.ca.oe vtrga paftozis. 

©ptrattont0. 

f Dvafco/fbolfgonos mafculus bcrba e vfr* 
gae fcfae teneras molles z multu nodofae.-z ejc 
panfaefufitcrraficutagrcftie.foh*b3ruteftf 
milia:fed obloga z molUoza.-z femein foltje fin 
g»f.vnetmafcul9oicraeflo8illealtotfenicc9 
f *f>oligonoe vero femina frurejceft vna vitf 
gam babene mollem z cannofam fpifiajt no 
dofam:tnquitonodiefoliafunr pini fimilia« 
•Radip e tlli inuriUe.in lode nafrimr bumidiei 
f ^linius.^oltgonu grcd vocant qua5 nos 
fangm'nafiam:n6 artoluf a tcrra.folrjerute fi? 
mitefcminegraminie.quaplura gencra poli? 
goni faciunnbunc marem mtelligi volunt :ap 
peUantcpamultifudme fcminieaut •oenffrate 
frutia'8.Slq pougono a frequenria geniculo* 
rum-zc.fl iS»tcpbanu8infYnonomi8.-J!SoW 
gonoe.ideftvirga paftozie.v pzo v fcripfit vt 
alTucuir/z inWraimida poligQnoe.uozrigiola 
mulrigonia.ali) vcro camer jillu ©icunt. 
4 •fctimuelibzo.icicvtj *|i>oligoniii grecf vocat 
berba qui nos ©icim9 fanguinaria.a rcrra no 
artcMturfolqerurefimiliegmmini. 
«ftitwccue «U8 nariko tnrufus fanguine fuflJZC 
mir.£tpot9rii vino cuiufeppariis .pftuutum 
et cruenraecjcecrarionee inbibet acfiftit. 
f D vaf/fboUgonoe mafculus bcrba eft bne 
virgae renerasmoUee ac mulrae nodofae: ct 
fug rerra ecpanfae ficut agrdUe.vn z polf eatf 
posofctacft.ftoetilicftaltoautfemeeus.air 
tutem b? iiiprica et/rigida3.13nde fuccus riua 
btbirue medieaf cmoptoicis % abftinet reuma? 
rifmuvcntrie.mcdef qnocp colcriciez ftran* 
guirns.vzinam pzouocar.2£wzfito venenatis 
cum tino bibitus oecnrrir.3 cbzito periodicie 
maicimepzodcftante boza aceeflionis 
f Sfajpofirue 4? flupu mulicria coftringtt.au 
rium "oolozes eopefcir Xocriicii vino ac mcl? 
lecuratvulneranature. 
f 5olia eius carbaplafmara cftuattonee fto? 
macbi toUunr.£>anguine retjaetito fubucntf 
unt.betperaecurant.3gneTamleninguiit.tu 
mozeeacxmriciee tollut.f S» aguinercqcien 
titovuwcritomajciepfunr.*fcoligono8 vcro 



femma frutet; eft vfrga bneinolle z carnofa m 
<x fpiflaj.-z eft ramofa pinguie atqj nodofa . m 
quitonodiefuntfoliapirifimOia. 
§ *Radip eieft inutilierz nafcif in lorie bumtf 
die/Oirruecft ci ftiptica.? facere pot omnia fu 
pzaferipta licetminozcbabearvirtufc.jEt fci* 
aecffeberba que&pcra fiueburfa paftozis. 
se qua fupra in a.cccnq/oictum cir. 



V 




£apiffltom*ariRfi^ 

DOlio.3ltdozu8.i>olio8 a greciesicif. 
alatinisomimozbia:co cj-multfs mo; 
bfe fubueniat.Tlafcif in morito z t>u^ 
rfe locie,t>e vnaradice mulrae z tcnuee fibzas 
nutrit.femfnie plenae.3n fumrnitate bab3 cc» 
rfmbos canefcentee odozie grauie z fubdulc^ 
<ff •fbl3teari9/fboln, ©iuerfa funt gcnera:f3m6 
tanu pzecipuu. ^um flozespducit tebct coUt^ 
gi.Uirtutc5babettiffoluendietcofumaidiec 
©iureticam ejcfubtilitate fubftanrie. 
<(f pYaf.^oIiovnumeftmaiue alterum mi^ 
m»e:id ef t montuofitf quod nobfe venit in vfii 
£teft frutejcalba z tenera .babene foUa vniua 
cubitil6ga:ifupervirgam capircltafcmte pte 
naaquo^ceditquafitanicieealbai-zvcluta 
pitli logi babee odozc cu fuauitaregrauem. 

0ptrationr0 



CractflW0'. 



% f yMoim&iicaieeiue aqua coctus a fer » 
penrifo percuflbs fanat.Sjparfam in aomum 
vd tncenfa cmes ferpetcs fugat 
f •{Matearius.ainum ©ecocrionis cius valet 
conrrafrigidiraccftomadjisincdtinow %x>o 
lozejcpvencolttate.Contra opilationem fpltf 
niaeteparisvalct» 

B f Dvafco:idc8.£uj8 eltjcatura mo:fito occur 
rir vencnari8:magniicg pjdicfiu eft bydropicS 
Scero mijcco fpleni adbibetur vtiUcer.2>5t>o* 
lo:cm capiris comoucrrzcafiomacbu eft.ven* 
cre5 molUr.mcftrui8 imperat.refq5 vcncnaraa 
ejtfingaic.CUinam mouet.ftratocp copofirum 
ferpentes longius arcet. 

£ f £atbaplafmariivulnerito cdfcrt.reumattd; 
paracolefimfacir.? arcuaromo:bo fuccurrit. 
f Buicenna.i>olium eft fpccice t>e cbea lin q 
v P eft calidiras ct acnitas pauca. Ouod ep eo eft 
mmnscfacuriusefamaruts.EtfuntincotYr 
fierfiores. 
f £ui8capufdtvtfpera:in quo funt quafipi 

fc \i albigrauio odoris cii aroinar icirare aliqua. 
2£>aiu8 eftaurcoebilius:qdnecamarum e.z 
acusras quedajin ipfo eft.'ibonranim) min9 
cft.cr minus qitidem eft calidit cr Itccism in fecu 
dogradu.fiftsuteaperifiuufubnliatiuii.er^p 
p:ie minus eft ad opilarioes inrrinlecas aperi 
endum. 
f 0uod cc eo viride plagaoreceres cofolidat 

S er p:op:ie maiue.quod cjc eo ficcum eft.vlcera. 
fraudulcnra p:ecipuc minus. 
f £m\ accro epirbimarii couenit fplenis apo 

£> fkmarico2t>uricieieiu8.facuaufcmcapirifo 
da.nocetqsftomacbo:fed pfert vctericie nigre 
p:opu'ecpmaio:i8t>ccoctto, 

*> f Xonferreriam eadem bYdroptlT.^dem pto 
uo car vrinara et meftrua.foluit vcnrrcm:et co? 
fert afcaridito etanriquis fcbrite.ac fcojpioia 
punctionito. 

[~j tf pecocrio maio:is mo:fui vermium vcncno 
fontm ommit p:oficua:ercj; ca fnrrumigatur 
ac fternitur.er fugar minosa venenofa. 

iJk € £onft anu'nu9,i>oliumeftcalidum in fecift 
do gradu.ficcum m terrio.£5umo:c8 groflbs 
artcnuar.tialer bvdropfcis parictibo p:optcr 
ppilationc epatis acfcltio z fplcnis. Orinam et 
mcftrua,puocataenrrcm foltinv 

X f £um acero bibirum va ier contra tmrtciem 
fpleme.£fciu3apo5imap:opinatulumb:icof 
Jucurbirinoserafcarideaccciudif.AIapitista 
meu t>olo:cm gcneratcr {romacbo nocet .£>i 
©omus ejc ca lurrumigerunrepritia indc fuga? 
tur. 

Capirulum.tf ri&iu) 



l« ■ 




D 



Dlitricon.t>Y3fco:i.T>oUrricon gatf o 
)urricum:quodadYanto8t>iet'rur.bab$ J* 1 
folia co:iandro fimitia infummitate -X'\ 
fcilTa.bafta eius elr tmabus palmis longa:ba Q«- , \ 
ben8fup:afcturgida capirella fcmenbabentf r»t>t 
ttaj-adijcefttllivrilts.Scdvirmscuieeftinfci l r 
l«8; 

0ptrattonf0 

f Dvafco.t5i8fiqm'demtnaquacli]Cie.a.qua 2 1: 

tpfa bibtta medicatur afmaticisettnfnoicis: 

Yctcriciscttjiuurrrjs.calculosfrangit.vcntre 

ftrmgir.morfuscaninosadfanirarcm perdu^ 

cit.reumaq5ftomacbicompefcit. % 

f jQum vino bibita menftruis imperat^abor^ # i I 

fum facinet fanguinem rctjcictibus fubuenit* 

mojfito quoqj vcnenatis occurrit. 

4 aiopiciactvlccracapiti8.f.q8acarasvo; i ;' 

cant:ct ptcrigia purgat.fcropbaftp fpargir. V/ 

pofitaqnidcmtrita-jmijcta cnmltciuio addt^ 

to cinereac vino td p:eftat. 

f £ omefta a pugtlibo ad pugnam vtilitcr cc^ I \ 

fo«at.S pcconboetiacomedifur. 

f 3tempoUtriconinloci6vmbwfi8atct.pa; i 

rietito bumidiset circa fotttcs nafcitur.alq ta 

cpreco:po»tiuam t>ecoctionem tardis ctiam 

pafltonibus labo:antibus t>ant in potu.f, ba^ 

nelon'8.ftomarici8fluo:iventris;ctint>irTicuI 

tatcmijttus. 

f Deficcac emm ^dimtoe etejct cnuat.idcocp i '■ 

cbYradias ©igerit .apoftcma et lapidcm rum^ 

pit.*i>ot9adbumo:e6gIminofo8acpingue8 

t>e fo:accadpuimoncmafccndcntc6 bcnciui 

uar. 



MksWs 



C •Renma ventris conftringif . mediua em cft 
inter caltVz frigi.temperanria53rt txHori colli. 
fo .cius trica cum granis piperts ac femine co 
riandricumopnmovinosaturadbibendum 
introcuntibalneum.facit z ad capillos mulic? 
numendostftKcoquarurcumoleo. 




£apttuIum.fttIjE]Eii. 

DO:rumlarine.arabiceeurat. S>era.lf* 
ag.ca.curat £urat,t.po:n5.£ jcco c to 
mefticuj-rcftbifpanial.-z cjceo eft naba 
ri.etcftmontanu\?ejceoeftpo:ruvinee.etpo: 
rum agreire.zmcdiu inter po:rum z alliuj . tx 
reperitur vtrtus buiue inter virrurem pont z al 
U}.ficutinucnie8rilege8capit.]ciiii.j£tptopter 
ijoceftmagisceftccattuujetacutum qjpoiru 
ioomefticum.er cctera cuncta agreftia acrio:a 
funtfcomcltici6.£tmedicinequecalefaciuntil 
tae3lefactionefunttnfinegraduum.etobboc 
. cfl malum ftomacbo.et eft acutum in cifiuum 
groffo:umbumo:um magieapericiuus ppila 
to:umo:gano:um.et eius opcrario eft plUe c| 
t>omeftict.£t ( fl?ter boc p:ottocat v:inam z me 
ltrua.potiffime qnrerinenrur ^pprer bumo«8 
frt'gido8groffo8.£tb5tm©ccalcfacri6cq < vt? 
fccret qnafl)licaturco:p.iecteriue.£.tno8 tam 
fcirimus cpomnes medicine que calefaciunt 
tlia calcfacttoe z vlcerant funt in fine graduum 



f £>cra.auc.DYaf/jbo:rii pomefiicu indtat 
libidinc:? qn mifccf cu melletfit inde loboc? co 
fcrt fcolou peetorie z vlcerito pulmonie.-z qu .i 
do coinedutur ctil mudiftcatcanna pulmonts 
ct qn quie affucfacitcibu ei9:inductt obfcunta 
tcm vifus z e maul fto.macbo. f £t qn acj ci 9 
mifcef cu mcllicrat o z ejcbibef :coferr m nfibuo 
vcncnofic.£.rqfifi'r emplaltrgcu? po:ris ipi3 
ct ponit fupw locu mo:fus facir boc f £ rqua 
do mifcef eumolibano z accto ? lacrc? oieo ro 
fato.: ©iftillaf tn aurcm. ccfcrr t>olori cf9 i tin 
ititui c\ fit in ea £ t quado fit cmplaiiu; cum ci& 
ct fumaeb:aufert vcrrucae.£t quando fir tW/ 
plaiirucn5ci8tfate:mudificatvlccralo:didiS. 
f £tqnbibtfe]cfemine po:rr;grsnte mini. 
ana^ii.fimultriti8 1 abfcindutfputu fsgui nis 
anriquua pccto:c.f £tidemauc.ftuffr|!bo: 
ru^puocar mcTtrua z fetue;? anfcrt eructuaiio 
nce aeerofaerzmoiiic venrre.f £ t idc auc ,3a 
dctVfbtopzieras aute eft cv t>elrruit ©etes i gin 
giuas.f ^rtdeaucto.Sben^efuaY.l^otf 
cct vefice z rcnifo qn in tpiis vlcera . £ t folia 
Po:ri ©c feni coferisr matrici ct^pzietar c que dt 
in ei8.qm cft tncis bumiditae q facit lubucarc 
ferum.2 femenpomquido fumig^f epco an9 
t>cftccat fiftulas que funtin eo.f 2> cdpo:ru 
vince eft ©eteriue fiomac bo.£ tci i csAidins et 
ma gio p:ouocat meftrua .et quando comcdif 
confcrtmo:fui venenofo. 
f "Ibauluscapit.ticpozo.^omim aduflu nitf 
ptumcummclU etinunctum curat ragadiae 
feufeiffurasquc fiuntinlabiis. (ff 3ftdo:us . 
•f>o:rti8 di otue cuius t»uo fnnt gcncra.vidcU 
cetfecriliezcapitame fl -jbaltadiue lib:o.iiij. 
^nnicnfefcbtuario couenis pc:rii fcrere^Que 
iiic-.tilem veliepoft fcuoemcfes qua fatuecft 
porme cefccare mancntein arciefuie ©5 <M 
pitatft rariue fcree.^ 3dem in li,vi.3n mert? 
fcmaxo planf a po:ri traffeitur:vt riganoiiib) 
ammet .f 3dc3inli.ct'.3nocfob:imcfc po: 
rum verno fatum ceuenittranffcrre vtcrcfcat 
in capi£c.^3>ie fan ulieaffiduecircufodiatur 
S»edc6p:cbenfapo:ri planta velut tcnacito 
alleuetur : vt inanitae fpacr) quc fuberit radi? 
cibueincremcnfo capirse ftiflplcanir. 
f ^faacfSoiruscatidusri i z fic ueintcrtfo 
gradu.quodcemficateiuaponricitae.ondc 
fanguinemenarib; manante ccliringi .iSk 
f m cibum illaudabilis cft.fiocet enim l toma 
cbo :faciert8inflarioncm acvcrofttatem. 
4 ti^ pocrates .*p>o:rus calefacit ac ©eftcca*t 
nimisepar. ct fplcncm apcrit vetcurat:fol^ 
ucns quccp conftipata in eie .^bowccm put 
5 « 



& 



'£ 






t£> 



•B 



ICrarrau» 



wonem purgar.U d aurium quo<£©olo;c"t>ui 
mrnufaat:acgnaree¥crericoepurgar. . 
4 'i^acer.jinmultiecaufis vfusmcdicamic 
po:ri.C^iritr t^pocras mcdicine matimus 
auro:.3pfiu6fuceu folumfcedit ipfc bibendu 
£ grotie que rcqciunt fpumant ve cruotem . 
£iuoeemoproico8 foliti funtoicerc grcaXu 
gWomibmc cllii tburifuefarina 3 ur ge? 
sraa w gmie po;ro£ uitunie vnanuu 




CapimUim.trdjrj-u*. 

»*Rofcrpinata grcce.araJ3arfiarbar.la 
rinelinguapaffcrinjrt in lingua pcrfi* 
ca "Dicif pcrfoidamiicStta.libto aggrc 
gato:i8.caprru."i?arfiarbaYaucto.D*;afco:tf 
dic. t5arf iarbay : id eft pwferpinara. cftenim 
WcuUieetfcmina.^afeuuieelt bcrbaquc 
nafcirur omni anno.*bec babct ramoo feu vir 
gasreaae;mollce:fubrilee:nodofae.cr**4K v en 
diturfupafacicmteiTcficutgramcn.jEtfolia 
babct fimilia folijerure . ntfi qnia funr molho 
ract longio:a.j£tbabct iujetavnuquodcp fo* 
li'amfemen.ctp:oprerboct>ia'rurmafculu8.et 
1?abjflo«m albujctrubeu:Sfcdfcmina bab* 
plitaparuactvirgamvnicamtamtencramfi 
wtlem canne. etbabet nodoe fimilce nodia 
quifuntinradice canne.ctinnodi8ipfi8 fune 
ioUaefirdioKiadbipuivB-fiafutiilufolqapi? 



ni ct babct radiccm in qua nullu eft utuametu) 
nafcituriujctaaqua8.X?eclatine vocaturcan 
da vulpis :que el t virga (iue burfa papiotie ; fi^ 
cut apparet in capitulo.*£oUgania . 
C j3aU'tnue.viitfinpUaumrannaco:0.*|!s:o£ 
ferpinara bj quid luptieiraris.pominaf vero) 
in eo aqTa bumidirarie vt fit in f ecundo gradu 
et infrigidantib? farmactJ8.vcl in tertio f m p:i 
cipiu.^ p¥afco;ide8.-£:ofcrpinara berba i 
q babj virgulae tcnerae 1 mollee 7 multae n o 
c fae 1 fpanfae fup. rcrra ficut agrefiie vnde % 
poUcarpoesittaelt.ioIiababetrutefimiUas 
ficut et obloaga et molli3 ^t fcmen in folq 8 fin 
gulis.vnde? mafcuuiesicta clt.f.cscftilUal 
bueautfcniccue.Oirtutebabctfrigida et ftip 
t icam.*^k)fcrpmata femtafrutejceitvnue. vir 
gam babetcannofamct molkj.fpiflam-rno » 
dofamait quibue nodiefolia funrpini fimilta. 
'Hadiic eit illi inuriUs/Rafcitur locie bumidtf 
Oirt^eSi iUifuptica.j£tbcclarincvocaf &au/ 
«iavulpis. 

©prrationrs 

C J5altcnue.3uuat iracp ejcufios ftomacbo 
euenue ajplicata fir bcrifipilara et calidoe flc 
moneeaai etiain ralia etiftentia repercutit rcu 
mataxtcrindevcro ficcariuu cuitere:p*opter 
quod berper um bonu cft farmacum et vlceruj 
craUo:um euidcnrtflimuvcro ficgmonofbuij 
rcumatomm. qr£iraufem ifanguinofotum 
vulncrumcofolidatiuu 3uuatveroadvlcera 
queinaunl»;crfi pusineiefurTiciens fucrit id 
ficqsf .ptoprcr cafdem vcro virtutccet fiujcum 
muUd-^fiitit.,£f*oinuitcriactfanguiniecdtt 
aionce et quccu qj immodcrarc aliundc caafa 
tiiro.C 3 it autcm DYafcotidcs ? vtinae p:o* 
uocarc iirangtiirianri b? t>atumaion tamcn ti 
(ttnguir v iUgcntcrtnTpofuionein qua opoaj 
t-arv. % D*?afco:ides . £> uccm eiusbibirua 
cmoproicie mcdtcatur .vctrie abftinet reuma* 
rifmum.Coiicie % ftranguiriofie opirularur f 
vunamp:ouocat,mo*fib? vcncnaric cum vtf 
no bibitus mcdtcarur, 

<5 £um rino coerueetmeUc vuuicra neuaoj 
rat .pcriodioe fcbuto anrc vnam bo:a acceptf 
majtimcp-odcft fufpofitum, 
f ilujcum muUerienringir. Dolo*cm auriu^ 
copcfcit.^ angiiinc rct}cieiu>? (jubuenir.^rt 
peraecurat ctrlfiiuiae.Jlgnem facrum cjcttn> 
guit^umo^sftjuriace ippfitu fpargir,"8c^ 
cennjbucvulneribpmajcHncp*odrii.*^;oljnptf 
nata fenuna prr.u fmulircr facert porcft;qajt» 
vjrttttemminotcm babeat. 

Capitulum.rrdffif» 



&mm 







Qlmonarfa *j>andecra .*fSulmonaria 
r berba eft fari8mt'ruita:ct molua babef 
folia:et quafi formam pulmomarn loJ 
Q8 bumidis nafce8.qua qmcli pcpanu vocanc 

ft 2lt> oia vuia pulmSispfcrtbibitactcmpIiii 
ftratu.^f £lijcatura ci9 cu vino cofert pcripleu? 
momaticiet afmaticis.^ £ 'oct9ct;aqu3 cum 
oleo accto etmcUcioajdillime fumitur 
flCofcrttuiTientito etadpecms nurib?. 

€flpituIum.tttl)EjEunf 

*2f""VRuna laric et grece.arabice gua 8.3 fi 
•Y 9 doats.^rimaalatinieob cetojcmfic 
^-^funtatpetlata.Cuiuegenctismcliora 
funt ©amafcena.ab ojptdo t>a mafco fic t>icta 
tlft ptius arbo:ipfa eltafpoztata. 
qf Hrillotilee in lib:o "oe platie. frucrui» qtitf 
dam eccarncet otTe?#rano edpofittfunt vt 
pumi.^tiSaUadiuslibio.icn.^mnaficcanf 
infole p_ cratce toco ficcto:e TJcpofua :becjfunt 
qtuttamafcaiatricufur.Blii tnaqua marina 
vet muria fcmente recentia lecta pmm oemcr* 
igunt^ indc fub ivi ra:aut infurn o tcpidofaeiut 
nutinfolciiccari.^^obiHee^Kfuecap.Tie 
p:uni8.-p>:iinaalia funt alba.. iui cttrina.alia 
rubea.a b'a trigra .et $ eie qucda? fum 1111153 q 
funt ad a&crandfi magt8.qucttem tf ukia quc 



Tunr adfolucduvcntremmagfextomnfa at* 
teranr.erfolutiortcmfacwm.pluetamcii*mtf 
nus.Damafccna vero-z armena inomnitoito 
It8fumfo:rio:a.tbumidaqtiidemplu8faciut 
itludcrjucca. et licca mintts comimpnntur in 
ftomacbo 03 bumida.funtcmbumidaadco^ 
ruptibneetputrefactionejconucrribilia.tJul 
ria funtintcr calidum ct frigidum.seclinat ra 
men ad latue frigiditat ie .et funt bumida in fe 
cundo Gradu.^ujaverofrigidcfunt inp:ittf 
ripto fecunduvt poftca babef .£t atta quidcm 
funtlajcariua ctrefrigerariua ctlenitiua. *Re? 
criuecujquomifecnturci addit ean;m opcra 
fiom:funttamanndiccpU)priefm modoe in* 
mfiont8notof?ctcaiTia filfulacf tcrtrtiabinct 
violc condireet fimitia.£ t ftt cnm aqua cantj 
fvrupus iuuamcti nori. £ t ejc ca rnibue earum 
fit clectuarium bonum. Bnncni quoq? arbo* 
rcm pumoaim perfo:ar fubtikm in Ibngirudi? 
ne paknc ei; tmabue vel tribue partibue: et in 
tcmitmntfrtjfirafcamoncttctfigillantltfto.'? 
funt fruaus tllius arboris fotutiui furTicfenter 
ct fariunt Ibpbiliicatceea liae in arboub? altjo 

©ptrarionte. 

f 3obanee , < e^<fue.Sjolutionc cducif cole* 
leram:ct©anturinegritudimbcolcrici8etal 
tcrantmaliciamcaru5:ct foiuutmaliaim epq 
fiunr:noccnttameftomacbo:ecfuntpaucimi 
frimenri.Dofis aqueeanim porio eft cirriter 
libwmvnamaimjuccaro.^fDvslcorid.capi. 
^cpumi8.1i:unu rccee vcnttf foltiir. «rj,£5fo 
5 tt) 



Exmtatm 



TOcbo wiltrarium mtafifiM omne boc in 
comocktclcrius ©igeftione finir ficca no ran? 
r am maliciam p:cbent. quidam ficca eocra al* 
utimftringcTecpftimanr.quod jSauenus non 
tmmcrifo falfum cffe contendit. 

P f Ouiecm ncfciaretpaffo tnfcocta vel mul 
fa folurione ventrie opcrarianaicimcq? gficere 
fi sccocnim ipm cuifuccueadmijcrus ctt fo: '/ 
bcrur.iacittamcnipfefuas fcitTcrcnriae W 
ucrfi gcnerie in pumf e; vt fvriaca tantu putat 
minus aluum mouerc co cp fint ftipttciota. 
f jb^fpana rcro pluo folucrc cy fintt>ulcic4a 

€> cpornibuepuimsjquemaiomlatafunt 
f3dem4jrcnera?T>igdlioni8faciUo:a?v2 

7 tremmolliedo accomoda p:cfumit mino:ibuf 
omniaineffccontraria. 

&> f£ftTagrdrepmnumauftmonWoaib:ifcB 
fir tur ie.boc ficcmn criam ©iffinr cricos ccrruj 
cft adiuuare.gummi but9 arbo:is poraru caU 
culosfrangir.eumaceto tritumacMinitujfa:? 
cici Ucbinas optime purgar « curat a qua in q 
folia paini cocta funt gingiuae i vuea m x fimi 
U'aeolwendoscfcndir.£>edinvino tecocta 
t«bcintnnu8p:ofunt« 
f ttadiceeitemcB co:tc|Ccandem ftfptfca ba* 

¥* bcnt potcftatejque in foltjs eft conflirura 
fScrapton bccciidcsicu que fcictafunt fm 
p jafcottdcm* 




CaptMmw!fld£ 

»*Runcllalatinctgrcce.i>:uncUa eber 
ba fimilie ojimo :fioe quafi laucndula 
fedgroffib:a:foUaz flo:c8vruntur. 

©prrarfonro 

f Succueiftiue berbe mijcrus cu olco rofa? 
timpo:a inunctu fcdat foda.2>rpocrae £nic 
cu6cumvinofumpni8tollitmo:fu5vcncnofo 
rum.fuceue ifhuebcrbecurat alcoli:? confcrt 
fquinanrie.f £ t ad omnia vitia oiio i gur cii 
turieconuenir.candcm criam operarionej b$ 
aquacP&iftfllara. 




Capttulum^aljfjE^ 

DtJpIatfe^rabiecaffcfrfiuctcrfie^fcft 
l^anckcta.Srdcndfic^ptjcfitejc arbo 
reUgni arvn.tcft arbo:fcercbin vclfce 
d&ct eft ccdrue vel pinnue mafculue eu$ fru 9 
c me t> fcunrur coni. eep ea bumida -zficra. 
f ScTapionli.3ggre.ca.£cft.dncfo.Praf* 
cortd«8.j£tbumida coWgifltf foarboab? ugni 
airm.i4nafcuUpmi«p:ofmfructumparuum 
2epcofiflumen*£tn]elto:cpe3cftalbafplcni 
toicuieimunda. 

0pfrattonf0. 



&rMt0 



f 0altewq.(iffl.far.ca.pl|C.p~m tranfla.greca? 
^icquequideficcaficcat ualcferit f m terria 
abftanria^comeTurarisrplusncrarenataccB 
calcfacere q liquida ecotrario caUfadt plufcg 
ficcet J?ab5 aiit 6,d fubriliii partiit cj afmaticos 
i empricos iuuat.fl£f babet qwdc quid t>ige 
fhutn ©y afoKttcu ficut zf m guftu fubamarii 
quidtacre.^ 3ta autelop:ofo8 vngueeedu? 
cant mtpte cttm cera.t anperigtncG ccpttrganc 
s>igerut aut tntros z ind t gelto 8 .buino :cs om 
ncs qui pojuitur in catbaplafmanbti8.Jb:tior 
vero ad emia talia cft U6,da.sura vero ad bec 
quideprio^eft.^Sdcofolidarioneaatvutne 
rummagisidoneaspali ergo epbiseqtfiquid 
copiofai bumiditarie calide comfctum eft pici 
liquide.fl-jSiceleua.oteumpicis.iiteppicebu 
mida quldo coquitur.zeftqueda epea quecft 
fimilisvifcoTifcolttatefuatnoiaturvflcofa 
£teftaua que ectoraucca elU mdioi cjtca e 
iHaqueepuratenap sodoafera fimiUs rcfine 
pini.fapo:bui9eft acurus? fcreamarn8.>£c 
virM6du8eftcaUanterriogradu.?©cficcat6 
dtplus 63 calef actio ipfius 




CapmtlunufdjEjEtf. 

D3pliquida.-^adectaxa^cctjc^3ictari 
arabiccgrccc alkitranJatine vero ofeu 
^efarbtn^cftpiicuquida^uc ideoma 



tenoftro vocaf pecula. £> era.li.ag.c.bicratK 
id eft pip Uquid a:t eft oleuj q6 cgrcdif t>c fccr* 
bin.£tfcffbint>uefuntfpeae8aiiaea?>eftar 
bo: magna.t cgenuf abieris;refteK ea alkitrl 
bn8fmaufimtlefructuidp:ein.nifiquiacmi^ 
no:eomulriufecundacft arbo: fpinofabns 
fimaitudmccumarboreiunipcri.imagnitudc» 
frurrusdueeftficutgranimirri.^duisauce 
alkttran eft aiud quod efl fpiflum darum bfis 
odoiem fo:tem cujbombilir ate.t quando int 
ringiturin eot>igiru6;noncito ©eftuit ett>igi 
to ptopterfuamfpiflitudtncm.tquando ftilla 
du8cadirinlocorcmanetcoliccta:ctnonejtf 
panditur.j£ttdemauctojitate.£i3lte.Specie 
rumfcerpincoplejdo eftca.sucin.m.gra. fed 
oldqtJeptrabifejcarbotcfuafubftanttacfub!? 
tilis.-z virt9 dus e calida z ficca in quarto gra? 
du:f$ plus calefacic cp ficcet.% ignu fcerbin i io» 
minatur lignum moztuo^quia conferuat cot 
po:a momia a putrefacrioncaJide virtue ci9 
^eficcat et cuftodit co:po:a moauoMim.etJDe; 
ltruic quod eft ibit>e bumidicare. 



0pfrattone0 



$ Sferapion.*fSijcliquida cuftodit anpota 
mouuo»im.-zoleumdu80cciditpediculo8 et 
lendineetuimbricosetvermesquifunttnaa 
rtbus. £t quandocumcontnafcalecomimf 
pit fetunuet cpdudit momwm. 
4 £t quando linitur virga in bo:a eoitusfctf 
ftruitconceptu.-ripterboceftecveriorite me 
didnio z fomoribus ad,pbibendu impjegna? 
tionem adco cp acdditd qui vtitureo:vtfiat 
ommrio fterili8.eria5quando wftiUaturejc ee* 
inoentemco:rofum fedat x>olozemz frangic 
s>entemxaufertIiuo:cmquintfuboatb. 
f aiWcran .t cft ulud quodeft copofiitu ec co 
quod coUigifur in lana:quando fupcr ipm fu 4 
fpcnditur z t>ecoquitur.? fub tuius alteran ec 
minue acutum a rdiduum quod remanef eli 
altoran,teftttodq{Jeft©eeofpinum« groft 
fum.eteftfianiiludquodrcmanetej;fptffituV 
dineolcuidco alkirranpwprerfwgroftcieni 
mo:dicat? 3perit.?p:opterboc alKitran a\ r / 
ratapoftemata^eftpiicUquida. 
C Sedgranifcerbinvirtus eftteperate adco 
q> poccftcomedunift quia facitfodam etmo:^ 
dtcatftomacbum. 

f j£tidemaucto.pvafco*2likitran cftquod 
co:rodic x inddicco^o^ viuenriuttcoferuac 
co:po:a mo:tuo:um. z (i fiat pbcretrum i quo 
rcponatur co:p9oefuncri ecWgno fcerbinier^ 
uat co:p? ©efuiKttvi putrdacnone .etp:opter 
3. n 



a 



-& 



Txattsm 



^feocnommatipm quida vitz nto:tuo# 3 alfctt 
tran aduritplatasacoria^faneceflitate fue 
caudir^ri8mficcari6i8.ttabftergitmacula8 
oculiqn^tbifcu>obtfalepauco.c6uenitmo: 
faifcrpcfis.aquado linitur fuper elcpbantiam 
e6uemr:afiterifterecumco:aocadtf tamba 
cosparuos. 




€apttuhmual#£t?» 

«ir^&nie.^ffdor^antsfciVrusefteoq» 
•I 1 umonimdboanponaf^anmenima* 
#•-' bari9 c qui ad cibuj feruis t>af no teW 
catu8.5ermctariu8t>iaTfermeri9c6fea^.Sn 
musautcno fermctatus. Ham a^tmuseftftf 
ncfermcto finccrus. Bcri5imus autcm lcuiter 
fermcntatusjqfiacfo a^imus.clibanicius intc 
fta coctii8.*Rubidus auf recoaus et rubefa^ 
cru8.£? ubcinericiue t5: cinere coctus ac reucf 
fams idcet focacme.Sttmgia tf: panie aqua 
tiutins Iscatue.ftmil am modica fcrmetumq? 
modiaim acapit .et baba bumect atiots pluf; 
qlomiepaniSvtptcr qt>et ffungtcnome acce? 
pir.-fMaccntc funt q t>e farc fiiit qs alq caudaj 
libafciamrjeo qtfhbeanretplacciinf, Dulcia 
funtopcris pifrom genera ftc afapo:e oieta, 
mclle crn afpctfa fumutur.Hcro:.£ollirida 
tictrur pamaquadratus t>efimilafacfU8 in 
■tf fartagme cum oleo friicue.vel modicue panis 
triangulue.X agana funtpancstati acrenuce 
ptfta eft panis fuperficiee. 

©prrarionfs 

21 f gutVfianie vt comedatur opomrcf fltmu* 
duefallttf.mafia bfss pfect&fermetaru6;benc 
•oecotwene comedalcalidu8;fedma noacjj 



maneneXalidtfe cfn no cf! aptid natoraj ret 
cepribilfe.f ttacceprio eiued, eftt>cfurno x 
reHq? fibi fimiliu cftmala f^anie t>e fimOa me 
lio: elk mudio: acrtumbilio: cp alius. £ i$nu 
trimetu melius c;f? tardtoris penarat ionis 
f Opirusautquiepmrimifurfurisvelocise 
pmefratiois^nutrimcriminorisacoeterio^ 
f 3lle vero quinobitcoquif eftpluriminutri 
mentuetfimilitaquipa^babet fermeri.f5 a9 
nutrimcntu opilatnifiillosqut plurimifutejtf 
crcitq.buius generie eft pante te patella . na$ 
cius inrerio: pars raro bene coquimr 
C^mplaftru qcpane facrucalidi9 ecpcicfhi 
mcnto pant8:ej;frumcto nouo vclocirer ipin* 
guatf -JlSams t»e frumero cu mellicraro.fuca'f 
cpcouem&itovalerapoftcmatibxaudie.lcntc 
enim i infrigidat ca/Jbanis cii aqua ct fale x>e* 
coetue a empaigini infufus cofcrt ■£ ft quidc 
vclocis Tsigc fttois ct rardet>cfcenfionie. 
f -jbanis opirus e lenitiuus nature. fermcra* 
tu8c]5 vcntrclcnit :cta5imus ftringit. £>imil# ■ 
rertopaMlaccfcr9aantiquuepanieficc9ve; 
trem ftringir.fjffaacintriais particularite 
^anctriricocalidio^t)irimu8:cuiu80iucrfa 
funt nutrimcta quatr uo:modisvidclic5.:£:ft 
mo,ff f cr farina vnde factus e. STo$o eic arrtfi? 
cio fuiXario ejcignea 4 cocf uecft . Ouarrc* 
p:o qualir at c qua fumif. iarine modus trifa; 
riamtiuidirur.^rimue^fereffcnria fui.S»e; 
aldu8^qlitatemolifori6Xem'u8fmb:cui; 
tatcvelIongitudinetp,isticquo mola cotrita 
eftyt fuperiust)ictu e.-fbanis quanro mudfoj 
cft tanto pluris nutrimcti at»urio:is egcfttoiJ 
nis.f Diucrfitatispants ec arrificto fiyctuo 
funtmodi.vele)cfo:ma vdecarfificio fimf lici 
ta.5o:maautcmplejceft.magna:parua:mc* 
dta .^agna medullc plus baba.co:f icc? vc* 
ro fubttlio^a t>urio:eXo:fc)cp^ferca paru 
numt.etcft adt»igcfcndut>uru8. bumiditatc 
egenicmiseicficcatvndeetvetrcjcoftipac- 
f ^edullagrofraeftetvtfcofact inflariua* 
fle6mavifcofti?genera8.1i>am8partri et fub* 
tilis imerio:a ignts p.fo:ar.«ct bumiditafcmc^ 
clullecicuccar.vndcparunufrifzfardi^yigerif 
ctverre conftipaf,manme ft eftuefit Cnpritao 
vd fecudo tn'epoltt>ecocftonc. 
f Ondc bvPocrarcs.lSanis magnus ? grof^ 
fus cft medulle nummeti pluris ventre fcluir. 
paruusaiit et tenuiemcdulle cftpaucc .num? 
mcnripauci.tgeliioausrarda eftvaifrc con 
(tipat.0uiaufemmcnfuremediecftifo:nia.-j 
mcdiecltporeftaris. 

f arftficiumpanisquaftuo: tiwdimr mo^ 
dts.£ft cm pamsquatu qcpcdrt fermcti :tamj 
febcs a falte^bcnc cofcoue, et ftcur opo:tcc 



©riBttbfe 



< oc tus. £ft parii" fefinet ams i coctu6:ct in cef 
t^isancccltariatatipcrantiaimmuuit^.cbfia 
fcrm&u cic falc vltra cgfaris c.fl j£lt a^intf z fa 
lecarcns.^rimus quidemodcrarib: ein otto 
bia fup:adicri8in ftomacbo p/ecre oigcrimra 
fanguinein coipoK clariflimu gcnerar.vn ml 
ture cofoaar aaionetfprcrca comoduseft qui 
quicrifunt i ocuuaru^eUctatidevinfit £t tis 
quopaigeftio ©efectuparif vt fcnto: et cgritu; 
dincociccunnu.ar8cm cjdbibua cjctcri? fufficic 
naturc labo:anti intmuo 
C^percnaritoautlatouarito noadcoceucni 
ensdtptoprcrruafubtihtatcctfaciUtateoiiTo 
lutioiu8c;cmcbu'8Co^. > i>ani8 fermentari^mo 
dicu babes falis necbn coct9 vifcofitategene* 
ratigrolutati.vnt>urio:dpaoKtardiot.p:o 
pfcri?apr9ecjcercirarihj?l3bo:atib?.Baabu 
danria caloaseow eftcaufa fomtudinis z t>i f 
gcftiont3.s5cdqutfermcmi falifcgfugliuum 
babiKrUminimuiwm'nconfo:rar;virtusern 
faliebumidiratcciusocficcaricrmcntucoiuit 
crionemrarificar. 1 

4ff anniusfiirminimunurrif zouriflime fcige 
riffardiflimecpcgcfif.,ppaeratcb5opilarione 
etvcntofitatcmgcntradi.3darcoincouenie8 
eftomitonamrMraroasqmajciinisiabo 
nbueejxrcejuur vriiKiFoiC8. 





CapfeuIum.tdjEiriO. 

&pa3ft.u'.exY/Rapa rctl 
eft a rapicdo : id c ccp:cbctt 
dcndo£ 1 t aut radtce ainpli 
o: uapo.f.ipo:et>ulfionfo 
iio tenurjS0Ua.ti.ui £? etng 
b:afice vetuftu mutaf in ra 
pa jf dein li.viij.3 n menfe 
iuiiofereda £rapa foloputrufolatri iniicco 
ncc fpiflbOoas bumidis z capis Utaf /Rapu» 
aut in ficco ac.ppue tenui ocnejco er fabuiofia , 
mclio: nafctf ;loci jpuetao vrrucp fcmcn iu altc 
rum murarrBam rapa in alio folo g frienniu5 
fata mutatur innapos.atia vero napusrran* 
firinrapam.Sfubactiifolufierto:atumverfa 
ttimcpcoquurquodipfiscr fegertbus pwdef 
rir:qmibiannocodcmferunturOugorapjrii 
quat ruo: fejctarr}.napi autem qumcp fufTiciue 
S»i fpifiefunt imcruelles aliquas vt cetere ro 
bo:airur:vr vcro in fcmina maio:a redigirur 
crucam rapam folqs omibus purgas;er ad x>i, 
midijfcigiii craflitudinem in ca.nk UicodeSi 
Stuncin fulaetrtligentcr fubacris oeronissi 
giris feperatam obwc8.iUiicic8 rerram i caka 
bi8 ita inagna nafccrur. 

f *Rapa cft napus V5ltdu1imu8:c0rurbatco: 
pim&eduat.Scdfcmcewscorra venenain 
porumcarur/Rapafifrcquerercomedafinfia 
cfonem ftomacbifaar.S>emc e$ cfvino tritu 
valet connra mo:fu8 ferpcutum. 
$ t>t afcojidcs/Radu; rapebona eft/r Q ven 
trem inflat :co:po:i tamcn fuccum addtt ; verre 
q$ ftimuiat.£iuscu'paturam fomento poda 4 
grisacpermomb>p:efidiuin eft.ipacptruaa 
impofifabeeomniafacerepofeft. 
^"iam3ciueeiii:aacomcitacftt»turcti<:a.fc? 
Eicciuacjcvinobibituvulneritovcnenatisp^ 
ficir.3rao3fcmcn inrapiecalidu acfcrueno vi 
dctur.i ipfepaulo folunoKscrcduntur . ©ed 
quo fiijnu9cato:i8poftidcnt mollicndi pore; 
(tafem eo fou io:em conrincnt. 
<ff 3dem radijcinnat^icmcn inbotninegene? 
rat vel augmentat JSgrcftie rapa locis ficcis 
nafa'rur;fruriccm colUctum faaens cubiri lon 
gitudincm babcnsmultafo; virgdlaa . 5olia 
knto:a^ in modum ^igiri grofla. &mm a9 
nfoliiculiscitconclufum nigrum etfragiU. 
quod (racrumbaber inrus coio:e album. tracj? 
faaa mifcetur alba menrie vci timn miv co:> 
poys 

^f 3faacXalida cft in fccundo gra du. bu^ 
in^inpte.9urc9igcri(ur/^oiUin iiM 



U 



'& 



& 



STrattatiw; 



flariuam camcTacitJptcr fuivenfofitarcm;pl 
inde coitum fufcitar.flegma augmetat. Utilif 
flut eft fibiscocta vtracpaqua rciecta coquaf 
cum pinguifTima eame.3 dcm cuius iiire fi pc 
des podagricowm lori fucrit fcoloM mirigato 
ncm pzeftat.f 6aU'e.li.ij.t>e abi8.c.©erapaj 
^>:ilrifo:miter aute cr banc bomince p:epa* 
rant vfcgad boc cp coponunt cam a»m garo % 
accro vt babcantp vfuper totum annu3.£.bi 
mum antcm rcddit in co:po:e grofTioran com 
menfurato.p:opter quod fi abundauerit quis 
invfu ipfius.etmanme fiquis t>eficioua in 
ventre tHrigene ipfam congregabif vocatum 
crudumcbimum. 

fl adfeceflum auremventrienecgcontraria 
rivticpnccpconferret>icatquie ipfam:et matf 
jcimequando ©ecoquiturbcne.indiget cnim 
ipfa x ampuo:it>ccoaione.fit autem oprima 
bis cliparaficut t>ictum cft p:ius t>e caulis pic 
parationcjfi aurem audio: fumatur indigelh' 
bilisdt.t tnflatiua et mala ftomacbo. qiicg; au 
temetmo^dicariones operaturfmventrcm.g 
aquaauteelicatam admirabarvriq? fiminus 
aliqua bomogencaru plantaru nutrit 
f £tidej li.vi;oe fim.medidnie ca.gengilidia 
fiucrapaipfaa femen adlibidinejindtarutf 
ilanui fpiritus generatiua ejciltens 




Cap!tu!um.fftl0fiift 

■S~y Spbanu8.3uVRapbanumgrceenoff 
^TvradicevocamSxo cy totSt>co:fum ntf 
"*• ^rirurcurdiqolaarnagiemfumma.p0 
filiant^ui9femincmacerato*^alta.li.iiii.3n 
mcnfe martio rapbanoe aliq ferut quib? vrun 
tur eftate.3de in li.ijc/Rapbanu vrjia pdicrutn 
dtficut-<b:afica coftarcffeviritointmica. fia 
t fidrcafeferanrurnarura t>ifco:darc refugtf 
unt.auiceyRapbanuebabalignu ealidu et 
bumidum in p:imo.Scmenca.in.iu.fo:tiu8 
c feme ©einde co«cjt.poftea folia t>einde caro. 

©pnatiDnf0 

f *RadfceP aidunoeomdravcl potata,ptit 
anridoriimagnu adiutoruicfanitarie truta* 
menrii fo^is:fj adinftarioncfacit % ructuafc 
ridoe.^ ^nictSa^viinamouet.Ucntrc fceco 
cta malacat:-: in cibo prifide pwdcft. Zoiac\ 
flegmata purgar.£u opmeUe accepta vomitS 
moua.C umcllcmijcta putredincj curat:X# 
no:e8 rollir.Uim fungi vencnofi (dce(cit 
f£6travipera?moifu8 ( pfia'r.S i cmecuacc 
rosarit fplcminiiir. b^dropicisac fplcuerios 
in.modu cai baplafmc impofitu (ubucuit. 
^•ftadijcinacaoacmcUecocta figargarijtf 
fvnaricoo curat.ioliari^cotufa-zipofifa ■oo 
lenrite articulie,pfunt.qf "Rapba no calida ef 
fe virtute oim medico? opimone ptjifjnobif ejc 
vfuinrelligercUcet na cu cercris cibis comdia 
tdco in ftoma( bo rucr? cfft'cir folue.q: in eo co 
quirur p:ima.f £aptUoe ab iniuria a lopicie 
rdtituitcumeuc.f ©uccuscria grancdincs 
auritttnfttUat^cmedat .f j£g?ptu regee i c\to 
erat ftudiu fcruta ti cozpa mo:tuo^ ? cae vautu 
dinuocculta fidcrccognofcae.ainipfo coV/ 
devirul nafci.pdtdcrur.f S>eme rapbani cuj 
mclle rtiro z fumpro fufpiria mirigaturXuflis 
arcef.Sola cufatefumpta vetrisaialiaejctin 
guit.vetrc ftimuiar.vnna cocirar .^uerperis 
copialacriBacqrif. f "ftuttaresfomus vrine 
tirricuUatefbluif .vel foninap unpaatnjcfttu 
is.rapbanus comefta ceuftomacba . poftcit 
bosfumptacigeritcructuafionefaatXoaa 
ct efa tuflientito t pituitante i roar bi mcden^n 
f iloaudJcatbaplsfmis adbtbitu cnjmdie 
pafcetia vulncra curat.f "Liuoie ipoftra fol/ 
lit.^)o:fttovcncnafloccttrrifia^inc8pur 
gar.t tbita meftruis imEanScmed^bibitu 
etaurericu.fplcnetremifcaefac.f£lijcucuo)ci 
meUe ga rgarifmo ftna tictcp opirulaf . ^craia 
c]j piiao accepta ftat im mcdef. pdcdcauo V/ 
mtfla .vd gingiuis fricata.t)oIo:c eiue mirrefc 
dat."f jtft aiiudgcnus rapbani cfi muUi ar ; 



Btfyttbti 



nwrtatifotaltensfolia lapfanefttia .euftra* 
dipoblongacftactcnera.t!cq.f.fi»p:at>tcme. 
f -{Ma. , Rapban9ca.e? fic.in.ti .gra . Uirtati 
babetina'dcdi:ottToluedi.c|ceo fit copedesoti 
melUscorraquartana.cctra cjtidiana :corfa 
©uricicjfplenio. 

f tiaba ipa cocta in vino et olco fpleni catba 
plafmetitr.pecrimcarbaplafmataftranguiriaj 
cf/oiiunteriamfolmt.; 

f^ypocraXapillosmuuqzfccmtosrapba? 
nt iubct fricari:et cotra to:meta vulue fnp vntf 
bilicu imponi 'Reducut z cicati ice ad colo:cm 
S^emeimpo(ituc]caqfiftit.c3qfascdena6vo 
cant vlcera.f Dcmocrit9.oentre3 F5 cibo pu£ 
tat itimulari/z ob td fo:tafl'e voci nocere tradi 
derunt aliqVolta q ouraicat in oblogis nafctlt" 
acieoailo?cjcataret)icunf.vbiveroacrio:me 
©ictna admota Jit Tfopu t>are,prin9 impcrant . 
^ecanripafiaeft.Euriuverbgmtarirapba* 
ni fuccii inltillant.f ^apibumecrat z fcifper 
gitfkgma attcroritatcfua.iolia tneiiismin9 
auftera funt.radit trfra in vino naufeapuocat 
€'A'lt.li.]C|c.'Rapbani ftomacbii purgat.pittu 
catuerraiuar.vrinicdcitanr.fift cliiuofus in 
toliaizaromari3voc|tfatiu3.Sratiuit>eco? 
cti mane adtrcs ciataspoti calculoscdminttf 
uittzenctunt.Bdtu(Tintq?ieiuni8rapbari9 ( pi 
deft i mane cum mellc £j eme ei9 roftix ■oeinde 
c6rritu cuj melle fufpiriofis valet.3 demq? co* 
usrmmpiQdcll 




Captmlum.rrd£££u; 

tf~y Sdi]c.i>lafc3rt9.T?adit;eberba cuius 
TC\ ftmili noic anpella f ,7 ecali/r fic. in.t? .$<? . 
T c du.Oirtutc rapbano ftmiieb3b?.£tco 
tra eafdccaufa8val3eodcmmpdo:fcdnd effi 
cap eft.3tao3 ol tn rcceptione tnuenif . potcft 
poniradijc rapbani (i radijc no babeaf. 'fcaila? 
diu8li.£t:.3naiigufto mcfevirimo ficcio2i'b> 
lorisradices ccuenirfcri.q bYcmcmimftrcnt 
vfum.am3nt terraj qtialem rapapinguem ac 
folutam-zt)iiifitbacti.topbum verorefo:mtf 
dant 1 glaream:|3audent ccli ftatu nebulofo. 
ferendifiintaufegrandibu8fpacrj8T3lfefofJ 
fis.melio:efq5puenimfiferltur in arenispoft 
nouam pluuiam nifi fo:re pofitnr rigari.quod 
farum cltftatiin laii farculo Ocbcr operiri:fcd 
tamc 116 ingercdum cft:fed potius palec. quc 
inde fungofe fttnt .fua uio:e8 aut funttfiea sa cj 
falfa frequenrerafpcrgas/Radiccs fcminige 
nmsptitanturqueminusaaesftmr.bsbcnt^ 
qj folia lario:a lema % cuni ioaidttare vtrcuaa 
et bis ergo femina funt eolligcnda .'3aio:ee 
fiericrcdunf fifnblarie oibusfoLisfclo tcnui 
cauleoemiflb:fepe ferris opa ianttsr. Qiqini 
mis acrabulcem fieri vctis femen m ac nocre 
mety awtpaflb macerabis. 

0prratiOM0. 

f.3faac*RadiiL*cftca.in.iij.gra.fic.in.t}.min9 
iqjrapa notrir^pr er acnme futtm :q6 foitiue eii 
itaiminerape/Hutrimcmmauscrt^ummz 
sroflumoigeftioniftomacbi nocitm 1 incon» 
uenicsocribtisacoeulis? gulcomibufq} 00 
loribusvutoe.f $5a5m vero mcdicinamco^ 
iienit.fcdm ctbummandticata to:tione 1 infia 
tionemfacit.*: illaudabilis ftomacbo fit . 06 
teftaturructatuseitis quimaiiimc fit antectf 
t>um.elcuat cnim % ©efccndercpbtbet cibit ad 
iocum coctiois.3deoqifit caBfaindurarc x>i 
gefttoni8.natnralcq5Virturcinbibct.abumcp 
pellensinfuperio:iEte:cicquarefitvomit?ma 
icime bis qui vcntofitatcm in ftomacbo babet 
«jcconfuetudtne. 

f 0ue tamen poft cibii3acccpta mino:c agit 
venfofitat2afcendcntc5fup.iii6.qnia cum gra. 
uitatcfuat>cfceditinfcriu8:©eponitcpdbum 
incoct&oni8locum .£tvtoptet cigerif vnck 
caufa'cpnfo:tandc fecundc 'oigeftionis cffifaT 
bcc cft graria fuecoaionis^que non babenttV. 
busvcntofitateaccepta poft cibnm impedit 
^T l^windc li quts eam vult acciperc pio vo '/ 
miruantecibii5fumatur.fcdp:opfcrfnfpleme 
um fccunde aciertie 'oigefttoisjpoft ctbu? ma? 



a 



'B 



ffattata^ 



bumtda:m0dific3t 2t>cft'ccat illa,fcf patat ali^ 

cycjtpamaf fuccuseinstseturinpotu cuvti 

m> .etcoiicniarmedidnis momferis* femeet9 

ctilfadtboc.Bosautecgrifumusmulfocies 

wb3CplantaicpqrlcoqiutmuUucUWIto:dcl 

vamc ©iffoluaf in t>ecoctione tt>etur tn potu 

bjmasiiaefficactaincgrttudinibopectonsati 

ttqut'8 quef iutit ab bumoato groffis 

f £tid e auct.lluftiVRaffanus cofertflegma 

ti:? f puocatvomftmeteftmalu8capirizoOTlif 

Writoef palatorccomipit dbum.£t eftcof 

ueniens omibus cgritudinibus muuerii.genc 

rat vetofttatcQ in fupenoato parabus ventrts 

CttUudauct.^umaY^pterfulmaUciameVd^ 

locisputrefactioisfuefubftantie* 

f £t idem auct."Rafi8.0i)cit mtbtqutdlami 

cnsmeus <y ergtuseft I5.-J inuenitvcrum ?>tf ' 

ftillauit enim aquaj radicis rapbani fup. fco:? 

pionem.etinuenitipmftatimimmobilcm.tie; 

indecotinuoinnamsdtetcrepuit p, mediu £t 

radipc6uemtfe.quartams.ctrigo:ib?fcb:ium 

periodicaru % t>oto:tbus ventris. 




<epcfcdampttojaiqu?qufd^fafbanufmicf!r2 
vocat.3ntu8 l?5 mcdulll candidl.cjctra eouif 
ce8nigros.nafcif in mcnto-ztorieafpcris.ati 
qnandosvratoofis 

©pfrattpnta 

f ^era.*Rapban9agreft^bn8fo.*firia[ap? * 
fane.tb5radicemolle:fubfite.l6gat tcneri.r 
fapo:ri9eacut9:c9folia uamicoquntunco .< 
meduturrt puenit fto. f CU'rf9 eiil eie vifdda 
ct fciurerica et caU'da.et io iri cibo fumpta copt 
ofaeffuditv:ina.3ncitat etilmeftrua femia 
rufto.vttlis^epaceto^at^.-fiinjitasglutinof 
fascumellefumpfa ©iffoluit.fijbricoelafo&cjc : < 
cludit.f *Radipaduftaetin pnuierevcrfa ad 
ficcahdu etpurgadu vulnerifo imponif ,0tri 9 
dl fuccu et'9 cu vino fclt cotra vcnena. eadcm 
vis in femine e fi cu melle fumaf.nobt'8 ecprum 
garmo&ril in ptifanafo&itione trifcoctlto 
rarisvitiafanare.f S5rapbfln9agreftlque « 
romani voclt arnunacbio b? folia ftfta folijs 
tomeftici.ctb5radicel6gamolle.etfapo:ci9 
9dacuitatet>eclinl8:c9foIia iradic ficoqulf 
ctcomedlrarc6ueniutftotnacboȣtd9^tU8 < 
cftcalidainflariua.f £t,puocatv:inl ctmen ! 
ftrnar.ct qn fumif cum melle incidit bumojca 
groffosetvifcofosmpatott 



^> Bpbanu89grcftis.£>vaf.-Rapbari9 
JC\agrdh'8iunco8t>uo8fiuetre8fpargfc 
"^S ;"rubeK8 i terra.foua mtefifia,4:adKe8 




€apimtom.fffljpm£ 



Bt Sjrrbia. 



•^3 &diarfa..^ltXtfv\ftadiculdcbcrba 
jcvtauldis lanieapta,adftfuccu bjmiri» 
**•■ "qlru^adoKpfcreeeque? molliria.na* 
fdf vbicp fatiua.fed fpote pripuc in afia fvriaq> 
favofietafpcris lode.%>ane eufratcntnlau 
dariffima.caule tcnuifcf ulacco ipfifcp ctbic m 
digcita?-eppcrito.? mgueri qcqd ftt rii 4 fceco 
quafoUuefoUo.bacftratbionvclffaringrcci 
vocanr.£ftat€fto^.afpectugrata.veru finc 
odow fpinofa,? caule lanuginofo.frme d nul? 
luradicmagna qpridif adqueoictuerfum. 

f1&i.U.|cjciiq . Zm&tib % radfcula ramoe p* 
parar.qua ftrutbibna grcde vocart fcirimus 
f 3g>>edef motbo regio ipa tfeocta .? vis potii 
3tccpvitU8pectorIobuiat.aluufil]it.Tuluafqj 
purgat.q3ob:e aureu poculii vocat ca medici. 
j mellecril^deft ad tufiim. f Dtfopnce jjdeft 
incTura cocU3rI.cii poleta $ oz acero lcpzas rol 
lit.eadecp cupanacetcaparieradicecalculos 
frangicac pellit.panoe otfcutit cu outeacea fa 
rina i vino tecocta.f 22>ifccf ? malagtnant» 
i coUirije clarita ris caufa ad fternutamcra rti 
Us mtcr pauca.f Xicn(45 ac iocincricodcmo 
^ridt.po.ocnarupodcrcejcac{mulfafanatfu^ 
fpiriofoe. fic? pleuret icoe ocfcp lareris ttolo* 
rce. f i>andc.'Radiculai.condft. t ponit itt 
smidoiarioYiriliinporioneadfcrofulae, 




Cflpitulum.tn!jffjrutt) 

■^3 Snnuelarine-rgrcce.arabice baufie. 
JCV vclbufcb fiuc battftg.Scra.lib.as.ca . 
**• "baufiofiue baufig.i. rannue.dtpl5ra q 
nafciT in vallito. i funtriuetreefperice. tfcta 
ba bcr fiipite rcerii fpinofu3 ficut a rbo: q tii ale 
tiftalicb.inramistfpinifiduer': folia ctffunc 
oblongabntia bumimtatevifcofam q adberet 
manui.£»c6a dtfouis alba plufcpipfaXer^ 
ria baberminora folia cp ipfa t lario:a.2 t>ecli 
natparurubo:i.etramidu8runtlonst:l6gtm 
do ciue eftb:acbq vniue. ereit fpiffiozaliis.? e 
fcebtlio:.fpinavcrocweeftacutio:.£ffracru8 
ciu8 eft latus fubtili8.ct cft vclur tn vaginis ftf 
cm berba quc ri: faebidalton.f £r idc aucto. 
#alie.0uod a^mtncfiraf cjcrannofuntfolta , 
iiue^ufttntrecenria.^tvirtuoeittocftquein 
frigidat? ©diccar in fccundo gradu. 

©ptrationr0 

fD?af.ca.©eranno.TSannu6frutcjccftqut *l 
rircaottoenafdf.&ufusvirgc funr longeet 
fpinofc.folia babct pingutffima longa ? leuia . 
£.(t ctil alia rannue colo:e bns fubalb idti ,£t 
tcrriababc8Colo^fubrufu5^virgula8 logas 
^bittsquincp.tplue.bccfpinofefunjr.ctmtm 
iria babent virrurc.£ iuefdncn larii cft % rcnue 
etiti folle reelufum ftcur affodiili* f 3dc,£> ntf *> 
nitifpccimi rannifolia car baplafmarite ^dbi ' 
bita ignefacrum co:po:ie p:obi.bcr. f £?era. £ 
EurtBsrannicftquccurat foanica i beriripi^ 
jam quc cftt gecaiidtfatis. ande qn fikmpla* 
Jlrumcufolasduecurat bcrifipila-zfomitc^m 
^t tsicutaliquicyqnramicius fufpcndunf in 
oftqs 2 fcneftriscdfar operatio arboue co:ff. 
f ^Iiniu8lib.jcjciiri.3nrcr gcnera b:uro:ft ran;; 
rtu8 appdlatura grcciecandidio: frutcjc.^s 
flo^tramoe fpargcne.Tcctie aculde no nce? 
tcri aduna'8.BlterugctiU8 cft filueftrc nigri9 
rubcntce fercnefoUiculoe.a^uiueradiccKe? 
coctairiaquantmcdicamcnru:quodltdiivo^ 
iarur. f ScmenfcCttndinaetrabit: altcr Ole p 
candidio: liringtftfcdmagis rcfrigcrar.coUci 
rttontbus z vulneribueacomodatio?. 
f £onftantinueinlib:o graduum.^Rannue 
frigidaeftinptimo gladu.tomfecnndp.va^ £ 
lct puftulieo:ie.aentrie5oolo:cm^ ftomacbi 
lycfecrioncm curat^atbaplafu^tue bcrifipill 
»cftruit.f Succu8du8oculo?colltriomijct9 , S, 
fiuefolu8contienittoIorioculo:n:majcirneq5 **- 
panno:um albcdmi.^ibitU8attte(apidemre 
Damrrangir. 

Capitulam.ffdj^djf. 

a 






1 






& 



wata'cai{da.tdnfdtttiamcmpetf8inl.cu 9« 
to.£iuecpitbima cafuitpercufltonf pfert vai 
de.pjockftetiicontufibnilacertojum?ruptu; 
Tcf jConfert afmati ? fputo fanguinie tepatie 
ftomactoqjfcoto Jibueintrinfecie. ©tngultui 
* soloti pungitiuo ventrie ac ©iffint cric acfco 
feiircnumacrcficc^atcpmatricis-rftujEui fan 
^uime^cf£babu83nnquie^plcncjatfenu^ ■ 
atitmoifui vermium venenofojum rcmcdiuj 
«ft.f £onftanrinue.*ReubarbaTum . aliudc 
iridicum aliud pcnticu. 3ndrcum cft laudabtf 
liue.caUdum i ficcu infccundo gradu .0uod* 
dam ftipricitatiB z acuminiebabefisJtoma* 
tbot>cTeaov9lrt:venf6fitatenu cpatiefcoto 
rcm z fptcme^uriacm.t Ypoatndriam ? ejctc? 
fionancurar. *Renum ac veficc t>olo:e ac ma? 
trici8ecrtrpat.fS?anguinc©cpcctoJcmana 
tem coftringinanbdirne fmgulri! . vulncra in* 
tcftinow:smmmlfolurtonem;ac pjolicamfitf 
trtcm ampurat: faricnttcutQ 9 lcnriginibue t 
*mperigtnemundificar.£ontra rcpttuu motf 
iwiaat puluerifatu6:cum aceto tcmpcrame. 
f •fbandecta/Rcubarbarnm t>iaTareu qtfeft 
radi|czbarba^:quiacftradijcqucinbarbaria 
rcgiortco:tror:etin india tranfmarinie parttf 
bu6.£teftatiudqo* t>ictfur renporicn.trc quo 
In fequert capitulo. quonii ^: fiejt>e co q; in po 
to infularcperifcvd qtponricirbabct fapoje. 
fRcubarbarum vtquidamt>icurc:r9dfccft 
cuiufdam arbo Jie. i rcperitur quafi qucda tttf 
baofitaeinradtccciue-rc.^tcftcatidu-tfic* 
cum in fccundo gradu.f jfobarinee S&efuc. 
•Rcubarbarumquoddao:irorinindia.j£tvo 
catur raduedfenu? cft metiuext quodda orifin 
barbaria,eteftlaudabaittepoftilttf.£tqtfda 
o:if ur in mrcbia: ct cft minue laudabilc iltie. ct 
laudaturmagieeceie quodeftfubnfgru t>tf 
dinanead rubcdincm.etquod grauecft cnm 
raritate fua.z in quo in confTacturieinuenitur 
«tfgregatio cerufo : glaueo.? quod eft croccc 
titxsurcjEt quod eft rccene cognofcirur quod 
iton dtadulteraram: quoniam cft rarum ? mtf 
tiotislhpricirarieictcftcroccctincmre. 
f adttlteratu vero babcteontrariu bo?« va 
rictatcm quam babcrc t>cbct tn confracturie 
amtfitaiano fubnigrtfcir in cie.et cft calide c&i 
plccioraen ficccinfecundo gradu. 
f £onucneruntautcmp.m^rionc ctueaqud* 
caaoane d fiipricitatem fubftamic.? acrritas 
spanecirartf a tctn fubltattczcft ut eo ignrirae 
pcrfickne: queptopter actiottcm citte % fcrrri? 
ntanipfiue ipmmfaeirdTc amamm.tlcnira 
tcrrcitae cft fm pjcrundii due. a ignrirae cft 
mupriicicipfiue:qucp»pfcrinfufioncrofc^ 
parat tnrcrcuiefiibttantiam.ueplaioc^ffa* 




^-^ £ubarbarum.3fidoJKPtttlibk)Cfbf* 
J^mologiarum/Reubarbatjtm t>ia? cy 
JL ^tn fotoiwrbarico trane t>a»:ubiu? in* 
«enitur.*R atponticu quod arca pont/cuj in* 
iterattff.£t idcm©idf ur reu quod dl raoVp 'A ; ' 
Itradicbarbaric9 vclponrica. f ^tareariue. 
IReubarbarumqtSin 3ndiavel vltra ma^ 
me partce repcritur.radtc eft cuiufda at bo:tif 
^afiqucda5tttbcrofit9e.£tigimriUudqiiod 
guuccft infao gcnercct non perfojatum:0tt 
4riamiumfrangimr:mtcriuebabetquafdam 
Tcnulaejoifttnctaej^inc rufae btnc fubalbidae 
^4'nccn9CC9e:etcommafiicammttngit quafi 
4crocue43irfutcm babct purgandi colcra pjin 
^cip9litcrct iDiurcficam. eompacnrcr ponitut 
4nfviMfae^)ntr9febjeeacutae. fBuiccnna 
^atbarbariiutadulfcratum fpiffiue dt ac vci 
fcerneritiueJlipJicuiiii^urum autem cft vebe* 
uienriuef arum z jriinue ftiprtcum . et eft croj? 
«e'tincmre.3nipf9ifiterrcit3e amara $o'> 
|«£T4CtioJiani^ietraaetn ipfa. 

f -f>latCiSriue:^ontra cairfacrioncm epatie? 
jopimonc cccalida cauia t>9tur cu aqua cjali* 
lida.f auicena.^eubarbaru confcrt panno 
&c vdttgus fug cutce rcmancntikoiquado cu j 

accr o iiniiur./t i: co fir cmplalUaun a d apoftc; 



BtlWbfo 



ipfum el r e ; toominium calidira rie in fupcrficte 
ciUBJtconfeaitio cotracrioniep.ipfum ea fub 
ftanria ftia tcrrca ftiprica. "Floneft inco nooi 
nienttiajparene.t^atinomnirfietinbniicca 
tc: m cperiipuerie-z pzegnantito&attir.t eft 
be clegantiozibue z meliozi to medicinie aque 
lacria.-z piopiie quod fumptum eft eccapzie q 
magmficatopcraiionfaus/imilitermagnifi 7 /' 
cacur infufio ciue in aqua endiuic x aptj pzf us 
bulitum et colatum: vet itt aqua ptantaginie, 
ctrioperinittafquincadatinfbcictatcciuefpi 
ca.£ftcro pzopzn iuuameuricum ipfo ."ficqj 
bzctcrmittae addjrionemodieivini albi odo? 
rifcri clari in mfttfiombue ciue.T p^prie qn wi 
emcdarioneopilationiip»pinaf.y£teiuequi' 
dcmtnfufio comperit quando folum queritur 
abftcrfKnfdlnno z opitaiionu apcrrio: z ipfiud 
conrriti eil*birio:quando querif:vrpofttllairi 
fa vifccribue vcftigta cbrracrtonie t cmancar. 
teru ejcitlo quod alTum eft vebemeriue er. adri 
reo*z<itf ejceo puriue eftfuftinerquodopozret 
■zmeref ttccontririonc.^nraro aure? lato cd 
tritio vcbcmenercfoluir virrurcm.Dccocrio 
criamftmiliterrcfoluitqualifcuncpfit. ';■ 
«f3obance'iJbefuc.£ducit fowtioneeiueco 
leram? ftegma.^aio: ciue pzopuetaeeft mii 
diffcare cparcr ftomacbu.ctconrore ©olezito 
pimgiriuiscozum z vifccrum. 
4fi& clarificat faugiHncm:tauferiopilafibce 
% mpJbos quozum matcr cft opilarioificut bp 
dropifim:?crm'ciam:grofuciem fplcnie x fcba 
bi»opilationttm:ct fimilia. 
*f £c cc parre fubftantie fue^rictae cft pfcrrc 
fput o fanguinis tcmaua tioni ciue vridecuncp 
fa.% cafui? Ecuffioni.xfanare rupturae intrin* 
feea e^ ectTinfecae.x^prie ei9.5.t.ininimc. gra. 
♦tj.ctrubcctincto?.sra.iv.cumvinoftiptico. 
f £t confcrrinutKrio olriciue contufiontbue 
scotoririonitolacmoperfcotozibueeozunu 
ipfumquideeftmcditiriafinfluttuestcftmcdi 
cf na&ona tuflintcrie. ct pzopzfe quod epccreft 
afium.-z bibitum cum fuccoflantaginietpaii 
fovinoluptico* 

f £t confert febubuapcriodideifebiib? opi» 
tarionuctfebnbueanriquieipofteporioeiue 
infufionie ana.j.u.f* .vfqj ad ©ccemu eontririe 
ana.5.i.vfcpadi5.iii}i 

.f £c ipfum confcruaf pcr annoe quomioz: et 
. confcruaf a cozroprione z purrefacrione:fi fug 
liniarurcicera? rcrbenrina liquefacreiautccra 
fota.ourji fepeliatnr in pfilto aut miue:corifer 
uaturemtUiKtcmpotccittcnfo. 

- Capirutnm.fft]Ef.- ;K 




^3 >£nponticu.^andCiT^cupoficu.i.barf 
jOvba firiftaarteftradijcpbtica mulrfl Ittta 
*** "rctibarbaro.^trtfbsvenutae ©iftfn 
cfaevtreubarba£:f5nb ringim reubarbarMf. 
£r&rcupc*icuee q? inpbto infuia reperif:vel 
qz pbnticub5 fapozeVz reuranru cft ©icere qui 
tu radiy.f pvaf.ca,t>e reupbrico/Reupbricii 
nafcif m boffozo .ct fic ab grccia vcnif : cuiue fo 
iia magna funt fimilia folqefimpbiri.radiiceft 
aliquarenue.vafta ec nigra. i^afia fimilia cen 
raurec:fcdbzcuiozeft fragilie': lcuietn pbdctfe; 
fincodozc:ctguftu amaradcuirer ftringene. c| 
u mafticcf .-fit filutinofa ct crocei colozie. 

BpmtiontQ 

f DvaTc* 'airce efftcacitcr babct ftrmecntc^» 
j£r ibfomcro impofira mflafionce ©eficcat: 
crvulriera glutinar:acfanguiriie' : abundantia 
repzimir.^5abct in fc magnl fubftantiarcmpc 
randi:qztenet infcterreni frigozie et calozia 
part^.er lepromeriecft ad afma; ergo reuroatf 
ca ct oztbogonia itmatpotata. uuozceetcm) 
pcnginee fa nat cu acet o illinita .cf pofata cmb 
ptokisettifftntcricie piodcft:fcd bona cft q 
nbeft pttifara. 3ngultu mufciltaginofa vaafi 
dicii fubmozdee.bibita inf>ationcm fiomacbi 
toUit.XaBtudin€ct t>oloze Ibma^ bi fplenetji» 
cieetepaticiepzodcft.f JConquaffarionecoi 
poziercficit.pe alro cacicntifefubucnittBcu 
frericieet foz iomfo ef ifcozaciet tf bctianiefa 



a 



.Etattsm 



m 



totarc cft S&t cricas? fciartcae catifas c ompcJ 
idr.^anguincrcijdcnribuevtaiteradbibef; 
Sfmafi v tep:oclcft.^SjijbsUiricnribU6Tri> 
Wreradbibcf. CiUadssoiflrinrcrias frigoJtto 
ti^ta'0fm0aliire|»«:fidttjcft.^ojfibu8vcri(^ 
natie oceumt:firm1ircrvtagaricu9 ©aturir» 
ommb9 caufie. Zeroaslimpidat z Uaoiee al 
flccro impofifaifimilitercuaqitaluiozcPorTks 
tollir.UirnwdtatcrmajJrica^panto ftiprica 
% -pMxlw capi:oeraiponfico* £a.eft i ficin 
fecundo grami.Tlirrute babctrmindtficandi: 
confo:tandieicporoiritateiua; etoiurerica ejc 
quauta rito. Squa ©ecocrionisetue/bUiir opi 
larioncrafpleniatcparieeidhgida caufa. Cej 
rotfi e.e puUtcre cius i oleo roJa?: cr ccra va let 
contra •ocbititateftomacbi.-j^iilnia dueUim* 
bricoseiusoccidir.f^fidoiiBrfrbtmo.l^ai 
ponrial fanguims abuttdautia repriihir. T)a? 
betin fe manima tanpcrandi fubftanria: quia 
rerinetin fe rer rcni frigoris z catoris partc. £t 
ctia lepromcrie vnde potara ad fp3fmara reu? 
matica iuuat- j&tlemtues cmpetigines fanat* 
S> plenem repzim.it-ctluairiatoUit.£it aceto 
bibira emoptotds toiflTinterids eftiuuatiua* 
f Btbitafcftomacbi inftarioneciufer* lafittu 
dinc p:obibet acooloie.fpleneiicie z eparids 
f^ffdt.cdquaiTariortesxo^pozis rcftcir: ac ©e 
aUo cadmribusfubucnir.lumbiseriiftojrio? 
nibus totfds z vpoaindrne cft fautr arie. 
fStmcasjctfciaricascaufaecompefcir.fan 
fiuinem mjdenribus adbibet ur vriUtcr. afnw 
«dsftibgiuricnribuo rnodeft. 




€npUj^Mtf(u 



4~y jefoa,3lW^U.^«.*Rcfinaeiafht T | 
. fy\ ma ftido:clignoHim cjcalafa yr balfa* 
J r* "miferauipiniilentifdtavboruini -ivu- 
jjulro:it quc fudare pcrbibenf .*Rq* crii grece 
Cniaita rc oicif vcl tudare ficut Ugna odoriferai 
pricn'8.ficutgutfabalfamiaurfcrul3?quaruj 
gurra ourdcirin gcmmam/.in etect? .^:ima 
flfitrcfina^idfrbercbenrina^dtpuiiSriltima 
prealtfe.-z Oeferrurioeat*abia:uidca:fYria icji 
p:o i africa:? ab infnlis marie.£> ecuda cft l| 
rifcinaqtiemafrir.yocotur.betc jCbio infula 
©epozranrnr.Zeri ia cft pineabBrz bec nuc eft 
u'qutda:ttunc;mrainuenif.f 3re3lVRefiii3 
igitur oicif quodiibetfirame Uquidum vd ari* 
cuimliqttidarefinavt balfami % rerebentina* 
•barat vt maftic ttommyrrba ? bm oi.£ mis 
aucc refina pzimo eft mollist Uquida vd vifo 
feXedinprimafuiemanationcetflliquaremaj 
ttet liquida -t aliqua calo« vel frigo:e induraf. 
omnio au t rcfina eft vrilis in medioria.a ideo, 
fdina pofita in nebilibue anridotie:? vugueri 
tJs.OperarfoneeautemetvinuKe refine futf 
0ulp:um.quer e in lode fuie, . 




: P 



,-:-( 



V % 



*r> Jbe«^an4ccta.-oevJj.'Ribc8quicI£ 
jcv ©icunt creft acetofa.ct quidam oiolc 
*• B^^cctte,rcd^:.p^rjw^Qja 



BtJbttbfo 



1 

k 



itoeftacerofa.qm jS^ticfadtfdnorim capt 
rulumoerob©eribe8.7 cap.&erobfce accto 
fa.Sftfr vbi ponitcap.t>crobt>c ribcsait<y 
valet ficut rob t> acaofa. 3tem no eft coccus 
qm coccus cft ca.-r ficcc pplerionis: fcd ribea 
funrfrigi.?ficce.fSlbani.T*ibe8eltplanra 
ftipiri babcs rubeum ad viridiratesecuue te* 
nerum.folia roruda viridia nigra.cuiu8 granii 
peraturt>eco:afceni aridtfapotyoec] fitrob* 

js v^Jffesatft loco eiu8fuccu acetofe que elttappa 

I <*\ fciumagrclte ponere pofrumu8.fSfera.libw 
/v fl3.cap.rib^8aucto.3raacbenara. , Ribe6elt 

^ &^>Pk nra babcn8cap:eolo8rccente8rubeoBa4 
_, Vriditatet>eclinate8.-zbjfoIiamagnalataro 

• vv mndaviridia.«babrtgranac]fapo:cft©ul* 
a0cuacetofitate.jetipraeft frigidazficca in 
p.gracw.£tfignufuperboceft acetofitae ei9 
aftipticiW8.^e|cbocc6twgitcj» infrigidac 
ftomacbum.£taliquirtcuntqreft frigida ec 
ficcain.itj.gradu.'Rafriturautcmplaraaifta 
mmpntibus f?rie fngidis niuofte. 

0pfrationt0. 

a f £>er a.3pfa abfrindit firitmet pfert fpectefo 
babaon.i.moMlwabfciiiditfmmq"fit a ca^ 

8 Udifateeo:po:?:?rainetftitrimf fcteomtc 
nitfpecieb? botbo: qucftunt in co:po« ficuc 

C variole?fimitia.f£c p:ouocat appetitum :z 
tncouatftomacbu fiia frigiditace. z abfcindit 
firim a colerarr.ftuEum vomitu.rrob auaco* 
fert cardiacc? vomituiet fturui quifit a colc* 

^ rfl.f £tp:ouocatcibiappmtii.et inrofc ciua 
eli ©ulccdo z acetofitas. £c idej aucr, ^ben 
mefuai.frigi.eft z fic.in.q.graduitrob e ficuc 
rob acetofitari citri z agrefte th vircutettcft bo 
na emo:roidito z cbrietati.? putant aliquime 
dico^cpfitillacjnominamracetofa^lappad 
um.? putauerut aliqui q> ftrgranu acctofum 
q6aftetfe|cco:afccni4icetomc8oecipiantHr» 

€apttulttm.ftffat]f. 

•jT\ 3 fi.T>andecca .Ivq.Srj arabice grc 
j<Tl|ceojo:a.latinevcrorift.j53lie^Mmo p* 
&* *dbi8ca.t>erifo.3nfapo:eeiu8eftfiip 
ricitae.iidco retinet ventrcrctenrioetcperata 
ctincorriceriuseft rubedomagis manifeft»- 
tfcin ipfometautin reliquo co:po:$ciu8.-z n# 
misnutncqsfermentu. f £t idej.viq.fim.far, 
ca.o:ofa.D:ofa.i.rifum bj quid ftipricu c\cyti 
ca ventre moderate t>erinet.f£t idem U.p:e^ 
dicto t>ectbie.£5ocfemineome8fldreftricrio 
ne ventrl vcuntur t>eleeta tione ipfiue fimil*m> 
racientes condro.£ft aut indigefttbtliue coin^ 
dro^nutrienomintisXicut t adpclccytipnej ; 
cdulq ocficiene ab ipfo plurimnm. 




0pfrattonf0 

fSfera.lt^ggre.cap.2lrj.i.rifitm.Suntca? 
ude zficcecoplerionis inprimo grfldu.3lml 
fo:tractfltutertiocap.arj©erifo.*Rifi tcmpc 
riei queelt tntcr calidum z frigidu vicinu cxV/ 
jfttta ventreftringit .Sfolitis aut colicam pa 
finocerico cp licctnutriafoeventre^tamenno 
facilct>efcendit:nificoquaturcualiquomuJirii 
vntfuofttatisbabcnte.qb' quado eu Iflcte co? 
quitur z cu juccaro comeditur plurimu nutrit 
flfCBfanguineaugmentat.fS>.erap.0uado 
faniegcnc pultito ciue^tet punctiones quaf 
babctin ventre.auf^rjpter ftuwtm multo? bu* 
mo? fup. quos vincit colera.aut aliqua alia 6 
caufa fimili buic.coqucrifiquoufcptJiffoUia? 
tur:7fiantficutflqufl Kiftiet t>ainpotu;bo:a 
couententio: vfus ciU8 tcmpus cft bumidum 
er qn ft omacbus cft fo:ri8 virtutis ad cibos, 
f £tidem aucto. t>f a. £(t pauanutrimenti 
jftringit ventre.augct fperma:^ mino:at feces 
et vrina ? v&ofitatee,£ft ein completu in Itip 
tidtatcz ideo eft bonu vlcaib inrdtino?:t pa 
crionitoco^quado bibitur.autfif cuco crtltc 
rc.-z rubcu elt conftrictiuuptus.f 3faac. 'RiO 
fi namra cafidum eft in primo grad«:ficcuj in 
jctfo.&Uquado moU teritur.eiufcp fartttfl fi^ 
cutirtticicoc^itUMVfllctbi8qnirno:fionetn 
3 «9 



P 



Kmtam 



3 



fn^macbotCnfefttitfapfltiijntor.fnttgrum 
. autcuiffaqua coctumvalet adeolrrica ©yar 
riam.£um laetearamtgdaleo coctum conittf 
pjrtonemfuam amirift«pafectenutrit.2>£ 
guincbonii gsnerat (icu eo vel aqua eim Wt 
t igineslaucs:aufert eas: x cutem mundificat. 
f £onltanrinus inpantegni "Rifum calidum 
cltin pamo gradu.ficcum in fctfo.unde ven* 
trem (cringtrmon tamen muttummift mijcrum 
fitibi milium:lon«m quocptcuburiro i amig 
dalcoii cocrummo dt venrris conftipariuum 
fedmfeigat©olo:emftomacbt"«ardowm inte 
ttm^t Isurusnucrimenrum temperatum eft 
i ©igdtiuum.fi cum lacte coquirur-sconftipatf 
tioncmfarir&d bumectat ac nutrit. 
f Buicennainfecundo canoncTlifum calt 
dum eft i ficcum.^Rutrimentum p:ebec multu 
tardeinfrigtdarur::tnipfodtablierfto.t>ec(> 
ctutncum aqua Itringit vfqjad tcrminum.£E 
in fpemiatefacit augmentum 
f 3demtnquarto;canone £o»etri(ivenetw 
reputarur.Utemm quidaj pamo:umt>iteruc 
€tcuiinpotuoatur:accidit itatim©olo:mo:e 
«tinlingua:ctipfa lingua apoftematur.fceutf 
<kt>olo: invmbiuco cjctendituret ftomacbo: 
fhtdlt» ifcp emd.Cotumcp coipus inftamma? 
fur.curaturcumcuranonecltaridum; Opo:^ 
tctautcmcrinolcoduequodipfcmponi fttf 
«tttaronfaiint&ecocta. 




W3 Dbelia,3faac'RobeuefrfgtcIefBnriii 
•jCp p:imo gradu medic inter bumida i fitf 
"**' "ca.£o:tejce9?-ftipricu6eft.f Scto^ 
!3fte funtvtdclicet robclie.ficut fcijrimns pau 
lo fup:a.queanonnullismedico:um noftroj 
eftifimantureflepifa. 

#prrationr0 

1 3faac vt fnp:aXomceeius mundare lao* 
dabilesgenerant cbimos.-Rec inflationcm 
9utrcntofitatefaauntvtfabe.Bdvfumcden 
dt boncfuntin dtate? in calida rcgtone. 
f^atbaplatmaepeismembristracnsappo^ 
fitnm folidat z t>olo:em aufert. 
^^nsejreiusvelutecfabafactnmvalct a4 
cardtafim tulTim % soloiem pcctoue. 




Capitulum.tf(fru. 






CapituIum.frtjEdii). SSSSS 



Ododendron.f3(lfdouie. , Rododett 
droncomtptevulgo lotandrumvoca 
turcco crfolqslanrifitfimuMozeve 
rofa.arbotenimvenenata eft.intcmcit enim 
alrerasmederur ferpentum vecationibns. 

©prrationra. 

4 IbhmuB lif.edectino. *Rododendron vt no 
mine apparet a greci8vemt.aiu neruimvoca 

Iq rodopfcancmrocaucrunt. frodt 



Btfyttbte. 



fonpttmrumrdrcftmiUmdfnccmilibue frurtt 
cofum.^untcnriftfjcapnot ouibsavencnum. 
3<km ramen cft bomini cofra fcrpcnrum vct 
ncm rancdium.f jfaem ttteo.cvtj/Rododen 
dronferiturp:opagine:ficutcriam fcminc - 
CJ &5 U.jrriiq/Rododcndrosnc nome apud 
noe inuenit latinum.fcd radopbonem vocanc 
a ut ncruim.^irmncp folia eflc quadrupcduj 
venenumibomtni vcro cotttrafcrpcnres p:elt' 
dium addir a ruta t vino pof a .*fS>eai8 etimvz 
opcr fi aqua bibcrmtin quo folia ea maduc? 
rintjbutufmodi mo:t t>icuntur. 




(EapitulHm.cfrjEaif, 

5m*"> Dbur.;aao:.*Rebur (ftn 3itdo?)ge 
^C^ncralifcroiciwrejcomnimatcriaquic 
** . vquid eft firmiffimum.13ibtiominu8ra 
meniarbo: qucdam boc nominc nuncupsf, 
fcc qua frcquenter •jMinius loqnuur. 

i>ptrattonf0. 

^•f>liniu8ltb».]rvi.*Robo:dr6landifcra(i? 
cut i qucrcus ac vla:p-aer frucrum i alia gi? 
gnit pHirima/crt cm tgalle genus vrrucp.£c 
qucdamvclutimo:a:nifi ©iltarentarida t>ttf 
ncicplcmqjcflputimitantiatbauriquitoinf 
cft frucrusnnclris oliuc fimilie/flafcutur % m 
copuiMc.nucitono abfiiintceiiicue babctee 



flocaik>0motlc6[nccma?1umtnibudapfu^ 

'R3mifineolcoflagrIt:ficuti gallia ntgraw 

5crt 7 aliam vt ilcm pillulam cu capil"o.vcroo 

tcmpo:ctamcnmelligcnifucci. f 0ignunt % 

altj ramo?ct'U8 prflulas co:po:i no pcdiclb ad 

bcrcntcs candtcat ce vmbilici8. .Cetcra nigra 

varietafcoifpcrfa.^cdia cocci eoloJem bs# 

bent.f Sliquado % culicce gignir.Rcc non c 

folus conuoluras pillulas:: in fotio rubcnres* 

Sqiiofbsnuclcoocanclicanrceactranfluci* 

doe q*diu mottcs finnin quito t ailiccs nafat 

rur.*z£)arurefcunt in modum.fcrunrcr robb? 

ra cancb:i pillulam in mcdicina vimvrendiba 

benrcm.3o crctcit bvcme spcritur vere piluila 

tot a:cadirq? cum folia crcfccrc r eperinrjtain 

muuifera funcs tot ree p:ercr glandem robo* 

raparuum.^cdipolefoefquillofo^nouiffi^ 

ma irriramcnta guicquecirca radicce nafcutf 

tur. f*Robo:e quocp vifcum ac mella fcrunrs 

vt auto: eli 3befiodu8.«ronftato3 ro:ee melle* 

oeccclo cadcntcenoaltje^magismfiderc fro 

dibueXrcmari quocp rcbo:ie cincrcm inrro: 

fum cffecerttsm cft.©candula quidc5 c robo* 

rcn'raprifuma.moccfilandifcri8alt}8;fcdmt> 

nimcturan8p:ctercgcpmo.^5onrcs z val? 

lcs i> iligir -rob ur caftanea et ab tcs.£> tmr au^ 

t cm robou folia roro ambitu finuofa. £ t funt 

riecriaincaudiccipfoiamtcnfaacrara^ch^ 

pcro3laterario:aQifpofita mtrro* 

f 3 rcm.*Robur abies % laricno conrfnuant 

gcrminationcm: fedintcrmitnmt.^ triparrira 

t rinacfl garma cdunt. 3dco et inter fquamaa 

<;o:rtamfparguitf:quod omnibusarboabuf 

cuenitingerminatione.quia rumpitur ontcjc 

p:cgnflnfiu.*Robo:ifcuTu8cftco:tcj: no lcuts 

fcdfcabcr; *Radiccs coptofe arcgcarnofc-qs 

in'p:oftmdum agitmolfis ac pcffima lignt 

par8ctiaminrobo:cfacilc purrefcens terre; 

cliniobnopa.idcocp fcmper eft amputanda 

f"Robwvk£acmo:iretcbetttte?quefincmc 

dullafuntrota offcefunt.*Robo: fpiffsmba; 

bct matcriaimacEi mgricane colo: cft.^anta 

9uiiciaincfttobo*i;vtnifi madefactum norr 

queat tmb:ari.-zncquidcmftcquidad actus. 

clauu8aucui3taq$caricmvefuftatcm fcntic 

tardilTime.ftnut tamcn rcredinan ccfum in vc 

re.^mmavao ncq; vittatur necEfmditurja li 

U8obno*:iumaiamvtto:qucatfefe:findatc^ 

quodinfubae tcmpeftiuccpcefoaicmt ^efof 

fum t>iuourat robur .fcd aqua marina co:ru>t 

pimr. 

f *Rcbur7olca in franfucrfumpofitcfnairf 
uanrurtccdunrcp pcderi.tliridia p:acr robnr 
Ct bwu tjcrnnacmercfiiiunt fcctioni fcrra^q: 
S>cnK6cquaUtafercplcniirKrri^untaujri>: 
Mm 



& 



& 



Hmmm 



twa i interfc i cualtjeglutino inforiabflia. 
vifeus adnafcuur: i in rubo« x t quercu \t fltf 
«.Odc5tt.ppq.!3nfico^omniucapacinima 
j>idmrplatanu0.*poftcarobur:vc?Ttracp fa 
po:eeco:rupunr.pedamentafuntoprima xti 
cibue e robo: oleacfc. I^etttea pomifert, que 
tferminant:nccfracrufcrat.fcuTa radicc lapis 
i'nditur:fcrtttefcBfiunt. t5oc idcmin amigda* 
liaeroborecunco adactofit.penicparbou» 
(qacdam ablato in roto coitice mouuntur. tar 
^iueautcmrobumquaaje* 




€apitulunw«jffoit 

£T> Dt9be9velrodab9.Srera4i.ag.cai 
TC^TCodabaquandocftbumida? receno 
!** ^fdturalraicfafsi^neftiic.Waifafao 
«cft fpccicsleguminieficnoiata.Et idc? dua 
pyafco.twimo qn nafcitur cft umflis anda* 
cuebesq nafdtur in p:ati8.fedquando eft com 
plctab^foUafubtttioiaq folia ipfiue.fbabet 
ramosfimileeramiofandabucbe^tfuntdfe 
mina inmagnirudine leuri8:to:tuofa funt co: 
iwa.aiiqnDeuccaturtadminiftraturcu ali 
Isrctospparatur cufale. jettdem9uc09lie< 
S^apo: bmimgram cft ftipticua ficut fapot 
lenttegetvirtuseiusdtcaltdacaliditatetem 
perat9.zedicc9ttoeiu6eft9mpuo:ejdi'cc9tu> 
ficUnne;j(omcditurfia«lai0. 



jDprrattonra- 

ajScra4ueto.3faacbcnar5.3lfaj:fiafa:id * 
eft rotobea nafcitur fuji aquasitno ficcatur 
tneftate nccpbfeme.: tdeo nominarbumida 
jPrqrjseeaadminijtTarordtfcmeneius-zfo'/ ,, 
lta.?cftcau'.tbtunfoeftineoinrl9tio, f£t * 
icko9ugafpenn9rzineit9tcoitu.?augctiuu9 f 
iticntummedtcina^quefaciunwdboc.f tt * 
femmdueingrcdirarinptorito pfecrionibua . 
fouibue.ajEtqnficcrr^laftrucumfolqeeu» * 
confertmembtieqindigcntfcdationeioolorl 
co^dlctituenimedboanimauum 




Capttulum.raw. 

^3 Ofalatine.greeerodon.arabicebard. 
jCp S>erapion ltb:o 9g.capibard.9uao* 
■^5j5ab'eni.Titj.fimplictu farmaco? cajn 
©erofa ioubftanria due eft ccpofita etfnb* 
ftanria aquofa calida cu ©uabus alqsqualtf 
tantopcrmiica ftipuca kn amara^uiue Itip 
ricitaedim quanriraterali.quiaco:po:a ba* 
benria virrutem flucum no potTuntfciUbluere 
virrutemdue.^fcmenduscftmagis ftipricif 
cprofa. £t idcmrofacum ftiptidratcque cft: 
in ea ineft eioutcedo i fimilirudo acnijratierel 
inotdinarioniepauce.? ccmenit apoftematito 
calidte inp:incipio eoj,? opciret Cf redpiaf 



&tl}ttbi& 



%cne ej&aft abfcfodanf fummn^ee ci9 val* 
decu foipictbueit refemenf pmcdicmimko 
oailoa, SJedoIcurofa^cftfo natura fua mc* 
$5 forcrnaturarofez okux eftmedtcina d 
quacurartf apoftemat a fangufoie in atigmen 
toipfo£.2ineo elit virtuepcnctrandi adjpfun 
ctum co^porie.tburaeaatco^po&ficcarzcoa 
qaaffaritr ca accto : % inungif caput a\ co .% cot 
tiemt t>olori capiriefacto cjccaliditatefolie. et 
eraado rofc ficcanf:opo:tet cp ©eficcenf in vutf 
b:s : i cdmaueanf autduc. z aqua rofa? eft fri* 
# Jiq: coplccionetemperata: non tame' multa 
ctipfa quidccft fubrilioiiwltefubtihtatie, £t 
fignum inboc eft q> rofa t>«flccaf ctto.ideo qz 
fo ea non elt aliqua vifcofitao: quia odo: dus 
viiic^jpterea fcftfoat? fepiet viae odowtus 

p f £5era.aucto. E> vafXft cm rofa frigtda t>e 
ficcar iua.-: ejccaeli plueltipricaficca cgrccee. 

, £tfuccue rofa^ qfi coquif cum vtno coucmc 
©olou capirie z oculo? z auriu.£t conmit gin 
giuisujncueo u'tcoUutio:zcoquunf folia c& 
ftneftipinbuoetiioejcpiintnnf.etfitemplaftni 
cu efe bcrifipilc. •zfcmen qtf eft fo mcdio rofa^ 
qu paluerijatur fuper gingiua s ad quas fuiat 
b«ino:eo,conucnit multum .Sped caput rofc 
quando bulierit m aqua z btbitur ;abfc i udit fiii 

. jcumvenme^fpuctimfanguinie. 

- f£tidcmaucto^)acbam3quarofa^bl 
bccfluL-uad oculu.etconucnitfujcopi; quado 
btbitm-ec ea bauftuealiquie. 

* <ff£ttdeaucto.^umav.*Rpfafo:ti(icatmem 
b:a intrinfeca. £t ftipriatae eius penctrat^ 

j prcr ammtudfocm que eft fo ea. 

' f £t ideaucto.ab.cn mcfuay. 0dp:ario rofc 
pucnit colericis z bnttto cau>:e s capttie colctf 
rcm a colcra. £t,pbibet famofitatee colericae 
acuu s.ct ^ncnit t>olo:i acuto.? mouct ftemu 
tatwnebabeYiC€rebwcar.£^qnconn^ifcum 
melte aut cvi juccaro abftergif qubd eft in fto? 
ntacbo e)c feumoribue flegmatiae. 
ff £t idcaucto/Rafto. eiepeituecftqutdaec 
amiciemeie qui acccpir ccfo Itje rofa? rcccrtti 
buszjuccaro. zfcccrutcu afcllarc oece vicite' 
3boc facir fuccue ciue:veru hcca no ci i lacan? 
tia.? bocfigrtfficaf ccco cpvtrtueatteeftama 
; ra q» abftergit,£tqnrofat>eftecaf fitftipW 
ca:quiafeparaf ab ea amaiitudo. £t ftccitae. 
«juidem in rofa eft pauca ;quia tpfa dt compoft 
t^cc Uipriciratcz amaritiidiucvnde abfcindit . 
; lib!dincm;ctlaicatla]cariouefo:ti. ... . 3 

^ f 3obaunee^)cfnc cap.f erofarRofa ciicp 
medtcini^bencdicrioHrt qua cit vtrtuficonfo: 
catipnctfl factce.-? fpitin "onc % m«k ^litaaft 



|KnnutationcXteftcicean»beazaIba.teftw 
vtriufq? mnlro^folionj z t>cnfo«ira z crupom; 
ctahapaucomzplanoJH.etmelfotcftrubea 
vererubedintepattcommfolionl^planoutm; 
z ec albie cft ntclic: babce jimlteeri Etjnelioi 
fuccae cft cutus matcrjdt rofa complCT«:ficca 
vero mdio: dt in qua nodum Ccctdit cSglc%h* 
^ft frtgida in p:imo gradu; ficca in kaindol 
PiucrfarQ autc naturantm fisbltanric compo 
fucruntrolam.mterqua6pordtcaderefcparai 
nbfciitingueneXompoiiif an qcparttb? ter* 
reie z aquetGmediombuetiantibuo tt fiiprici* 
tacem etfiibftanriam.£t£f;p3rfibueacrue p} 
pter quae dt in ea t>e ©ulcedtnc aliquid z aro£ 
i m9ticitae,£t cjc parnibue igiuie fubttlibue: a 
quibueconfiftitpcrfcctio z fpcacet>anrtb,u0 
ici amartrudincm.pJopftTquodin abfcifionc 
amarituditiie ipfiue que rcmbucf p:oprer foli 
ejaccationeeiuenojirefolniturfpecics. 3n ab> 
wfione rubcdiiue noneftpluorofii c$ bomo 
riioauue.amarifikloflutcineaqiicreceneclt: 
plueeft t)eftipticitarcipri9. £tp:tma due opc 
fatio eftp:opfer amaritudinem fuam.p:optcr 
quod roia reccne cteius p:op:ie fuccue folunV 
iuimaurerefotuitur calidiraePaneci am$? 
jrttudinem: p^pter cjriccationcm ctue nomina 
Itur fifcfjantia eiue Itipnca ;f.uuj»e conli ipati* 
onem. £ft autefuccue eiue calidue fcre ad pri 
mnm gradumpwpter cjcclufione etuei re tcri 
rdiriifrigtda. _ 

if 3ol3annce^)efue,£rt auremrofa folutiua 
^ctftene ectinctiua inHamationu^cofouarfua 
memb:b:um:coadnuariua parriu z conitricri 
na .tfemen eius t n boc dt fo:riue.-z fimilirer pi 
Kduequi funt tn medio ipfiuo: 1 fuccus eiue e 
rcjblucne.£t ficca quidem magtefrigida zftif 
^ric3. l etquenondtcompleta frigidiou fiipiC 
cio:.t alba in fngiditate z jltiptkir ateplue di q$ 
tubea.non cfl iuca malicia: fcd eft eit t>cbtUter 
(plucntibu8.vigo:af tamcuopaationcm eiue 
aquacafci. 

f ©icm fuccirofanim.5.i.mtfceatiircu aqtt^ 
cofa etpauca fpica dt folutiuum conueniene» 
£z fimiluer tiifulio. j*vt. foliouim rofanun ia, 
aqua cafd cfi pauco mdle:foluit finc mold iia , 
£tfYrupasfacfueci:fuccoduedtleuiefolu^ 
ftonie. £r umtliter ponitur olcum due in awc 
darioncni£dia'naramacutarum:ficuteftfca^ 
riwncaetfiiiulia. 

fRole mcm coudirccum mdfe abftcrgunt. t 
imuiidificanfetcoUfo:raot.£tcondtrecum 
jttccaro minoris funt abftdfionie '■% maiorie . 
cbnfoitat ionte -x ftipticirarie.ct aqua eo% q«c , 
fit pcriiifnfidntmmundificat ?confo:rat;iib>f 
iKrgtfrtvddlut;' "'*■ ' ■' ^ 



a 






€tmsm 



* f £a qiietltpdfublimMiotieeRmvAtecofoi'/ 
tatibnisrnccp eft refoluf iua ,fl>ta rcfolutionej 
fubrilie calfdi ! taris ef us fn ©ecorrione ipfiue. 
p.a\bae vero nofirfolurio atiq t>ecj fitairan? 
du. -z c in de t>e fftpactate ptulqj i hi. necp fut 
umUes ae in confoJtatfont.-z ciro <y rofe non 
fublt(naoct>ccoctioncaUciclotno:t,|p^ere# 
cettfcs.foluif em ab ds virtue: fimule abfterfi 
o nc due i foluri bne.*t>eclaraf vi rtue riiie fti 
pr fcafacicnsconftricriouc.Snccus $>o etoa 
futfmct ©tfocrioncaliquidmediocriterJfaf; 
qrifrft ei fubtilitate-z bottirarem abfteriionis, 
X ^0lcu^?factuccrofanondu\6pUtiScft ma 
io:ie infrigidaf ionie i ftipricif arie.cuiS meliue 
fundamenrii eft oleum oWuarum mediomra tn 
mamritate aur fifaminum. 
X 2£> ■ fl" 3 cewm aure infnffpnie duseft medicina 
omnium inftanimartonum.? cft t>itufiuumfo^ 

i lurionc? confo:tariuum. 
_ "B f Sniccus eim cjc aqua infauonfsrccentium 
co mplct a? foluf ione educit eokra: mundificat 
fanguinem ab ca et vcttas? articuloe. 

© f Jzt conuenit vcteriae: i$pcrit opilarioncs 
_ cpatis z ttomacbi: t mundifiicat z confoitat ea 
ct confo:tatco:. wuenittremoudus. tedai 
cit materilcaufanrceam tfcbnbus colaias. 
•ftofa vcro tolcii ciue i aqua ipfiue f jcta pet* 
fublitnatione confo:ta t coz i ftomacbii i cpar 
et coadunat partee lajcasmembjo?.-? c6fp:7 
tatrercntionc: / z fedat t>oto:c8 ealidoe mir.i fe 
.\ datic4ie.etejcringuira^permutatmalictasin^ 
fl5mariom1:perimit i fedat eae.£ t funt ejc me? 
clicime faacnrilms tjoimirc.facutnt ramat co 
rijimtftcmutatione.tobfuiitcatarrie^ltrin 
gunf gurtunt confo:t anr ea :z auferunt crapu 
lae. Dofie potio fucc(rofa?.eltab.u. vfceadi 
.tj.cum juccaro.£rporio f^rup. facti ejc fuccc* 
carumelt.5.tj.vfcp.v. 

«fS f Btri.U.t>evirito co:dt'e ©f cit :q> eofottat cor. 

3Qt ^alladiuetib.tt|.3nmenfefcb:uariorofa^ 
ria confacnda funt:qnefnlco btaiiffimb attt 
fcrobibusponenda funr : velvirgultie vdetil 

* fcmine.Sfeminaauterofarumnonputanus 
mcdt'08 ftofcutoecffeaurdcoloae quoerofe 
fcrunfrfedbaccie nurritmr: quaeinbmnffimi 
piriad ftmilirudine plenaefemin(b9 fuie pott 
vindemiam rcdduw:marurasereolo:e fufco. 
tt moUi( ief potenmue eltimare. £Ji qua criaj 
funranriqua rofana:boctempo:e arcumfo^ 
, diunf:t farcwlis vd&olabzis aridirae vniucr* 
fa rcdcltur.tunc qucrara funnpoffimr t>ucta 
virgi?i p:opagtncreparari.Sirpfam tpfiue 
bafbcre votucrie ouabus palmie ab ea gYrutn 
fodiee: ? aqnacatida bterisgbie in t>it% 

*R- ^3dcm;^4ira/^ofafTigidai(ttnp:iiiiosra 



dn^i«ain fecundo. \£x viridistttcca «opeifr 
vfui^iicdicine.jOtuida colligunteapbft mam; 
ritatem:fcdnontamdiu fauatur.lpcbcntaut \ 
colligi cum non babet fotia omniro qcpanfa j 
'Ztamealiquantulumiamrubea.yCollectcaut 
adfotcm aliquanwwmocficcari potfant^e 
triamiumferuari. 

^2bacer.picifloe flo:u nobferofa iurc vi^ 
derur.0uodfpecia'cunctoep:eccdatodoa^ 
fto:ee.'Hon ramcn bec fpccie tm necodozcui* 
ttare r Roevalet:bacvart}e noeadiuuat illa 
fideU8.£ttie ficca gradn viec fei friflidapmo. 




Capitutom.fffiEri]f. 

^3 StaavdSnfcra.^autuecap.Snfe 
jCv rs.antera cftidquod inmcdioipfiu» 
"*• "rpfe nafcif aurci colo:ie: z a fpcae flo t 
ns t>icra cfi.afiH etia medicinc competunt. 



^tiniue.ilapita rofarum peta ventrcrti et- 
fanguincm fiftuf.jfrem;anguee rofe fatubra?' 
eptfo^s funf. "dlcera cm oculo? rofa pwacg' 
inittje fo:defcur.3tem anterat>iffintericie ma 

gnumpKfidiumcft. 



.ffff. 



iH. 



Bt\\u\m 

m 




V> 0mmpo:a'nnm.^3ndccfacat>trui 
■ICvocr. •Roltnim pozcirium berba dtlon 
•"• ^tudmtsvnwsoigiri^eiurdelarats 
pandene fc fuper rcrra amplccrcrie eam.cuiu9 
foliaejcvrrocpiarerefunr incifaincifurie ma? 
gnie.er in ciue medio leuatur ftipue paruue.in 
cuiusftipitefitquedamlanugo rotunda ficut 
pila.ficutfacit berba femifion: quecum tanfiif 
ttiToluitur; 

J0paatfottf0 

i ^ £onfert opilatte.Tloftrum cowtnnm bcr? 
ba eft quam pluree tricunt confolide fpccicm. 
fedfauo:immo cftberba vtcunqjpitofa babee 
quafi odo:em botaginie: ct virrutem confoltf 
datiuaminvirtureucutp:cccdcn8, 

€apitulum.tfftt 

W*"> Ota larinet greccSrabiccvcro ra* 
^C^dcbvelalfctep.©era.lib\aggre.ca.ra:J 
*** ^deb auao.Dvaf/Radeb.i.ruta.,£relt 
*>e ca ©omeftica i filucftrie. fj filueftrie cft ma 
gts calida cp ©omcftica z magis acura.qucef 
ciaett norieftbona.fedt>omeftica: zmactme 
flla queoatur circa arbo:em ficue vcl circa cu 
cumereeefteonucnienecibus.etaliudgenue 
rntefiiucftrie que nafcitur inmacedonia ct in 



gallfda afvcquf mom'ctneeappcHanf. £tat& 
quiarmotam eamvoclr. ^rutcceft vna radi£ 
vtrgaemultae babene. folia lat io:a plufcg t>c* 
meltica. fcd mollia odoic grauem babchrta ct 
no:em atbu i capita maio:a qjtjomcfttca, et 
cribu8partibu8t>tuifa.27uiu8fcmenob:ufu$ 
ct m"gonuguftitainarucft.i?ectnanriquote 
po*e colligif .3fido:ue lib» crbrmogia/Ruta 
©tcra eft eo q> fit feraerfflima .criius atrera agre; 
ftie at 03 virtutc acrtQ:.fed vtraqs fefuenftilimaj 
comptobaf.&anc venente repugriaf c muftele 
©ocent.qucfrum cum fcrpenre tnmicauerint: 
ctu8ciboarmanf.3faac.7^utafilueftri8cau^ 
da tficca inquarto gradri. someftica vcro trl 
terrio. que melio: eft ad ©igerendu. q: virrore* 
babet incidcdi,? grofibe bumoteezvifeofoe 
errenuandi.*£lareariue.£ft ruta someftica i 
filuellrie que piganfi ©icirVfciiifae folia ? fcratf 
na comperuntvfutmcditine.tlirturcmbabcr 
©iurertcam ©uToluendii cenfumendi.!kvpd? 
crae.*Ruta calida x ficca m tertio gradu.*pal? 
ladiuein (ib:o quarto tcagriculf ura.^enfe 
2£>artio ruta fcritur locie ap:ide. foliue cirie? 
rieinfperfionecontettea.loavcfidcratauid; 
ra.vridc bumo: due clabitur. fi penae etue fef 
mina adbuc claufa folliculie figillarim t>ebe 
bismanuarrtccrc.fi iammjnHwfumfpaffai 



Zmttmw 



tactabierzrafiroabducta cooperice, XTaulce 
eiuequiinclufie feminibue natifuerint fouio* 
res:fcd fcro4ttfcehf.T*amula eiuecii aliqua 
comdsparrccduulfi verno rgep planris|rene? 
bunKtora^tTauflamuioacf.i^lonullciramu 
losduspertufefabeMcruntvcl bulbo:atcp 
tlla obumnraUcnovtgo:efcruandoe.foub ff 
ci arbo:iexmblalibcntiue acquiefcnvfio cffo 
ditbcrbae:feddprar audli.3mmunde mulictf 
foim&mmc&i&iiWb.pi:.fcmMtfa 
uomo z ab autumnicquinojcio: oditbycmeec 
bunw2eacfimiiiapaa'e^aiiclctacficcie:rcwa 
^q^jeunelarericcaXinere«utrirtvulr:bic 
erXemini mifecrorvtcareaterucie. 



^ 46af.vq.fim.far.ca.moiX>uara.quidabmdt 
ratafiluefirenoiam: 4da aufarroola. tlirrue 
autciuaiubrilliedt z ca.ftiLiiij.gradu.vnd c% 
tnddtr;groffo8j>umo:ce:? t>yafo:ar:? ad yiit 

36 Ttat^epuocat^fitidc.viqfnn.iar.ca.piga 
-niii.lbisamu.i.nJta.Sti^citSieqatdgec-iiq. 
eft.graduealcfadcnriii i ficcanau: fcomeftica 
-vero ejctcrrio. £11 aur no folii acrie guftu: fcd 
«tilamara:cj incidere^ioyafowre bjgroflbs 
tvifcofosbumouie^prcreandeautvirfureet 
gvjinaseuacuar.quirijuotfubaliupamucft 

X ct vaofirariesefirucriua. f ^ciddrco ad fpti 
rarioneBConuemtoamontateeq ad vcnerca 
perrinenj«©yafo?aK ffctattnodcrare. eftern 
ucfoirirer ficcanrifofannaci&Qfcra^ucrozi. 
fDyafc^uraefttiercbueniagiscohftrcnrito 

%>* <nnarionitorvfroftrarifo.f ectpfactringuit 
libidinecouus.Untionieftica z filueftrisfuht 
ambe-calefactiue;adu(riuc:p:ouocariucv:ine 
■-i mettftrno£/r qncomedflfruta aut bibif ftrin* 
gitvemre.? qnfumiftnpotu etfemine: cuiutf 
cuc&quantae vniue caluf cu vino eft medica* 
mcnconfereneniulrummedicinte mo:tifcrie^ 

£. f £tqncomcdurirYolia dus fola:aut cu ficu? 
bueftcde xnudbue: auferuntnocumenta mc* 

3 didna^rr»:ftferaru^^teftvltima.incdicina 
conrra tnaUda vcneno?:qfi adminiftrar" ficut 
x$ijrimuej2p:efem'meontra pcftilenria. £t qfi 
comeditur ^bibif ruta fetnp, abfrindirfpcrma; 
£t qncoqmf curn aceto ficco t fumitunfedac 
rozfionee.-zqnadminiftraf in buncmodu:con 
ferr totori Urerie -r soloripccrorie: z afmarier 
tuflttapofiemari pulmonie« fdaricc z x>olo:i 

^5 iuncmraru srigonbue.f £t qncoquitur in 
oleo-zponifincriftertbueccfertinflationima^ 
tricie:z tttnariomto inteftino?.:: soloiito rccri 
irtrcftini.£r qn rerirur z confictf cum mclle: ec 
Jiriitur fup:a cellumamcisconfertfcoloriciV 
t> ^uiftocarionimamde.f jerqfKoqtjifmolco 



ctbibttur.-occtditteicpcllitlumbricoe.-jcon^ 
fidfcumcllc^fitcmplaftrutoloriiunctura?: 
z SOlori et concufltoni.T fit cmplaftru cum ea: 
etficijbuebydropificarnofe.f £tqusndo coi 
quitur ciivtno vfcp ad confumprionemedieta 
tis vini er b ibirur.? confert fpeciri bumide by* 
dropifis.? quado comedif fola fitie cft autfal* 
lita acuir vifum. £t quando f it emplaftru cum 
ea cum fauicb fupcr ocuuim:fedat fcolotc ciue 
f £tquidotcritur amifceturrii accto z olco 
rofa?:t fir linirio cum co: fcdart>olo:ecapitt'8. 
£rquldoiitrromirrifinnaribu8tpfaautfuc^ 
cua due abfdndit flujtum fanguinisab de. 
f £ r quado admifcetur cn nirro « fricaf inck 
motfea a Iba conferream.-z quando fir cmpla^ 
ftrum cum ea cii mellczalbuminefuper empe* 
tiginem cofcrt ei.f £t quando fuccus rute ca^ ) 
Ufirinco:ricegranari«w'fiillafinflurem:con 
fert ©olori eius.t mifcetur cum fucco fcnicuU % 
mcllc.etfitcollirium cum co.ctconferti>0to:i 
vifue*f £t quando mtTcef cum accto soleo ro 
farum.etconftcifcumccrufa.tfitliniamcntu 
cum ca:confcrt berif ipilet fo:mice.et vlceri to 
capiriebumidie.£truta quado mafticaf poft 
comcftionemcepa^^alio^aufertfcto^illo?. 
fSerapio.*RutamVeneni8rcfifteremuftcte 
«occnt.que quando cu ferpenntot>imicaru« 
funt abocius armanf. Vocait etisi rcjc ponti^ 
cue.qui cumfratrie fut timcret infidiae rure fo 
lia cu cuato nudbue z toride caricis admittb 
faleidunueacccperar.sfecurecumcoagcbat 
Bgrcfiieftfumarurnimio^cipfaocddir. 
f Hi quando ipfa co\ligit majcimecum ccpcrtt 
ajparere floe.fi carnem rcngcrir v lccra r er fa* 
rir inflarc cum ptmiru.quareopower qui vute 
cam coUigere cr vngat manus z fadc cii oleo 
rofaru.£tcjctimaueruntquidam q;(i fuccue 
ciueafpergaffufjpuUo&gauina^ndcomcdit 
coe miluuB. ,£t putant quida cr illa que nafcif 
in 2S>accdonia p:ope fluuium quiticif arcbt 
tnon .quando comeditur occidit. z (oca in qutf 
bus nafrirur funr locaferpenrum plcna. 
f3edfemcnduequandobibifconfcrtvo(o ' 
ribueinrrinfecie.cr ipfumingrcdif in confecri? 
onibue medicinarum.eteftiuuariuum. 
f £t idem auctoritate 'Ruffi.T^uta «omefiica ! • 
cft medicina majcimaiuuatiua inteftime intei 
rioribue.tconfmvifui«gtimmidu8eftca.ui 
finc terni gradue.ficca tn terrto, Xurat vlcera 
oculi quado puluerijaf fup. ea.-z confcrt fcro; 
fuUs quc fiunt in gurrure? fub afccUie. 



Capim(urn.rrfn7. * 



Bttytlm 




<^~% Obus.1*andectaca.t>cl,a\fuiacarabf 
*C^cc.grecebanie.latincvcrorabue.£ii 
•** "fulac cft qucda egritudowfctdt -fctfn» 
^Sfcraptonlib.aggi-c^a.fulacSacrulcir.au^ 
cto.£>ali.id eft rubue bmnibus cil no «10. f o> 
liariueifumrnitates recentce funr copofira i» 
fubftatiafuacpfubftatiatcrrca frigida z sq~a 
tepida.£t fapozciue eMiphcue.et virtue ei9 
infrigidflt tt>eficcatvi fccunda congtattnat . [ 

0pftationf0 

f 0altcnu8.vi.fim.farma.capi.batus fm txffl/ 
latibnc grcca.£>attis.t.rubns:folia quidc 1 cVt 
me: necnon flos zfruoue ftiptica pamcipanc 
quaUcatemanifefte/jfrt boc tamcn abinuicem 
©ifferut.l^amfoua quidet p:efcm'm mollia 
1 noua plurimu parf icipanria aqticfttatcime'* 
dicumfunt fttotica fm cam rationet fumnif$ 
tcs.andemafticatacurat3lcola t cercra que 
faoJKvlccra fanar.etalia vulnera folidarcpoV 
teft. £ft emeowcpplejcio ejc terrcftrit frigida 
(ubftantia et aquofa tcpida .iruetueVero qn 
f it mamrus parricepe eft moderate caliditaf ts 
fapoascufit vt oftendimus t>ulcie.quare pio 
pter bo c necnon p:oprcr moderatam ftiprtci^ 
tatemcomclhbilisnoncftmolcftus.^mma^ 
turus^uteafristdtt^te terreftri fupcraf fub^ 
ftaruia. £t idco fhptiois eftet ficcatiuus fo:it 



fcMvtcr^to^ 

ccjftens rccenfcfed z flos ciufdem eft nrfutte 
cufructUiadCifnnrcrtasvctrisquoc^fluicus 
rteenontfputumfanguimeidorteufarmacum 
f adip autcu eo q> ftipticat z no pauca (ubtilfa 
pamufubftanrtaparticipar.qulob^metlapt^ 
dcBqutfunrmyenibusifrangit, q £rS?erap; '3 
auctezitate Dvafco.airru8ciuse(i quc curat 
fllcolactvlceraonequandomafticaf.tcurat 
fllia vulncra. f £t ©ccoctio ciustirjgft capttf £ 
los.Sedfapo^ciusfrucfuseftculoeiZeftbu 
midus tcaudue,? immaturaeeft frigidtieter 
rcu8.ctfapo^eiU6ponticue.':t)ef'tccat©cftrca 
n'onefo:fuSfedfto:i8£W8cftftcutvirrasfru 
ctus. €^tconfcrtvlccrib?tnfeftino?tflurai' t> 
ventri9.-z%bilitatiinfcftino^tant.fedradici8 » 
eius eft fubftaria fubrilis.t fapo: eius eft-f iiptf 
cu8.et tdeo frangit lapidem renum. £t quado 
fit cmplaftrii cumfolqs rius curatvlcera fcumi 
dacapirie. $Sed rabueeanie qmgrcce & j£ 
*. tnofbattie nocet ttccoctio ciue fracaie can^ 
«cpulmonie»2ftrin<jitfiurammcnftrt5o?.Bt 
radi i ecfuecftcaltdfo:ipfo.t)cquafi'fiatemp[a 
ftrucctrabitfpmaataliamfipacozoozi.^St f 
quando fitanplflftra cu foiue fuis rcccnribue": 
pwbibct apoftcmata. 4f£r fdem aucto.ijiilie» /$ 
^rucme baiue planrceftftipricus ftfpficitstc 
fozri.ctfouaottsbabent ftiptfotafe paucam* 
ct opo:tct q> caueatur ab eo c\t inrra fhict ii cft 
ftmilc bombtono: quia nocet multii ca nne pui 
monie.t?anc fpecicm inucniee:fi legcs £a\\o$$ 

banj.oeftcapimul.cjr^i.fup:atieje.^^r' 
capi."5aru8eftomnibn8nom8.uirttisefti!li 
fiiptica t ferannca,£lijeamra citie capilloe iw 
ftor.acmrein abftincr. ^lujcum marricie mutt 
crum f tringif* "^oJltbus vcnenatts occurrir. 
Zjttaegingiuae aptitredineferaat.rumezes 
ozie compelcft . marime fi folia eiue cum acet o 
m afticata fuerinr,£>erperee mnndant . aco:a» 
capitis purgant Xumo^s oculo?t condilo? 
mata foluit.cmo:roidibue fubucntt fupppfira* 
ftomacbis impofita mcdicatur. eardiacte opv/ 
rulamr.f ^uccusbutuefcerbe t baifa^folc 3 
ficcatU8 omniafiiccrcnouit.<©uccu8ciii8 k't 
mirti6martirtomnib9 caufieozisvtiliter adbi 
betur. Uentre abftinet comcftus.fcdnon ma 
turu8.3ioe eiuecumvinobtbifus ciliaciset 
tnffinteriOe pzodeft, 5Ios ritts albue. z ejt ca 
nicutariozmvigce.^pfc quoq; ponntiafus ^ 
cuvinobumoziefiuozemcobibef. tfjlkmtus K 
cummclleoctiiowi lippitudinem mcccrurarcg 
isti aceto.l?uiueergo folia zftotcez moza 
ieuitcr ftnngunt. vnde ad vulua t faucce p:o> 
pzie vjdcntur facerc.cBtue omnc pzofintimidb? 
ncc ftringant.f iolta eitie t cimc nia i; icat a at % 



t) 



tmmm 



y&> 



n 



P 



tinant.mo:a eiue marurababenr infemcdio? 
m'racalo:em.3mmaroravaofurafrigidatx 
tcrrcftrcmrcnnetinfcfubftanna.vndcnimia 
fccu'ccanr.ff jfrem puluie ecco facrusjficut eft 
©efloieciusplus t>eficcat reeenrioribusj facit 
namq*adt>iflinrericoe:7adonmercuma Ven* 
tristfad t>efccfl'oncTaguiricmcjcpuentrt»i23ie 
puluie t>arus vtiliflunumeir mcdicamen. 
f Tladicatucmeftipnca-: (cptonuri8eft.ee 
idco ncfrcricis t>a ra lapides rumpir. 
if H* pedcsbariTunr t>uc ona comuroeique 
©icta eft: x qucomnibue nora cft. 21 1: cra que 
gppdlaprydcafitjecinofbaru&quccftrubofi 
tariemaioae um:adiaa./£teft virruriecon* 
Jriietiuc; £iuanamcp mollia gcrmiha fiue r vr 
ficonrufazcpp^lTafucaimoimirrunr.quifub 
IblcrcticruscoqwrurvfqjadoroiTkicrneUte. 
crt>atur adcaque fup:a. 
f Succus ciue cum rinot meUc wp:apoftru8 
fuperienb9pa)de(h 2&o:a cum vino fumpta 
fapienriam nurrmvt ab anriqufe&icitur.Xc* 
gcecam in meufe3unq«t3ultj:cum mcllcct 
4>anc conmtaapoftemata miritice rumptoct 
jrkcra frauduknta curar. 




CapiMtrrwrfriuV 



J~y tlbca tfoefo^fitae.^ubca »fcff 
•fCveocp rub:afir radfcciuetvnde: lanao 
** ^colowrepcrbsbcf.fDvafco^idco.l*!! 
beaquaaluerirrodanu:larimvcrorubcit)icut 
±5erba cft omnibusnora. fi>peciee ciustue 
funr.tmavidehccragrcRie^lliavcroqucvc» 
catur farcbo8:ramulo8fiu<tvrfc8 babetw tct 
nucs •: qfi nodofoe:folia j> inreruatia fciftatia 
ac g fingulas coftodationes vcluti ftcllarunt 
imaginem mittentia.jfruauevcl fcmcneius 
rotundum viridc.t binc rubul aut cfrca mttitf 
rttatcm nigru.*Radicembaberparua tcnucm 
pufillarrmibicunda. f •tjMiniue.ea. <£rir b:cn 
quasKrj erirrodanu vocanr:no8Vcrorubeani 
quarihgunftanctpcHeetccfcra.jEftceuevc? 
ro eritrodanu t>icir. na crir bioo rubms cocbsf 
noe femccue rubiaindue cjcpont f t e rubca » c» 
f •fcandecta capirulo. ccrlviu.£rirrodanum 
vcl cutradoton vel crir bion vfetrtrioda nogre 
cc. 3 rabiccfanevdara. Xatinevcro nibca 
rinctomm.Obi fcicndum # fc>vafco:idce eapt 
tulo t>e rubca t>icir:<y rubca fiue vt alq crirbto 
daimmt>icunr:-rcllt»eri)bcatomcfu'ca3iij> 
capirulumfnuenif apud tbvafcoridcm. quod 
ficbabctmtroclanucicur.teftrubcaagrcftie* 
3 tcm ftn veriratcm ctritrodanum in alia traf 
lationc Drafcondie.Sut r ctron vocant plurf 
roi.*Radii; cft illi irficicne. f uo funr tim Qt9 
liera.tlnum agrc ftc.3 liud fcminamimficut ra 
ticnnc ira liefuir locis culris fcrmnarum/flarfi 
zin vtje fpote nafcirur. 252ftc funtilli quadri 
7\c£cz afpcrcficur apparinc:fcdfo2tio:e8 et 
longio:ce.folia babcnrceinrranodos ipfor. 
5olia babct ficut aftru?:id cft ftclla in gvro po» 
fit a.Scmcn ciue rotundum cft in primo ririt 
dctpoffca rufum.er cu maturaucrit nigrcfcifi 
j£t radi ; c ciue longa t enuis t rufa tf.ioed f m 
tranfiarioncm adam Dtafco:idis:*Rubcafiue 
vr alq critrodanum bci ba cft omnibuenora. 
f ^crapk>nlib:o aggregaro:is capitulo fa* 
ncyjuctotirareD^Icondie.fancfiucfaucid 
cft rubca tinctomm.qucdam cjcea nafcitnr: ct 
qucdamcceafcminamr.ctbabctratroequa? 
draroe longoe grolToe fimilee ramie bctbe § 
ticirur abarummifi quia funr maio:a eie? ©a 
rio:ee.Superipfoefunr folfa tiuifa adfnui? 
ccmcgrcdicntia iujcta nodoe:i infimilitudinc 
ftcllarum.£trrucfueeftrotondu8:anu8 cof 
lo: in p:inapio fuc aperitionie cft viridiei^otk 
ca vcro rubeus. j£ t quando maruruecft fit ni 
ger.^r quod t c ipfa adminiflratur funrvcr» 
ipfiueitipfcfuntfubiilcslongcarubee. 
% 6alicnn6 Iibw fetto fimplicium farmacoai 
capirulo £ritrodanum.£rirrodanum:id cft 
rubearinctojianjMdtjc ac«ba« jsnwrafc^m 



E>ri)ftbi0 



gttlrum.tlndetf quodfciccum eftt>ealij8 ad 
fruiiccm (ibibmoi virrareseduemences ibac 
radicec6fpicis.f^aulU8ea.t>enibc3.caiida 
cftet itccainfecundo graduf Biicrrois lib:o 
£oUiger.capimlo t>erubca. "Rttbea cauda c 
ctficcainrertiogradu. 

€>pwari0M0 

4 Dtaf.£furodanumvirrutebabctmtcru* 
aleat accco iltfmra albis macuf medcf . afus 
cria aus ad capficit ad quc cctcra t> iurcrica 
jpficere fcicimus. S5ed agreftfs vircus eft fm 
pvafcoridem mtcruafo t>iurecica:vnde vrina 
cfinenftru3p:ouocat 

f 6a?.£ricrod3nu fpleneet epar ejtpnrgaf et 
vrinas grofias er mulras.Eft aiit qnq? z fan* 
guinolenras cuaciianB.qrTq; etiam piotiocat 
mcnltroa.et 3bftergir mediocrircr quecucp ab 
ftcrfionecgenr.mo:feisquoq53lbi6 dx acero 
peruncracofcrr.qutdiaurpwpinateasfciJti^ 
ci8:nccno paraltticis tix mellicrsro .f Buicen 
na.T^wbca rinctonicftporici fapoiisiz abftcr 
gic cu cqualitate:ponirur cum accro fuper em 
pcn'gincm:crfanarcam.n'milirercrmo:pbea$ 
albain.ab omnfveftigio mundificatcute.Bi* 
bira cu mellicraro confert fciariee ? paralifi 
fUaUrcrtSpcufltonicrcafuifuccuseiuscnj 
oicimcllcoarurad apoftcmara fplcnie:? muu 
dificac cpar ct fplene.Eomcp opilationes ape 
ric.drinbocap:op:ieraseriltitaccci.vebcme 
terp:ouocac vrinaimvtqncflfaciar mingere 
f anguinem.Et opottetqui cam bibcrit quacg 
©icbalncerur. 1 

fSfuppofirameftruapuocar^ectrabirferu 
^iufcpftipriciraecii foloecoferunr mo:fuii^ 
mnimvenenofotttm. 

f -fblarearius. *Rubearincro£ calida cftet fic 
cain fecundo gradu.oirtute babct pfo:tati> 
uacjc aliquanrula/ua pon riarare ec siurerica 
et amaritudineXonrra ©ebilirare! ftomacbi 
crepariscrrclat;arionemdarurvinut>efocri^ 
oniseiu8."RadijCeiu8rafafupponiruradme 
ttrua pzottocandaxt fetum mo:ituu cdtif cndu 
Bqua^ecocrioiseiueficaputindeabluatur 
capillosreddicrubeos. 
f £onitanti.vbifup:a.*Rubc3 eft infine p$ 
. misradus calida et ficc3.babet quoddaama 
ritudinis cr ponricitatis.vndc fplenem i cpar 
imJdificar.? ciue opilationc aperit .vrina-r me 
iirua.puocar.Otnniaoimcbw co:po:is a pu 
tredwemundtficanet mo:feam curar. Bdbi? 
betur quooj cu mellc et aqua caltda piopt ylii 
t)oio^aii.f ^Uniuelib:o.j.i,c.*Rubearingeni> 
dislams ecco:useft ncceflaria.Xaudatifl*»* 
ma dt YraUca,et majrimeluburbana P*oue{ 

. : ;■.-..■, ■':■«■.:.:•. . 



nirfponrc.3tmcdictna moibumregfom fa^ 
nar.£r vrinam enciet cjc aqua mulfa.jblia cjf 
cp'captUuminficiunt»Bpudquofdaminucnio 
regiummo:bumbocfruricefanari;eri33fiacl 
alligatus fpectetur tantum. 





Capitulum.tfrritft 

ijBluia larineBrabicege 
Ijliffa goe.grcce eliffa gue. 
feera.li;aggre.ca.0clif 
S fagos.i.faluia.£teftar0 
j buftulogu biis plures ra 
I mos.? lignu ei9 i folia fi? 
j milia foltjs aroniorj. ntf 
l»fi q: fttnr logioia et firicri 
o:a cr rugofa paucarugo(itate:ficute rugofi 
tas panni poftcp;abluff ancecgectendaf et ref 
ponafa colo: rius ©eclinac ad albcdine. ct b? 
odo:e boniixr bj in fummtrarito ramo:um fe 
men fimile fcmini berbe filueftrisj quet>icirur 
o^mcn.t^afciturautinlorisafperis. 
f Pvar.ca.clirTagu8 fiucelibrragus f m tran^ 
flationcnoftram.j£liifagu8.idcftfaluia.jFru^ 
tejteiueeftoblongaetmulrasbabenevirgas 
quadras et albas.? folta (imilia malicidontjs 
fedoblogaminowetafperaetalbtdio:a s o f t 
do:ata fub:ugofa.femenfup virgas eft fimi* 
le omnino agreftt.^Rafcitlocis afperis. 



£ q. 



Crartatw 



B 
J6 



2) 



tbafla eft civafta ct quadra.fblta sUquatcnS 
afpcra.-fcoteft cm acritcr rcfiringerc.f £>af. 
vi.fimpUcufnr.eap\cltffague£ cmtk rio but9 
fcct be <ft caUdfl f ajtduatcma mftfta ct mfticic 
ti etparumftiptica 

€>prrationf0 

f^UMscrba ipa facitad tiffintcrifoe.?fiic0 
cu8 folio? ei9 capilloe gcncra f:et vrinf juo? 
car .f £5 era .t ccof rio foltoui ? ramoaiipiuB 
qfi bibif ,f tiocat vrina?uicflrua:et qrpcllit ic r t 
tu.ct ?fcrtmo:fuivencnofo ftrigom'8 marinf: 
^tcnigratcapflloercpfmflroftcmfltibnab 
fcinditfluicufanguime^mudificatvlfcrafrflu 
dulctfl k cu tccof rione ramufo? i folio:u ipt9 
fitablutio.-zfcdfltpntritugcmtaliuviro^uut 
multc^.f p vafXtfrrue cftis l tiurcricfl. l&z 
itruieimpcrflt.Bbotfumfafit.^craifftjmfiri 
goniemarmimitigatX apilloenigrefcir .JE ft 
criam tcrmanrica :ctfanguinc fluentc c% vutf 
ncrtteftringir.Sj o:dida rulncra ptirgat. 
f £uitfl tura folionl ct vtrgaru ipfiue pumgt* 
ucm nature c 6pcfcit.fi ft ctiam virtutie redar 
guetiecii acrimonifl.dndecf tifluitcria arqj 
mulicb:cfluriJ(qucgrccirigconvofantXacft 
fucfU8folio:u ciue.£flpilloe tcnigrat:ct vri* 
m^puoc at. f r |baulue.Ut'nii t cc ot t ioie ei9f 5 
fcrt paraliticie btbitu z catbflplafmaru fup pj 
tcparaUticantc.f £t ticut mflginefaluia c? 
ipa purrefa cta fub fimo generaf auis quedaj 
bnecaudaferpcntinact alba? mcrukfimilie* 
jSe cuiue f inere rt ponaf in lampadeapparct 
cr tom9 (it plcna ferpentito. f £ jc bctbario 
JS^aluiabjfolifllcgfl ctflnguftafubafpcra o9 
doK fuauict graui.3n locisafperic nafritur. 
pcr oaio ciue potata vrinaj ct mcnfirua tro 
uer /}>aflinacc marincfi qucpcufferint virua 
ctctudir;©angmme erttpf ionc ftfiir. f *£la. 
JSaUria ca^eitiii.ific .Hi.ti.foUifolia tcpcrunt 
vfui medicincctviridia.cf ficcaxomcfttca ma 
giscofumitetconfouat.Silitcftrie aut ma* 
gietYsfo:crica£linu tecocrionte fatuicvaf 
iet paraUtirie etcpilcnticUcmetatio cc aq tc 
coctioie ctus vaUt ? firanguirii et tiffimcril 
t^mccrmldififatf^li.li.|crii.^erbanfic| 
ntic funt berbaru. ckKfpbacon grccc4arini vo 
CatfaUriamcntefiimfecanaodo&ta.bacap? 
poftta partue emouuoscjctrabut. 3tect vcrt 
mee auriuetvlccru.f 3dein lib:o.ic»:vi.:ketf 
ba q aqbufdaappcllaf faUiiafimtf vcrbafco. 
;C6terif ca et colata caUfir.ctfic ad tuffim la? 
tcrtfq3tiolo:c8fcibir.£adecpc6trafco:pi6c8 
arq?ti:aconc8marinoecffica]ccft.>JC6rrafcr 
pcnree ctia ccoleo o.ungi ea^dcfivyfopi fafri 
cuUj6cuquadrantemclU8©ccoqmfadtuflim 



f 2S)accr.SflIufflrtiCnonim crtfifafee <& 
«pi.dgrtcoe,£i,n; mulfaicecrie.Fdefi rctaf 
,ia querelic.^cUttabouuj. lociilqj mcr.firua 
jjurgat Xtuavcncnflroecuratfupcraddifa 
iro:fu8.^rtidie vulncrik qucmuUo fangutf 
ncmsnflnt.Bpponfletritaticutrefincrccru) 
oumXuvinofuccueteFlduefifumifbuiue; 
iCcpcfcit tuffim vctcre laterifqj t olo^rttf 
tituevjuluccurfltvirgcqjvitilie.Sifoucfla 
vtno ft,cnr qi:o faluiacoctfl.J Iliuc fuccocri^ 
ncewgrefccrc t icunt.©i fim t ot vntii ftrrfi 
bJo.lubfoiccalcnti* 




Capitulum.fffm 

aii)r.3Ii.libxtT.^alittfcracff»o^ 
f fflliar:idcftcrcffaf.2ltbo:Icnta:vitito 

vinccndis abilie.f Smb:ofiue. Sa* 
lic ce vidcnt ur nifc fl bcberc fcminie.fc£bcnt tn 
gramcn qucddam in foltje quo tcrrisccmiffo 
tanql fcmtnc pofito furgat fltbo: tc furculo: 
cttflnc|fcipffimejiufcitcttcfcm(ncfuo. i 
f ^lofflfue£faiam.jcIiiu,^aU)ccftflrbo: 
Cnfrucruofa:fcd cifo crcfcitanaM'mefiiu)ctfl a? 
qttam fit .f 3 riftotilee in li.tc plant ie.&m* 
&m in bt: mido loc o.qucda in arid o ct qucda 
invtroqjvtfaU)c.3dc lib?o t e aialitr.qucda5 
atbouenofructtficant.Sficutviripinguca 
non mulfum fpci marifant.Xfl Ue tli falU.5ro 
ir.8 na nur.f ^dcm in Ub:o t ccimo fc^to. J ft 



iBfSjfrbtb 



Ita funtvmcptnfcr pnmasgcrminat. £ircum 
agunf faUcisfotia poft folfticul.necaUo argu 
menro intelltgif cerriusfidus cdTccru.0ciffi? 
mcrcro falfcanumrfaneanrecpmaruritatem 
[entiatomino.tobiclfrugiperda ticta eft ab 
bomero.iScqucsvcrocrasfcclcrcfuo bacfc" 
tentu inrerprara efo fcmcfaUc$ muUerie ftcri 
litatis tncdicamerii e.£> 3 in r> quocp nafccnri 
ttaturapuidincp *>e pacro furcuto incuriofus 
fcmcn©edit.Una rn^pdirurid maruriratcmi» 
farefoUraininfulacfoera, 
^F1i>andcctacap.ca',£ulcfara.^reccvtre.la^ 
tincvo-ofaujc. 

Bpmtitmt^ 

^£5era.tt.ag.ca. €uief,i.faIijc.folia sflos et 
rofa et9 baba in fapo:e pdticirate.t virrue fa 
Ua8efts>efi'ccariuafinepuncrioe.£o:re]cvCTo 
iptu8ftcriori9cftc6ple]L*ioniaficutfuntonic8 
fpecies coiticle.^Vtn admimftraf in glutma» 
tione vlce?.S>ed floejzrofa riueadminiftran 
tur i adroifcctnr in omibo inedicinie 7 vnguc 
tie t>eficcatiuib.£r funt ei boifco c\ aecipiur fio 
rcs ct rofanw fuccuipfiue.? cdponiir ejc eisse 
ficcariua mediana quecofcrr in mulri8.q: x>tt 
fifcar fine mordicar ione -r^pzic: quia in ipfa cfl: 
ftipricirae pauca.f £t qn ecburutur c& coittf 
cee z coficiutur cuj aeefo:admt'niftrarur i omi 
bus egrirudinifco in c\ to necdfarta e fceficca tib 
ficut in vcrrucie zfpiie in rotundie z tn verru'/ 
ris fimilifco capiritoclauo?: z in verrucis infif 
ris i cut e.era dicat em cas qn fup. eas fit Unif io 
f £t qncueUitur cottcjc ei9fEequo cmanat 
flcnee et eolUgif gummi cius. £>abcf boc gfi f / 
mi vtrrateabfterfiua x fubttliariua.z idco ad? 
tntniftraf in omifco egritudinifco q accidum pu 
pilleet fariut impedimentuj vi(ue.q £ t fdon 
aucro.^ituU.Oirtusfolio?-: cozticu etfruct9 
faltris 1 fucri ri9 eft ft iprica . £t cft frigidctfic 
cecdplecionie in pumo gradu.ff £tidem au* 
#o.*£edigar.0n bibururfolia eiue rrira cum 
pipercct vtno panco edfcriit eolirie.ct quando 
fumitur cum aqua p:obibct imp:cgnarionem 
<t fructueciue cofcrt fputo fanguinie qn bipif 
ct co:r ejc ei9 rrit9 eu5 oleo rofa?. (i bulierint in 
coitice granaticofcruntcoloriauriuj 
f £x riue "oecoctio admini ftrata fupcr pedce 
podagrico?.c6Terr cis mnlrih? mundificat fur 
furescapit^. ct colligitur bumidirae ab ea •oe 
ftaene qn ercoriaf a coKice fuo qn incipir 8|pa 
rerefloe a'9.qm repcrif intra fo:ricem bumidi 
taeeongrcgataque abftergitocultsm. ctaut 
fert reneb:ofirarem ciue . *£:op:icra8 falicis 



ausqcjrmjbitfanguifugaeaabsrcnfcflgut^ 
turijcrglurinarvulnera reccria.f £rtdan an u* 
cro-urareabcn^bcfuaY.^oliafaUcis bibira 
£>bit*nrimp:egnanbnc:rt cdferutfiurui farrt 
guinis.': lac qe cgiedif ejc rie acujfr vifum 1 ab 
radirpilo8.^£nck5aHCfo.T>auU.3nfoltJ8 t 
fatia8ctfalicc:n6t)iiLitj5altcnusal»Hd. J 

f ,6alicnii8 fcprimo fimpUrium farmaro? ca -j* 
pirulo ytrc.y tre fiue falfjc vf etur quide aliciui» 
ctfoIfjeadtanguinolcnro-gvulnejKofoUdari^ 
©ncmifjmajLimc fiozceius fcrcomcs vrunnir 
mediciadcofccrionem ficcatiut cmplallri^ft 
cnim vis coutm fuauie ficcattua baber aurem 
cr quiddam ftipticitatio. 

f 0uida vcro 2 fiiccuj facictee ef: eie immoi? -j 
dajcctficcafiufibabafarmacu?admulra vn 7 y *T 
lc.ln ibil crii magis occurrir n(ui cBfarmaoij 
immo:datiu6 ficcans pamj: fed fttptican8.fi^ 
curinrracrani fcefompofirionc farmaco:um 
plenius ©icerur. f £ o:rcjc cria buiue arbo:is «gs 
Itmiltb eft ram frondtie cp flo:um virruruprer 
03 cy cft ficcio: f m copIejcione:fcd bunc quida 
acccdunct vrunf cinere in omib bisqnc rib f / 
lenra indtgent ©eficcari.ficur figilcs 7 c bilce. 
id eftmirmicea8.aufemnr ipfum madcfacicn* 
rcs acero acri.quidam vero rempo:eflo:cndi i 
cidcnrc8co:riccm.Xtquo^fiquidecolltgunc 
cr eo vrunrur in obfufcanr ibue pupi iltie. cii fic 
fannacuabftcrfiuuftmulcrfubriliariuum.cii^ 
fir bmct porerir eo vrt aad alia mulra. 
f -fiaUadius Ub:o tcrrfo3n moifc ftbmart fl 
plantc laliae obmendc (mtn omntum gencf 
que ajplicantur arbu fto . 

f DYafco:i.©altjccftaibo:cutU8foliagluri f\ 
nat vulnera cracnra.5 loscria ciueftne mo:^ 
dicarionc©eficcariuu8 cft.^uius cinis cum 
accro fup. calloepcdu induaue cos roIUr. £c 
fimiliravcrmcas^mu.ndar.^toseiue cum aq 
bibfru8omnecalo:clibidin!efrigcfcaefact^ 
f Sut'ce.Salici8 foliaitipricafunr fine mo: ^ 
dicarionc:£tdt incie cjificcanb fuftiace. £i '/ K 
mb aufemriusvcbcmeiirieeft cjcficcationis» 
£mplaftromeiccofacrurcrinafiutufangui8. 
f £0nftanrinu6.£>aliece frigidc funr tn fc« i\ 
cundo gradu.ficcc in primo.tialcnr fcolon ca 
pirie xiecaloie (i in naribus mitt anrur. ©uc^ 
cu8riuevulncrafoIidat.£o:tejcau8 vttus ct 
cumacao tcmpcratuevcrrncasctpo^oeau^ 
fcrf .S cd lac eoaicie a falicibue flo:cm Nbe^ 
ttbu8erarivifumclarificat.C>cfccfo8confd^ 
tatoculo8j©uccu6frondiumctpomo?pota 
tue mulicri vt concipiatnon pcrmirrit. 

CapUulum.fffuiN 



Ctacrams 




eSmbutf.-fcanaecta ca.cedjcrfje. Stf 
cndii cy accis e fambucus: kamcactis 
fcicif ebuUtsrz funt plate omibc» notc . 
tlit vcrfu8:£? abti cue c f t 9cti8:f? cbulus e ka 
meacris.f S5cra,U'. ag.CKameacri.Kamea* 
cri ©ue funt fpcs:qrii vna grece t>icitur act is. 
inlarinofnmbuc9.ctfaJa nominatur ingreco 
fcamcactta ct'9 eft interio terrcnus actierr in 
lariiio t>tetorcbtmjs.t>cqlcgeca.clfl:v:8 . tf 
£.fl •fMiro9.S;ambudT>uc funt fpecics . eag 
vnaaflimtlaturarboritobabcnrfbusramoeti 
milcs canm9rotimdie:quozu5 colo: eft ad aU 
bcdincm.z fantionga . x fnn t tn eie quattuo? 
folta aut quincp po:recra fnperramos quofii» 
betvz fimaia folrj s nucis.minoia tamen eis.ba 
benria graucodo:cm.? inmmmiraritoramo? 
rum funr fto:es albi.-r grana fimflia granis vi 
Tidib9 vel lenrifci.quo? colo:t>ecUnat adpur* 
purcitatem cu nigredincet funt velut in race? 
mi8.zbabctmuttabumidirate babcute odo* 
rem Um'.? ifta oicitur act is.SUa vero fpceics 
quetHcitur kameacriseftmino: pama.babct 
ratnes magtpjinercs berbe qdratosi quito 
iitttt mulri nodi z fdlia inuice t>iftanriaafingu 
lisnodis fimtiiafoUisamigdaltsin fummita 
ribue fmsmifi q: babent vcnasrz funt longio* 
radsbnriasratieodojc.-rifumitiititoramo? 
fuor capicella filia cownis fupdicre fpecictVzfe 



men ? rXooftfr .1 b? f amos logoe gfoRTfucTfnl 
sigtri babetc8.3fidom8 lt'.etb\mologiarum« 
£> ambucueeft arbo:molU6«z parua. 

% "PuW li.]cvi.S5buci bnt acinos ntgroe z 
paruos bunioree lcnfi,3nncicdo majtimc ca* 
pQlo.qui z ipfi in aquafcecocrimandunrur. 
^ 3deXtv.3rbo£qrundarrucr9 pediculie 
Dependcnt vt pin'3 lia vero racemis vt edcre 
arq? fambuci.<tf 3 dcin U.]cvi.£>abueu8 ger* 
minat intcr primae:? nudaf intcr noutfl tma e. 
et ejc bis q bvemc aqla ejc orictc coctpiur: o:die 
nature flo:et p:ime filueftritl fambnc9: cui mtf 
dulla cft plurima:^ comus nri nulla. ©ambu 
cu6 eft arbo: t>iuidua nec ramofa Unrifftma.z 
fdeo fcurie facicdis aprifii'ma.euiu6 nimi?. pla 
gafrprinuecerrabinfuucp vulnus claudr.et 
ob id cdtumaciue ferrum tranfnutfit. io antf 
buci atcfc rubi generie fiint fungofi.alitcr rame 
cpferulcquippeplueltgni arcpfucci eft vriq? 
fa mbuco ejt q magie cano:a buccina tubamcg 
creditpafto:.3b!cefe:vbigaUo? canrft nocp* 
audiatfrurcttUcf 3dej lt.tvtj.3nuentn>tft 
furculo8abfcifo8ferercq?5fcpi8Cflufafacmj 
c fambucie 1 cotoneo rubifcp t>epa cris.ad pa^ 
lum vinca^firmifTima cfambuc^.raleifcj! ftrif 
vt populus.^ ani.Sabucus alba c^ltdio: e 
^citrina-j cgDurpurea.Eteft vniucrfattrerin 
tcrrio calida et ficca ^ft aut fubnltariua btimi 
ditatu.fenibufqj cofert a'9 oleu5. Delet autcm 
pannu:-: facitrubedincctus odo:amcntuj 
f Oleumei9cofmfentorzrrigidt8neruo:um 
cgritudimto.Odo:ei9fao'f foda^ii 15 ru relbl 
uir fodafri.a rlegmareodo^ta.ttcntcp purtiim 
af-) oleit ftucre facit fanguine cp nanto calefa* 
ctucuipmodowt.^£ciftarinn6.Sibucicai 
funtinij.fic.inprimo tiiflblutiui acncruoujm 
moUitiui funt :ftomacbu ci? molliut.vomtru.p^ 
uocat.eatbaplafmari mamilla?. apoftcmata 
fanat^abuceoliieljfcabicacpullulae-iapo 
ftetnata nariufanat.vnlnera claufa a£irxucr^ 
faq? ad fua naturapucrrif .ouriu t>olo:e placat 
bibituqj Uib:ico6 1 afcaridee fiegmaricos ejc; 
cludit:ac melancoiicos bumo:es cjcpurgat 
^*ji»U.li.!cpiq.Sabucu6 babetalteru genua 
magie fiiucftrc. q6 grcrii bameacre .a Uj belld 
vocantmnUo bKurAvrrfufcg, foub^velfcmia 
veJradic.ist>ecoctijjin vinovctm ctadcra^ 
tbosbinospotuftomacboinunlccftaluotc^ 
trabcs aqtta.f Txcfrigerat cm infiamationc 
majticrecenfie|f8bufn.£tcaniemo:fu3Ckm 
polentamoUiflimiefoUo^tlUris.SiKcusc^ 
rcb:icoUeaiones itntt infufue.Scmiciusin 
firmio:c6b3reUqtJe capiliu ringunt. qpoy. 



©f©frb!0 



acaabjrtimcnfurarrinafrKmenfcSd omnia 
erTicariojclt? quc mino:."RacUic«u65ccocra 
acpotabjdroptcojB ennatuui^oliaTnttno 
poialei^wmicti&usrdiltun^f-Jbodagri^ 
dscum fepo[bircino vclxmenrcr pzofunt cau 
liculitlltriflckmin aqua maccranrur:vt fpar* 
fipulicc8 necenror.f ioliomtecoaio d lot9 
fpargatur mufce necanrur.f ^oa appcllatur 
mozbuspabutarucumrubcntcojpoza.faiw 
buci ramo verberaturXozrer interio; gjjjjjjg 
«£vino aJbo porus atuttmioiuuj 




Capttulum^fffuit 

SSmbacu8.-|!Sandccta ca.ccclrjcvi3e 
fcmin arabtcejt ambacb:grccc lcco va 
larinefambacuo^f^era.lib.aggre. 
ca.id'emw.3cfemin:ideftfambaeu8 cteft pli 
(a baben8albumflozem.et qucdacftrinum.et 
dt mitiueca/zfic. q$albii,ct fimilifer eft mutf 
inoperattonefua.eta'trtnu8repcriturinba^ 
bvlonia.Efteriajfpeaeealia ejeco cutusflos 
celefttseftcolozio.f £tidcmaueto2i.Sben 
^euiaY.fift calida tnpztnapio tertrj gradu8 
^ > 0af.Ti.fim.far,ca,t>eicfcmtno.fm rranfla* 
tranegreca,3mbacb berbe qua iefcminvocat 
fememajtfevtiuiecaUfacriue-i^eficcartttemec 
l»pnfuJ?riliuf)artwvirturi8eftXftautefluftI 



tfefubama^cracrcctpaIl.qttonrflmti«rcf£ 
cfl cftct tYafoteticuXritautmcaUfaciedo z 
ficcando rcrrq gradusintcnfiXtia bcc cicit 
infetrebuiuext.fobdirinfcptimo Icncova. i. 
3efcminij.rora quidernjtejLabflcrfiucet fttb* 
riuu parriu vittutis.ma0ieautcj parrieipant 
ea fiozecer boJii ficriozes magis vindibue. 
tfia uicen.ponitrrc8 fpccice.lciliccr albo m: c£ 
trinaet purpurcam.£ t eft alius fambacus a? 
firtfu'8,teqt!oftiptatc. 

!E>pfraitonf0 

f S? erapton.iblia riuebumidanolicca q» 
ponimrur fuper cmpetipicm ctpannu erpcl* 
lunt co8 ct rcfoluut omncfupcrfluitarcm. 
f Etpuenitbnritocararrumjctinducit x>o\o 
lozecapitl illisqfurocalidecoplerionis. 
f £t olcii ciue eft iuuatiuum in b vcm c.ct (i 
babcnecaudamcoplcrjoneodoze^ nimiu t>e 
ipfofimcndujcftmefaciatflujcumfanfiuints 
ctnanbuscum 

f £t idemaucrorirafeSben*^>cfuaY, Con 
fcrfbitmidiraritoetflegniarifalfo:afenitofri^ 
gidccoplatonie.et confcrt solozitoqui fiitt 
cjcflegmafcvifcofo. 




Capirulum.rfffuut. 

•Jb nii 



fErartartia 



2ltic(ijc.^Unfu8lit)?o.lC!tv.^!i^crr 
f bcrb a qucdam t e qua panni ringunf 
inblaucumcoIo:tm. 

j&prrarionre 

% f 3dcm*^liniiielib:o.ic]C]LV. ©andaraca (i 
ro:reaf equa parte rubaca admtjtf asfandiccm 
facif.q5q3anfmaduerfo tlirgilium cfiimaffg 
idbetbamtffevctfu illo.it> ponrefua fandip 

56 pafcentee vcfccret a gnoe.f 3dem in lib» r.rij« 
£5andiemolerefilutftria grccie ponif ficut 
PpinioctjErafiflraruerradur 

f~ f Detocta $o aluii fifiim fcminefingulrue 
pfdtim ccaceto fedar.3Uinif arr.btifiie vrina 
cqcir.i2niceuetecocrc,pddtltom3(boOo* 

P cineri renib? ac vdicc;f :frec d t qua 3 rir. oi 

pbanee euripcdi p oerc iocularitcr obtjcir tine 

c marrcme olue quide lcgir tmuj vcndieafTe fcd 

& fandiccm.fDYafco:idce.^andu.vdfean* 
dij:calcfacitcrt)cficc9tfo:rircr:9ct\'afo:cricii 
*lt:etob boc mcrito vifcejpurgariuudt» 



©pfratfonfs 

f 2?erba tora c valdc amara :vircr bsfectte 
acraeatcpeaUfacroriaeifldcmncturicievcl 
rigottmvaldeidoncs^eddcttscatbspUi 
mata fiucporaraa fco:Fionevcr;flrie vdtiffi 
cuUatimicfue-.vd mttllmom fe:mcnrolabo 
rantitc.f £iue di)tarura mcdctur fcvdropfcr, 
tlrini,puocar.ct fotrionib? cft vtilie.S» ucc9 
addito mdlcluiotce tcrcrgir.£»co:pionum 
icrur cuaccro ct falc c cpdcir.la ^anonib, tcne 
flcbibcfXcrorievrilircraddirur. 
f Q mnee rumo:ce co:poa'e cr ocuIo:u fegtt 
catbapiafmara cr majtimc ctl polcnra ircpofti 
t a. 'J rcmappofira folirc purgarionc* marcrie 
pwuocat infcirinie.bcnc qnoq? malaginarr) 
bue mifcctur i aeopie.f ©amfucueft in tcr* 
rio gradu caliductficcii.polo:cm eapitis ct 
cmigraneamteficgmarcctcolcra nigra cu? 
raf:ft'cicaije9po5imafec2purlauefaucn9ri# 
bue appliecmr.Piffoluir opilatione? vcnro/ 
firarcm grolTam. f £ t riue apo^fma bibitum 
bvdroFifim ftrangutriam venrrie t olo:c ba 
beniitoftt tonij.f jCum mdU catbaplafmatii 
nigredinem in pa lpcb:ie a mputar. i cu acero 
mo:fum fco:pionie curat. f •^cffarifatu ve* 
ro mtnfirua p:ouocar.lapidcm aufert.f: pil». 
ticie couctn r cr para liticie. B urib; inft illaru j 
©olo:cmplacaretfonirumi . , 



a 



s 




p 





€aptrulum*rrrri£ 

Smfucue.P Yafcp.famfuciie I fuatf 
f uenommaruramaracue.ctdtVamo* 

famuUaebabenevirgaefuper tcrraj 
Cjcpanfae cum folqe paruie arcp rorundfe ne i 
p5ceftmilib»e*v vdutbirae ct acemmiei 



Capiruluunrrrrf. 

2lliunca ? pvafco:idee.SaUunca tft 
gcnueberbe queradiculae % folia ba* 
bet fubWa:flottfcppUirimoe a tari 



Wfttxbte 



rcfoffa inmduftfyKUm^lltinGif.ldtfcim 
aiit tn lapidtto furnie ct no:i(fl rc gt'onc.3llavc 
ro oprima e k q cft odotifcra rcccne cr finc fabu 
loneplurimofepramuloecr radicce babcne. 
pnfergo eadequcetfpiea cgufe fc«fi»mio*fit. 

j^pfiattcnre 

^Mi,jcM.£>aliunca £>do:amcnroJus mut 
ra ntbil artin enr ad co:onsmcnra vt yrie arq? 
faltunca.cljcpvtracp nobilifiimi fit odo:ie. 
f Sf aliunca quidcfoliofa:fcdb:cuie clt e que 
ncerinonpofiinradtcinumcrofacobercr.qus 
bctba vertue cli qjf oevclutimanui pulTa» 
btcuitercfefui gencrie eefpee.bae panonia gi* 
gninvnotica aipiucp apricavrbium cpo:cdia 
tantefuauifatis vt metailu cfTe ccpcrtr. vditb? 
camuitcrpontgratifiimu5clt.J:uiueradijc in 
vino t>ccocta vomiricee ftltit;fiomacbumc& 
co:robo:at. - i 

f iiy. finonimie £>atumca inrclltguntquida 
in mcdicinie.p ancufa:fedin aurea alcjcandria 
recipitur p:o ea fpica celttca. 




CflpftulMti.fftrjEr 

SSuina/fSandccta capitu.vw.Sbbcl 
arabfce.greceb:flcbi4atinc ©autna 
©auina cftatbo:cuiue folia funr fii 
miiiafolr^famarif<i^magiefpinofa,>£bct 



bomTodorcef arbortfta ercfrfi magfe inWtft 
qvin longu^£ft calidwt ftecc ccplqrioriie tri 
terf io gra c\u . Serapf on Ubvo aggrtga ro:is 
capirulo Sbbclitdcft fau'tna.£t ftmr dmiuk 
fpccice.ona cufuefolia Itirfr fimilia foUfe xif 
p:cn1idmagi6funtf^tirofacBaltfl.^)abcetd 
nuinodo:cm.eraibo: butuecft rbme.cr creft 
cit magte in amplum c% in !ongutn .£ t frcr t9 
eitiecft ficttf ?aro:.*£ro qiro lcgcca. fcuecreffr 
mumnonum^unipcrue.fitqufdamvtunfuj* 
folrjetiuepo ft migto. £> ed ainriuefpccfcf 
folia funrfimilifl folrje rsmflrifri.ctfflroieme 
cfi ftcur fepo: cfpaflt.bcc hmc vocarur faiiiut 
cuiue fubftflntia cft fubrilte.ctin odo:eiiueg 
aromaticitae.? catcfacfncr tcficcat in tcr rio 
gradu.3uifcnna ltb:o frrundo cap/ufo.2 b 
bcl.Sbbclcitfmcruearbo^teftmilie!3unipj: 
ro factue (tcut jaro:.ft d tflttrcn vcbitnch tcr cfl 
nigcr boniodotie ? flcu.tifaporie.i ifta art 01 
cft prima fpectee fauine:ct pofita pcr Scrspf 
oncto,0autnueftf;tt> fimplirium fflrmacorif 
tcfauina;B:a(bittuc fauina teftcfflritito foj 
ittcr cft f m tree ffl po:ce.qu oe in gulisdo mo^ 
ftrar.cqualircr cip:cfTo:nifi inquanrum acrtoJ 
cftco.ivrvticpfcicat quie magie aromarica 
rbuiue crgo cripfiuequaltratie.parrifcp8 
elt vidcliecracrie,lh'priea complcictonccfllida 
Sdbucaurcm in amarirudtneet fiipricirafe 
Ccbiliue cft c\ cip:cfTue. qitantum cnim fupe* 
rat cip:cffum acrcdinc:t anto tsiminuif in Wip9 
tiaratc.quod patct cr calidiue cfl cYp:ctTb.ct 
Cdeo magie t>vafo:cticu:tgit ur foltdare quide; 
nam^pter llvprtciitaris robur crcfludiratte.iitf 
rantum cnim ambobue bie pflrticipat :vtiam 
rcnfiuumetinflatiuu ciiltar, purrefacriqnibua 
vero confo r ficur cipKlTue,ponatur aute boc 
farmacum in rcrtia fubftartf ia f m cfltcfa ccre z 
ficcare cne intcr ea .qucmajcimc funt fubriliui 
parrium. 

jg>pfrattonf0 

C6ar.£cfra fcnafmoncm tcfrigida caufaj 
5iatt»ccoctto ci^in accto et vinor: ft:mupafi< 
cne rcctpiat.l?crba ipfa narite catbaplafma 
ra valcf cetitra frigidu rcuma.fionift#criflm 
tn vngucnrie bcrfcrrita cotra fcabicfantofflm 
tli num tecoctionte cius valct conrra tolo:c 
Itomac bi ct inu (iit\b:uict contraftrflnguiriaj 
ctt»ilTurria5:fcd caibaplflfn-ata valct confra 
tolortxliaw.f-ftitia t»\afo:cti(tlct viumi 
ctim fomem u ejc aqna t ccoctionie.eiue vel vi 
no.£ft flOf fauina cpfpcbue iunipcri vtflpect 
in ca. 3umpcr9.Sf crfl,auc.£flfXlirfne ciH 
quetuTowitvabftetgitpuiTtdin^mv.lfmiril 



Crarram0 



Ttmftaminalotff cojrodcrituim antfquo£ 
«■ipfa fimtlita mundtficar vlccra mclancoltf 
ca fo:dida qfi po t«'nir cam mellaet aufcrt be 
rif ipt la m itiprcr caufam fue fub rilir a tis£W/ 
carmcilruflplueomniaaliamcdicina.t fflcit 
mingmiangmncainterfieit ferii viucntc.ct 
otpcUir moauifcaingraiif invnguaie odo:i 
fcri6:tponif,pamonio vd ariamomo supUt^ 
pddcrieciue.Eridcm aactoritare £>rafco:i> 
die.iolia ambarum fpccicru^ bibcnt ailata* 
rioncm vlcmieowdcntiuimafcdant apofte 
mata c :rofiua.j£r quacto ht^plaftrum cuj 
cie aufcrr U'uo:cm curies fctfdirie eiue quc ac 
cidityprer fugfluitatee cc«po:u:ctaufert efca 
ramtgni8.ctqfibtbiffacitcnrefanguinccum 
vrina:etcfpeUi£fcium.er qitldo cc ca fir naft 
calefacit boc.grinfireditur inconfectowi>u8 
?ngucnro:umcaUdo?um. 




CapMunufffjfn. 

andalumj©andalarabice:0rece 
ii ?larincfanclalu.£>c.li.aggre.ca.fan* 

dal.i.fancMu5*cfcrtur ejcfyria.ct eli 
srtbumatiiffamacitttnunuJ&^^ 
fcamdo:ct mcli9 ct fandalo eft citrinu pingue 
poftcitrinunlbeit:etcftmagioficcuatrino^t 
poftipm album.£ t idem aucroritate 3 Ibuge 
rig3lbumdrfn,ifjau4n.it3.0radu,iscda' 



trinummbajm funt W.{n.fi< .1 ficini}* 

Sprcaticnre. 

f Sferapionaueto. 3bcr, iKcTaaf. jCoBfat 
T>olo:i ftomacbi z epatisejicoUra. £t rubcg 
cft frigidiuealbo 1 citrino •« vft magis iiiuari 
uum.t^tpm^bibaflujcubumo^admcbza: 
7 cft ficutfaufdinrrigiditatc^ ficcitatc. z fo:> 
tincargingwaetftomacbu. 
f jEttdcm auao.Sbciinicfuav.JCofcrr ear* 
diace cu fe.qfi linif cu de (uq cou 
^£ridcmauao.3faacbcuarflmXonucntf 
untcalcfaoie.a cotifaiint©cbiUtaril?oma* 
tbi % cardiacc que accidit a colcra qfi tcrunf . 
ctmifcenturcuaquarofa?:?anpU'eanmrejtf! 
rcriue.? quando confidunf cum aqua rofa? 
z pauca campbo » cr Uniunturinde timpo:a; 
confcrt fodeqfitacatidttarc. 
f£rquandomifccturcnvnaquatitafefan^ 
dali albi mcdia quamifariefarco coUon con 
fictrur cum albumine oui z ponitur fuper tim* 
po:a:et confcrr fode colcrice. j£r p:obtba ©e* 
fcenfum cararri adocuuun: z Uriinir cum eo 1 
balneo.x p:obiba ardo:em pfilorri.a f anda? 
lum rubeum eft frigidius albo. 
<ff j£t qfi mifecf eu fucco folatri aut fcmp vtuc 
4urpo:rulace:aur Icnricula aqucpfcrr poda 
gre calide z apoftcmatibo^bibabumo:ea 
sbtlusmembrie.tmcUueeicfandaloefirirrtf 
numpitjgucr:poftcitrinumrubaim.tcfima 
gis ficcum citrino:poftca album. 
^£t idc attcto.Slbugcrig. 3lbu cft (risiiu 
fnau.gdu.tcrif z rcfoluif cu aqua rofaru cr in 
catarrie ca .pomT in fronte 2 in ftomacbis ca? 
Itdien infrigtdat ca.-r pfert fcca.? birfcn:? flo 
macbi©cbilitari.f5cimnitnibafunrrn.i.iij. 
gra.ficari.ij.nc bfiree flipriciratencq^puricira 
te rofa£/z qfi ©iflbluunf in aqua rofaru z poi 
nunf fup:a ftomacbft pfcrur fe.acuri6 z ?>ebtf 
litari (tomacbi.i fodc qucfit a caUditatc. 
fj£tideauc.atabari.T?ubeucftfrigidi9al; 
bo:aiiniunf cu co apoftcmata caUda. 

Captmlum.ffffjEtff. 

BBtirion.*£adccra ca.d.£bafial!Xcl 
arabicc.0:ceco:cbievd afrodifiavi* 
p:iapifmon.la rtne f rcft icub vulpis 
vdfaririonvdlepo:ina.£?crapionlib.aggre 
gato:T,capiXbafialkclfiuc cbaftalrbcbad cft 
fatirionJBunt cius t>uo gencra: Onum ba ■? 
bctradiccmfcu rcfiiculos slbo6.avocarur. 
XbafialkU^rimumgaiusfaririonisvdca 
tur rcfticuUie canie.a grecc Kinofcri bis: cr cft 
cipianraqucbabafoliacicfenfafupcrrerram 
p:opcipfjim?o«U8elt cjcradiccvntue Itipi^ 




ri8.?foliac{9fant fitfafoltja olfucsnifiq: funt 
fttbtilio^ rie et tdgioia fu g terra qcccf a.et logi 
rodorinseferein ldgitudinevni9palmi/zfto 
rcm b? cotorie purpura'.radiic ctus c filte radi 
cibulbiJiifiqrdttedesadldgitudine tfubtili | 
tatcm.£tcftTiupleplicuffuntt>ueoluicinfigii 
ra.ttna infenueecalia fuperine.et vna plena 
tt alia vacua rngofa .ct comcditur radijc eius 
cliptafiaitbulbuo^tiftcDkiturfatirionquo; 
oeecdniunitervtuntunetfubdit . 2>ecundu 
ittegmSfaririoisbjsuaefpceanaeque vo 
caf arabice cbafolbab.el fiue cbafialrbalep. (d 
«Itatiliculnfvulpis-zvocafftmilitercatbaricb 
etnorainaf boc in greco trifolium.q; plurimti 
<jnodt>econafcitureft babenetriafotiaotf 
ctinanria verfue terra. a finulantur folije acd 
tofcmaioao^m folij \Aqititfi quia funtmino*. 
ra cisict in telticulo fuo eftrubedo scclinans 
rubcdini fanguinie:et babct Jtipitcm fubtitem 
longiwdinevniuebtacbij. ct babet fto:em (i 
milem floribuelilu albiirifigura.ef rad(ca'u8 
aflimitarur cepebutbi in figtira^ dtiniiiagni 
tudiiienjalieftcriu8rubacobas:iiiteriU8al5i 
biiicutouum.etquodcieipiaafiminijir38}r c 
radijc. 

Bpmtimm 



f6aiic.vii5.(un.far^a.©cfdKcuto<?flm8r T m 
tranflarionearabica,*Radijcet9?©ulcie,2vir 
tue riue e ca.t buMi q: fo bumiditatc ciue e 
f nfla rio fufiflua^incitat libidincm. 
^ ^bidefm traflarionegreca.^aririon vel 
trifotia bumide cz ealtde ceplecidie: 3 circa et 
$aftkib> ipm vidcf oulcet vctofl bumiditate 
pofliderc.^tcrcapuocat ad venerca.£>oc at 
ccradip bs>bcrbccfficere nata e:vt quidam fcrt 
buntaiamcpiftotonufanacaimvtnonigro 
anftcrobibitum. 

€£tidefm n - aftarfonc5 arabtcafce teftioilo 
canie/Radiic cirie eft ©uplep fitie radici bulbt 
tlna plena.et fapo; iltfus radirisq e plena :eft 
^ulciemuttebumiditatietfugfluitaneinfta] 
tiue.queqnbibifindfatlibidinc5.£tatiamoW 
lioJfiuevacuaqb^coplcrioneqoccJinatadca 
Iiditate52ficarate.£teftineabumidita6 W 
gefta^tgeftione copleta.t ideo cdringitcp cu* 
boccy noincifatcoifufacitcotrarifu abfcin* 
dit eum. tifte ambc radicce comcdunf aifate 
ficurcomediturradi|cbutbi 
«[f p?afco.ca.o:cbt8 fm tranftarionc noftraj 
0Kbis.iJariribn;H"ri? t>e radice eiue cr (ixir 
comedir parrcm maio:cj rius gcncrat ma fcu? 
los i fimino:cm comedit:gmcrat fcminsm^c . 
<p mulicreeparrtum iralicsanr ti icam cumla* 
cte cap:a? ad inc irandil Isb idincm. ct quettbetr 
tpfarum babet operationecotrari5alrcri9 qii 
bibifur.nafafurmloaepetrofieiarcnofe 
f £tidcm aucto:itare StrcbifaticaliaAlt fpc 
cicequa nominantquidam fandacbias pro* 
pferfuumiuuamentrsm magnum.-rdt baba 
babensfoliafimiliafottjspozrozumjiiftquia 
funtlano:actcftburm'ditae iueaque adbei 
ramanui;babenebaft amlottgam circtf lon? 
gitudinemvniuepalmi.ctbsbctfto:cmpurpu 
reum ct radicon fimiUm tdiiculie 
4 0au'e.viq.fim.farma,ca,o:< bisquam rt fer* 
rapicidam vocant f m tranftaiionc gi ecaan fa 
po:eifiiu8fpcaeifu|plcvlrimct>icfcautfori# 
tarc Brcbifalie z ftipticif ae.er virtue eius cii 
fircio; virtute ra dicis que fcict a eft p:iuc:a^ 
ptcr boc no ita confert in coitu ficut ptcdicts .z 
Tselt :cat ur i ell adbuc ficcio;.ainue eriam ct9 
cftquerefoluitapoifanatainftata quado po 
niturfupcrea.ctmundificat ctfroras io:di^ 
dae- 

f£tcuratbcrifipilam.ctquandocftficcacu 
ratapoitemata fraudtilenta putrtda.er quia i 
ipfa cft fiipricirae.raiiict vctttrcm quando bi 
bitur. 4 DYafcoridee.Ouando ce iita 
fpecic fit emplaiirum ipfio rdiiculis reioi^ 
uit ^poftcmata ftcgmatKaeowim: cr mundifi 



a 







»1 



Wtmm 



X 



tatYtoctfoimid.-rapmtcmoirodiafi.jgt 
qfrfitemplaltycu ea fedat apoltemara calida. 
ct fi adminiftraf ffccapbilxtfcitarione vtceruj 
etabfcinditputrcdineco^:etcuratvlccrafVau 
duknra qiie funrin o:e.f S>edfcienduj cp fa 
tirion cft ca.-z bumida in pmo.S» j c alia fpcd 
csfaririonisq vocaf berbabafilica grcccara 
biccoigiriatrinivelbujeiden. latinevcro pal* 
ma crifti.cur?folia funt fimilia prime fpecicifa 
tirionis:fed gracilio:a cunigris puncri8.radie 
ciuebzancemanusvclpalmcmaniiBbabetft 
militudinem ftoiis croeei .curn vino vcl aq trt 
rumcroccanum effieitur. 
^Oiibafiusca.ocpalmacrifti tlencms refi 
ltir.quactbabuerir:a makftcijs-z venenisfe^ 
curus erir.f &ui.li.tj.c.oigiri ctWni.ei9figu 
ra eft ficutvola manns comiicraeparrinitate-z 
albedine;? eftoura inq eft pa?©ulccdini6.xcjc 
ca cft citrina cu parua alteratione at cg afbedti 
nceit calida •zficca in fctfo.refoluit fugftuir a* 
reegroffas valde. «|f £reft ei^tfcras valdc 
mundificandicwim.ctconfmm&aeneruof* 
timpedimenrisfuis.tconferr manie^prie. ct 
loco cius iniuuamenro manie ponif quanrum 
eft mcdieras eiiis ec bcdcragfen cum tuia b? rcr 
tqefce f 




S3 turegtala tineSrcce Z^mbis, m>, 
bice S> abaciSera.li.ag.capir .S> a 
bancaucro JDfafco.Saba nc j- ue ^ 
barcr cft planra omnibus nora.nafcif in locis 
facofi8ctafperi8.?cftfimili8tbYmo.nifiquiii 
folia rius funt maiom moUio:a.? babet fpi? 
cam plcnam florib?.quorii colo: vergit ad ci 9 
trimrarcm-zviriditate.jEtvutusriuseftficur 
virrusrbimi.^adminiftraffiajrrbimuf.-teftca 
li.-rfic.in.iitj.gradu.t ponitur in cibie. Et quc 
dam ejc eis fumif in bomerr clt Debjlioae opc 
rationis cp alia.t ipfa cft magie coucnies in ci 
bis ctj acutt ae dus eft magis rcmiffa. 

©prranonm 

C£>erapio .airmsrimbtfcftcalefacriua mr* 
tum ? ©eficeariua t rcfoiutiuaxr.puocat v:inl 
ct menftrua.et erpcllir feruj.er facit eccrcare fa 
perfluirarcsapeaou:. 

f £r idem aucro.Sben mcfuav . £>arurcgta 
clt cali.? ficin rerrio gradu« magis agref tts . 
^rprierasetfeft cpejcpcUirfupcrfluirares cj dmt 
nt ftomacbo.-r p:ouocar meftrua.-z acuir vifii 
•ocbiltt jnl ab bumidirarc.eridco comcdimr i 
boccafu cum rafano tbederaos.t cofcrt r>olo 
ri fciatice quando fit emplaftrum cum ca cum 
frumento trircr agrefiisfomo: e fcomelhea. 
fl^fidomskabvmo.Sarurcgiaeberba ca 
lida ?,fp:ie ignita.vnde % illinomen indim cre^ 
dunt:eo cp vencrepzonosfaciar 
f *f>alladiu8 libzo rcrt io.3« fcbmario menfc 
faturcgia ferimr folo pingui velltercoraro ct 
apico.vel mclius mari p:ojcmto i c pulis mic ra 
fcminamr 

C 0Yaf.^amravclfamregia calefafircr ni 
mi8t>eficcar:etmanifeftec|cfenuar.idcoq3 ni'/ 
nam cr menftriia mouer:ac ferus ejc rrabir.po f i 
tui t>ara vifcera purgat .B to:sce arcf. pul ? 
moncbumo:cmpurgar:' t pCT08 fpura pdlir. 
f £>romaebujquoc& naufcanrcm cofirmat 
fa ouo fumpra vcl porara.etcontra ca que icri 
bueaculeariefenriunr animaua. 
C-J>la.Saruregiacftca^tfic.erpulrc8crfa* 
hna ct aqua er eiue pulucre mundificanr fpiri* 
malia.^uluiseiufdcmcomcftusad idcmva 
lef. 

f T&accr Ximbza folet grcrctici.faruregia 
larinc.3llaficca nimis.vis cft cr fcrufda valde 
pumocar vrinarmmoucr quoqt menflruauim 
pra .•^elIirabo»innm:muliibMa vifccrapiir^ 
gar^Uiuspuluiscumcoaomtllefubactv.iC 



f- 



^ik 



Capimlum.ffftiEiir|. CapimIum.raf]Eu. 



8$®fii 




>3 ponaria;£an\Jcaacapi\cvfi*£<> 
Lricbvel ojarfe greee. arabice agifdo 
— • latinefaponaria vclberba futlommw 
«ft faponariate qua pariiculoe fariur: quoe 
bcrbaticoo vocar^ ficcat eoerz.p fapone vtu 
,tur.£5teremtae. <pi lauer^ rc nitro i mutttpli 
caucris tibi bcrba bo:icb;maailata ee iniqut 
t aref ua, , ftli.cap.t>ebo:icb,:8o:icb cft bcrba 
fatie notaque fatie pgru.it ad abfiergendum 
panoe.-zideoipamultftfulloneevtunf, 

i>pfrattone6 

! f •fMini.fcjc folqeeiuefactumcatbaplafma 
vulntramagna glutinat:etcnio:eillo:ufifitr: 
« rcprimit tumo:ee.quc trita cu melle purgat 
vulnera fo:dida :et mundat maculae. 
:f £ t mijcta cum albumine oui fubuenit ignt 
faao. ' . 

Capttutum.frrr*u?. 

P3pbatum.auicen.©apbarucftatf 
l,Ho:ar;ibica ctarmcna. £tcftvnit t>c 
lactianqeXalida cftim ertio gradu. 
ct rius ficcitae in quarto et tn ipfa cft fiiptiri* 
tae temperata. *5cnrit tsicta cft a fitu ^cocy e 
terrainculra inquafentifee fpincq? nafcunf 
tg>>3to:ceautenofiri omne arbo:cj fpinolaj 
»iccbant vep:cmxo cv p:cndcat.2.?iero. mp. 




£fa{5.Scrba cftgenuearboiie nafccnrT itl 
^ctenio;fpinealbefrmil!tudincbabcp.iruiit9 
Ifgnuimpurnbileetlcuiffiniu omntiT ligno:ii 
' tam in fonirudinc q? in nitozc.folidirare i ouU 
'■ cbzirndinc fupcrarXinde oia tigna arc be % ta 
bernaculifacta funt inltrurfienrb. frs\mo ibi 
de.£|cbac3rbo:ererrainqua nafcfftir tncra. 
cftfcrbim.vndejDicunf tigna ferbim. £jc li.tc 
naturi8reru.i2?erbim elt atbo: o:icnrie rcbi 
tiffimaalbefiriefpinc.fedmulfomflio:cfaia' 
tioz crcfar. Xigntl ciue albire lcuc ncfacile cc 
denstgnincc vncp bumozcaliquo vel antici^ 
tarecomjptibile.quodadbucpafet in arcba 
noe^uceftfupcrmonfce armenic. 

iDpfrattonfe 

f 3ui.£>apbati) flipt icitate b?bcrtcpcrata$ 
ct confcrt empctigini Imit o . f £> up_ alcola 4 
q$ mcUe Unitur cr rcmoucf.vctitre fotuir.-z t»c> 
biliratvifccra.ctequcd3fpeciceciueinferfi<t 
cne fedente" in cts vmbza f £a ucarur crgo s b 
ca ,*Ra m a lactie ciue t rce (pccicext interfkit 
in twabue cpar crpulmonefrangcndo. 
f 'Rorandu? cy in tfio capiruio b&bct rrce pla 
t ae t>e quito a udmifti:fcikcct fa fbatti m fcnujc 
ct fcta:rt appafctfn figura. 

<Capttutum.ffftfui'N 



%xawm 




f Itabiofa ladncgrc.ftibcs (Tuc fttbeoe 

©prrationf0 

flDYaf.ca.ftibe6 berba geut'u6fcmcftipri«2 
^rorftficcariuefatis.fidctrco cius secoctio 
©iffintcricis incieif % t>e auritopus cmanae fa 
natinftillaratfinmagnisvulnmtoacraais 
glurinaroua evtiliusid agesficu vinojiigro 
i auftao er ftiprico coquaf.scficcar cm fo:titf 
oia q p narun fur bfiida.f iblia atir eis viri? 
diarriraetcatbaplafmatib? appofitatn ano 
cmojroidaorep^iut/iejcgcufTicie in oatffin? 
Kyfimfactafuppofitaiuuat.f3tcfo^t i ;adbi 
bita furrufioee oculi8t>aagur.£janguinem 
vulneritoimpofitaficcat.ffi>au.ca.t}fcabto 
ofa £5cabtofa ca.eiuc.in.tj.g.tfalctpfcabig 
?aloptcia.?fucc9a9lub:ico8nceat.5um$vtf 
ni ■oecocrioiseiSvalet pcmozroidas.f £on> 
tra pdiiomata q arricia ticunf fiatcmplm se 
fupcr exipfa berba.fumo tn p:i9reccpto.f Di 
cif cr.f.arbanSadperoej cuiufdafo:o:i8 fuc 
anbclantisfuEfcabiofe^turesqmipcprinue 
vtcbaf ;mifit fibiinfraieripros ^me.Oi ban9 
p:o fc nefcir p:ea'u fcabiofcRam ptirgar pe? 
ausquodppamitergafencaus. ? enir pntf 
moneimpurgar larcru regionem. Bpoitcma 
frangir.fi locu? btbira rangirXrtbp vncra fo 'i 
ris;anrraccltberatbo:i6„ 




Capitulum.frt(]Euif 

f jCaIongiagrcce:larine,Cepu<ia 

€>pfran'onf0 

f 0af.q .sc dbis ea.t efealdngqe.SifuM fcaf 
longie ejc genere bulbi.eomcdif cm ipfom ra* 
ditfmefolqs.baberaurinfeipfa smaracr m 
ftcra $rute norabilf ter pcr qus ftcmacbu rcfo 
luru cccit awliqlifcr.apperif u f non ptrariatur 
ncqreipuerealicid indigtnt ibue cjt pecro:e ct 
pulmoncer quidcfubftanria co:p.is grcflio? 
remetvtfcof'o:cbns.amarffudo cius contra 
agir grofficiei.ficcarc vifcofa.t groffa apta na 
ta;ficut in bis quctc medicinisfciaa funr.p* 
pfcr quod fi bietiecoaefucrint nurritiuefunt 
magie.'eonrrariantur autciam ejipuere indtf 
gcntibustancii vricfc fcepofito toro amaro 
f £ omcdere aure ipfae mclius runc cu acao 
fimulctoleo ergaro.'£renim t>clcaabilto:e8 
funrerminuemflarme:tmagi8nutritwefub 
ttlto:cs ad t>igaendum.2lbundante8 aurcm 
fmefumipfommquidammanifcftefcnfcrunj 
a fpama plus fcabcnres p:omprio:e6 facti 
a d vcnerea.p:cparant autem ? bos bominee. 
muItifo:mifa.'Fionenim folum cliiwepcra* 
quam fcd a vala cjc fpfa 8 valdc p:eparara cof 



■fctyfrfett 



alfanreafupcr larmtiltamt>ecocrioncnd fulti 
nenr>$£ontcnrifunrautevaldemodicamecp 
otmtind p:edecoquuntgaudentee iplbai ama 
rox auftero fapotc faluato:pzouocar em ipfoe 
magie ad efum. fl £&d inflarionem t r ozriene" 
faferunr uon T>igefti. £]C bie quidem itacp qui 
ficeomedunfnonboniebimialimentumfir. 
f ^bfeautquiampliue&ecoquunfautbie 
vt oicttkftigrolfioz quidecbimue.mdioz aute 
quanruad©igefn'oriem.2nufiwuuefir.Cale0 
faaunt aute m jnifefte:z aliquid aromar ijane 
ktiiwmn vanatiucfunr. 




CapituIum.ftftjEi)f. 

• Camonea Iarinc.0recefc>iagridiott. 

.Brabice fcamonea.©cra.uD.:2ggre. 

capi.fcamonca.aucro. fc>v afco. Ska? 
inoneaeftplantababcneramoemulroe cgre 
clientee ab vna radice longicudinie qtfuo z bza 
cbio:um;fug quoeeft r ifcofttae a dbcrcne ma 
writt parubo:re.j£tbabetfoliafimilirerpilo? 
fa :? fitta folue planre lebteb.t. volubitte agrc; 
fti6autfoIUscu(ui84.edere:niftquiafuntmol 
liozafolqeculfue.tbabenctresangulos.zba* 
bmfflozesalboe.rorundoFucocJUoe^fiteem 
figura fua cartaUd eft tubeb bee graueodo* 
r«n.2radi(e)babetgroflamficutpoIUp.alb4 



grauie odozfe plcnamlacrc. St cdlllgtf fti 
bunc moduYRam vulncraf vifga 2 radtjc riue 
ct fiiit foueeiucta vuluue: i bumiditae mana£ 
a yuwere m fouris fllie: que poftea eolligif in 
cedcie>0uidam verofodiunt etrca radiccm i 
fternunt M feliatfuc z vulncrata radice qt> t6 
bumiditatc egredirur fuper fubiccta folia colli 
gunt.poftca'fict)imiftunt ©onccilla bumtdi? 
tae iDeficcata fuerit qul reponunt . z mclio: ep 
illa bumiditate que e(t fcamone a :dt que cft cU 
raleuiesfimilie ino>: 'ozemoglutino:qi:odj 
fit cjccozue boum: babcne gibbofir atem. 2 cffi 
fpongtofa. ereft illa que©eferrur er. locis irq(it 
sejcterrie afiecft buiufmodi.£t itle qut vutr cli 
gerefcamoneara? colligerc ipfam: opoztet cf 
non fitconrentue vtrum albcfcat :a ut non alf 
beicat quando tangtrur cumlingua. quta idej 
coiragfcquadoipfacftadtilretfraculacrcrittf 
lmw.Oerutamen^ifcerniturquando nonelfc 
fldmi^tumxo 0/ non aduritncemozdtcaf lin? 
guamaduftione et mozdicarione font.^Ram 
boc accidit quando cft fibi mijttum tac ririmal 
li.iocfcriozfpcacrufcamoneceftillaqucoc^ 
fertur ejcfeni^ ecpaleftina:quia iftefpedee am 
befunt maleaduUerate cumririmalli lacre:ee 
cum farina.ozdci.^t elt caUda % ficca in tcrtio 
gra du< 

©ptrationts 

^Scrapion.Swntautequiacdpuwter.ra? 
dice planrefcamonee:ct coquuntcam.? t>ant 
cUjcafiirainpotu 1 purgar . £ t aifumitur radijc 
plantefcamonce:etcoquinir illa cumaccto ct 
terirur contritionefo:ri.et conftatur cufarina 
otdci.: fit cmplaftrum tuuariuum fciarice. 
^Etquando lana inuoluirur infucco radicie 
ciue.cr fubqctrurpzcgnanrifadtabozftim. £t 
quando mtfcetur cii mcllc : oleo 2 Unmnfciim 
ca cjtiturc foluir cae.t quando coquimr cu ace 
to^tUniturfcabteevlccrataeiccoziateam.^t 
quando mifcemr cum oleo rofaro.t linitur ta 
putcum caconferrfodcantiquc. 
f £t idemauaozirare ^alicni.ilaUdfl cft ct 
ficca in rertio gradu,£f eftcaUdio: pipcrc.£t 
idcm aucto:i.^auli. ©camonca abftergit ca 
tim . i mdio:at colozcm. 1 mundincar barae . 
% aufert totozej capitie anriquum.quando ad 
miniftraf ciimolco rofa? % accro,? infundirut 1 
fu£ caput.er mclioz ec ca cft vcrgcne ad coleze 
cclelte quando frangtf.-z eft infrtc atione ftta fi^ 
cut coclcafracta. £tilla qtiecolUgif in monri 
bue kem cft buiufmodi. £t ma la cit curS colo: 
vergit adnigrcdinc.-zfigura eiuecft rotund^ 
1 alreTi9colou8 ab illa.f >£tmodue reaifiea? 
tionie pzimc fp«idquc,dt bonadt $ acci> 



& 



Xxsmm 



Trtaf dfom&zabfctndaf oecsptcc ciue rotula* 
sfodiafmediu^:?t'ntromittafibtfcamonea 
ibdnde ponaf cooptoriu qb* fuit abfciftum ct 
firmef .Dcinii inuoluaf fup ipm pafta n ponaf 
i'n fumo nomultucaltdo.z&tmittaf t>onect>e 

_ ficcef.etsofieeiusita p>arata{itab:vnot>ai» 

*? uidjvfqjad^uos.^tfciascrfcamoneano 
mutaf necp minuif/aciatasdus circa fpactum 
iqcjc.vfcg ad.il.anno8:nifi illa q eft pparata (ft 
cut t>ijd;nu8.na tlla quc cft pzeparata qn nan* 
ficr(tIongutcmpU8fuBtpfam:amtttitrirtutc 
fu5,?,jpf er boc opo:tcc cp pieparee ca qn volu 
erie ea adminiftrarc.z qn fumtf fcamoncaplue 
abea quatitatequat>ijrimu6 fo:tafie tnducit 
anjriaatczlanguo^e zfudo:e frfgidit? hx\co't 
ptm ct flupii t>oncc motif .£t fcofie eiuecoue? 

S uicns eft a.vi.granie o:dd vfcpad.iqc.f £t t>e 
p:oprietatedueeft cr/ejcpcllitcolera-z bumo* 
rcs vifcofoe.etattrabitfupfluitatce malas a 
co:po:e, z multiejt biequifunt calide coplcpio 
nis po ftqj fufceperiit cam incurriit fcb:es aotf 
ta8,£t ab ea cauerc botto meltueeft: nifi ma* 
gna neceffitasincubat.Ttunc acciptat fmfoi 

X> ma z quanrit a te qua trijrimus.qj^t tdeaucto* 
&ben2£cfuay.Xajcatfo:riferventre:?nocct 
(tomaebo etepat i: z timinuit appetitu cibt. cc 
tnducitancietatem-znaufeam.fctrecrificatto 
eius eft q> adtnifcef ri anifum z t>aucue i femc 
apq :z raditpipcrie. z admifcerc cii oieo amig* 
dalino cftbonii. £tfcamoneanont>cbct mnl 
tum tcrerc ne adbereat ftomacbo vfnoeeat ei 
£topo:tet cpnobibaffimpltcifenzfumanir 
cum magna cautcla . J£t fit t o fis ciu s ab x \ • a 

"23 fe^rat vfq? adtree.f jfobanneeSgbcfuccapi. 
se fcamonea.£> camonea cft folunuu magnu 
£tt>icit pemocritue q? eft triffowtiuuanro? 
nomarice:? q> cltgentte foluriuo^ generalt9 
fiig oia foluriua. jit aiit ejc fucco cuiufda fpe* 
ctdvolubili8:ati«8folia funtinmodii fagittc 
alate.Rafrif aute in anttocbia 3rmenia;z co 
rarcemtn parritoarabiettburcbtc. zplurimu 
nafcif in terra noftrarz eftmala.z credo # pi& 
pofiriolommodusculrurezare infaciendo 

3 aujriliaf :vt fit bona vcl ma la.f ^odi autcm 
opatiomsdus ftmt qtfuo:.*£:imuecft vtac* 
cipiaf ra dijc riue poftqs euellif a rerrarz fiat in* 
rifionee in co cy apparct fup_ terra z inucnif ;qr> 
egrcdif polt ©icrz efi res ficut gumi. z ttmit tit 
ericcari-zconfauaf.Secundu8eft:em'rpanf 
poitilludtotalitcrradicesiincidunf.tcoliigi 
turlaceo:umfluen8rzt)ccoquiturcufadlitafe 
: t etkczi foli.z fiunt inde fo:me -z figillantur.ct 
buiue fcamonee colo: eft fubalbidue aut vari? 
Xcrrius e(t.f crunf adbuc radtccs poft illud: z 
ejttrabif fuccue.z fuucut Dirim? $ t>ecocttc*e 



taltis.tfigniant^Uofigitlemuncaut^fidcef! 
gilloutm pcrii t.£x bec fcamonca cft groffa ffi 
gra z pondcrofa.0uartu8 eft:teruntuf flccee 
dus •zftipitesrz c?;tra bif cc cte fuccus z fit fimi* 
lit er .£t bcc eft fcamonea nigra atrincne viridi 
tati.'Zcftgrauieodo:i8,^£lectio.^)clio:vc 
ro clt autiocbcna:'z armena cft poft bacQue 
vero fit in parribus noltrte z in co:afceni ema 
la p:o:fu8.£tmclio: adbuccftquecft p:ime 
founctz que eft fccudepoft primam.z: alie funt 
malc: z ccttrio: riridie. 3dbuc autequi lau? 
daucrunt fcamoneam in quincBpu>p:ictanb 
laudaucrttnt cam.']!»:ima dt vtfit (n cotozccU 
ra fiatt gumi.zpu)pricfpcdeeciueprima:aBt 
fubalbida:autvaria.Sfccundavtfitangatur 
confracrii ciue cii aqua vcl faliua fiat ficutlac; 
Xertiavt fitrenera mtHte facilitatie ad frar^ 
gcndum z pulucrijandQ. Ouarta vt fit ponde 
rieleuie.0uinravtfitodo:iep:opalbom'aio 
grauie.*Rcmota vcro ab bie p:op:ictatibue t 
noncftbona.f £onfcruafurautc5pcr annoe - 
tr. fcd quanto anriquto: tanto t>ebiIio:. £a W 
de complcitio m'e cft in tertio gradu: ct cfi (icca 
in p:imo.£tcftinca t>cacuifafe minuecp in 
planta fua.£ tcredoty arein fanendotpfam 
frangfrejcaaiifat c riue aliqutchet in ca dt ama 
rirudo.ct ipfa quidemeft abfterfiua:indfiua z 
refoUmuacuaftracrioemulta.cuiueattractto 
cprendif vfq? ad mutrii remofa; f T^eaificario - > 
Onattuo: funtct familtarfaquc tnco:pe ma£ 
gnitudincm nocumentom imprimunf ,£ft tin 
tncavcnfofita8mo:difi'cafina:tfacicneinlio 
macbo fubuerfioneznaufeam,? drtiationem 
labo:iofam.Siccundu:q:infuntdcalidita62 
acuitaebabilie innamarf.etp:optcrbocfadt 
cadercinfe.z firim:z p:op:iequando inuenitur 
paricntiep^paratio.Xeitiu quoniafitrripfaj 
atcracrio vetemate t>ilatatioo:ifido:um ve# 
narum: quia facit cadcre in immodcratu flu* 
cum:quonia cft in co fcrofitae opcrane dd 
co::ationanvifccrum.quarcgcneTat!oolo:c8 
flcutospungiriuoe.etfacitcadcrc in tiflinte^ 
riam % tenafmon. Ouarrum eft p:opacfae ct 
opcratiofuajquibuefit impuflto nocumenti 
ix\ memb:a que funt rninere virt utum: ficut co: . 
epar4loma(bu8«fimtliade. f Suuliandu * 
igitur cic bie di rebue quibuepzopriefatewir 
tute nocumcnt a tollunf. ficut vcrbigraria»b? 
uiamuedquoprimo ©itiadiuuando: vtrcfol 
uamrVapo^dnerurbidtietinflatiuue^fadee 
fubuerfionem z labo:cm.j£t ad bocau]dliatlH , 
nobie^ccoctioinpomo^igcritcm-zmaturat 
et refoluit z ejccludtt vapozce duerz aufert ferc* 
firarem riue.£r mifceanturaia insecoaionc 
iuwequcvcntofttatcmrcfotuHtriCarmilwnt 



BifytxW. 



iidhmnt ad fltodfiairoatiaieptopric-rga* 
langarz fanenfemajli %_ fcmcn apfj .1 fimiUa. 
f £r©ico cp ©ccocrio eiuegeueralin::? ppara 
rio ciueaufcrte plura cr nocumcneq t>ijnm9. 
j£t obuiamue eiq?5 ©ijrimue in fccudo : mifcen 
do intfcecoctioeciue alic\d$nircrefrigaatiuu 
sopaldovtfrangafacumennnfiamatioa? 
£tadf3au|ciliaf nobi6t>ccocfioa'ue m bioq 
«cringuunt i lcnitmf .ficur eft muiallago pfillq 
1 aqua citts z carnea p:uno?: z fuceue rofaru: 
t aqua viola^ ct viole rcccntee:? inuolue ipfaj 
fliifecocrioncciueinolcorofaru^autviolato 
aufcrunt boc nocumcntunt a b ca. 
f £t fu ccus ciconiom mufey, z fumacb 1 fpo2 
dium faciut fiinilirer.£ tobuiamue eiqtoijcti 
muein tcrrioanifccndo ri in t>ccocrioneq ad? 
iuuat virtuf ee mcmb:o?tt aujcilianf in aggre 
gatione z co:robo:atione partiu lajcaru. z ad 
bocaurilianfrtobiemajcimercefttpticitatan 
babeteo^oiaqtieaufcruntfupcrfluitareacu^ 
minie cm-.z remouent fubriliratc^virtute pe 
nccratioie ipliusficut cft maftijc: citonia z fuc 
ctie co?.funt cm rectificariuu bbnu. 'Z&irabo 
lani quo cp citrinifunt mirabilcs in bac opera* 
rione ■zaloefimilitcr. 

f £r obuiatraie eiqo* cijcimus in quarfo;mi* 
fcendo ree cj aggrcgant t>uae int cnricc6.*j>:tf 
ma eftacquirereei facilcmcgrcilum.? B cu rcto 
cjcpcllcntito citoaudacia eiue:2faacnrito cl 
t>efccndcre.£t ad boc aujciliaf nobie admini* 
ftratio'eiue di reto hibnficaj ib/tcut cft mtifal 
tago pfillij ?carnc6p:un6?.£rfqiiifti q> com 
p:cffiua c jtonia;-: matime fumpra poft mcdict 
nam.?p:op:iepoftqa'ncepireduccrcfeftinarc 
fa dunt aue egrcfltoncm. 
f £r fciuiilicp aqua calida poflmcdidna traft 
mttfataudaaiaipfiue^ t)cbilitaf virtuteeiue. 
f Ht oirit*Rtifueri8 qui fumpferiit fcamonea 
fccmelio:ib?rcbU8:eftadejcpcllenduaudacii 
ciue:vt poii quattuo: vcl quinq; bo:ae poft cq 
fumpfcmnt eumpfilUiieoquaffarucuaqua te 
pida autolcojofa?.fumafz poftbowejouae 
riiieinfufionemmirabolanitribue^ficcmnon, 
t imcnf nocumcnta eiue. ©ccunda cft rcprime 
rc ciae virrutcaaita z fcrofirarcVr bocfacimue 
cu aujctho te% bumida? z vnctuofa^:(tcutcfl 
Dragautut olrii rofa^ amigdala?. ttobuia 
mus ri c\t> oiu'nr2in ejnro.-cv eft tbcfaurus tot 
riae ogationie: z ilUJcftacc^rereribonifate oi 
medianie mcb:a z virtutee e6fo:tant tb?. et ad 
boc aurilianf nobie mcdicieco:dialcefrigide: 
z medicine ftomaricc.£r aujctlianf nobisarst^ 
modu6p:cparationie:(icutiamt»ijcimue. 
f ^oduerectificationieriuscft fm crnarra 
trit •Rufu8t>ecoqueie tcamoneam in cironio 



poftimjc^ttrioncdiie-rrcijolurionefcrcp^fciii 
tnolcorofaruautviolaruautamigdalaru.ct 
poftiUudtcraturfacilifcr;': voluatur? reuolua 
tnr in fcutctla vitrca vf q? tmm ficccr ur cii inf u* 
fioncmirabolano:um citrinommfacta infuc 
co citonio:um.ftincfiunte)cco troctfci quanri^ 
tatequartc.5.i.-: fit •ooiie trocifatsvnue» folu 
tionc ein educitabfcp moicftia/^odue aute 
aliue f m cundc fa tie bonue.Decoquif fcamo 
nea dk p:io:i t)octriua;adiungendo ci mirabo 
tanos citrinoB ad quanritatem tertie parrie ip 
fiue.ttrinde acripe femena nifi feniculi:t>aucia 
na.j.tj. tiecoque cum fucco citonio:u cu facilit a 
taz cola ct vtere tseficcarionc •: inuolut ione:fi? 
cut bic p:ojcimo wjcim^Onquir *Ruf ue. S i$ 
tua addcrciminucrcctmutarc: fmqo cjcigit 
t>ifpofuio. 

f jlnquit 0aU'en9. ^>ifcui fcamonea cu fccftt' U 
plo ipfiue manncz rriplo ciuefucci rofa? poft 
bonitatecocrioniectu8tnpomo.£tinuenicc -% 
modie p:cparationie ciue bunc modum farie 
laudabilcmt.cmaidantcmplura cjc nocumctis 
qucrimentur pcripfam.£ta!iquando mifcui 
mcdicinae co«lia(ee. aliquando alia fiattrc8 
cicigfbar.^nquttloamccb.Bccipcouptiei? 
flo:umviola^;:mcdiump6deri8ipfiueUqm'^ 
riiic.z intio lue in oleo rofaruu fac trocifcoe.5. 
.i.-zftfoofieco^umvnue. • 
f 3nquifX3umar,Diflroluamraim oko vio* 3E 
larutn aut amigdaUno et pauco mafticie. et g 
t>icm z ticm agiref in folc cnm adminiflratioe 
ohm paulatim poft boc agircf g t>icm z t>ic cu 
aqua rofa?:inquafaerirt>flroluru bdelUii tcjcic 
ccf z ©ccoquaf inaronio.^oftboccurcrtia. 
parte mirabolano^afriiK>:ufianttrocifci. £t 
ftt 9ofie.5.f .3 nquit •jbaulue.Zii&berr pipcr 
longum z antfum:adn;iicf a t>ecocrione tpfiue;z 
p:op:ie in pomo acerofo aut pontico remouct . 
nocumenra ipfiue. 

f^oduerecnficjfionteipfiuecjciiiucnffone p 
noltra. Dccoquanf fruftra ciue inrer amigda y 
lae rnrae mulrae poft p:epara rionccccu inrcr 
foUa fcpcliendo ea in rinere calido.t poftt>iem 

abiectieamigdaliebiflbluanfinaquacitonio 
rum acctofo:u:in qua bulicrirfpica z antfum, 
z ec fpeciebtie % fcminibue rcdolent ibcnz t>cfic^ 
ccwr. Deindecu paucomaff iaez bDclltJtJC/ 
coquaf inpomo monio uiuoluro in mafla. . 
tcindcfiattrocifcivnaakvna.JSrfirpofisrnii 
jOpcratur cm fine nocumento. 
f i^odue aliti8p^parationi6p:edictc.!©)t. 2 
fccatur quantum ipfaef f t>efumacb.? quanta 
parrc ciue t>efpodio. j ttanr jndc rrocifci ft cut 
p:ic«ce.funt-cm vlrimi. Dtfioluaf fcamonea 
cu ocruplo ciufmiuci cum pauco fpicc poft in 



Ctactsma 



%* 



t 



«etofConcm cuiefnolcorofa^ atit amigdali& 
£t ©ccoquaf cum faalftateamendaf cifx a fua 
*naucia.£t fciuifti cv aloe frangit maticiae ci9 
2mirabolanimagnificaiJte3m.^t$ecoctio 
^uiein fucco pomilaee: aut aquafeminis ipftf 
U8 auferunt ptora cc nocumentis ipfiue. £t 
mcdicinc cc*ctt'ale8:antftomaticecalide:aHt 
rrfgide;ftn q» reseugititrangunt malicia eine. 
£t opoitct cvfiat ©ecoct io riue cum facttitate* 
3 mpetuofita 8 cm in ©ecoctionc addftin m9 
uciamciue,£tiftaficutfciwlhiacmfurfltionc 
modidfumnct.quap:opter in trfrurarioncfp* 
ffusnon nftniu infiftaf Jtjcrcbus mc fc cimt 
ribas facilcmctvc(occmcgreflum cius a cot 
pozcfuntcitonia qn mconfectionibue i cleetu 
ariie fimulmtfcenrurn umilirer mfrabolani* 
3pff cm funt oc cito cam T>cponentfbu8.£t (t 
wftttcr fifup?a eam poft fpaciubfbaror. JEt Tci^ 
wfticp aquacalidaetpellitmaliciam eius:ct 
aliqua aliafimiiiter fi«t fcfcimue incanonc. 
f ^olutionceducitcoleraajfacwtatc:? m 
trabitca a fanguine z vcni s vcbcmentc*. ct ef 9 
operatfoeft ficuwperario furiofi. £t ipfa eft 
inimica eo:di:ftomacbo ?epatitinreftinie.£t 
cft etfacientibus naufcam z conrurbarionem 
in vf fceribue. sccuibuerrentibue ea. % facit fi* 
tfm. rsebilitat appetiru cibi. £tec caz mfrra 
sotco z fucco agreirn pauco apio fiut rrocifcu 
tcuvirto ponticoict ptopae cum vitcUie otii z 
acerofb:ti» 

f ^fanat fodam anri quam tfrigidam:?,jp:fe 
emfgranca©ifftcflem.Jttfiponaffup:a^cnte 
rcmbuef©Qlo:cfu8ieo:rofio.fctfifnpcrfcro 
lula8:tp:op:ic cufuccoapij t>3tici:©clereae« 
fziti fitlinimentumcicvco co^eum fuccouY 
fimb:n •zacefo/cdlocoapq pomrur eartweii: 
tMnif wpoftcrioup3rtccapiffe.tcfl tnagnii 
iuuamentum ad fubct z atargiam* £t quando 
fcamoncafupponif eumlana eduatmenftrua 
sfarit abo:fum.-rf pfa quide curatmoaue (cot 
pfom8:pM)pMc ©cfug linfta cum fucco mcntc: 
autcunivino.aifcntautei'u8 acecprfonequf 
caifde z ficcc narurefunr;eft aurc" pararueea* 
^rtiin fctece.2Dij aurc quf fumunt f pfanu.rtf 
mcant cftus ct frfgnerz abbowcant fhtctue: et 
p:op:iefrigido6:': aquam verifrigorie;? fom* 
nuifi p:oujtum fupcr eam: ? eccf tarfa fuper bia 
animtXonfcruaf auremfcamonea ptrlannos 
t>tiodccim. pofiociuscft a granis cjncp rlcp 
.advuodccim. 




B^lpFraga.i!Sandccta * S» arifraga ttit 
bcrba fimilis pimpmellcnen tifkrem 
nfff f n pfloftrarcjqufa pimpfndla cfrpi 
Iofa.fedfacffrag3 non babef piTos.tifi vcrfiw 
^mpfneUa pilossfajcifraganonbabct xUoei 

0ptrationt0. 

f ^auute capi. farifraga.^arifraga caJida: 

cftct ff cca fn tmfo gradu. 

f £tvalctcontra ftranguirism:ctvir»mlap£ 

dte:etttoioKmY»*nm, 



Capituium.ffft^. 



Capitulunurffjftf. 

»>Cafifagrila. j?f«5. Srafifagria cfi fccjf- 
,ba qucbabafolfaquafivirierz canlCif. 
recfos cmittit/emen babcns in fdiicu* 
lie vfrideac trf goufum fn modum dccris afpc 
ramrufcum:t'nru8 album z a martim/FSflfcirur 
inlocisbumidis. 

0perationea 

f DT«rco:idce.^taftfagrfaqufim iarimpd 
dicularfamvocannnafcfturmiocfsvnibroffe. 
j£t(um foliacius viriagrtfti liniiHa:cu:ifa a 






feffcflftfe 




fcflTa tancSmalaa agreftfs.baftasbns ton* 
ga8crcctasctragra8.SaiiencJlciftmilct?fa^ 
dctfto«0.aafcmetnviridio:ibi»8folltaitte 
«ft 0btect.u5.qn tcritur elt nigriianteriue albu. 
guftuvifddoetamctcalido. 
4ff6ranaciu8qutndccim acccptacumulfavo 
miriteciccluduntpingueficgma.vcrubq q ac? 
ccpcrint mulfajbiblt z ©eambulet. qm oftoca 
tf»neecitiu8p:eftattr:et gulamccafperant. 
C2Irita2bibitapcdtculo8UUcrficiur:fcabie 
ct p:urigincm tollunt.Cum accto dfcatoKrc 
tettta/accrepo(furaommafup:adicta. 
.^Tlmmagingiuieabftincnt.tiimoicsfaucu 
fpargat.mifccniftnmalaginatitocalidi8.Sc^ 
mcntritutolcomitcunccarclcndincsacpcd^ 
culoffeftiraniMuVComienicna quoq* p:o? 
batur tn apo flegmarifmo raciendo: vel afpcri 
taciWerTectie qudegreci ftigmatavocanttob 
rcco:po:arionemfaciendam. 
^auiccnna.StaftfagriacftvuaparTa mon* 
tana:cuiuo granii cft ficut ciccr nigru. 3 nter* 
tio gradu eft calida ct ficca.? cft aduftiua:co:* 
rofiua:acuta:am'8.3ntcm'cttpediciJloe:ip:o^ 
p:iecu arfenico. z confertalopicfe anriquclini 
ta. £ade cu arfcnico vel fola ponif fup. fcabies 
eoaationem:? mafticaf ad ejccrabendu cf ccrc> 
foofUgmactbuimdtcatcra. 



.fEtcaquocfcCttaccrococtacoluitfc^adfc? 
tium«olo^mctg(ngiucr)umiditat?.*f>rcfcrca 
fanatalcoiacum^mclk.tbtbunifcjceaquitidd 
cim grana cum mellicra te.f acirq? cbimu vifco? 
fumvomcrc,3nciu8tnbtbitiocrimo:cft:qtn 
fofaveficamvlccrar. 

4 £onftattrittue.©tafifa gria in rcrtio gradu 
cft catida er ficca.babcc acumcn quo cumma* 
ittccveloubanomaracatamuttumaflegmate 
caput purgar.Xtnguamqspwpter ftcgma ag 
grauatamalkuiat. 

«ffJ3argarifataquo$ capntfccgroflb? vifco 
io flegmatemundat.£um acetococra ©emiii 
©ototem ac gmgiuarii purredine curat. S>rer 
nutauooeflla: nigeltavtrifqj inaceto coctia 
(uuatinopilarioncvcnarumYctcrico8.mt)cta 
vcro cum auripigmcnto ct oleo valct corra fca 
btemacpediculoe. ' 
^andcctacap.cccp'ti,l5abcraearabtccvcl 
numbafae.grccepcdimlidda.latieftafifagria 
velpedicularia vel granucapirie:vclpafiula 
montana.velrofa regie. 
«ffScraptonliteo aggrega.capi. iJabcraefi 
uc babeltos:auct.t>va.£ft olanta babcne fo t 
tia fimilia folrje vitioagreftisincifa ficutfolta 
maluc agreftte.erbabet ramoe longoe. 
fl0atfenus fcjcro fttn. farma.ca. 2>tafifagria 
f intranftarioncmarabica5;j£ft acutafomtcr 
multum. £t virrus eiue cft caltda adurens ct 
attrabic z abftcrgitabftcruonefom'. 
CSucrrois quinro -Colliget capupc £>tah> 
fagria.gftcalidaificcatntcrtiogradu. 
f Buicennalib^.q.t>c S^tafifagria. £ft cajtf 
dactficcaintcrtio gradu. 
f 5 alicnus.^actt ocfceuckrc a a^iteqasdo 
mafticatur: auc fit garganfma cum ea: rlcgma 
mulrum. £t conucnit cii cgritudinito cti quito 
eleuaf curie. et coruientt ad pzuritum, f>arrici 
pat autem aduftiuecutufdamvirtutte, , . , t 
^pvafco. jSrana qtMndeCiuiacccptacumulf 
faflcgnuta pingaia vomitibue c£Cludit.tle£ 
biqut mulfamaccepcrint alViduebibant cr v>c'/ 
ambulcnt:q:o9bcationc8ciftu8 p:eifat; a gttf 
lamatpcrat.^tactbtbttapcdicutbencCai'., 
^Bucrrot'8.0uando m aiticatur trabit ftcg^? 
mactfuccusfuua mun jificat caput pcr narca 
£tdcctuariumciu8 valec adino:bu5 cadacft 
ctmo?feain:ct menftrua cducit. 






n 

Q 



O 



Kmtmm 




Y r ^ %n8uie*mtnwlituKi grcaflndri* 

^fi-^pio lt.ag.c9.t^9lacttogaucto.£>Y9. 
Vm^cbomvd(in^tbioegihsAJ[anffm 
t>:acdte qutfit cjc 3rbo:eq eodcnoic nucupaf * 
«eteftplarabnevtrgaavrauepalmildgas ane 
lAas^tTceftiricinqu&^ftlaf.fufiqerunrfdlia 
$ania fimtlia foltje co:iandri.quo?colo: texi 
fiftadnJbcdine.zbabcntvtfcofit3te:odo?cm 
fo:ton: no m tnalu fcd p:op:iu odo:e mcdictf 
itaru.£tiitfurtntaritor9mo^fitfcowticrotu# 
: dc z florce albi in pndpio nattutt ari8 icoKjf n 
ine #omtnt aura. flafcif in tcrra culta. 

©pfrationt0 

f &era,mcM.&indrichis3n platatfta 
eft rca q abftergit.: eft m«a bumidttae mutta 
ttipfauifrtgidatpa|;^ctcui^ccftincaparu« 
fttpndtas.cr^crblccaufa^pbibcfgcncrati' 
onc apoftcmatu. £t quidl noiant plantiq tfz 
£#0panotcbuui8platc.?c(lrIantaftu6buk 
piatcinoib?:mft'qtut3ptata eftutp.io:tn fttpti 
^atcabipa^tcrbaccaufa^pfcrt fangutni 
iTlcmtoinfcltino^ftuicuimcllruo^fupftuo 
43 dcauCiXIoftan.!Sucaia buiue planfccft 
fanguia ©:aconies»icma. t cft nibc9 fojtie ru^ 
4)cdime,tfapo:ci9cftftipficu8,tvirt9ci t ;£ftq 
^dat??«ii(C3tin.iij.gd«.vu pflluuat vutf 



ncra qftut a pcuulonc.ipfcrt flutui fanguie x 
vlccfibitcftino^. f £tidiauc»PvaOmapll 
ta qntcrifbniponiffupvlceracufangukfuo 
coglntuiatca:? .pbibct aparioneeo? . \ fdndtt 
flucufanguiniemcftrm. f £t fitatcarifmacc 
Sccocrtdc ciue; in q fcdet mulicrce. t abfcindit , 
ftucum bumiditanT antiquarii matricie. f £t 
btbifct:t>ccocrioncciU8advlccratntefttno:u. 
«tconfertinafidmbuecarnie^incarnitca* . 
f £tqfifitfufpofitoriucuco ftringttvcntre;ct 
pfoztaf ftomacbu interi? fumpme? ettert'9 po 
&ue.Sangui8T>:aconiefrtVz ficcft ppktiof 
nia in t cttio §da. £& a ut eligcndus q intcriua 
cft clarue ficut mtntu.S> opbifticaf quandoqj: 
cum puuicrc minq:a cu a lio fucco indurato. 
CCotrarUiaifanguiecnarib? imponafputf 
uie ec eon fricatf narce vt puluie a dbcrca t rw; 
pturerena|:.5iai ctia finapifma ecco lalfcumi 
nc out taqua rofa? circa rrontcm z ritnpota. 
f £dtracmoptoicl pafltbne.vino fpualul teS 
ncaf puluie ci9 % gumiarabici pfeerueer aqro 
fr ftinfufidie&agatittpstiee poftca rrafgluttf 
ar.St^o ftarvirio num ituto? t>cf cu fucco pil 
taginie. ^^dc.jFuvfueptiffintcril^iuatTtf 
lio fupcrio?.fi virio itifmo£iniriaf gcriftcrccu 
fucco plat9gini87aquao:.f Sujpofifonfi 
factu cjcco % (ucco fanguinarie vslet cdtra m$ 
triciefluicumjtprrarlmufanfiiiinienariujtn» 




©flifcbfg 



CapttuIum.fCffiEjEitt 

>3rcocolla.grecc.arabice anjaroe.la? 

/inc^o anjanira.Sfera.lf»3G0rc.capi. 

&n3arop.anc.DY3f.£ft gdmt arbotis 
fpinofe que nafcif in terra "fbarae qd fimilarur 
olibano i runt pama fruft».: colo: ciue cft fiib 
nifueyamarifaporie.^rmcliota: eaeft quc 
rirofrangtrarf&eficcarfine motdicationc.d 
mfapoteriue eft amaritudo.scft calida i ficca 
inprimo gradu.tlndeviraiecftque glurinat: 
et abftergit:? maturam rcfoUiif :z incarnat^c 
apcrit apoftemara cj fiunt a peraiffione.f £>a* 
u"enue,viq,fim.f3r.ca. t>e farcocolla . Srarco r / 
colla eft lacbtyna arborie cc *fcerfia . mittam 
babenevinutcJZtemplaftica quadafubftanf 
t ia:z modicum ftipt ica.vnde immo:dariter fe 
car^^pterca vulnera potcft confolidarc. 

©prrationfff 

a f DYafcoridce.£>areocoU^babctvtniitcin 
* cdgbuinatiuant vulncru, et abfandif bumidtf 
tates que vcniunt ad oculum i co:rodit car ne$ 
coJrupta m qne cft in vlceribue:? babet v irro* 
tem in obralmta oim poratnr . fc: tp:opactat cf 
ciueeft etpellere lippinidince ab oculo plue 
aUje mcdicinio^n jcime quando adriiiniftarur 
critn amilo i juccaro albo. 
3 f £tidimauc..3rabari.*Reftanratfracwra 
■z incaniat vlcera.t muudificat vlccra cii mellc 
iqn mifccrur cu slbumine oui:aut cum lacte ec 
^mccatur.tpofteateraturxcrib«>f'2 inpuM 
«creadminiftraf:c6fcrtobtalmic.ipurgatflc^ 
$mivjfcofum.£tt>ofi9aueeftquadomifcef 
cnm »lqo mcdtcinic inoccoGide.a ,j.f . vfcp acl 
vnam.sipfanqnpdnaiur fola p:opter malictf 
aineittsmagriam. 
t f ^tidcmaucroUsabfc.Sfarcocolla acuta 
multumpcrforartua.cpmcditcarneevlccrum: 
■? babet incura obt aimie pu>,p:ietatcm magna 
zvirtutemmagn.im:ct virrutcra potentcm :ec 
iaufcrr lippirudinem ocutoum : quando babec 
obtalmiam.quodquidem non facititaaliqua 
medicina.r marime quando mifcenir cii amtf 
loetjuccaroalbo. 

f£tpdtioeaiead4atandumventte^:£Jabec 
pzopuetatcmiuiiandidculum et ventrcm .t,p* 
p:iead purgandum ftcginagrofliimquodcft 
aggregatum iriiuncrorieaintcfiinie-rin fcia 
ctingcniaili0.e|cpellitiplum ajm fo:rirodinc. 
etcum aliquantulo colo:e:z iuuat medicinae 
aUaeadetcundumecco:po:c. £rfo:tafle vub 
ncrabitoculum ad inteftma. et etowiabit ea.t 
tnducittcnafmonemp:optcrfuamacuiratcm. 
f £t (i ipfacawr in powaUcui(oia ? aut am 



aliquamcAtfna/ifiicffftllccfaffecemplekfrt 
Sacit ri caluiriunuf arit ca dere eapilloe omef 
©ccapifcfuo.fctfifiicritiuueniofifiubofino^ 
ra.£tfimeritfencc:fac!tilUidciti'>.£tme!io: 
cjcillacftquctcrirurfjalitcr.ciuceftalbidio:-! 
inmaid:ibuefruftie.£tqtj fitcumolco tienn 
cibttetfjut» oleum nucie frangit acuirate ciue. 
€t p:opfer boc rton babct ipfa facerc id qt5 t>ijri 
muBinco:rofionc:p:oprerea qiuadlcum p:o? 
M>er cam adberere. i caiidirae nucie frangit 
plurimum acuitatis que cit in ca . 
f S> cd fip:cparae eairi cu olco amigdalar u? $ 
ponc fceco fcuplu ant triplu pddcrie t ipo oleo 
fi vie ipfjtm poricrc in aliqbuc ptllwlie ,£3»ed fi 
vobierieipfain adbibcrcfolamfine aEtqua cot 
mict ionc a lt eriue mcdirinc:pone plue pondje 
rc riue t>e olco . i pone t e elco ce kcma quaii* 
mc quapoffittiffoUit folu:tpoftca mifcccii 
alrje mcdtcinie:i: cu olco t>c kcraa crit fcnibua 
coumicntio:. 3uuenibueautenou cft conuc; 
nicne cum co:quia calo: naturc iuucntutieno 
fertcalo:cmolrit>ekcruai 
f Qx quatitae ©one ciue fimpiicie pofto}; p:e f> 
paraf ficuttirimuecftpddue smrcivmVvfcp 
ad pondue.*.iq ,i quartl . £ t mdioice mcdicie 
que cducrtiut tn admiaioric eiue funt fcrapimi 
1 mirabolani: i turbit i aloe •: armomacum z 
bdeUiumiudaicum: i fcmen api} i amcoe: i\V/ 
milia bo?um ermedKinie. 
f -fSauuie capirulo ©e ©arcocolla :S»arcd i "Xi 
colla calida eft i (icca in rerrio gradu. £mpla 
ftramfactue]cea^albuinineoirifupcrrimpo:a 
valct ad rlutum fanguinie a naribue. 
f "fSuluie ciue eu aqua rofs? pftnai i folecpc 3 
cctur«ife^cuaquarofa¥poiianoailo.quia 
maculaconfumtt ■: oculu clartficarXont ra tc 
nafmonem fumuociue pcrmfcrioia raeptue 
cmboro impofir a valcr. 

f Bulcafim ub:o c\ b: S> ertiifo: tranflato a f^ 
(inoncte ^anua^o^ma nutriendifarcocolla 
wlacfc.&ccipetefareocolla bonaalba grof> 
fa:z pone i vafe vitreo ampliorie o:ifici? 1 mul 
ge fu£ caj lac aftne in qnritate pauca nc infuti 
datur inco 1 ttqucfiat:fcd remaiicatXic 1 pdne 
fubtf i foU vt cito ©cficccf.-z qn erit ftcca ppo? 
tet vt irc^mulgae f m qnritatc qul x>iiivz fcrn^ 
pcrcaueae necocpiriaecamlacrc:ne accfcat 
lac ant eq? tcficccf •: t>cfiruaf . ■: fac ira quarer 
vciquinquice.-zcubocfccaie^ficca tene-ic^ 
fcrtia.'tfin6babcelacafincparatum:faccum ■:[ 
la ctc multerie:quia cft mriiue, 
fBuiccn.SarcocoIlaeftafbo:isfpiriofcguv X 
ina iriqua eit amarirudo:': bona cftltlla quead 
cin-iniratcmtccltnatftmiligoitbanoi 
•f ^{ ticuf qutda 0/ eit calida in fcaindo:ficea 52b 



Wtmmm 



m 



a 



1 rtprimo.£ft mte gu$r&Mtfoa:iideo confottf 
darercamemcrcar.IiaUteriamad auretnfaf 
niofamXonfiatobtalnnc^ipMclijpitudtnit 
flumii ociili.p:opjiccum lacie afinc. 
f lblareariu8.SjarcocoUa cftMccnndo gra 
du calida ?ficca.£t eftguma cutufdam arbo* 
riscjcpartibitsttanfmarfois.^uius gencris 
aliacftpunteremredscta:quefacfle ejc aucri? 
uspulueris admiittione etiam fopbulicarur. 
Slia vero groffa r€peritur.t>iuftruatur ct gui 
rinofiratequantbabet»3ncft ei virtne cortf 
ftringendi % confolidandi.j£ligeda eft iUa que 
atba eft:aur fubalbtda:aut gumofa.quc in ma 
ioii qtianritatcrcperfoirVRcduaa inpuuierc. 
rionvaUt. 




" sr V,1i)atuiafertda.^crbaeftfimi* 

ittUsyrcoQ, 



f^attluacapttuloDcfparulaferida^uccue 
ctuocradtcatmozfcamalbamfifiatvngucnrii 
ccpulucrcau8tpuluercftapbifagrU.ftamuU 
% bcrmodactilt^iocattrameto cebuflo in olta 
fudt cu accto 2 a tftrsfliapozcina vctufta.et in* 
ungaturtcrinwctcoopcriaturcufoliocaiiJ 
hectplantagtnis. 




CapituSunujar. 

>£beftcn.*£andecra capitulo' £>ct;c3 
, tcf imotriccfimo feprimo.Sebcftcn laf 
tinc.£5rcec'jgbacbalomagiata . Sra» 
bicefaulis fcbcftcn.Et in lingua f>crfica voca 
turmammillacanis.xsndeiScbcften mam* 
mata canisfcrt •fkrfica liugua. f Scrapfoit 
lib:o aggKgatoris capitulo ^auUeJSjebefteV 
Sboaufcmocbiatafuntnominaiftiuearbo^ 
rie frucrificantcc frucrue t>nUce:nominar eoa 
gcnree faufts fcbcftcn . f £i idem auero:ira« 
yfaac.fenerammocbiara eft rotbin Srabia. 
et cft arbnl iu m altum fupcr tcrram ficut bafta 
babene cotticem ciiue colo: vcrgit ad viridira 
tem^tbabctfolia magna rorunda^rbaberra 
ccmo8:quo:um fapo:eft tulac:ct vua ciuee 
tnagnirudinie nuciatle quc poftea glaucefcir. 
cummarur3rur.£rb2bet(nferiu8vifcofirare 
albanur granum qnodcftficut granum ol# 
«c.tMcfructus coUigirurcr cpficcatnr roncc 
paifue ftt.t cftfllud quo vnmur tn medtcina ,x 
eftmcdicamcnmediumin complejtione fua in 
calido ct frigido. 

j&prrationra. 



f yfaac awto:#b{fup:a.Scbettenlaieat ve# 
trem fcbticitantium .confcrt tufltque eft a calt^ 
ditatcctficatatc.2lciiitpectu8,«fcdatcatarf 
ru$ calidu ftipticum pwptcr ciue bumiditate'. 
C£tconfcrtardoM'viincqucfitpzoptcrmo^ 
dicationcm colcrc iti vefica % in rcntbue,? etpcl 
lit vcrmes intcftino:um:quu adbercnt ci p:o* 
ptcrvulccduicmfuauii 



f awYcnna.ufl &cap.fotnbcl. fcanbel catfdu 
cft in tcrtio gradu.£r eft fcinearcnofum qtiod 
cooperit rubcdo que.e mino: rttbcdini iapidio 
tnfdlebouie rcpertU inipfo cft fttpricitae vc 
bcmcnsantcrficit v<jme6 ct afcaridc85Cteipel* 
iitcoe* 




fapitulum.tftt^ut. 

>.£menlumb:ico:u latine.6rcec31ba* 
^fan.&rabice Uanbel.©crapiott li.ag 
ca/fcanbcl.fd eft femcn iumbiicoai 3f 
nmilattircniarenc.ctafcedittitpcripfumglau 
ccdo.zeflinfubftantia das fltpnctrae fome. 
ctecpeUuafcaridee. 

0perattont0 

f Sera.auc.aunafo:ie/Kanbel vcl kanabci 
id elt feme lubrieoui.eft calidc cdplcjcionie ? ep 
pellitafcaridceTcaditfupterra alba.t nokt 
jninaf.£teftvna©erefcoquecaditt>ecelo. 
f£t idcm auc.aiuifmcn.*Kanbclcft ree in q 
clt glauccdo.foU'danrur cum ca ollc qn frangu 
tur.t ©icitur cv repcritur fup. tcrram in cowfce* 
ni poftcp pluir:et coUigitur tunr . 
f £t quando bibir ccpcllit lumb:icos ct afcal 
ridc8.etlaeat ventrem. 



BCapttuIum*ffff0ui!* 
£ncarabiccgrcce? lartne.£» erspiort 
lib:oaggre.capir.fcnc.2>ene quaec» 
acfiecatur reponitur . £t ipfum babct 
vagftMeoblongaeinquibuemntfemuiac:* 
dinate tiftincta.-z tlle ragine babcnt pedicuui 
fubrilem.que adbercnt ramuliert quando agt 
tantur vaginc a vento cadunt xt paftoKe coU 
uguntcae. 

©Pfranones 

f Scrapion auct.^bt)c.tlirme ciae eft ca! 
lidaetitccastamenpaucccalidirarieetficcitat^ 
«iuo cft pzope caUditatem ipfiue:? babet virf 
tutcmmagnajquando perucmtad fiomscbii 
pttrgandimelancoliajtcolcram. £tfo«ificat 
fubftanriam cozdiequandoimTcenturcuni co 
medicincquaettjciiuuisrcficurviolaictpono 
«ccoctionieplueeonfert cpir/fum wmm*&% 
tofiefjiccitwieiu8ea.5.uttntccomont5;r^ 
£ m 



H 



Wmmm 



€> 



T) 



tarrcpiir8antbumo:c8aduftpe.?confdtfcft 
bienpumfui. 

f 3oban.'i£>efuc.® cnc eftfolliculue plantc 
qtu vocat f>erie atjemer. £t imtcnif cp co t>o 
tnelticuiu i utudtre.£r mehb:pare plantc cft 
folUculu9jdeindefoto.£tmctio:folliculu«dt 
cuiue colo: t>eclinat ad viriditate t fubnigredi 
tiem quanda. -rinquocft t>e amarifudinc rea 
modica i fiipticitate:? qiiicft magie c omplet? 
^inquofuntfeminaampla-zcomprcffa.Siub 
atbidue aut no cft bonue z incdplctue. <©?imi 
liter i folia funt metio:a viridia.fubalbid3 vcro 
■i reniuAfuntbona, % anriquu ct co ett fine fpif 
ritu Jiftipitcsciuefuntinunleo. £ftcatida in 
p:incf pio fccudi: ficca in pamo. i fotia-funt iti 
primo calida. £t cft abfteitf uu: mundificatiuii 
conuenienterx rcfbtatiuu.&tbiltecff? tardc 
folutionie.-z^ebititatftomacbum. 
f £onfo:raf aimrcbue acmieficut jinjibcr? 
fal gcmma: i mcdtcinc co:dialee % ftomaticc 
cum co fcticitant opus ciue; 
^[£t |3afccnue. ilumiurcgallouiaut carniu 
foluitlincmoleftiaufiinfundafinaqua cafci 
c^fpica:t>rindccoquafparom:eftmedieamen . 
bonum. Solutione educit cm cu facilitarc me 
lancoliam % colcramadufta.-r mundtficat cerc 
bmmco^icpartfptcncm^membwfcnfuum: 
«pulmoncm.uonfcrtegritudimbaeeomm.t 
aperi-opilarioneevifceru.xconferuat vrente 
ipfo iniuucnrurc:? generat gaudwm.jCaufam 
amcmtrifticicamputaf. 
4| tr pominf folia eiue in tauacriead capuf : z 
p:op:ia cu c,miomilla,£onfo:tat cercbuimt 
neruoc.tf m omuem modtradminiftrat iouie 
eiue addit ii\ vifurn:: cd:robo:at auditum. 
f £reft mecHcinabonafebrfum mclanccuam 
ct auiquarum. £> ofie eiue infufi potio eft ab 
Mrcis<rii.vfcj$ad.3.i. 

^-^larcariue.Scrtccftbcrbacalidatficcaci 
fn tranfmarinisparttbuenafcif : mapme circa 
bflbilonianu in Srabia,vd in confinio bfibt v / 
k>nic jatabie.^olia tantnmmodo compctunt 
vfuimedicinc:perannost>cccmfcruatur. , i 
$ jrrvirtutem babefoiffotucndi attrabendt et 
purgadi ficgma principanfcr metaricolia.Sjs 
£uVpcTfct>afurpa'ncipaiiterint>ecoctioncp0 
;m^cbainqu5tifatevniue:5.£umautcualQ8 
in quantif atemcdic vel tcrriepartie. 
/«ffiJarura metancolicae pafiionee:epflcntiam 
quartanam:cmo:roida8, eomravitium fple* 
nie-z ep4u'e tfineopim:cpiknttam, 
f Bdidcm quoqj valet fYrupueqcfuccofcni? 
culiacfeiic dim juccaro* imajuneconrra vi> 
ju»mfflcnie. 




€apifuIum»ffft]EjEuu7i 

B^rjediil.iyfi.ti.etI?imor.©encciori 
tf:eo cy verc primdfcnefear.vndcet 
cam latini fcncaonem vocanf ,J3re* 
ci oaganon. flafcif ur g maecriae. 

iE>prrationr0 

f Cva.3enccion naicif intcctt i »« Petr^ bj 
folia viridia ttwfa:tvrTum fcibruruin. i in «9 
fumitate capttella (n modu viticeUcvirce bab j 
Crinscree:cadeq5facicnrce quct ptantagc. 
4 £u accto carbaplafmara vaict ao nenio? in 
cifionce-.cuvino autc ttulci tcfi icu lo^ inflf.m a^ 
tioncmtollit.^olia crn ciuefrigida funf. • 
f^tbttbano.ScncciarofacuarungtasuH 
poftta vulncra f anat cria recentia. ©tomacbi 
^•zpcdumiumbo^': tocarumatcpnerueutm 
tsoto:emt ollif . ad podogramcriam tufa^ tm^ 
pofita equcpcdibue p:ofkit. 
f 3cfo:. S»cnccio t>iciturct carduue bcncf 
diCfue;ficutinf"Ynonomiefegiiur3liudcftfc 
na cto : vidclicet B ai turrium aquaacum. ccq* 
fupcriue t>icmmclt velrl; 
€^>3cer.|£>:igeon0reci:noefcnccf0vocir9f 
mtis. quod fimilie canie vidcatur fio:erapil^ 
Ue.Balaf iamune:in o:rie i ic0Ularie.3lliu8 
t>crbcvis frigida vidtur eftc.jiun)cdicinattf 






Btlwbfa 



tac!tp'nonpomt ! v6j»j : lo»0!c5foli|6 tundens 
in fundito rtnt .-jScr modicum ©ulcis: ct ftc tt r t 
pcf acta tumo «.tJecumul ajponae ani vcl ttf 
ftkulomnnu 




d 

r 



tmtulumsmfflt. 



> £rpftlu. jrfiS.SterpiUue waf co Cf ra 
^diccs rius tonge fcrpant.£adem t ma 
trie animolfl stcif eo o/ mcnftniamo 
tKaf.^alladiuoluiij.i^cnfemarttofcrpillu 
plflnrieaUquodfemtoefcrtainfedvetuftamc* 
Uoz.Uriuerrotidcbinfed iutw pifeinavcl lacu 
m'vdputciraarginc8Confcraf.l!>U.li.)cjc.©fcr* 
pillu a fcrpendo putat©ictit:qd infilucftricu^ 
wnmajctme in pctrie.£?ariuii no ferpit: fcd. scJ 
palmi^ltitudincincrcfat,pingui9voIuntariu 
tocandidio«to,folU62ramiedficajccftadt!crt 
fue ferpentea inarimefcolopciidrae terrcftrce 
or <p marinae^dc-^i. ca,oefcrpillo.^crpil 
lum idem eft qo" berpiUu,0nc& fumif>poligo 
niwt in 3 lcpandro t>c soloze capirie ejccatttf 
fa calida,£t tneif ferpillu q: fuper t erri fefpir. 
£t eft aliud fitueftreiaUud Domefiicum. Vo'/ 
mcfticu ramoeoirTundit fuBtcrra,iptlueftrc 
Jnlongumcrcfcit z aUu, ibandeaa captVotjcitt. 
"Rumir arabicevelmeftratir mifcri.grecc fcv r / 
piUum Tdberpfllum,larine fcrapultu. S crM 
Pioa lib# aggrcgatoziecapi/Fiutnir.aucteri. 



pYafca*£ftwcotomentcuetfilucflre.fed 
©pmeftica eft planta uiclinata fuperfactetcr'^ 
reliaccne. et quod •oeea tangit terram: infigit 
interraradice8.etbabttfoliazramo8 fimilia 
foUm ramie origani: mfiquia funt atbiotee: 
i in odozc fuo cftatfquantulum ejCodozemaip 
rane^tvtunturea multamcibie.snominanc 
cammuWarcla8tarclancm.©edfilueuTecjc 
co nominaf ragfs # nonindinatur fiait aiiud 
fupza rerram t'no:ra fuo.tmmo ftat erecrom cc 
babct ramoefubrflee Ugnofoejadco c^pbflu 7 / 
mnefacereejtrieltdhiaadlume acccndend^; 
sramnufunt iongiarcapaunnmplemiricltis , 
rutefimttibue.nifi quiafmitftricrioza tlongio 
mourioza foltJerute.tflo:ee acuri fapozisz 
oa>U8oonipcfltnfmlaeramo8X>if!incto8 r : 
Xuiue colo: cft in fummitate ciue purpurcuei 
£t babet radicee \n qtiibue no eft iuuamentui 
•flafciturin rupibu8^inloa'elaptdofie.7 eft 
foztiue a calidiue t»o mcltico: ct admifcctur tn 
mcchcini8.etcft alia fpedce agreftie vet ftluci 
Ifetsi-z eft fifnabarion/fiafeirur ih lociq babi^ 
tabflibuet oomefticie.etcft fimilte itume:nifi 
cjuiafuntafolialatiowcpmctetuidiozcoclo 
rcm babcnria.£t idemauctozitare j6fllieni« 
iStobftanria riue dl fubrilie quccaUfacit a 
fceficcarinrefriogradu. ! 

Bptwmte 

f DYafcozideeca, ©e 3 crpfllo: fiue vt iariui 
tiicuntciccrerrartcu.t^erba cftbumins-rfug 
terram rcpena cu folqe ar 03 ramie ozigano ftf 
miUbue:att>idtozibu8tamcn:famfuciodozem 
hngcntibue.£t riue fpccicefunt vuctlna oi9 
tualie fiue vfuaUe:que icampie lapicoite crc? 
fcit.Slia agrcflie:quenon per ^rerra ferpi&fcd 
recta qf ce ftipinepofirionc erigiturcu ramu> 
liefcnwbueatcpbozrctibtieinlongifudiVeb^ 
p^lmit^u folije paruie rutefimilito:fed angti 
Iriozibue 1 longiozib. cui5> bafta f tmilie cft far 
mcnt o.5Io2c m odoze fuauebabene in omnito. 
virgie conAitutflttinlummitate purpurca ct 
Imgna rcmozdcntc: ctguftuvifcidum.^Rackp 
riueiniwlifdr.nafcifmtoci8fa(iofte.£ftaut 
vcbemcntio: et calidibzeaquedlvfualie.que 
idco uapit nomcn berpillu: qt5 grcci betpete 
rcperc picunnquia flmbutar.Bam frucmp bu 
tiie pUirimumambulatrructiftcando. . > >= 
C3utcen.U.u.ca,mrfcatramclir.^>dcatrajf 
mcfir ffuc mefcaffa fir dtxuiue t tipttce furirfi> 
miieeafceb^abzamficco.£)tquonoaffunitif 
inpzincipio cibi (npoi plurtm9.neci? odoz.p0 
inide fuccedtmt a maritudo 1 s cu i rae.ct eft pi> 
ii(ufarumfpecieru,?vnadtt>cbiUoz:alia eilcjji 
idactiiccapjouaucnsadjertium.. ^ 



Craftatua 






menftrua quandofumitur \n potu:: vzinl £f. 
^onfmtoznombuaventrisrattririomtomui 
culozu -zfummftarum cozu.et apoftcmatibus 
«patis catidis.tidtbonum contra nocnmctat 
venenozuVquando bibitur. £t ntemplaftrum 
cumcofupa-mozfum. 

P (jf £tqncoquif cuaceto:radmifccfrioleuro* 
fa^t.pqcif fup. caput fcdatfodfoeft pucniea 
^tpucUtargte et carabito» £t qn fumif in potti 
cceo cum accto.?.iiq.rcdat yomiiu fangumie. 

£ f£t ide aocto.)5aU.©cmeneiu8 eftjpititcr 
calefactiutletidco qaida cpbibcnt ilkid in po* 
robabenttbusfYncopinu tationeoinvirio. ", 

f %£x ide aucto.DYaf.^abetvirtutecalcfacfi 
ua qn femcn cius bibif cuvino;? pfert T*ilt iita'/ 
tioni viinc ilapidi:et toztiontb? vftrifl i? finco ? 
pi.j£t fir emptaftro cato ad punctura apum. X 
quando fumif inpotu fcdat vomitum. 

« f £t idcm auao .3ben mefuav. Sperit opila 
fionc8v0rum;etbabetvirtutcmconfoaandii 
muUuminpunctura. ','.•> 

rf5 f Dvafco.Uirtutcbabet pftricriua uucrcdar 
gucntcm.mcnftrui8impcrat:vzina5 pzouocat 
Iribitum tozriones t conquaffario nce vnliter 
curaf:tumozcmcapiti8Compcfdr.*iJbozfibu8 
vcnmiris occurrtr .bibinun a impofttu id pze* 
;ftar.Dolo2em eapitis cu acab co ctb:oIco rof 
iarum addtrocompefcit.ma^imcUtargiciset 
frcneftasadbibitus pzoddt^aufeam pzouo 
caf.3rcmc»nptoici8medcri , picitur.3.iit}.cuin 
acet;>T>ari8. 

3 f Q jUe.vi.!tm/ar. a.tc ©erpillo: nominat 
fpfum mulufufubar. S> apoz ct'9 eftfozutcr acii 
tii8.ct virrus eiusclt calida fubr fttariua i refo? 
tutiua.£t pzouocat vzinam -z mcnftrua. 

*& f auiccnna.Onpafcutcii pccudc6faatcmul^ 
gerefangamem:acraifaraeatamcnto.immo 
foztfuscft copturimum.tcietrabit bumidira* 
fcs vifcofas a peabzcet pulmone.g>rrupu8 
ciueconfcrr conturbationt nwufce.pzouoeaj 
menltruafozriterefvzinam. 

^ C£tatcarw8.©erpittucltca.etfia£fcftt>u 
ptecDomefticuramoefnp rcrra effundif.S5il 
uaticu ih longu aefcit etirt attu.^oUa ?rlozc8 
rius mcdicinc compctunt .valct contra frigidu 
rcuin.womra tulfim. contra frigidi ra tcftoma 
cbi et t>olozem cc vcntofitate. 
^S ^£cbcrbario. ©erpittuqoin morifo (^oCio 

- n3fafctRcaciu8cftadmcdtcina.3&uiu8funfi . 
. . tficcatipulwscuaquacaUdapotatfmcitrua, " 
jmoueKvzinampzouocataoztionesvifcerum t '■ 
i ozmeuio?. niptioncs fanat.3dcm valct ad ca 
pittBOotozcmictadferpenriumicrus. 

O %y&ctt&efpmv<xac8i>i)nw$q(i(crt 



patXcrre vicinuteibutc feruida Bccaq? vtecf? 
2tcricu vihofritu contundiaotiuo.jCui rofa 
cUtnomen.-bocTnguincpcrUnc frontc^o 
ricapiti8fotetbocfcdare«)6l8«m. ttidoico; 




Sjf rapinu larineet grece. i» acbabcng 
arabice. f SerapionUbzo aggre.ca. 
^acbabenejfiueSjacbabcngi auc. 
D Yafcozidte.^ft gummi cuiufda plant e:ffmt 
lt8 galbano in figura fua.£t eft vna ecfperie* 
bu8fatiJe^cutapparetincapi.5atita.*iS>eU^ 
autcmcceo eftclarum: crtcriue rubcum t ihtt 
riue atbum.D do: cius cft intcr odozcm afcfe? 
ridc:etodozemgalbani. 

^pfrationt0 

f S»crapfon auctozitafeDr9fc.£onfcrtt>o* 
[ozipccfo^6:efafrririonilaccrfo?.ctfi:fiianri 
qucetaufcrt fuperfluitafesgroflas quefuntt 
pulmonc. et curat epilcnticos z fpafmu: citfa^ 
citvcclinare caputad poltertoza.etvfllctM 
lozifplauoetparaUfi. 

C£t.ilU^;amifitfcnfuj?iiiotuaUajiu8 mcbif 
caufa frfgidirafie: que acctdtt ncruis t caftot 
dit cozp? afrigozcma^imc $o a frigozcfebztu* 



BtfyttW. 



paiodiea?. t fit cm eo inunrio m&oloHbus 
magnie et confcrt. £t quado btbifcu jdromel 
lcpwioc4tmenffrua.*inrci€rirfcium. 
f £t qn bibif cu vino pfcrt mo:fifc> vcncnatw 
7qfiodo:afeoufcrtfu|focattouimatricie. . 
f £t qn im ;fs»l acct o fug cicamcca attcnuat 
ca s.ct ipwm abncrgit vdtigia vlcetfi ooilo?» 
*(f kx confcrt obfcuritati vifue t aque q fccfccO 
dit ad oculum^t pzobibct cam. 
f j£f ciiToluif ficuttuTolHif aq cu amfedaus 
a marie vt ruta : au t panc calido. t fic admintf 
ttraf ad ea q pinntf.-? e priu vcucnie mo:riferf, 
f £t aliqua ndo t erifur cum accto:et limf fug 
o:dcolum:?aufcrt ipfum. 
f £ t pfcrt colcricc.-r qii fumif in potu: aut fit 
cum co crift ere: purgat rlcgma grofiujqb e in 
iucturie.? motlit vcnrre molltficaiipe ppererf» 
f £t pfert emo:roidjito qn fumlf fiinpleir ant 
copofitu. .t cft puentce mcdicinie lajcarinie acu 
lis.-zcjcpcUitvaofitafcogrofiae.iciiToUJif la 
pide".t cofcrt rigo:ibuefibu'u. i augcr fpcrma. 
^iJzteit bonu cpati.ct pwgar aqua citrim. et 
pfmpaciuriofcozpionis.': pfcrt vcmcfitanto 
inteftino? scofia?. ? pitrgat flegma vifcofum 
1 ©ofie eute fimpliciecft,a.j.i.vfq5 ad aHrefi .!. 
infufialiqua t>eeoctione:aut in aqua rure;aut 
aque mellie, aut fenugrect. £r fi admifcef cum 
alqo medicinis infrigidaf . 2 fic fcofie ciue eft a 
.5.?. rfq5ad.5.i.£tmcliuecfti!tud cuiuscolo* 
fccclinat ad rubcdinem. 1 eft claru babtte odo9 
rcm boruyn z acurum fapo:em. 
f[£t cofert aeloato cmo:roida? qii bibif ftm 
ple,c autcompofitu.cft pucmeneadminiftrari 
cu mcdictnie lajcaffuie/r fbibcr tJirTiculr at an 
flitr graucdine cayfitenarura.-z rcfoluit vento 
fitatcegrofTaequegcneranfinco:po:e. 
< j5af.viq .fim.far* caxie ferapino. ©erapinil 
opoe eft ca .1 fubriliu partiii fimtlirer altje opif 
Ifcabet aut?cid abfterfiuu 4*cicatricee qin 
oculieeitpurgat % fubtiUflt,cjntmmo(urTuuo« 
nft)uefl5rcr8rofiicic3bumo¥ ficnritobonucft 
farmacu. 3 pfa #0 pla nr a cjc qua fiit fcrulc fimf 
liec^iftcnetcbtlte^inHriliecft.Bpminataut 
p:incipaliue illa fcra pinum» 
.fDpoeeinci9abvtefib?noiaf»faficut^alia 
mtta ^rbefectu vocabulinoiam9abufiuc:mc 
U9 crii tpm no ferapinu:f5opoeferapinit)iccre 
% -^aulueca.ticfcrapino. Olidaflttficca 1 
ttrrio grsidu.£t ipfum •oinolunim in fucco ru, 
tefrangitlapidcm.tfacitviinarc.^tfttcblU^ 
riitm conrra panuum ocukmim. 
f^rpfcrtobfatruatevifue-zaquctcfcfdcti 
ad oculu.cui9rcaprio cft bec.*Rectpcfcrapini 
.5,toifibluafin.5.i.fucci.ctlidome5uccflri.34* 
acilijilefajmiactemulicnsanacqualitcr, „ 




Capitti|tni.fffi|«Ei. ! 

>£fama vd fcfaiiioV*i>!jiniueJ^efam« 
^ venttrabtfndiea^ quaoleij faciut.-zcfl 
candidi co tou'e. £ft aut cp d!iuie fru? 
gibusqindratcanrcvtrgula?eico:tuferunf 
^uf^frucmevafc^ififtcurctpapauen^fn^ 
clndn/.i?ccqUide fic miUum % panicu x omriiai 
cftiua maruranf a flo:e&iebu8.jcl. 

? 0perarionf0 

f TJSltntue. ^cfamam vt pinfaf inca.aqua 
maccrataconuenit cj£o:rigi.i>«ridec6fricari 
et frtgtdc immcrgt vtpalce fluiter. itcrumqj in 
folc fupcrltHrbcacjcpoJrigi. iDonift fcfttnaro 
pcrragarur:iiuido coIo:cmutefcit Op^ vero ql 
atoluunfatiamaluanf^ariababentpiftara^ 
Tationcm. aate vocaf cu pcr fe pinfatur iopi 
cacin advfueaurificum^i vcroinacra fcrif 
cumfttpula:palca nwiwc partcrcrrarumpa^ 
buloiumenrouim. 

f3dcinltb:o.jc]cri.^cfematritainbibctvo^ 
uuiionee. ^uriumo3 tnrlamflriom tllinif zmf 
" buf iie.£ ffcJctu x t>il in bet ba cft eflicir.ampli^ 
neinvinotiecocratmpontfoculie.ltomacbo: 
autecftinuriliecibue.-z aminograutratem f« 
cit. ^fcUionum mo:fibuet'cfi(iir.vlccnbufoj 
quecococfbcvqcanu. .,. 



€rattatit0 



$r W^r aurfb? pjo^ctt atcu^noa epfllaftt. &^ 
famoidcsflfimflitudincnamcacccpit.srano 
amaro?mmo:efoUo.nafatmgUriofi8.;8ile 
inaqua pot urn fcetrabir. 

3b f £t rius fcme tllutitur ignt facro pannoq* t>tf 

w amt, £ttettanuncau'ud fdamoideevidclicet 
antYarenafcen8.q3obbocaUqttivocatantY* 
ciricon.Cetero fimilccrigeronti bcrbc. 

c f £5rahum fcfametn viito Dulct adfetracrio 
ites saturquanf u trtbue ©tgitts capitur , iSbi 
«fcentetiadlcbori albivinum.?t>imidiu obulu 
purgarioni eam adbrbcf es majtimc infane me 
lancoUe. comfaalibusquocjn podagriectil 
pafe^gmeporidcrecjcwauif. 




€apitulmti.ttffjE)EjEit. 

B£ride. •jMiniue itb\]cr. S» m'n lacture 
fimiUa.t>uo:u gaierum eft. S3> ilucftrfe 
mdio: eft nigra tfta z eftitw. pcterio: 
bybcrriM candidio: eft, 

®pmt\ome 

f OtracB ftomaebo vr ttifluna. picctpue qnem 
feumo: verat .1 cu aceto irt cibottrrigaant.vel 
lllite ©iTaifiutirq?-? attoBcpftomacbi. 
f /Cumpolenta (iTueftriumradiceo ftomaebf 
caufa fo:benmr tcardiadefug firiiftra niam* 
mamjlliniunr'. ecaceto podagris? fanguincra 
rcijacnribus vtiles funt omncobec* 
f 3tecpcibgenirorartutt altcrnotMC^potu. 
f Dvaf.Srertdtst)uefurtt fpeciee.Qna vidd$ 
$grdtie.?alia omuaeft.Hgreftisqtttde pm? 
S»iet citononcft ajpcllata.z babet folta lata. 
2Urera vero^omua ipcaes babcttmae. Una 
quidem babct latafolia lactuce ftmiUa>2lUcra 



vcrocftatwavrbabrt folksngtu*fg.Om»iS 
virtU8cft fttptica? cuftomacba, 
f Ocntremabftinetcu acctocoaa macimccB 
agreftie.vecatu ftomacbo purmat, % dtuario 
ncs mirtgat.ibla cu polcta ipofita blidtf . coi* 
diactesoculo? rumoafitouenir.foUa impcftf 
ta vt cathaptafma mitigant fcozpij percufium 
f 3pfa quoqj addira polentfe? impofita com 
pcfcitignemfacrum.^tttacuaceroacccri» 
faomnvbU8caUdi8rcbueopitulatur« 




(Capitutum.ffffjjrfiU. 

SlMta/fiandc.ca. cdrjtv.5 t;ra arflbi* 
cevcl ruU vd batc vclbalca.£recc bcn 
gcvelfragtj8vet?davdelIica.Xaftnc 
vcroK>dta*Sr<r2.lib.aggre.ca.fiiU.tdcftfpcl 
ta.z ipfa dl ffctit o:dd granu. £r funrduc x>\ie 
fpedce.invnainueniunf t>uo grana.er inalia 
vntim. z quodlibet granum in co^t cc fuo. £t 
ipfum quidcm minus nwrir qwdett.-z cft bo* 
m'fapo:ie:£anio citt quier eo ftt minue nunif 
cppanietrifiavdoJdd. 

Spfrationf0/ 

fl@cra.aucr.tYafco.2>ague.t.fpdra.ftgu* 
ra cius eft ftgura gra ni.qui t>: ca nriarisfum. tt 
cft mfoo:ie nurrimeri.q: itmUu b5 t>t furfurc. % 
nodtfaciUecigciUome.tmoUttvajtiiitt» • 



Bt gjrcbts 



t> f £t idc auctoritat c *£auli.Cragu6 cff fpelta 
. eceftcjcfpeciebusgranoriimala ftomacbo.ec 

£ lcnit venrran.ttf £t idem aucto.3faac.£ft fri* 
gida i bumida vifcofa.6alic.primo lib.fceedu 
lijo capftulo jeva. aucfo:irarc Dvafcori . Zcva 
D»plep.£)ec quidcm cft (tmpler:? vocarur fcv: 
m9U.becaure"t>vtouto6vocsfur.iBt>uobu8 
quidemin volucnsiconiugatubabcnsfcmcn 
tntnue aute niuritma frumentis* i £ftcm,pfun» 
daru radicum-z multoiucalamoaim.ft-uctus 
aut leutmmu8 taffcctatus ab omnibus anima 
libue.^i t aut fimiie framcntia in frigidis regi 
onibusculrum. ^rattrcmagionutririua ficu 
oideo aptaqjftomacbo farina factact e# et 
frumento fiunt pulrcs. £ft aute kti& nurritiuii 
ctfacileclabo:abilc.magi8autcmfubcuatiuii 
ventrte. 

J5 f£tidanfcjcro(tmpliaumfarmaco:ucapittt 
lo jcva. jevafiuc fpelta mediaj quodammodo 
Virfutem babct iuter frumcnta eco:dea. £c io 
innorefcacribiperea. 

£ ^[©erapion.^ollitnaturamccgcnerattn/ 
fiarioncs ctrugiru6.?eft bonavifcofitatibue 
pulinonis « pectorioxt fo:ri rufli. 13am fiunr 
ep ea loboc z pulr c8,ctp:ouocat v:inam« mi 
diftcatreneesvcficain. 




Captmlum.tfff]EiEjEiH). 



> pmpbfcum. t^afco. ©vmpfoot na* 
,fc4turinloci9 afpcriababens virgaa 
origano fiimles ac renuesxapira vero 
ficutrbimum^irgclignofcfunt-zodc^rcsgU!» 
ftuept>ulces:tlegma p:ouocante6.*Radi]t eft 
tltt loga 2 obaifa in modu t>igui grofla.SJ ym 
pato8.3(ido:u8 JSvmpat os grecc oictus eft 
co o/tantamradictsvirtutembabcanvt fru? 
fta carmsincacabo afpeifacoagulct.©Yna 
piagrionvelvtoiamtlarini fcandalicB.upes 
pulli.nafcitur in tumulis % liiper tcgulae^bcr 
bacftbabensfoliaminutatangufta tmobus 
sigiris longa:infummo triuifa x pinguia.Qir 
gam p:Ofert inmedio tmowm pa!mo:um cit 
paurto ramulis: in qutbus fcrrfemccardamo 
fimile.latum»b»fttndumacveluti conquaf? 
(arum.vndcet voeatur talafptuni. j$rea'nlcg 
tbalaflc ticunt frangercfiue quaflarc.5lo:em 
babct album.OirtU8 cft m femini rermaritica 
atqjacra. 

fepaattonra. 

^D vafco/fsotui t>atum vcbementcr purga '* 
tionemfaatfuperio?acinfcrio:um. £>ciattf 
ctsmcdefurpcrcliftereadbibitu.^cnftruis 
impcrat btbimm , jCollecriones in aceto bib i> 
tum rumpir.3bo:fum facit. 
f 3dem.©vmpbicii elijrij in mutfajptilmone 
purgar.rciicichtcmcp fanguine:aur ncfrericos, 
cumaqua medicinaliter iuuat /R adit cius cii 
aquacoctactbibitafiuicummulicrisabftrin? 
git. Piflintcria'8 quoq5p:oficir. 
fjCumojcimelleoata coquaflatiocs atqjfco? 
lo:ce lateris falubcrrimc curat . 'z£)afticara 
vcro firitn amputar:? afp«dine fauciu mirigac 
tlulnen recetui paracolefimfacic. £nteroccli 
acoe bibira t catbaplafmata opt imc curat : ec 
carncs concoqni faar. 
f Sliud cft fvmpbicii qtf pitcn cft appcUatum; 
baftababct afpenit^uobuecubitis longam: 
angulofam^abintusiuanemanquafoliafunf 
afpcra cc angufta.ficut buglofios oblonga.a n 
gulodctiababetipfabafta in qntbusnafcunf 
folia. flotfe babetmeUinoe. 
f £tfcmcnfugbaftaeficutflomo8.1>afta t 
rrut e|cj?abcnt quiddam fimilepulueri:q?5 cura 
carnc appiicawm fucrit:p:urigincm facit ♦ 
^['RadiiccftciBigra.quecurracfafueritappa^ 
ret alba et mufcilagmofa .tJectritact bibita 
mcdctur emopt oicis.conquafia tionco rcfictf : 
^amftimousfpargit. 

f jCum yringicbcfolEjs cat baplafmata faccrc 
poteft omnia fup:adicra. oulnert paracolei? 
fim efiicir. Earnee incifae % in cacaboe mifiaa 
infc glutinarefacit. 



n 



Cracrama 




^ Ptarcorfdeaeapi. trcpcrrofSitio q* nafrtf 
m macedonia in criprt'8 ct fpcluncie. S?emcn 
cf t minurofimile apiovclameoe ocbjatumet 
vifridum ct aromaticum t t>furcriaim valdc* 
f^)cnftrui8(mpcfar»3nftariac6licmacbi 
scollicompefcit calcfaaendo z ficcando/Ri* 
nrie fowionibuo fubucnit . -tDoloicm latcrii mt 
rigat. Wret icis z xtiicc t>olori fubucnit. 
f^rouocatabundamervrinam;maitimeal 
vino t>atum.t>iurettcie antidott'8 mifcctur. 
^aulue capir.t>epctroulino macedoroco. 
•^etrofilinum macedonicum cuius fcmcn r-e 
£>vria arTcrtur. vel femen cftminurum fimilc- 
apio wurericum valde. Raiciror circa parae* 
femcnafotiafimiliaapio.fcmeneiueodo^ 
rom z t>iurericu valde.Onde perrofi Unum vo$ 
carur : quoniam multoriens inperrt e nafcitun 
qnod mulri pecrapium oicere confneucrunt» 
&ttia idem funtfinonum z petrofilinum mac«i 
dontrom:quodlarinct>iarorpctrofilirifiagrc 
fte.Xcge capt wlum *£etrouIirium. 
ftgbulrifinono vclmaccdonico carctce: vtii 
turalcjcandro.quoniamfuntciufdanvirfutig. 
tlirtutcm finoni vcl macedoniu inucntce in 
c apitulo*^crrofilmum. 



S3r»utl.^andectacaptrulo.t>c)rfvit|, 
Outdam t>icunt<r beccftberba quc 
, ^K«pe8maui.aufdamt>icunfcreft 
aMndram,fcdfalfo.'FIamneutrumifto:um 
flt vcrmmquoniam non eft pee miliriqui voca 
enr pcpanmcquiapcemiuu babctfolia faria 
matoiact pinguio:a.«2flo!ee faris a rloribua 
ltnom©iffcrcntce.qitoniam pee mrtui faat flo 
rcematoectalboefimulconiunctoetncapi 
fcmpKteapparcntceriicntcaudagattc.teuie 
bc6aftCiitvalcnana.eredfinonumrectefto» 
rcfcit ftcut pcrrofiUnum vfualc. fccundafacfc. 
foU? Jed matoja. Hon eft fitirer alc)candritqd 
faatfemina iiigra rugofa vrcucBamia?ma* 
gna ftottgit. Sf cdfihonum f m Dvafcotfdcj 
i ttixm faat femma fieut aptum et amcoe . 
andcPmvaitatemfinomjmcftpctrofainnm 
macedontcum.OuoniamDyafcoridc6t)ia^ 
Stnonifemeneftminutumunnlcapiofedob 
longuma nigrurmguftucalidum? t>inrericii 
raldc xl.Sx ©idfur fwonum; quia nafcttur in 
ffcria pwuinda rcgtonie ^>accdontc 

^ptrarionra £apMum.t(WWU 




tBthribia 



^gnipiV^an^rta captfulo»«nci«-iti » 
j £bardclarabice:greee vero ?latinefi 
napie. Sanapie cuplcp cft fperiee. 
tirta eft aiiAe femina er.teriue funt fubnigra: 
foterfae vero alba. 3Ua cniue fcmina ejcrcri? 
ct inrcriue funt alba.et babcnr vna vfrtutc.fed 
p:ima fpeciee eft aatrio: fccunda ; £t compo ? 
luturunapie a femunipue:quiafcnet mcditi 
tntcrfinapimxnapum.clrcalida7(iccainmc^ 
dio quarri gradue. f Scrapion lib:o aggre^ 
gatone capifuio £bardd.aticto:ifateT5Ya* 
fcori die capitulo £ bardel: id eftfinapie* £t e 
illuddtgcndumcjucKlnoncftnfmie ficaim ncc 
dctcnu9tum.ct babct granum grotTunu fi frl f 
gitur ctt album interiuerteft bumidi». naifttid 
clttaknouubonum.f 3dcm auctoriratc £>a£ 
licnicftcalidaetficca in qttarro gradu. f 3ui 
ccnna Ub:o fecundo capitulo t»c ffnapi.2» ina 
piacftcalida tftcca inquarto gradu* 

©ptrarioure 

f Stoapfon.tairniefokb:um cft calida vlcc 
ratiua. et ptopter boc pungit mulfum: quado 
tcritur ct mifeetur cum radice cnulc. et t>!*mit* 
tirurfupcrlocumpcr fpaciumlxwc.tconfcrt 
, friafieevlcerofcziplem. 
f £t Uninir cu eo fcabice vlccrofa : t aufcrt ea* 
ct aufert maculae vngufum.t confertqttando 
radip etue fufpcnditur incoilo babcnrium t>o 
lotem T>enrium:nam fcdat cum. 
f ■jMem aucroritat e "DTafcoridie. Sfinapie 
vircue eiue cft calida : i fubriliat i attrabif qfl 
tmfticarar.£tquandormWtmifcerureutn 
aqua:ct rcmperatur cttm Ydromelte et ffe tnde 
gargarifmue. 

f Confcrtapoftemaribueradicte liriguc:tan 
rique afperitattpulmoni9:facto atm cogar* 
garifmatc.£tquando fircumco emplaftru? 
cum rcbue conuauenrito adboc refoluit fcro* 
fulae, 

f£tquandofcrimrtapplicaturnaribuecdT 
mouct ftcmurarionetmer confcrt epilermrie cjc 
citanecoe>ctmulieriqucpatiturfurTocanonc 
matririe. 

f £t confcrt lirargic quando fir emplaftru cn 
cofupcrcapunpoftcp fecifticapilioe riuesb? 
radi.ct quando adnrifcetur cumearicie: r : po* 
nitur fupcr curim:t>onec rubcat confert fri arice 
t Xmrtctri fplenie.et eft conueniene p:op:ic.po . 
lonbtie anriquie: quando volumue artrabcrc 
aliquem bumotem ad qcreriota.et quando fit 
cmplaltrum cum eo:curat alopiciam; 
ij tt quando mifcemr cum mellc er adipc: aut 
cum ccra % otco;t>iffolura mundificat faciem: t 
aufercmaailamfeuliuo:emqui firfub oculo % 



coquirur aim flctfotct linirurcum co fabfefl 
vtcerarattcmpctigo. 

f £r qn rerif grolTe i t>afur in poru confert fc'/ ti 
b:ib ue periodicie.t ccferr grauirari audftue z 
rinnitmaurium. fitquando tenf i adniifcci cu 
aquatmelle.ctfitindccolliriu.cor&rtcbfcuri 
tativifU8:ctpniriruipalpcb:an»m. 
f 3uiccnna. Sinapieincidirfcgma:cf okit 3 
ciue cft calidiue oleo rapbatiuet fugiunr e ]c fu'/ 
mociue vcrmcevcnenofi. etdla qt^eft ftUie> 
ftrie gencrat bumoecm maluj. Kt in ipia func 
abftctfio cteriamrefolurio. 
f ^tboicequida comtdfitfotia riue:t radicc K 
riue eliicara. t mundfica t