(navigation image)
Home American Libraries | Canadian Libraries | Universal Library | Community Texts | Project Gutenberg | Children's Library | Biodiversity Heritage Library | Additional Collections
Search: Advanced Search
Anonymous User (login or join us)
Upload
See other formats

Full text of "Verhandelingen"

Google 



This is a digital copy of a book that was prcscrvod for gcncrations on library shclvcs bcforc it was carcfully scannod by Google as part of a project 

to make the world's books discoverablc onlinc. 

It has survived long enough for the copyright to cxpirc and the book to enter the public domain. A public domain book is one that was never subject 

to copyright or whose legal copyright term has expired. Whether a book is in the public domain may vary country to country. Public domain books 

are our gateways to the past, representing a wealth of history, culture and knowledge that's often difficult to discover. 

Marks, notations and other maiginalia present in the original volume will appear in this file - a reminder of this book's long journey from the 

publisher to a library and fmally to you. 

Usage guidelines 

Google is proud to partner with libraries to digitize public domain materials and make them widely accessible. Public domain books belong to the 
public and we are merely their custodians. Nevertheless, this work is expensive, so in order to keep providing this resource, we have taken steps to 
prevent abuse by commercial parties, including placing technical restrictions on automatcd querying. 
We also ask that you: 

+ Make non-commercial use of the files We designed Google Book Search for use by individuals, and we request that you use these files for 
personal, non-commercial purposes. 

+ Refrainfivm automated querying Do nol send aulomated queries of any sort to Google's system: If you are conducting research on machine 
translation, optical character recognition or other areas where access to a laige amount of text is helpful, please contact us. We encourage the 
use of public domain materials for these purposes and may be able to help. 

+ Maintain attributionTht GoogX'S "watermark" you see on each file is essential for informingpeopleabout this project and helping them find 
additional materials through Google Book Search. Please do not remove it. 

+ Keep it legal Whatever your use, remember that you are responsible for ensuring that what you are doing is legal. Do not assume that just 
because we believe a book is in the public domain for users in the United States, that the work is also in the public domain for users in other 
countries. Whether a book is still in copyright varies from country to country, and we can'l offer guidance on whether any speciflc use of 
any speciflc book is allowed. Please do not assume that a book's appearance in Google Book Search means it can be used in any manner 
anywhere in the world. Copyright infringement liabili^ can be quite seveie. 

About Google Book Search 

Google's mission is to organize the world's information and to make it universally accessible and useful. Google Book Search helps readers 
discover the world's books while helping authors and publishers reach new audiences. You can search through the full icxi of this book on the web 

at |http : //books . google . com/| 



Google 



Dii is ccn digitale kopie van een boek dat al generaties lang op bibliotheek pi anken heeft gestaan, maar nu zorgvuldig is gescand door Google. Dat 

doen we omdat we alle boeken ter wereld online beschikbaar willen maken. 

Dit boek is na oud dat het auteursrecht erop is verlopen, zodat het boek nu deel uitmaakt van het publieke domein. Een boek dat tot het publieke 

domein behoort, is een boek dat nooit onder het auteursrecht is gevallen, of waarvan de wettelijke auteursrecht termijn is verlopen. Het kan per land 

verschillen of een boek tot het publieke domein behoort. Boeken in het publieke domein zijn een stem uit het verleden. Ze vormen een bron van 

geschiedenis, cultuur en kennis die anders moeilijk te verkrijgen zou zijn. 

Aantekeningen, opmerkingen en andere kanttekeningen die in het origineel stonden, worden weergegeven in dit bestand, als herinnering aan de 

lange reis die het boek heeft gemaakt van uitgever naar bibliotheek, en uiteindelijk naar u. 

Richtlijnen voor gebruik 

Google werkt samen met bibliotheken om materiaal uit het publieke domein te digitaliseren, zodat het voor iedereen beschikbaar wordt. Boeken 
uit het publieke domein behoren toe aan het publiek; wij bewaren ze alleen. Dit is echter een kostbaar proces. Om deze dienst te kunnen blijven 
leveren, hebben we maatregelen genomen om misbruik door commerciële partijen te voorkomen, zoals het plaatsen van technische beperkingen op 
automadsch zoeken. 
Verder vragen we u het volgende: 

+ Gebruik de bestanden alleen voor niei-commerciële doeleinden We hebben Zoeken naar boeken met Google ontworpen voor gebruik door 
individuen. We vragen u deze bestanden alleen te gebruiken voor persoonlijke en niet-commercicle doeleinden. 

+ Voer geen geautomatiseerde zoekopdrachten uit Stuur geen geautomatiseerde zoekopdrachten naar het systeem van Google. Als u onderzoek 
doet naar computervertalingen, optische tekenherkenning of andere wetenschapsgebieden waarbij u toegang nodig heeft tot grote hoeveelhe- 
den tekst, kunt u contact met ons opnemen. We raden u aan hiervoor materiaal uit het publieke domein te gebruiken, en kunnen u misschien 
hiermee van dienst zijn. 

+ Laat de eigendomsverklaring staan Het "watermerk" van Google dat u onder aan elk bestand ziet, dient om mensen informatie over hci 
project te geven, en ze te helpen extra materiaal te vinden met Zoeken naar boeken met Google. Verwijder dit watermerk niet. 

+ Houd u aan de wet Wat u ook doet, houd er rekening mee dat u er zelf verantwoordelijk voor bent dat alles wat u doet legaal is. U kunt er 
niet van uitgaan dat wanneer een werk beschikbaar lijkt te zijn voor het publieke domein in de Verenigde Staten, het ook publiek domein is 
voor gebniikers in andere landen. Of er nog auteursrecht op een boek mst, verschilt per land. We kunnen u niet vertellen wat u in uw geval 
met een bepaald boek mag doen. Neem niet zomaar aan dat u een boek overal ter wereld op allerlei manieren kunt gebruiken, wanneer het 
eenmaal in Zoeken naar boeken met Google staat. De wettelijke aansprakelijkheid voor auteursrechten is behoorlijk streng. 

Informatie over Zoeken naar boeken met Google 

Het doel van Google is om alle informade wereldwijd toegankelijk en bruikbaar te maken. Zoeken naar boeken met Google helpt lezers boeken uit 
allerlei landen te ontdekken, en helpt auteurs en ui tgevers om een nieuw leespubliek te bereiken. U kunt de volledige tekst van dit boek doorzoeken 

op het web via |http: //books .google .coml 







'^^BRA^"^ 





(KEN AROK) 



ov 




im m mmi u m 




ÜITGEaKVKX KN TOEGELICHT 



DOOR 



U\ J, BRANDEN. 



YERHA ÏÏDELINGEN 



VAN HET 





rr 





ü 



VAN : / : 



KUNSTEN EN WETENSCHAPx^EN. 



DEEL XLIX. 



BATAVIA 

AL BK ECHT & Co. 



.S IIAOË 

M. NU HOF F. 



189 7. 



AS 



-•) ^ • ■ 












INHOUD. 



Pararaton (Ken Arok) of het l)oek der Koningen van Tumapël en van Majapahit, 
uitgegeven en toegelicht door Dr. J. Brandes. 

Verklaring van de meest bekende Javaansche raadsels in poëzie doot 
W. Meijer Kanneft. 

Het dialekt van Djapani door A, H. J. Cl. Walbeehm. 



407677 



INHOUD. 



iNLETOINa BI. 1* — 6*. 

Tekst ^ 1—32. 

Vertaling en aanteekeningen „ 33 — 204. 

Hoofdstuk I. (BI. 1 reg. 1— bl. 15 reg. 26) BI. 35. 

Km Angroh, ah kming Rajasay enz,, Caica 1144 — 1169. 

Aant. Arok's afkomst en nakroost. — Het lichten van veel beloven de kna- 
pen, — Arok eene ineumatie van Wi§nu. — Mpu Gandring van Lulu rabang. — 
De vuuruitstralende prinses. — Arok's streek. — De herinnering aan Arok bij 
de Javanen van Java en te Baïijarmasin. — Ken pëdës = Dewi i^n. — On- 
der de door Arok beloonden ook de smeden. — Verhouding van Daha en 
Tumapël vroeger en later. — Gantör, enz — Rajasa in de latere koniugsna- 
men. — Kagënëngan. — De invoering van den Hindu-godsdienst op Oost- 
Java. 

Hoofdstuk II. (BI. 15 reg. 27— bl. 16 reg. 14) Bl. 59. 

Anusapalij Caka 1170—1171. 

Aant, Anusapati ook de naam van Pafiji in de Malat. — Tunggul amë- 
tung's geslacht regeert nog verder. — Kidal. 

Hoofdstuk in. (Bl. 16 reg. 15 — bl. 18 reg. 4) Bl. 60. 

Tohjaya, Caka 1171—1172. 

Aant. Rajasa en Sinëlir wellicht partijnamen. 

Hoofdstuk IV. (Bl. 18 reg. 5 — bl. 18 reg. 13) .* . Bl. 63. 

Ranggavouniy als koning Wisnuwardhana, CaIca 1172 — 1194. 

Aan f, Wisnuwardhana en Narasingha. — Canggu. — Een fout in de cij- 
fers. — Jajagu. 

Hoofdstuk V. (Bl. 18 reg. 13 — bl. 19 reg. 20). , Bl. 64. 

Kertanagara, als koning Ciwabnddha, Calca 1194 — 1197. 

Aant. Duur der regeering van Kërtanagara. — Zijne namen Qiwabuddha 
en Kërtanagara. — De Chinecsche berichten over hem, ook in verband met 
hetgeen de Pararaton van hem vertelt. — Wiraraja's naam Baüak wide. — 
Diens zoon Nambi. — Pinggir rak§a. — Oorkonde van 1216 i^oka, zie Hoofd- 
stuk VL — Kërtanagara bijgezet, zie Hoofdstuk VII. — De pamalayu, zie 
Hoofdstuk IX. 



Il 

Hoofdstuk VI. (BI. 19 reg. 20 — bl. 24 reg. 33) BI. 69. 

Interregnum (Jayakatong), Caka 1197 — 1216. 

Aant. Daha weer meester. — De patuinapël en Raden Wijaya's lotgeval- 
len volgens de oorkonde van 1216.— De geloofwaardigheid van de Parara- 
ton. — Onderlinge vergelijking.— De Chineesche expeditie volgens de Clii- 
neesche berichten. — Sommige bijzonderheden anders opgevat dan door den 
Heer Groeneveldt. — Canggu. — De traditie van Java omtrent de stichting 
van Majapahit. — Punten van overeenkomst tusschen de westelijke en de 
oostelijke overlevering. — De sints de laatste 20 jaren gangbare mcening 
van de grootere oudheid van Majapahit onhoudbaar. — De oorkonde van 
Qaka 762 onecht en daarmede vervalt alle grond voor die meening. — Wat 
de Chineesche teksten leeren. — Majapahit desniettemin toch ouder ? — De 
argumenten te putten uit de Panji- verhalen en de Mcrveilles de Tlnde. — 
Het dara in de namen der uit Malayu medegebrachte prinsessen.— Mar- 
madewa. — Jayakatong's kidung, gevangenschap en dood. 

Hoofdstuk Vn. (Bl. 24 reg. 34 — bl. 25 reg. ^) Bl. 104. 

Raden Wijayaj als koning Ktrtarajasa (Jayawardhana), Caku 1216 — 1217. 

Aant, Wijaya's koningsnaam. — Zijn sterfjaar 1217.— Fouten in de cijfers en 
de jaartallen in de Pararaten. — De dood der drie gemalinnen van Kt^rtarajasa. 

Hoofdstuk Vni. (Bl. 25 reg. 2 — bl. 27 reg. 17) ...... Bl. 106. 

Kala geniet, als vorst Jaijanagara, Caka 1217— -1250. 

Aant. Dit gedeelte handelt werkelijk over Jayanagara. — Nogmaals een 
gedeelte van de oorkonde van 1216 (de biniliaji van Kértarajasa en haar Ai/ia- 
patan, Jayanagara) en Zang XXII — XXIX van de (grootere) Sajarah Ban- 
tën. — Bangga lawe's opstand en de kidung, die zijn naam draagt. — Banak 
wide krijgt zijn deel van Java.— De pakuti. — Iets over Gajah mada. — 
Jayanagara's dood. — Wie zijne opvolgster was. — De in de Pararaten voor- 
komende ParameQwara's. 

Hoofdstuk IX. (Bl. 27 reg. 18 — bl. 28 reg. 28) Bl. 118. 

Bhe Katuripan, Caka 1250 — ? . 

Aant, De opvolgster van Jayanagara prabhu istri I. — Het opschrift op 
den beschreven steen no. 38 van het Bataviaasch Genootschap. — De tijd, 
waaruit dit opschrift dagteekent, in verband met de Sumatra-opschriften, 
't Manjugri-opschrift en den tekst, nader bepaald. — Sadeng. — De in de gelof- 
te van Gajahmada genoemde landstreken, bepaaldelijk Tumasik en Taüjung 
pura. — Wat met Malayu bedoeld kan zijn geweest in de uitdrukking pa- 
malayu. — De berichten der Maleiers over de veroveringen van Majapahit; 
de Kroniek van Pasay en de Sajarah Malayu, Hoofdstuk II, III, IV en X. — 
Een lacune in den tekst van de Pararaten. — Waar de dood van de 
prabhu istri I in de Pararaten vermeld wordt. — Zij heeft zich dus later 
aan de regeering onttrokken. 



ni 

Hoofdstuk X. (BI. 28 reg. 29— bl. 30 reg. 25) BI. 134. 

Hayam wuruk, als koning Rajasanagara m Sang hyang Wékasing suka, faka ? 
—1311. 

Aant. Hayam wuruk's namen. — Het bhafara prabhn in den tekst. — 
Rajasanagara in de oorkonde van (Jaka 1295. — Hyang wëkasing suka in 
de Arjunawijaya en Rajasarajya in de Sutasoma. — De Chineesche berichten, 
die over zijne regeeringsjaren loopen, geven Patana panabu. — Nogmaals de 
gelofte van Gajah mada, nu in verband met de pasunda, de padompo, en de 
verovering van Palembang, welke laatste eerst in 1377 A. D., na den dood van 
dien patik plaats heeft. — Rajasanagara's regeering het toppunt van den bloei 
van Majapahit ; spoedig daaropvolgende onderlinge oneenigheden. — De ge- 
slaehtsboom, de methode volgens welke hij werd opgezet, het restant namen 
in de laatste hoofdstukken van de Pararaton, en de Bhre Daha's. 

Hoofdstuk XT. (Bl. 30 reg. 26 — bl. 30 reg. 34) Bl. 149. 

Uyang Wiccsay ak koning Aji Wikrama, Caka 1311 — 1322. 

Aanl. Hyang Wigesa. — Zijn recht op den troon.— Het rijk vermoedelijk 
door Rajasanagara tusschen zijne kinderen verdeeld. — Hyang Wëkasing 
suka II. — Bhra Hyang Wige^a wordt bhagawan. 

Hoofdstuk XII. (Bl. 30 reg. 35— bl. 31 reg. 28) Bl. 151. 

Dcwi Suluia, aLs koningin ühatara istri, Caka 1322 — 1351. 

Aant, De prabltu istri II. — Hyang Wiyesa weer op het tooneel. — Bhre 
Wirabhumi. — De kndalon kulon en de kadaton tvetan, — De Chineesche be- 
richten over de paregreg, — Deze paregreg het feit, waarop de Damar wulan 
legende gebaseerd is. — Rata angabhaya. — De Bhre Daha, die Bhre Wira- 
bhumi tot zoon aannam. — Hyang Wi^esa is blijkens de Chineesche be- 
richten werkelijk weder aan het bewind geweest. — De Chineesche berichten 
gedurende de jaren van dit hoofdstuk in verband met de koloniën van Ma- 
japahit.— De Sajarah Malayu, Hoofdstuk XIV. 

Hoofdstuk XIII. (Bl. 31 reg. 29 — bl. 31 reg. 38) Bl. 162. 

Bhre Daha, (islvi), Caka 1359-1369. 

Aant. De prabhn istri lil, na een tijd van koningloosheid. — Deze vorstin 
stond tot Bhre Wirabhumi in de eene of andere nadere betrekking. — Het 
begraven in één heiligdom van Paramccwara II met de prabhn istri III, 
en van Bhre Paguhan II en Bhre Pajang II te zamen in een ander. — 
Wellicht was Parameijwara II de gemaal yslix deze prabhn istri. — De waarde 
van den geslachtsboom. — Nogmaals de Damar wulan. — De palih'n. 

Hoofdstuk XIV. (Bl. 32 reg. l — bl. 32 reg. 10) Bl. 169. 

Bhre Tumapel, (als vorst Kêrtawijayaf'), Caka 1369 — 1373. 

Aanl. Onzekerheid van de afkomst der personen in dit en de volgende 
hoofdstukken. — De wong Tidung galating. — Canggu.— Bhre Hyang enz. 
eene interpolatie.— Bhre Paguhan II en Bhre Pajang II in één heiligdom 



IV 

bggezet.— Sabyantara. — De Bhre Tumapël van dit hoofdstuk wellicht Bhre 
Tumapël III (6). 

Hoofdstuk XV. (BI. 32 rog. 11 —bl. 32 reg. 13) BI. 171. 

Bhre Pamotan, als koning Rajasawardhana, Cakn 1373 — 1375. 

Aani. Sinagara dezelfde als Rajasawardhana; zijne kinderen in Hoofd- 
stuk XVIIL 

Hoofdstuk XVI. (Bl. 32 reg. 14) Bl. 171. 

Interregnum (koninglooshcid), Caka 1375 — 1378. 

Hoofdstuk XVn. (Bl. 32 reg. 15 — bl. 32 reg. 20) Bl. 171. 

Bhre Whigkér, als vorsl Ui/ang Purwaivicesaf Caka 1378 — 1388. 
Aant, Terugslag op Hoofdstuk XIV. 

Hoofdstuk XVni. (Bl. 32 reg. 21 — bl. 32 reg. 2i5) Bl. 172. 

Bhre Pandan salas, Caka 1388—1290 o/ 1400 (.^). 

Aant, Sinagara, zie Hoofdstuk XV. — De prabhu sang mokta ring kadaton, — 
Onduidelijkheid van den tekst. 

Titel Bl. 172. 

Aant. Pararaton, Arok, enz. — De plaats van den titel in vroegeren tijd. — 
lecasada. — De datum. — Een paar historische aantcekeningen nog voorko- 
mende in B. — Vergelijking van hetgeen de Pararaton verhaalt met de 
traditie op Java, ook volgens een Sérat kanda, en enkele opmerkingen over 
de Javaansche geschiedschrijving en het ontstaan der serat kanda's. 

Tabellen en registers Bl. 205 — 258. 

Tabel I. Geslachtsboom van het vorstenhuis van Majapahit en van de daaraan 
voorafgaande vorsten van Tumapël Na bl. 208. 

Tabel II. Personen in den geslachtsboom vermeld, doch van welken niet blijkt 
welke hunne afstamming is Bl. 209. 

Tabel III. De latere vorsten van Majapahit „ 210. 

Tabel IV. Nog verder genoemde personen van vorstclijken bloede . . „211. 

Tabel V. Kort overzicht van de opvolging der vorsten van Tumapöl en Majapahit. 

Bl. 212. 

Tabel VI. Chronologisch overzicht over de jaren 1144— 1400 Qaka = 1222— 1478 
A. D Bl. 213. 

Tabel VII. Lijst van de namen der in de Pararaton genoemde heiligdommen. 

Bl. 219. 

Register van de in de Pararaton voorkomende plaatsnamen „ 221. 

Register van de in de Pararaton voorkomende persoonsnamen. . . . „ 226. 

Register van de in de aantcekeningen voorkomende eigennamen . . . „ 240. 

Aanhang tot het register van de in de aantcekeningen voorkomende 

eigennamen „ 258. 

WOORPENSCHAT Bl. 259 — 314. 



INLEIDING. 



Het geschrift, dat hier den lezer in het oorspronkelijk en in eene verta- 
ling in het Hollandsch ter kennisneming wordt aangeboden, de Een Arok (Een 
Angrok) of de Pararaten (het Boek der Eoningen) is een der opmerkelijkste voort- 
brengselen van de Javaansche literatuur van ouderen tijd, ook omdat het als een 
geschiedkundig werk vrijwel op zich zelf staat, en het in ieder geval niets van 
het zelfde gehalte nevens zich heeft. Een afzonderlijke aanbeveling behoeft het 
dan ook niet, want het kan voor zich zelf spreken; het brengt den beoefenaren 
der Javaansche letterkunde veel welkom en degelijk nieuws, waaraan naar schrij- 
ver dezes hoopt in de aanteekeningen behoorlijk recht wedervaren is. 

Voor het vaststellen van den tekst kon gebruik gemaakt worden van drie 
handschriften, allen eigendom van het Bataviaasch genootschap: 

A, hropak no. 337, 17 bladen met nerf van 52 cM.; 

B, kropah no. 550, 47 bladen van 47 cM.; in den kolophon het jaartal 
1535 Caka met den datum Zaterdag-Pahing van de ww/cw Warigadyan, den 2«npaifjf- 
long van de maand Karo = 3 Augustus 1613 A. D.; en 

C, kropah no. 600, 58 bladen van 50 cM., beschreven met drie regels; in 
den kolophon het jaartal 1522 Qaka. 

De eerste helft van den hier gegeven tekst berust op alle drie de handschrif- 
ten, het vervolg op slechts twee, B en C ; A loopt namelijk niet verder dan hetgeen 
men beneden vindt op bladzijde 17 regel 9. Dat handschrift was het eerste, dat 
mij in handen kwam en vormde diensvolgens den legger voor dat gedeelte. De 
er door geleverde tekst kon gecollationeerd en verbeterd worden met behulp van 
dien der beide andere handschriften, van welken het eerste, B, door den resi- 
dent van Bali en Lombok werd verstrekt en het ander, C, als een geschenk ont- 
vangen werd van den Heer L. Th. Maijer, zie Not. B. G. XXVI (1888), 130; 
XXVII (1889), 24 en 136. Zoowel B als C bleken, in het latere gedeelte, op 
verschillende plaatsen, belangrijke leemten te hebben. Dientengevolge konden byv. 
bl. 24 reg. 9— bl. 25 reg. 11 alleen volgens C; en bl. 27 reg. 26-- bl. 28 reg. 8 
slechts uit B gegeven worden. 

Uit Me aan den voet der bladzijden opgegeven varianten blijkt steeds welk 
handschrift of welke der handschriften den tekst leverden; men houde daarbij 
echter, in het oog, dat na bladz. 17 reg. 9 het hds. A het zijne niet meer leve- 
ren kon. 

In die opgaven vindt men niet alleen de eigentlij k gezegde afwijkende le- 
zingen. Met opzet en niet zonder bedoeling zijn daar ook de onbeduidendste 
schrijf- en spelfouten, welke de drie exemplaren leverden, opgenomen, aangezien het 
van belang is te laten uitkomen van welk gehalte over het algemeen, vooral waar 



— 2* — 

het proza-teksten betreft^ ieder exemplaar op zich zelfis^ en omdat zij later wellicht 
nog eens zullen kannen dienen om tot het vinden yan de ware oorspronkelijke 
lezing den weg te wijzen. Verschillende plaatsen in den tekst; dien men ook 
vermoeden moet, dat hij eenige elders niet voorkomende woorden bevat, zijn on- 
verstaanbaar, althans voor schrijver dezes. Slechts een stipt referaat van het 
aangetroffene kan aan hetgeen weergegeven wordt, waarde bijzetten, ook al moe- 
ten die onverstaanbare gedeelten voorloopig als zoovele onopgeloste, en misschien 
onoplosbare raadsels blijven paradeeren. 

Hoe en wanneer de tekst, op het bestaan waarvan reeds jaren geleden de 
aandacht gevestigd werd door Friederich, van Bloemen Waanders en van der 
Tuuk ^), vervaardigd werd, laat zich niet zoo nauwkeurig uitmaken als wenschelijk 
zou kunnen worden geacht. 

Uit de kolophons van de handschriften C en B blijkt het, dat hij in het 
begin der 16« Qaka-eeuw reeds bestond, en uit bet bock zelf, dat althans het laatste 
er in vermelde feit niet vóór het begin der 15® van dezelfde jaartelling te boek 
kan zijn gesteld. Maar daarnevens wettigt de kroniekmatige vorm van het laat- 
ste gedeelte van het geschrift liet vermoeden, dat de tekst gaandeweg ontstond, en 
dus, gedeeltelijk althans, ouder is, ook al zou het boek in den vorm, waarin wij 
het thans hebben, vervaardigd zijn naar aanteekeningen in zulk een trant verzameld. 
De taal zou daartegen niet pleiten, want het is meer dan waarschijnlijk, dat in 
het laatste gedeelte der Majapahitsche periode, die hier blijkt geduurd te hebben 
van ± 1200—1400 Caka of 1278—1478 A. D , het Javaansch reeds een phase 
was ingetreden als door het idioom van de Pararaten wordt vertegenwoordigd. ^) 

Zou uit het juist veronderstelde reeds kunnen volgen dat de Pararaten een 
boek was van een zekere historische beteekenis, ook zonder dat het direct noodig 
is, dat het uitgesproken vermoeden juist is, mag reeds hier geconstateerd wor- 
den dat verschillende gedeelten er van op eene merkwaardige wijze door geheel 
onafhankelijke mededeelingen van buiten af en van anderen aard, bevestigd wor- 
den, en dat men veilig stellen kan, dat hetgeen men er in aantreft althans in 
hoofdzaak vertrouwen verdient. Daarover hier uitvoeriger te worden is niet noo- 
dig, de lezer zij verwezen naar den tekst zelf en naar de uiteenzettingen te vinden 
tusschen de vertaling, ten opzichte van welke laatste het niet ongepast schgnt 



1) Zie Voorloopig verslag Tan het eiland Bali, Verh. Bat. Gen., XXII, bl. 21 ; T^dschr. Ind. T. L. 
en Vk., VIIÏ, W. 165; en Not. B. G. XV (1877) bl. 115. 

2) Dit laatste is af te leiden nit Coben Stnart's Kawi oorkonde no. IV en de opscbriften van Pnku- 
ban dukn, Jiyn en Majajajer. Men Tergete niet dat de taal van officieele stukken steeds iet of wat ouder- 
wetsch is. De onderdom van de Pararaton eenigszins nader te bepalen door middel van het jaartal in de 
Rangga lawe, die op ons boek bemst, zie beneden, is ondoenl^'k. In de sHgkala, waarin de eeuwcjfers niet 
genoemd z^n, — ta ya wa^tan bcteekent, ook daar, «dat moet gezegd worden", — hebben de woorden wisaya 
en rata hunne gewone waarde, 6 en 6, naar aUe waarschijnl\jkheid niet, zooals uit de berekening van den datum, 
wwe fiwa watpatiia mraieny talima wiptwdrtha trayodafi, d. i. Donderdag-Kaliwwan, tcuku Mrakih, 13 
Krfoapak^ V, voor de jaren 14^5, 1565 en 16G5 ^uka, aau den dag treedt. 



— 3* — 

hier eene waarBchuwing te plaatsen voor hen, die haar aan den Javaanschen tekst 
niet zullen kunnen toetsen. 

Al is er naar gestreefd om die vertaling zoo nauwkeurig mogelijk te doen 
zijn, en zij daarom veeltijds letterlijk, hier en daar kan zij den Javaanschen tekst, 
althans vooralsnog, niet vervangen om reden dat op sommige plaatsen de ondui- 
delijkheid en dubbelzinnigheid van het oorspronkelijk met het vertalen onwillekeurig 
en noodzakelijkerwijze verloren moest gaan. De zinbouw van het Javaansch is 
een geheel andere dan de onze, de abrupte wijze van spreken, vooral in het 
laatste gedeelte van het boek aan te wijzen, is in het Hollandsch zonder onverstaan- 
baar te worden herhaaldelijk niet na te volgen, en het gemis aan leesteekens van 
onderling verschillende waarde, althans het niet toepassen ervan door de Javanen, 
dwingt om bij een vertaling in het Hollandsch af en toe een langere pericope te 
maken of een grooter leesteeken te plaatsen dan de Javaansche tekst leverde. Dit 
veroorzaakt dat zich de subjectieve opvatting van den vertaler nu en dan op den 
voorgrond dringt, ook daar, waar deze even dubbelzinnig had willen zijn als het 
oorspronkelijk ter plaatse is. Wel werd er zooveel mogelijk naar gestreefd om 
den vermoedelijken zin der woorden of het verband weer te geven, en werd de 
tekst, die feitelijk slechts een aaneenschakeling is van zeer korte, slechts door 
komma's gesclieiden zinnetjes, eerst ua een rijpe beschouwing in bepaalde perio- 
den uiteengelegd, maar de mogelijkheid blijft geenszins buitengesloten, dat de 
opvatting niet altijd de juiste was, en het oorspronkelijk dus hier en daar een 
anderen zin vertegenwoordigt dan de weergegevene of aangenomene. 

De inhoud van het boek zou in twee groote afdeelingen gesplitst kunnen 
worden, een voorafgaand legendarisch, soms zou men haast zeggen mythisch, en een 
meer historisch. 

Wat hier het meer historische gedeelte wordt genoemd, begint daar waar 
Ken Arok (of Angrok, beiden zijn gebruikelijk) Tunggul amëtung, den alcuwu 
van Tumapël, uit den weg heeft geruimd, met diens weduwe Ken Dëdës is ge- 
huwd, hoofd van Tumapël is geweerden, dat onder Daha stond, en zich daarop 
aan de suprematie van dat rijk, waar op dat oogenblik Dangdang gëndis koning 
was, onttrekt. Al wat daaraan voorafgaat kan eenige juiste overleveringen om- 
trent Ken Arok bevatten, maar het geheel is van dien aard, dat dezen er zich 
kwalijk uit laten uitschiften, en moet dienen om in het licht te stellen welk 
eene bijzondere persoonlijkheid de voorvader was van het Majapahitsche vorsten- 
huis, van wien in dat gedeelte zooveel wonderen worden verhaald, dat men het 
haast een geluk zou achten er niet nog meer aan te treflfen, ware het niet dat 
zulk soort van legenden van een ander dan het historische standpunt van hooge 
waarde zijn. 

De verdeeling bij de vertaling toegepast, en ook uit de inhoudsopgave 
te leeren kennen, is evenwel eene andere. Bijeen werd gevat wat telkens onder 
de regeering van één vorst of ééne vorstin moet hebben plaats gegrepen^ en zoo 



— 4* — 

het boek in zoovele verschilleDde boofdstukken uiteengelegd; al gaf de vorm van 
het oorspronkelijk daartoe ook geen aanleiding. Toch kon dit geregeld geschieden^ 
omdat de feiten in een chronologische orde worden opgesomd^ en de overzichtelijk- 
heid werd er zeker niet weinig door bevorderd. In het hoofdstuk over Ken Arok, 
als koning Rajasa^ vindt men alles bijeen wat over dezen persoon in het boek 
voorkomt, dus zoowel het legendarische als hetgeen daarna nog volgt, de andere 
hoofdstukken nemen telkens een begin als de regeering overgaat of verondersteld 
moet worden te zijn gegaan. 

Gaf dit niet zoDveel bezwaar, iu andere gevallen, bepaaldelijk bij het iden- 
tificeeren van personen van denzelfden naam, zijn de moeielijkheden herhaaldelijk 
zeer groot. Den beoefenaren der Javaausche geschiedenis, zooals zij door de Ja- 
vanen zelf, en in vele opzichten zooveel nauwkeuriger dan door de Europeanen, 
beschreven is, is het maar te wel bekend, hoe veeltijds, zoo niet meerendeels, de 
personen bij voorkeur door een titel of titeluaam worden aangeduid, en hoe be- 
zwaarlijk het soms is om uit te maken den hoeveelste van een zekeren naam, 
van een bepaald punt beginnende te tellen, men op een gegeven oogenblik in 
een bericht aantreft. Deze moeielijkheid drukt ook hier den onderzoeker, vooral 
in het laatste gedeelte van het boek. Op welke wijze het mogelijk zijn zou er 
eenige orde in te brengen, leeren de aanteekeningen bij Hoofdstuk VIII en volgg., 
waarbij reeds hier opgemerkt worden kan, dat te beginnen met Hoofdstuk XIII 
er verschillende nieuwe personen ten tooneele treden, van wie hoegenaamd niet 
blijkt noch in welke verhouding zij stonden tot de personen, die men in het voor- 
afgaande genoemd vindt, noch zelfs wat hunne onderlinge verhouding was. 

De vertaling zelf is slechts hier en daar met cene nadere toelichting opge- 
helderd. Dit in ruimere mate te doen was niet uoodig, maar er is naar gestreefd 
om zooveel mogelijk geregeld rekenschap te geven van de vertolking dier woorden 
of uitdrukkingen, die twijfelachtig, hoewel mogelijk onzeker, of geheel op de gis 
zijn. Het middel daartoe te baat genomen, is telkens het Javaansch te vermelden 
waaraan zulk eene vertaling beantwoorden moet, en hoe eenvoudij het ook zij, 
het laat zich veronderstellen, dat het aan de bedoeling voldoen zal. 

Men verwondere zich niet als men straks bij de toelichting zoo goed als 
geen gebruik ziet gemaakt van de liangga lawe ^). Dit heeft een gezonde reden. 
Er behoeft slechts geconstateerd te worden, dat de Rangga lawe op de Pararaten 
berust en het zal den lezer duidelijk zijn, dat die kidung voor hem, die de Para- 
raten kent, als van zelf op den achtergrond geraakt, waar het om geschiedenis en niet 
om literair genot te doen is. Af en toe heeft ook de dichter van die kidung, die 
niet het eenige geschrift is dat uit de Pararaten voorsproot, onze kroniek niet goed 
verstaan of verkeerd begrepen, wat zelfs zoo ver gaat, dat hij woordvormen afge- 



1) Dit voornamel^k met het oog op hetgeen men vindt iu Not B. G^ XXIV (1886), 43 en volgg.; 
de Pararaton was m\j toexunaaU nog slechts gedeeltel^k bekend. 



- om- 
leid van plaatsnamen als de namen van personen bezigt^ terwijl hij^ met een te 
vergeven vrijmoedigheid^ ook somwijlen aan zijne pbantasie den vrgen loop schijnt 
te hebben gelaten l). 

Ook van de overige parallele literatuur wordt in de aanteekeningen bier- 
achter niet gewaagd. Wat mij daarvan onder de oogen kwam was van zulk een 
slecht gehalte^ nl. een beschadigd fragment van een hoogst gebrekkig exemplaar 
van de proza Pamancangah, Bat. Gen. kropak no. 518, dat het veiliger scheen 
er geen gebruik van te maken. 

De kidung Arok uit Cërbon, zie Not. Bat. Gen. IX (1871), bl. 26, waarop 
door mij in mijn opstel „Over een ouderen Dipanëgara in verband met een pro- 
totype van de voorspellingen van Jayabaya", Tijdschr. Ind. T. L. en Vk,, XXXII, 
reeds gewezen werd, leverde evenmin iets van beteekenis. Van hetgeen er nog 
van voorhanden is, is het eerste gedeelte, dat slechts bij stukjes en brokjes 
gespaard bleef, alleen te begrijpen na het lezen van de Pararaton, en voor zoo- 
ver zij gaaf is, gaat zij daarbuiten. 

Van de opschriften, die behooren tot het tijdvak waarover de tekst van de 
Pararaton loopt, is slechts gebruik gemaakt voor zoover zij tot toelichting konden 
dienen. Het kon zelfs niet in de bedoeling liggen om ook maar die, van welken 
er gedeelten moesten worden overgenomen of aangehaald, in hun geheel mede te 
deelen, maar het kan zijn nut hebben er hier even aan te herinneren, dat er be- 
houdens de tot staving hier en daar geciteerde oude oorkonden nog andere zijn, 
die geen gegevens van dadelijk belang verstrekten. Wat er voorhanden is, is op- 
gesomd in Tabel VI, Chronologisch overzicht over de jaren 1 144 — 1400 Qaka = 
1222 — 1478 A. D., beneden, en voor een gedeelte leeren die stukken wellicht nog 
wel iets anders dan de Pararaton. Daar dit intusschen niet bleek, of althans niet 
duidelijk was, werd besloten ze vooralsnog te laten rusten; het was hier trou- 
wens ook niet te doen om de Majapahitsche periode in haar geheel te beschrijven 



1) Op z\ja beurt is h^ zelf weer schromelijk misverstaan door den zegsman van Raffles, wiens ver- 
slag over het eerste gedeelte van de kidungy tenz^ dat berust op een geheel andere redactie of een anderen 
tekst, wat niet wel aan te nemen is^ de vreemdste fouten bevat. Zoo zjn bjv. Jayapurusa en Laksmikira^a 
niet de voorouders van Qiwabuddha en Raden Wijaya; hunne namen worden er, heel in 't begin, slechts ge- 
noemd in eene vergelijking, die ontleend is aan een kakawin, Singhalanggalaparwa geheeten, waarvan z^ de 
hoofdpersonen zgn, winimba patwatatwa singhalanggala prabhu bkiteka ngifni fri jayapunuaim d.e kakawin : 
cayapunisa) fan fri lakmikirana roro sapura, zooals geschilderd wordt in den inhoud van de Singha- 
lang^ala parwa enz. Van deze kakawin bezit de Leidsche rjksuniversiteitsbibliotheek een geschonden exem- 
plaar, zie Vreede, Catalogus enz., bl. 399, no. CCCXCVI (Cod. 1913), dat aan het slot, bl. 65, den titel ver- 
meldt Ook z\jn (j^iwabuda (Kërtanagara, **ri) en Wijjaya geen broeders; hun grootvaders waren dat» en daarom 
heeten zij sanak mindon. Rangga lawe staat tegen den vorst van Majapahit op, juist omdat deze hem 
geen patik had gemaakt, byv. zoo staat er ergens, als hg r^kel^k, maar op een andere wjze, voor zijne 
diensten beloond en begiftigd is geworden, tan sukd kidwa amangkubMtni, Jayakatong wordt door het hoofd 
der Chineesche troepen niet gedood in het gevecht, maar sterft na hun vertrek in de gevangenis, ndan inucap 
aira tang kawénang ing prang gri jayakatong angripta vmkir polaman lud mokfa ing panjara ring Jung- 
galuh tirébu/awi makdkarana mulikeng turanadi^ £a zoo zou men voort knniisn gaan. 



— er- 
onder aanvoering van alles wat daarvoor ia aanmerking komen zou. Vóór daartoe 
zal kannen worden overgegaan, dienen eerst eenige der belangrijkste bronnen 
uitgegeven en afzonderlijk besproken te worden, waan^oor de Pararaten in de 
eerste plaats in aanmerking kwam. 

Om met dien tekst kennis te maken wordt hier dan ook de gelegenheid 
geopend. Moge hij bij den lezer voldoen aan de verwachting, die hier in het 
voorafgaande werd opgewekt. 



TEKST. 




ATAWA 



Om awighnam astu namas siddham. 

Nihan katuturanira ken Angrok. Mulanira duk dinadekën mamma^ hana 
aoakira rangdyaning Jiput, lumaku tan rahayu amëgati apusira pinakapamafi- 
cananing hyang Suk^ma; sah sira saking Jiput, aDgungsi sira ring mandaleng 
Bulalak. Parabira sang abatur ing Balalak sira mpa Tapawangkëng^ agawe 5 
gopuraning a^ramanira^ pinalampaban wëdas bang sapalaki dening hyanging 
la«?ang. Lingira Tapawangkëng : „Nora olihing apëningan dadi agaweya pa- 
papatakaning awak^ yan amatimatia janma; norana ta amutosakëna papalako- 
ning caru wëdus bang ika'\ Dadi ta sang amëgati apus smt^ng, asasggnp maka- 
carnaning lawangira mpa Tapawangkëng, satya ta sira, asanggup pinakacara, 10 
marganira mnliha maring Wi^nubhuwana tumitisa mareng wibhfiwajanma; 
mareng madhyapada muwah; mangkana pamalakunira. Irika ta dnk inastwan 
tumitisa denira mpu Tapawangkëng tinut i lasaning kapralinanira, amnkti ta sira 
pitung mandala. Ki huwusnira pralina irika ta sira pinakacara denira mpu 
Tapawangkëng. Telasira mangkana mür ta sira maring Wi^nubhawana^ tan 15 
lifiok ing rasaning sangketanira sang pinakacara amalaka ta sira titisakëna 
ri wetaning Eawi. Sira bhatara Brahm& angilingilingi ta sira rowanganirayu- 
gaba, buwasiug mangkana bana ta wong apangantenan hafiar, sëdëng akarënan 
sih; lanang aran sira Gajabpara, wadon aran sira ken Èndok, angulahakën 
atatanen. Maring sawab ken Êndok angirimi lakine Gajabpant; araning 20 



1. B. awighnam astu nama siwaya, C. awighnam astn. — 2. B. ndnk. — B, mvnufM ontbreeJtt, Cid, — S. 
A. rahandyan ing Jiput— B. apus, C. id, — 4. C. bah ontbreekt. — B. mapjala. — 5. B. parannira. — 6. B.a9ramA, 
C, idé — A. sira wédas. — A. en B. 9apa8aki. — 7. A. ^ C. Lawwang. — 9. A.mB. ta ontbreett.—lO, B. vuJnevtfi'^ 
ning. — B. minakacani, C. id,—!!. B. margahanira mulih. — A. mB. Wi^vabhawana. — B. maring. — 12.B.ndiik, 
C. id. — A. inastwa. — 13. B. tinut i ni9aning, C. ^'sakning. — B. amuktia pitung mav^iala, C.id, — 14. B.deni- 
mpu. — 15. B. lasira. — B. ta sira ontbreek f. — A. en B. Wi^uubawana. — 16. IL, en B. liQokirasing. — 17* B. 
Brahm& sira, doch ta sira, ontbreekt, C. id. — B. rwangan.— 18. B. hana wong — C. apapanganten hafiar. — C. 
aknrén aftih. — 19. B. ngaran. — 20. B. katanen, C. id. — B. sahwah sira akarya, sira ken Ea^olc, — B. Uüdnir» 
sèkul, aran Gajahpara, C. laki aran 6. p. 

Verh. Bat» Ge.xi, deel XLIX. U 



— 2 — 

sawali nggenirangirim ring Ayuga, prade^anira ken Èndok aran ing Pangkur. 
Tamnrun sira irikal bhatara Brahnia asanggama lawan ken Èndok, ënggenira- 
yuga ring Tégal lalatêng, angënakën strisamaya sira bhattlra Bralima : „Hayokita 
asanggama lawan lakinta mnwah, yan ko asanggamaha lawan lakimu, lakimu 

5 mati mwah kacaeampuran mêne yugamami iku; arane yugamami iku ken 
Angrok, iku tëmbe kang amutër bliumi Jawa." Muksah sira bhatara Brabma. 
Sira ken Èndok anuli maring sawab, katëmu sira Gajabpara. Lingira ken 
Èndok: „Kaki Gajabpara wrubanira yen ingsun rinowang asanggama denira 
byang tan katingbalan ri Tëgal ing lalatëng, wëkasira ring isini: bayo aturu 

10 lawan lakinta muwabmuwab, mati lakinta yan amak^akua aturu lawan kita^ 
kalawan kacaeampuran yuganingong iku'. Tumuli mulib sira Gajabpara, tëka 
ring umab den-ajak aturu sira ken Èndok, barëp dcn-rowanga asanggama 
manib. Alumub sira ken Èndok ring ki Gajabpara. „Eb kaki Gajabpara pëgat 
ingsun aomabomab lawan sira, awëdi sun ing pangucap sang byang, tanpaweb 

15 yan atëmu manib lawan sira''. Lingira Gajabpara: „Nini angapaba, sun-ka- 
pakëna, suka ingsun yen apëgatana kalawan sira, dening rënarëni kang sa- 
king sira den-mulib manib nini maring sira, pomabomabingsun den-mulib 
manib maring ingsun." Tumuli buwusing mangkana ken Èndok mulib maring 
Pangkur sabrang lor, sira Gajabpara maler ing Campara sabrang kidul. Du- 

20 rung gënëp sapasar mati sira Gajabpara. Suraking wongangucap: „Karaakara 
panase rareng jero wötëng iku, durung pira pöpögatanc raraaue lanangwadon, 
tur wong-atuwane lanang mati." Wékasan buwus gënëp leking rare mëtu 
rare lanang, binuöcal ing pabajangan denira ken Èndok. Dadi bana wong ama- 
maling, aran sira Lembong, kasasar ing pabajangan tumingbal ing murub, 

25 pinaran denira Lembong, amirésép rare anangis, pinarökan denira Lembong, 
singgih kang murub rare anangis ika, sinambut ingëmban bbinakta mantuk, den- 
akn wëka dera Lembong. Angrungu sira ken Èndok yen sira Lembong anga- 
kuaku wëka, ring rowange ki Lembong kang awërta, anënggub rare antuke 
amamanggih ring pabajangan, katon murub ing ratri. Tumuli pinaran denira 

30 ken Èndok, singgib siranakira. Këcapira ken Èndok: „Kaki Lembong ma- 
nawa sira tan supeksa ring rare kang deniramanggib iku, anakingsun puniku, 
kaki; ayun sira kaki wikana pürwakanipun, antukira bbatara Brabma asanggama 
kalawan isun puniku, bayo tanpamule sira ring rare puniku, upama ababu 

1, A. en C. ngeaingaogirim. — 2. B. irika ontbreekt. — B. sira ken. — 3. B. naring. — C tëgal oni- 
breekt, — A. angénakëna. — B. ri pasamayanira bbat&ra. — 5. A. mati mwab kacaeampuran, B. mati lakimn 
mAneh kacacampamn, C. mati lakinta manih, kacaeampuran. — B. ane yui^r^mami. — G. A. bhumi ontbreekt. — 
B. mu^sa, C. id. — 7. C. angungsi. — 11, C. ning wong. — 12. B. den-rowang asanggama, C. id. — 13. A. ala- 
mah. — B. lei ontbreekt^ C id. — B. he ra Gajabpara, C. id. — 14. B. ingsun, C. id. — 15. B. atëmna. — 16. B. 
apspëgatana.-"]?. A. den-uUh, B. den-malib, C, mulib. — B. **omabingsun, sadrweningsun, C. id.—\^. B. 
tnli. — 20, A, sapasar ulan mati. — 21. A. ikung. — B. para apapëgatan. — 23. Cr\iXQ ontbreekt. — 3. amaling. — 24. 
A. sé^ëke lu8asar.~25. A. en B. deia. — B. dera — 26. B. binakta mulib, C. id. — 27. B. dera Lembong 
ontbreekt, C. id- — A. angrongo. — 28. A. en C. ri.— B. L. kawërtta.— 30 B. maaawi. — 31. B. sapek9a.— B. 
Aoifft pang^, C. m^.— -j|3. A* ontbreekt ifuo. 



— 3 — 

kakalih abapa tunggal samaDipnn rare puniku''. Mangkin saDgsaya asih sira 
LemboDg sasomah rësëp; wëkasan atnha sakalawonlawon bhinaktanyamama- 
liog denira Lembong. Awayah sapangon sira ken Angrok angering Pangkar. 
Télas pomahomahira ken Ëndok muwah sapomabomahira ki Lembong, hënti 
tinotobakën denira ken Angrok. Wëkasan sira angonngon ing siramandala 5 
ring Lêbak; angon këbo sapasang ; alama bilang mabisa kang denir&ngon ika, 
ingajen deramandala wolung ewu ring sapasang këbo^ mangke ingnmannman 
sira ken Angrok dening raraa-rena kalib: „Lab kaki isun anunggna kalih^ 
lamnn sira aja lungha; isnn uga anunirgonana ring siramandala ring Lëbak*^. 
Wëkasan tan kedëp Inngba sira ken Angrok, kari sira ramanira kalib ring 10 
Campara . mwang ring Pangkiir. Tumnli sira ken Angrok aysab ' nmungsi ring 
Kapundungan, tanpawilasa kang kongsi përnabing angber. Wontën ta bobo- 
tob saji saking Karuman^ aran sira Bango samparan, alab atotoban denira 
malandang ing Kamman^ tinagib tanpangëmasi, sab sira Bango samparan sa- 
king Karuraan ananakti maring Rabat jalu, angrëngö ujar saking aka^akinon 15 
mnliba manib maring Karnman, „hana anakmami anghuwusakënabutangtaaran 
sira ken Angrok.' Sab sira Bango samparan saking Rabut jalu, lumampab 
saratri, dadi amanggih rare, kabitang widbining byang denira Bango samparan, 
singgih ta sira ken Arok, bbinakta mantuk maring Karuman, ingaku wëka 
denira Bango samparan. AnuH maring kabotoban, kapanggib sira malandang 20 
denira Bango samparan, linawan atotoban, alab sira malandang, pulib alabira 
Bango samparan, tubu van widbining byang, mantuk sira Bango samparan, bbi- 
nakta mantuk sira ken Angrok denira Bango samparan. Sira Bango samparan 
sirawayub angalap-do, sira Gënuk buntu rabi tuba, sira Tirtbaja rabi anom ; bana 
anakira (rabi anom) panji Bawuk, panggulü sira pafiji Kuficang, arinira paöji Ku- 25 
nal, sira panji Kënengkung, wuruju wadon aran sira Cucupuranti. Sira ken Angrok 
ta sira ingaku anak ta denira Gënuk buntu. Alawas sira baneng Kamman, 
tan apatut sira kalawan parapaiïji kabeb, donira ken Angrok sab saking 
Kamman. Tumuli sira ring Kapundungan amanggib sira rarySngon anakira 
tuwan Sabaja, buyut ing Sagënggëng, aran sira tuwan Tita, apasanakan 30 
kalawan sira ken Angrok. Antyanta dening padasibsiban sira tuwan Tita ka- 
lawan sira ken Angrok. Atëbër angber sira ring sira tuwan Sabaja, tan bana 
wiyatanira ken Angrok kalawan sira tuwan Tita, barëp ta sira wikana ring 
rupaning aksara, mara sira ring sira Janggan ing Sagënggëng, ati amarajakaba, 
amalaku winaraban sastra. Ya ta winaraban sira ring rupaning ak^ara lawan 35 

► 1. A. tfw B. mangke. — A. sanjisayan. — 4. A. oomahc. — 5. A. tinotorakën. — 6. B. derangon, C. den- 
anffon. — 7. B. iwu. — B. kébo ^aauuke ontbreekt. 9- A. ntuncrjrua, B. aunnttgonane. - 10. B. lao kedëp 
ontbreekt^ C. id. — IT. B mwang ring Pangkur ontbreekt^ C. irf. — B. aysah ontbreekt. — 12 B. oga për 
ka*. — B. ingungsi, C. id, — B. anetenicer. — C. wëntën. — 13. B. saji ontbreekt, — 16, B. maliha maring 
Karaman manih, C. id. — ~1. B. kalah. — C. mulih.— kalahira. — 22. A. ya.— 24. B. sirawaynli. — 26. 
B. Kuöca.— 27. B. ingaku wë a denira, C. trf,—29. B. maring,—30. B. Tita, elders Kita.— 82, B. l^ng^ 
tnhan Sahaja. — 38. B. wihata. — 35. A. malakn, C. id. — B. winahan. 



~ 4 — 

pannjaning swarawyafijasa^tra, sawrëdhimng ak^ara, winarab sira ring m* 
pacandra kapëgataning tithi m&sa lawan sakakala, ^wara^ paucawara, sap- 
tawara; triwara^ dwiwara^ sangawara^ wuku. Bisa sira ken Angrok kalawan 
sira tnwan Tita kalih sama winarahan ing sastra denira Janggan. Hana ta 

5 tatanëmanira Janggan upacaraning natar, witing jambu olihira ananêm ; antyanta 
denipun awoh, tuhnning atab anèdéng^ piningbit tan ananing wineb an^nnduha^ 
nora bana wani ameta wohing jambn punika. Lingira Janggan: „Laman 
ratfing jambn ikn undabên". Dabat denira ken Angrok kapengin tumon ing 
wobing jambn pnnika, maha kacitta wobing jambu punika. Tëkaning saratri, 

10 mfisa sirëping wong atum, sira ken Angrok sira aturU; mangke tanglalawab 
mëtu saking wunwnnanira ken Angrok adulurdulur tanpapëgatan, savvëngi ama- 
ngan wohing jambnnira Janggan. Tumuli ring enjang katinghalan agëlar 
wobing jambu punika ring natar^ pinupu dening pêpëdëkira Janggan. Sira 
Janggan tumon wobing jambu rusak agl^lar ing natar, Qoka sira Janggan^ li- 

15 ngira Janggan ing parajaka: „Paran sangkane rusak jambu iku." Sumahur pê- 
pëdëkira Janggan : ^Pakulun rusak dening tampaking lalawah amangan jambu 
puniki'\ Dadi ta sira Janggan angambil rwining pafijalin nggenira üërung jambu 
pttnika tur denirfitunggu sawëngi. Sira ken Angrok maliti aturu ring salu kidul^ 
a8andi(ng) kakawunganing alalang ring përnahira Janggan kadang amêlit. 

20 Satingbalira Janggan mulat ing lalawab abëbëlëk pangdudulur, mëtu saking 
wunwnnanira ken Angrok, pada amangan wohing jambnnira Janggan, apësëb 
twasira Janggan, kawalahan anggëtak lalawab akeb amangan wohing jam- 
bunira, sëmgën sira Janggan, tinundung sira ken Angrok denira Janggan, 
&kara madhyaning ratri patundungira Janggan. Kaget sira ken Angrok atangi 

25 pupungun sira, anuli mëtu, aturu ring palangalanganing jaba, winëton denira 
Janggan maring jaba katinghalan hana murub ing tëngahing alalang, kaget 
sira Janggan angidëpakën katunon, pinariksa kang katon murub, kapanggib 
ken Angrok kang murub ika, tinangi kinen mantuka ingajak aturua ring umab 
manib, tutut sira ken Angrok aturu ring patëtëngahan manih. Efijang kinen 

30 angambila wobing jambu denira Janggan, suka sira ken Angrok, lingira: ,,Lab 
malar isun dadia wong, isun anahura hutang ring sira Janggan''. Agung 
sakalawonlawon sira ken Angrok, angon ta kalawan sira tuwan Tita, agawe 
ta sira dukuh, kapërnab wetaning Sagënggöng, tëgal ing Safija, pinakanggenira 
dangadanga wong malintang bawan lawan sira tuwan Tita rowangira. 



8. B. triwara, astawara, waka, C. id,—^. B winahan dening Janggan ing 9&8tra, C. id. — 6. B.riDg 
aatar.-»-6. B. tahn atdb. — A. pininghitan ana, C. *^.— 7. C, ika, — 8. A.tamsening — 9. B. ratri, mftsa, C. m^.-^10. 
B. mangkin ta, C. id, — B. laltwa. — 11. B. tan pamëgatan.— 16. C. niog. — 16. B. lalawa, C. id,-^\7. B. 
rining paf^'aliD, C. id» — B. nmng. — .18. B. dcra, C. id, — 19. B. alangalang, C. id, — 20. B. lalawa.— B. adalurdalar, 
C mI.— 22. B. lalawa. — 24. A. anakara. — 25. A. pupongan. — 26. C. alangaUng. — 27. B. amangliidëpaken, C. m^.— 
9S. A. atam maring.— 29. C. patKnKa]ian.->C.befljang.— 30. B.dcra.— 31.A.agn.— 82.B.ta<m^rtftf4r^,C.M;.— 
B• U M^IrMi^^-— Séé A. aBga4aii|;af^**B. maliwat, C. id. 



— 5 — 

Hana ta wong amabat ano ring alasing wong Eapundniigaii, Snakanak wadon 
ahayu, milu maring alaS; teka giDamëlan denira ken Angrok rinowang asang* 
gama ring alaS; ya ta ring Adiyuga ngaraning alas. Mangkin mërsah sira ken 
Angrok, wëkasan sira analawa wong malintang hawan, ya ta kawérta tékeng 
nagareng Daha denira ken Angrok nngrusab^yataingilangakënsakingTnmapël 5 
denira sang akuwn aran Tunggul amëtung. Sah sira ken Angrok saking Sa- 
gënggëng, angangsita sira maring Rabat gorontoL ^Mogha takabëbëngringbafia 
kang an^langakën", sotira ken Angrok: ^mogha ta bafia mëtua saking tan- 
hana; samangkana dadi kang tabun, tan bana kewëb ring Jawa'\ Mangkana 
lingira ken Angrok. Sab sira saking Rabat gorontol, angangsi sira ring Wa- 10 
yang, tëgal ing Snkamanggala. Hana ta pa])ikatan përit, irika ta sira anawala 
wong asëdaban manak, annli sira maring Rabat kata. Eapibanan sira tamon 
ing kata sawaringin gönge, irika nggenira mësat angangsi ta sira ring Jan 
wata, mandalaning wong sampfirna, angangsi ta sira mareng Lalambang, ang- 
her ing wong amarade^a, wijiiing wong ajarit, aran sira Gagak ingët. Alawas 15 
angber irika anawala wong malintang bawan. Sab sira maring Knpandangan, 
amamaling sira ring Pamalantënan, kawraban ta sira, binara kaképang, tan 
wrab ta parananira angangsi, amamanek ta sira ring witing tal, ring pinggiring kali^ 
karabinan ta sira, kawruban yen amamanek ing tal, tinangga dening wong 
Kapandangan ing sor, tinababan kajar. Tal panika winadang dening ambara 20 
ring sira. Samangka ta sira anangis,. asasambat ing kang aya^adbarma ring 
sira, dadi sira amirësëp fabda ring awangawang, kinon sira amëranga roning 
tal pinakabëlaranira kiwa tëngën margabanira anglayanga maring sabrangwe- 
tan, masa sira matia mawab, dadi amërang sira ron tal antak kakalib, pina- 
kabëlarira kiwa tëngën ; anglayang sira mareng sabrang wetan, malaya angang* 25 
si ring Nagamasa, tinat sira binara, angangsi ta sira maring mandaleng Oran, 
tinat binara, malaya angangsi ring mandaleng Kapandangan, katëma ataném 
siramandala, ingalingan siia ingaka woka deniramandala, sira ken Angrok. 
Anakiramandala pada atanëm, kebipan nënëm. Eataja langba atatawa kang 
tanggal, kari lilima; kang langba ginanteu atanëma denira ken Angrok, tëka 30 
kang ambara ring sira, tar angacap ring siramandala: „E kaki mandala, bana 
wong arasab isan-bara, angangsi ingkenemaba''. Samabar siramandala : „Kaki 
dayakanira tan taba alifiok ingsan kaki, yen norengkene; bananakingsan nënëm, 
iki atanëm gënëp nënëm, wilangën aga denira, manawa lëwib saking nënëm, 



1. B. woog Maudaug, C. id, — 1. B. anawalan, C. id. — ?2. A. kawihanan. — 18. C. tawaringën. — 14. 
C. ring. — 16. B. afijari, C. id, — A. an sira. — 16. C. amalintanjcan — B. ta sira ontbreekt, C. m^.— 18. B. 
wwit. — 19. B. ta sira ontbreekt, — A. éntal. — 20. ,B. dening kang ambarn — 21. B. asambat — 24. C. angla- 
yang.— 24. B. ja ta (a)marang sira antuk kakilih, C. id, — 25. C. mariiig.— 26. B. RAgamafA, C id, — 27. 

A. majn. — A. atataném.— 28. B. maQ^a. — 2'l, A. en C. ananëro.^A atatahn. — 30, A. ananem, B. atanëm.— 

B. tëkangaburo. — 31. A. ri.— A. ring ontbreekt.—C, E kaki mapdala.— C. anane.— 32. B. ringkene, C. 
M^.— -83. A* tanta. — B. hana ontbreekt, C. m/L— 86. C. iki atanëm onibreektj^B. manmwi 



— 6 — 

tuhn hana woDg len iogkene''. njaring ambnru: „Tnhu yen anakira mandala 
nënëm^ apan kang atanëm iku nënëm". Lës Inngha kang ambara. Lingira 
mandala ring ken Angrok: ^Lungha ta sira kaki, mana^a mangsnl kang 
ambara ring sira; manawa hanamieara gabdaningsan, tanpantuk denira angangsi 

5 iringsun, langha sira angungsi alas'*. Ndan lingira ken Angrok : „Anghermanib 
kang ambnraa''. Ya ta sangkane angalas ken Angrok, ring Patangtangan 
araning alas. Annli sira ken Angrok angnngsi ring Ano. Sah sira ring alas 
ing Tërwag. Mangkin sangsaya mërsab sira. Hana ta sira mandaleng Laki, 
angarëpi wëlaban, mangkat sira amalukii pngagnn, akar}'a pakacangan ambbak- 

10 ta sëkaling rare angon mahi^nira mandala; den-salahakèn ing undangu- 

ndnng den ^radabi kele; katungkvil sira mandala pijër amnlnku pakacangan, 

iugandukandalcan ingambil denira keu Angrok piuet sëkalO; nangkën dina 

sira mangkana, kepwan sira mandala dening baryan dina kelangan sëganing 

pangon; pangncapiramandala : „Parau sangkane hilang sëknl iki'\ Mangkin ta 

15 inginte sisingidan sëganing pangonira mandala ring wëlahan, pangone den-kon 
amalakna; tando datëng sira ken Angrok sakingjëro alas. pak^anira ken Angrok 
angambila sëkiil pnnika. Sinapa deniramandala : ^Kalingane sira kapo kaki nga- 
met sëgane pangon-ingsnn ika nangkën dina". Sumabur ken Angrok : „Singgih 
kaki mandala; ingsan amet sëgane pangonira nangkën dina wetning lapa-ingsnn 

20 tanpamangan*'. Lingira mandala: ^.Lali kaki datënga ring a<;ramaningsun sira 
yen bana lawc, amalampaba sëknl nangkën dina; apan ingsnn pratidina anga- 
dangadang tëkabaning tatamn''. Tëbër ingajak sira ken Angrok datëng ing 
Batur denira mandala, sinwagatan sireng sëknl nlam. Lingira mandala ring 
istrinira: ^Nini bbatari ingsun amëmëkas ing sira, lamnn ken Angrok 

25 maririkia; mon ingsan tan hana ring umah tnwi; kukarënën tamnli; amëla- 
sakën''. Ya ta ken Angrok katutur nangkën dina tëka, lunghanira saking ri- 
ka mara ring Lnlumbang, maring Banjar kocapet. Hana ta sira mandaleng Turj^a- 
ntapada; mnlib sira mareng Kabalon, parabira sira mpn Palot; among dhar- 
makaöcana; agurn ta sira ring hyang buyut ing Rabalon; pangawaking dharma- 

30 kafieanasiddbi; siddhisanidya; mantak ta sira mpn Palot saking Kabalon amawa 
ta sira lakar; awrat limang tahiK areren ing Lulambang, awëdi sira mpn Palot 
maliba dewek mareng Turyantapada, rehiug wontön wong kawërta anawala ring 
marga aran sira ken Angrok. Sira mpu Palot tan wruh ring patatunggalaning 

1. B. abura, C. id. — 2. B. apan ... lés ontbreekt — C les ontbreekt.-- B. abnru. — 3. B. lunghaha, 
C, id. — 4. B. abarn, C. id- — B. B. ingisan, anuli. — C. Aogro. B. pangher manib aburua, C. id, — 6. C. 
BangkaaiDg alas ken Arok ring Pataugtangan araninjj alas. — ". B. maring. — 8. A* sangsayan, — B. Lakih. — 
9. B. angarëping — A. panggagan. — 11. A. den-wadahin. — 12. A. ingainbingambil. — 18. B. kepon, C. id, — 
14. A. pangangon. — A. paogucap sira. — 15, A. ingantc. — A. en B. ]>ani;an,i^onira. — A. panganxone. — 
A. en C. dene mnlnkna. — 17 C. amet.~IS B. sëgane paue. — A. pangangoning^un. — B. naken. — 19, A. punganjeo- 
nirm. — .■». en C- lamauingsnn. — 21. B. yen aluwe. — A. anga^angadanga, — 21 . B. töhër bhinakta sira, C. id, — 23 B' 
den.— B, rinogatan. — 24. B. stri. — 25. B. maririki. — B. amëlasakën ontbreekt — 26. A, atntur. — 27. A. kuct- 
\ C. att.-*-80. B. s«Ddbik&nidli7a,-«i- 



— 7 — 

woDg; ya ta katëmu sira ken Angrok ring parerenan. Lingira sira ken Angrok 
ring sira mpu Palot:' „Udnli datëng ing pnnëndi rakaki pnknlun". Lingira mpu 
sumaliar: ^alulangha ingsun kaki saking Kabalon, ayun mantnka mareng Turya- 
ntapada; awëdi ingsun ring marga, anënggnh hana wong anawala aran ki Angrok." 
Mesëm sira ken Angrok; lingira ken Angrok: „Lab pukulnn^ranakirayangatëra 5 
mantnk i rakaki, rapntnnira mëne anglaw^ana yen kapanggih wong aran ken Angrok 
punikU; lumaris ugi sira kaki mantnk mareng Turyantapada^ sampan walang hati'' 
Kapihntangan sira mpu ring Turyantapada angrungu sanggupira ken Angrok. 
Sa ëkanireng Turyantapada^ ya ta winarahan dharmakancana sira ken Angrok, 
enggal bisa, tan bana sor timbangana ring kagaktinira mpu Palot. Nëhër 10 
ingaku wëka sira ken Angrok denira mpu Palot; sangkaning agrameng Tu- 
ryantapada ingaran ing mandaleng Bapa. Mangke polabira ken Angrok anga- 
ku bapa ring sira mpu Palot; bana po deni(ng) kakuranganira mpu Palot; ya 
ta karananira ken Angrok kinon marang Kabalon denira mpu Palot; kino- 
nira amutusakëna dbarmakancana; ring byang buyut ing KabaloU; anguwusa- 15 
këna lakar katunanira mandaleng Bapa. Mangkat sira ken Angrok datëng ring 
KabaloU; tan kapibandël sira ken Angrok denira sang apalinggib ring Kabalon. 
Samangka ta sërugën sira ken Angrok: ^mogba bana ëmbang ring panapen'\ 
Sinuduk denira ken Angrok; malayu angungsi ring byang buyut ing Eaba- 
lou; ingatagakën sira parakategan sabaneng Kabalon paragurubyang tëkaning 20 
kapuntaU; sama niëdal amawa palugangga, amburu ring sira ken Angrok 
samamukul ing pahigangQa pak^anira sang tyaga aminonanayun amatenana 
ring sira ken Angrok. Mogba angrungu ujaring ilkaQa: „Hayo denira-pateni 
wong iktt, sang tyaga, yugamami rare iku, tangeb gawene ringmadbyapada." 
Mangkana ^abda akaga karungu denira sang tyaga. Ya ta tinulung ken Angrok 25 
anglilir kadi pralagi. Tëbërken Angrok angënakënupata; lingira: „Tanhanaba 
tega ring wetanini^ Kawi tan siddhaning dbarmakaücana.'' Sab sira ken Angrok 
saking Kabalon, angungsi Tuiyantapada, sira mandaleng Bapa, siddba ring 
dbarmakancana. Sab sira ken Angrok saking mandaleng Bapa maring pra- 
de^eng Tugaran. Nora ta wilasa sira buyuting TugaraU; rinusuban wong Tu- 30 
garan denira ken Angrok, ya ta ingëmban ta gopala sinalababën ing mandaleng 
Bapa, dadi kapanggib nnakira buyuting TugaraU; ananëm kacang ing paga- 
gan. Mangke ta ikang rara rinowang asanggama denira ken Angrok; alalama 
kacang kakampilan, sangkaning kacang Tugaran wijine akulimis agung agurib. 
Sab sira saking Tugaran, mulih sira maring mandaleng Bapamuwab. Lingira 35 

2. B. ing.— A. pundi.— 3. B. ningsun, C. wf.— B. maring, C, irf. — 4. C. ing.— B. anawalan, C, irf— 6 . 

B. Angro. — B. rakauira angatëra, C. «rf.— 6. C. ing. — 7. B. ugi rakaki. — 8. A. ngrasa kapihutangan. — A. mpu 
Turya". — 9. B. winaran.— 10. A. ring ontbreekt. — 11. B. ikaku. — A. en B. a^arame. — 12. B. bapa ring mangke, 

C. «/.— 14. B maraheng, C. id.— B. dera mpu, C.frf.— 16. B, 44téngi,C. datëng ing.— 18. A.Bamangkana—A. 
aréngénira — 19. C. maln. — 2). A. ring ontbreekt. C. sira ring. — 22. B. amingronana ayun, C. t^., <^A aliayun. 
—23. A. en C. ring ontbreekt.^ B. dera. C. «/.— 24. B. kading.— 27. C. tetega.— 29. B. prmdc^a ring.— S2 A. 
y^nggrgr"^ — S3. B. muds. — 34. B. id, — 35, B. mareng. 



— 8 — 

ken Angprok: ^Yen ingsun dadi wong adSnaha pirak ring kaki mandaleng Bapa^ '. 
Kaw6rta sira ken Angrok ring nagareng Daha^ yen arusnh asënötan ring Tn- 
ryantapada, ingilangakën saking Daha^ riDnrnh dening wong saking Daha, 
Inngha saking mandaleng Bapa, angnngsi sira maring gnnuDg Pustaka. Sah sira 

5 saking rika, angnngsi ring Limbehan, wilasa sira bnjniting Limbehan^ innngsi sira 
ken Angrok; wékasan ananakti sira ken Angrok maring Rabut këduDg Paniti- 
kan. Katnrnnan sira widhi, kinon mara ring Rabat gunnng Léjar^ ring dina 
Bndha hiréng ing Warigadyan^ sira paradewa abnm akuknmpul; mangkana 
lingira nini ring Panitikan: „Mami angrowangana as^^nëtana kita bapa^ tan 

10 hananing wraha, mami ta ananapna ring gunnng Léjar sëdénging dewa ahnm 
kabeh." Mangkana lingira nini Panitikan. Ya ta mara sira ken Angrok ring 
gnnnng Lëjar. Katëkan pwa Budba hirëng ing Warigadyan^ mara pwa sira 
ring pahëman. Ya ta sira asënëtan ing pawnban ingurugan snkët denira ra- 
nini Panitikan. Téhër muni kang saptaswara gëntër pater lindu këtng kilat 

15 halisyns haliwawar^ hudan salab masa^ tanpantara teja wangkawa, ndan samang- 
kana sira angrëngö (abda tanpantara; bumwang gnmuruh; rasaning abuma- 
ning watëk byang: ^Ikang angukabana ring nü^a Jawa, yaya tandi mandala". 
Mangkana ÜDg sang watëk dewata kabeb sama asalanggapan njar: ^Ndi kang 
yogya prabbua ring nusa Jawa"; patakoning watëk byang kabeb. Sumabnr byang 

20 Gnm: „Wmbanta kabeb watëk dewata^ bana si yngamami; manu^ wijiling wong 
Pangkur, ika anguknbi bbümi Jawa.'' Samangka mëta ta sira ken Angrok saking 
pawnban; katingbalan sira dening watëk byang; sama kayogyan sang watëk de- 
wata; ya ta inastwakën sira bbi^ekabbatara GurU; mangkana kastwanira de sang 
watëk dewata; asurak asanggaraban. Winidbyan sira ken Angrok angangkëna 

26 bapa ring sang br^bmana makanama sira danghyang LobgawO; wabn tëka sa- 
king Jambndwipa kinen apanggiba ring Taloka; samangkana mulaning brabmana 
hana ring wetaning Kawi. Dak maring Jawa tanpabawan parabn, atampakan 
roning kakatang tëlnng tngël; mëntas sira annjn prade^a ring Taloka; midër 
sira dangbyang Lobgawe angulati sira ken Angrok. Lingira dangbyang Lob 

30 gawe : „Hana rare adawa tanganO; aliwat ing dëknngO; tulise tangane tëngën 
cakra; kang kiwa (angka; aran ken Angrok; katon ing pujamami; kadadinira 
bhat&ra Wi^nU; pawarabira ngnni dak ing Jambndwipa : eb dangbyang Lobgawe 
wns mono denta miya ring Wii^naarccba; mami tan bana ring kene; ngong 
angjanma m&nn^a maring Jawa, kita tamutareng mami; aran ingong ken Angrok; 



1. B. dadio. — B. sd&lia. — 4. A. angunKSira msring. — 5. B. awilasi. — B. inungsi dera ken. — 6. A. 
anakti.— A. Habnt g^nng, — 7. B. mara mariofc, C. maraha maring. — B. dina ring Badha, C. id. — 9. B.. 
ling ranini. — A. asënëtan bana.— C. kitanakita bnpa,— 10. C. ahuham.— 14. B. kAlatilny.i4AUvrivrir.— 16 
C, boman. — 17. B. angakuhana.— B. Üli, C. »rf.— 18. A. en C. siri witék— B. nli ta yogya, A. 
ndi kang ontbreekL^\9, A. prabha,— 20. A. syaga— SI. C, ta mëtu — 22. B. samangkayogyan.— 21, B. 
winidbya — B. ngan^këna, C. angkëna —26. A Logawe.— 26. B. »aman8cka. C. irf.— 27. B. Uopawan, C. 
fi/«^28. B. tttang panvgél, C. »i— 29. B. aigalat ing.— 30. A, en C. talii.— 31. A. daleaira.— ;J2. A. 
A aguii Bdaky K. fjiwam ri Bg n oi nJUücr- B. •.— 34. B. «gannuy B. »i/. — B. kaa oMreekt^ 



— 9 — 

ulatana mami ring kabotoliaii'\ Tando sira ken Angrok kapanggih ring 
kabotohan^ winaspadakën singgih kang katon ins: pnjs^ denira dangbyang 
Lohgawe. Tumuli sira tinauan, lingira dangbyang Lobgawc: ^lya sira kaki, 
aran ken Angrok, sangkaningsun wrub ing sira, katon ing puja deningsun". 
Sumabur ken Angrok: ^Singgib pukulun, ranakira aran ken Angrok.*' Ri- 5 
nangkul sira denira sang brabmana. Lingira dangbyang Lobgawe: „Ingsun- 
aku anak sira kaki, ingsun-rowang duk anastapa, ingsun-wong saparanira/' 
Sah sira ken Angrok sakiug Talokab, mara sira ring Tumapël, milu sira brab- 
mana. Satëkanira ring Tumapöl kapanggib kaladega, ati sira asesebana ring 
sang akuwu ring Tumapel, aran sira Tunggul araötung. Kapanggib sira sineba. 10 
Lingira Tunggul amötung: „Bbageya pukulun sang brabmana, saking punëndi 
sira banar katingbalan." Sumabur sira dangbyang Lobgawe: „Eb kaki sang 
akuwu, banar saking sabrang ingsun, ati ingsun asewakaba maring sang akuwu 
ingsun kaki, lawan akonakoningsun anak puniki ayun sumewakaba ring sang 
akuwu". Sumabur sira Tunggul amétung: „Lab suka ingsun sira dangbyang 15 
yen sira santosa wontöna ring siranakira". Mangkana lingira Tunggul amétung. 
Alawas sira ken Angrok amaraseba ring sira Tunggul amétung, sang akuwu ring 
Tumapël. 

Dadi bana bbujangga boddbastbapaka ring Panawijen, lumaku mabaySna, 
atapa ring setraning wong Panawijen, apuspata sira mpu Pürvva. Sira ta anak- 20 
anak stri tunggal, duk dcrengira mabayana; atyanta ring listu-bayuning 
putrinira, aran ken Dëdës. Sira ta kawërta yen bayu, tan hana amadani lupa- 
nira yen sawetaning Kawi kasub tëkeng Tumapël. Karungu denira Tunggul 
amétung, tumuli sira Tunggul amétung daténg ing Panawijen, anjujug maring 
dukubira mpu Purwa, kapanggib sira ken Dédés, atyanta garjitanira Tunggul 25 
amétung tumon ing rara bayu. Katuju sira mpu Purwa tan bana ring pata- 
panira, samangka ta ken Dëdës sinabasa pinalayokén denira Tunggul amétung. 
Saulibira sira mpu Purwa sakiug paran tan katëmu siranakira, sampun pina- 
layokén denira sang akuwu ring Tumapël, tan wrub ring kalinganira, ya ta 
sira mpu Purwa anibakën samaya tan rabaju, lingira: „Lab kang amalayokén 30 
anakingsun mogba tan tutuga pamuktine matia binabud angéris ; mangkana wong 
Panawijen asata pangangsone, mogba tan mëtua baüune bejine iki, dosane nora 
awarab iringsun yen anakingsun den-walating wong". Mangkana lingira mpu 
Purwa. pKalawan ta anakingsun marajakën karma amamadangi, angbing sot- 
mami ring anakmami mogba anëmwa rabayu den-agung bbagyane". Mang- 35 

1. A. ulana. ^1. A. en C. samansrkana inji^sun. — 5. B. aran Aofin^>lc» C. id. — 6. B. lingira dangbyang 
Lohgawe ouibreekt. — 7. A. aanak.^B. isu rowan;5. — A. mong. — 8. B.Tapoloka. — B. maring. — 9. B. Tumèl 
smanggih. — 13. B. aranira. — 11. A ageja, B bhahigeya, C id,—\2. B. sira puniki. — 14. B. lairan ta.— A. 
en C. snmewaka. — 21. A. antjantalitnbayu. — 22 B. aiiran, C id, — B. ta ontbreekt, C. id. — A. ama^anring 
rupe. — 25. B. sira ontbreekt. — A. en B. antyanta. — 28. C. sira ontbreekt, — A. pinayokën. — 29. B. sang 
ontbreekt, C. id, — 31. A. mati. — C. mangkana ta. — 32. A. baüuneng beji iki. — 33. B ring isnn. — A den- 
wanglat, B den-walati —35. A. mogha onëmu rahayn, B. mogba arabayn, C. moghs anëmn arabayu. 

Ycrb. Bat» Geu., deel ILIX. 2. 



-^ 10 — 

kana sotira maliayana ring Panawijcn. Satëkanira ken Dëd^s ring Tumapël rino- 
wang sapaturon denira Tunggul amëtung, tan si pi siliira Tunggul araètung, wahn 
ngidam sira ken Dödés, dadi sira ïunggul amétung akasukan, acangkrama soma- 
han maring taman Boboji, sira ken Dédés anunggang gilingan. Satëkanira ring 

5 taman sira ken Dédës tuuiurun saking padati, katuwon pagawening widlii, 
kengis wëtisira, kengkab tékcng raha<^yanira, nëhër katon murub denira ken 
Angrok, kawëugan sira tuminghal, pituwi dening hayunira anulus, tan hanama- 
dani ring listu-hayunira, kasmaran sira ken Angrok tan wruh ring tingkahanira. 
Saulihira Tunggul amëtung saking pacangkraman, sira ken Angrok awarali ing 
10 sira danghyang Lohgawe, lingira: „Bapa dangliyang, hana wong istri murub 
rahasyane, punapa lak§ananing stri lamun mangkana, yen hala rika yen ayu 
rika laksananipun''. Sumahur sira danghyang: „Sapa iku kaki". Lingira 
ken Angrok: „Wontön, bapa, wong wadon katinghalau rahasyanipun deningsun''. 
Lingira danghyang Lohgawe: „Yen hana istri mangkana, kaki, iku stri na- 

15 ri^wari arane, adimukyaning istri iku, kaki, yadyan wong papa angalaparing 
wong wadon iku, dadi ratu aüakravvarti". Ménëng sira ken Angrok, ri wëkasan 
angling: „Ba^pa danghyang, kang murub rahasyanipun puniku rabinira sang akn- 
wu ring Tumapël; lamun mangkana mauiia-bahud angëris sirakuwu, kapa.^ti mati 
de mami, lamun pakanira angadyani''. Sahuri ra danghyang: „Mati, bapa kaki, 

20 Tunggul amëtung denira, anghing ta iugsun tan yogya yan angadyanana ring ka- 
harépira, tan ulahaning pandita, ahingan sakaharëpira'. Lingira ken Angrok: 
„Lamun mangkana, bapa, ingsunamit ing sira'. Sumahur sang brahmana : „Ma- 
ring punëndi ta sira kaki". Sumahur ken Angrok : „Ingsun datëng ing Kamman 
wontën bobotoh angangkën wëka iringsun, aran sira Bango samparan, asih iringsun; 

25 punika ingsun-tarinipun kadiangyogyanana''. Lingira danghyang : „Rahayuyan 
mangkana, sampun ta, kaki, sira alawas ing Kamman''. „Lingira ken Angrok: 
„Punapa karyaningsun alawasa". Sah sira ken Angrok saking Tumapël, tëka si- 
reng Kamman, kapanggih sira Bango samparan. „Saking ëndi kawëtunira, alawas 
tan mareringsun, kadi ring swapna ingsnn atëtëmu lawau sira, alawas tëmën deni- 

30 ra lungha'\ Sumahur ken Angrok : „Wontën ing Tumapël ingsun bapa, amaraseba 
ring sirakuwu. Sangkaniogsun maring sira, hana rabinirakuwu, tumurun saking 
padati, kasingkab rahasyane, katon murub dening^un. Hana ta brahmana haüar 
angajawa, pu^patanira danghyang Lohgawe, sirangaku wëka ring ingsun, ingsun- 

35 takoni: punapa araning stri yen murub rahasyanipun. Lingira sang brahmana : 
uttama dahating stri yen mangkana, arane iku kang sinangguh stri ardhanari^wari 

1. A. mnyana — 2. A. wahu angarbiai aira ken pëdës — 3. B. asomalian. — 6. B. ra<ya — B. tëhër. — 7. C. 
analn. — 8. B. ring kalitahayon, C ui — 10. B. lingira ontbreekt. — B. ëtri. — II. T. k^na — 12. A-ringlak^a- 
naoipnn, B. kalak^nauipun — 16. B. aHakrawati ontbreekt^ C. id. — C. ring. — 17. C. sang ontbreekt,— \^. C. 
maogkanaha. — 19. B. deniro, C. du-munira. — 2i. A. ^^töng ri. — 24-. B. riiuisun, C. i^ — U. rin^isim, C. trf. — 25. 
A. kang dali. — B. lingira. — '28. B. kawetonira, C. id. — ^d, A. (a. — B. 8U[ma, C. id. — 'ó4i. B. anama sira, 
G. idL— BL aira ta anp^ko.-^ B. iiigiiaa, C. id. — 33. B. lamun.-' B. san^ ontbreekt.'^^^, A. dat.— B- 
UuDiiiV C M^— B. tinfioggo, C. id. 



— 11-. 

ika, j^nlaksana témën, pan ikn asingadërwerabi^katëkandadi raiuaSakrawarti. 
iDgsun ta, bapa Bange, kapcngin dadi ratu, Iiarëpingsan ki Tunggnl amëtung ing- 
san-patenana, rabine ingsun-alape, malar bapa, ranakira dadi ratu, amalakn ingsan 
pangadyanira bapa dan^^hyang. Ujarira danghyang: kaki Angrok tankawa^a 
ring brahmana yan angajéngana ring wong angalap rabining arabi, bingan 5 
sakabarëpira piambëk. Punika karananingsan maring bapa Bango, malaku 
adyanadyanira bapa ingsuii-ci Irane sirakuwu ring Tumapël, wyakti mati 
sirakuwu deningsun''. Sumahur sira Bango samparan: „Rahayuyenmangkana. 
Ingsun, kaki, angadyani, yen sirfiharëp ambahudangeris ring sira Tnnggulamëiung, 
anghing ta sira kaki Angrok, sirakuwu t(^gub, luanawi nora tëdas yen dera- 10 
Buduka ring këris kurang yoniuya. Hana mitrauingsun pande ring Lulumbang, 
aran pu Gandring, yoni olih agawe këris, norana wong atëgub dene pagawene, 
tan amingroni yen sinudukakën, ika konen akarya duhung. Yen huwus dadi 
këris, nggeniraüidra ring ki Tunggul amëtung*'. Mangkana wëkasira Bango 
samparan ring ken Angrok. Lingira ken Angrok: „Amit ingsun, bapa, maring 15 
Lulumbang". Sah sira saking Kamman, nuli maring Lulumbang, katëmu sira 
Gandring anambut karya ring gusali, tëka ken Angroic tur atakon: „lya sira 
baya aran Gandring. Lab rëko ingsun pagawckëna këris, huwusa limang wulan, 
agatana gawene deningsun''. Lingira mpu Gandring: „Sampun limang wulan 
punika, lamun sira ayun den-apënöd, manawi satahun buwus, enak ratëngpa- 20 
palonipun'*. Liugira ken Angrok: ,,Lab sarupanc gugurindaue, angaing den-bu- 
Wtts limang wulau". Sah ken Angrok saking Lulumbang, maring Tumapël, kapang- 
gih sira danghyang Lohgawe, atakon ing ken Angrok: ,,Paran sangkaniraala- 
was ing Karuman''. Sumahur ken Angrok: „Sumëlang manira, bapa, ring Lulum- 
bang*'. Samangka ta ken Angrok alawas apanganti ring Tumapël. Huwusing 25 
gCnëp limang wulan, engët ing samayanira yen aken angg.iwe këris ring sira mpu 
Gandring. Mara sira ring Lulumbang, katëmu sira mpu Gandring anggugurinda, 
aninigasi papalampahanira keu Angrok këris. Lingira ken Angrok: „Èndi ken* 
kenaningsun ring kaki Gandring". Sumahur sira Gandring: „Singgih kang ing- 
sun-gurinda puniki, kaki Angrok". Finalaku tininghalan punang këris denira 30 
ken Angrok. Lingira asëmu bëndu: „Ah tanpolih deningsnn akonkon ring sira ki 
Gandring, apan durung huwus gugurindaue këris iki, lagi asëbel, iki kapo ru- 

1. B. ta siDg adniwea rabi, C, id. dfch sdërwe. — B. afiakrawarti ojtiöreekt, C, m^.— 2. A.kapengi^dan 
dadï, B. kapeojcin dadia. — B. kaharëpingsun. — 3. C. patenane. — B. san. — B. dadia, C. id. — 4. ujarira 
tang brahmana, C, id, — 5. C. wong alap. — B. rabining wong, C. id. — ft. A. ing ambék — 7. A. wyakti ma 
aira. — 8, B. siraknwa ontbreekt, C. id. — 9, A. augndangérié. — B. sira ontbreekt— \0, B. atëgub, C. m/.— 11. 
B. ringkës. — C. yonine. — B. bana ta. — 12. A. yeni. — C. nora ana. — B. gagaweane, C. id, — 13. A. ami- 
rwitni, B. amironi. — A. sudukaken. — B. laaiun, C. il. — B. akaryaha, — B. yan awus, C. yaa huwus — 14. 
B. ënjtgen, C. id. — A. GiJra, C. fiilraba rins:. — 16. B. anuli C. id, — 17. B. rawub, C. id, — B. anakon.— 19. 
B. a^ata, C. agati. — B. npun, C, lingingaranpu — A. lima wulan. — 20, B. depun-apënëd.— 23. A. la- 
waf. — 24. B. sumëlang maring Lulumbang manini, bapa, C. u/.— 25. B. amanganti. — B. buwus agënëp. — 
26 B. M C. sasamHyanir*.— B. akenken këris C. aken këris.—SS. B. la ëndi.— 80. A. punang këris os^ 
kntki 13, A. akoakona sira. — 32. A. aaëkeL 



— 12 — 

pane kang dera-lawas limang wulan lawasc". Apanas twasira ken Angrok, dadi 
siundukakën ing sira Gandring köris antukira Gandring agawe ika. Anuli pi- 
nërangakön ing lumpang gela pambÖb5kan gurinda, bëlab aparo; piuërangakén 
ing paronira Gandring, bëlah apalih. Saniangka sira Gandring angncap: „Ki 

5 Angrok, kang amateni ring tërabe këris iku, anak-putunira mati denekrisiku, 
olih ratu pipita tëmbe këris iku amateni'. Wusira Gandring angucap mangkana, 
mati sira Gandring. Samangka ta arupa analabasa sira ken Angrok patinira Gan- 
dring. Lingira ken Angrok: „Lamun ingsun dadi wong tumiisa ring anakputune 
apande ring Lulumbang". Töbër mantuk sira ken Angrok maring Tumapël. 

10 Hana kakasihira Tunggul amëtuug, aran Këbo hijo, apawong sanak 

asihsiban lawan ken Angrok. Satingbalira Këbo bijo ring sim ken Arok anung- 
këlang duhung baüar, adanganaü cangkring katut rinipun tanpagagala wungkul, 
arëmén sira Këbo hijo mulat. Angncap ing ken Angrok: „He, kaka, sun- 
silihe körisira iku". Sinungakën dcuira ken Angrok, ingangge denira Këbo 

15 hijo tumuli, wetning rësëpira tunion; alawas ingangge denira Këbo hijo du- 
hung saking ken Angrok punika, uora hana wong Tumapël tan sapek§aha yen 
sira Kebo hijo anungkëlang duhung lianar. llogha ta mangke duhung punika 
minalingan denira ken Angrok, këna dening amalingi. Tèhër ken Angrok 
kala ratri anuli maring dalem pakuwon, duwëg sirëpiug wong, katuwon denira 

20 dinuluraning widhi, anuli mareng paturonira Tunggul anu^tung, tan kawara 
lakunira, sinuduk sira Tunggul amëtnng denira ken Angrok, tërus prananira 
Tunggul amëtung mati kapisanan. Këris antukira Gandring agawe kinatutakën 
minaha. Mangke huwus rahina kawaswasan duhung tumanëm ing jajanira 
Tunggul amëtung, tinëngër dening won;;^ kang wruh kërisira Këbo hijo, kang 

25 inganggo sabran dina. Pangucaping wong Tumapël kabeh: „Ki Këbo hijo 
kalingane kang anidra ring sira Tunggul amëtung, apan sawyakti körise katut 
ing jajanira sang akuwu ring Tumapël." Samangka sira Këbo hijo siniköp 
dening kadang-vvargganira Tunggul amëtung, tinëwëk ing këris antukira Gan- 
dring akarya punika, mati ki Këbo hijo. 

30 Hana ta anakira Këbo hijo, aran Mahisa randi, alara patining bapa, 

ya ta winilasan kinatik denira ken Angrok, atyanta wëlasira ring Mahisa randi. 
Mogha hyang dewa sirandandani, tuhu yan kraraanira ken Angrok ring sira 
ken Dëdës, alama akakarëpan, tan hananing wong Tumapël wani angucapa sa- 
tingkah-polahira ken Angrok, mangkana sakadang-warganira Tunggul amëtung 

35 ménëng tan hana wënang angucapa, ya ta apanggih ken Angrok lawan ken 
Dédës. Sampun ta sira abobot tigang lek katinggal denira Tunggul amëtung, 
kaworan denira ken Angrok, atyanta denira silihasih sira ken Angrok lawan 

1 A. lawan, B. lalawas— 4. A. amalih.— 9. B. apapdca, C. id,—\0, B. hana ta. — A. apawor, B. 

apawo. — 11. A. asihsihën,— 12. B. dn liafiar, C. duhungafiar awamngka hafiar.— , B, adanganan tangkrimr, C. 

•fangari cangkrinfc— 19. B. ring ralri, C. «/.— 20. B. dinularing, C. id,— 23. B, dudühuag.--2S. B. kërisin 

Gandrinir.— 80. B. matining,— 81. A. en C. ring ont6reekt,^32, B. yen.— 33, A, tan haning wong.— 35, 

B. angncap, C. u/.— 36. A. nëm wnlan,— 37. B. kakwan. 



— 13 — 

ken Dëdës, a'awas papanggihira. Gënêp leking rare mijil anakira ken Dëdés 
lanang, patutanira Tunggul amrjtung, ingaranan sang Anusapati, papaujinira sang 
apaujy An^ngah. Alania sira papanggib ken Angrok kalawan ken Dëdés, malih 
aputra ken Dédés lawan ken Angrok, niijil lanaug, aran sira Mahisa wong 
atèieng, mwah ari denira Maliisa >fong atdlöng lanang aran sang apaiiji'Saprang, 5 
arinira pauji Saprang lanang aran sira Agnibbaya, arinira Agnibbaya wadon 
aran sira dewi Kimbn; papat patutanira ken Angrok lawan ken Dëdës. Hana 
ta binibajinira ken Angrok anoni; aran sira ken Umang, sira ta apatntan lanang 
aran sira pauji Tobjaya, arinira pauji Tobjaya lanang aran sira paiiji Sudbatu, 
arine pauji Sudbatu lanang aran sira twan Wrëgola, ariue twau Wrégola istri 10 
aranira dewi Rambi. Kwebing putra 9, lanang 7 wadon 2. 

Télas purwa wetaning Kawi^ kaputër sawetauing Kawi, sama awëdi ring 
sira ken Angrok, mabu ariwariwa ayun angadëga ratu, wong Tumapël sama 
suka yen ken Angrok angadëga ratu. Katuwon panduluring widbi sang ratu 
ring Daba siraji Dangdang gëiidis angandika ring parabbujangga sabaneng Daba, 15 
lingira: „E, ki parabbujangga ^ewa-sogata, paran sangkanira nora anëmbab 
ring ingsun, apan ingsun saksat bbatara Guru." Sumabur parabbujangga sakapa- 
suking nagareng Kadiri: ,,Pukulun tan wontën ing kinakina bbujangga aném- 
babi ratu." Mangkana lingira bbujangga kabeb. Lingiraji Dangdang gendis: 
„Lab manawa kang ring kuna nora anëmbab, kang mangko ta ingsun sëmbabën 20 
denira, manawa sira tan wrub ring ka^*aktiningsun mangko sun-webi pangawyakti." 
Mangke ta siraji Dangdang göndis angadégakön tumbak, landeyanipuu tinaficëba- 
kën ring lëmab, sira ta alinggib, ring pueuking tumbak, tur angandika: „Lab pa- 
rabbujangga dflëngën kagaktiningsuu." Sira ta katon acaturbbuja, atrinayana, 
sak^t bbatara Gum rupanira, winidbi ani^mbaba parabbujangga sakapasuking 25 
Daba, sama tan barëp anëmbaha ur mërsab pada angungsi maring Tumapël asewa- 
ka ring ken Angrok. Samangka niulaning Tumapël tan abidëp ing nagareng Daba. 

Tumuli sira ken Angrok inastwakën prabbu ring Tumapël, araning 
nagara ring Singasari, abbijjickanira rri Rajasa, bbatara sang AmQrwabbü- 
mi, ingastrj^an dening bbujangga scwa-sogata kang saking Daba, makadi sira 30 
dangbyang Lobgawe sira asangkapani, kunëng kang asib awèlas ring sira 
ken Angrok ing kina duk sira sëdëng kasyasib, pada ingundang kabeb, tinu- 
lung denira winalës pawilasane, makadi sira Bango samparan, tan ueapën 
siramandaleng Turjantapada, lawan anaking apande wësi ring Lulumbang, 



2. C. inarasan. — 3. B. en C. alama sira patatan malih (C. manih) lawan nira ken Angrok, mjjil lanang 

5. B. denira ontbreekt. — 7. C. pat. — A. hana rabinihaji — 8. A. Unia. — 9. ari lanang aran. — 10. B. arine 
paiiji Sudhatn ontbreekt.— h. tnhan, C. fV/.— B. stri, C. id—\\. B. putra 9. 7. wadon 2.-12. B. tilas.— 
B. pawetan — 13. A. ariwan. — 14. B. yan. — 16. A. liogira ontbreekt. — 18. B. tan woning. — A. ikina- 
kira. — 19. B. ring ratn. — 20. A. i kuna. — A. en C. manyke. — A. sëmbehén — 21. B. ing. — A. mang- 
ke. — B. pangawakti. — 23. B. ing. — 25. A. en C. sapasuk. — 26. B. mérsah ontbreekt^C, — id. — A. mareng. — 
A. aaewa ken, B. ring. — 31. B. aaangkamapi.— 32. A ingnnda. — B. tinuln. — 34. B. mapdala ring. — B. 
Tayantapada. 



— u — 

aran pn Gandring, gatnse apaiide ring Lulumhang Inpntesg saarik purib^ satam* 
pakiDg wulnkune wadung pacule. Hana anake ki K6bo hijo den-pada kawë- 
\vênangane lawan anake pn Gan:lring. Hana anakira bapa danghyang (Lobgawe) 
aran vvangbang Sadang, patutanira lawan wong Wisnn, tëmoki^na kalawan anakira 

5 bapa Bango kang aran Cacnpurantiy mangkana rasaning andika sangAmürwa- 
bbüuii. Atyanta kr^taning nagaranïng Singbasari; paripürna nirwigbna. 

Alawas karëngö wrrtanira ken Angrok yan huwus pangadég ratu, ka- 
hatur ing siraji Dandang gendis yen sang Anifirwabhümi harëp amérépa maring 
Daba. Andikaniraji Dandang gëiidis: „Sapa taangalabakënaringnagaraningsnn 

10 iki; manawa kalab lamun bbatara Garu tuniarun saking aka^a, sugyan kalaha". 
Ingataran sira ken Angrok, yan siraji Dangdang gëndis angandika mangkana. 
Lingira sang Amürwabbümi : „E parabbajangga sewa-sogata kabeb, astokëna 
ingsan abbiseka bbatara Gura'\ Samangka ta mnlanirdbbi^eka bbatara Gum, 
ingastwaning bbujangga brahmana rësi. Tnr sira anuli anglnrug maring Daba. 

15 Earëngé deniraji Daugdang géndis yen sang AmQrwabbümi ring Tumapël anë- 
kani andon maring Daba Lingiraji Dangdang gëndis: ;,AIab ingsan sëdënge ki 
Angrok winonglng byang". Samangka ta saujata-ing Tumapël acucub lawan 
saüjata Daba, aprang loring Gantër, apagat sama prawira, anglongi linongan, 
katitiban saüjata Daba. Ariniraji Dinglmg gëndis m)ktah bamakrti ksatriya 

20 raden Mabisi walungan, lawan mantriniixiprawiraaranGubar baiëman; moktah- 
ning arinira Dangdang gëndis mwab wadwa pinakatibati sira Gubar baiëman 
kalih karëbat dening wado Tumapël, amab gunung denipun aprang. Samangka 
ta wado Daba kapalayu, apan kang pinakadining prang sampun kawënang, 
Irika ta saüjata Daba bubar tawon, pungkur wëdus, dabut payung, tan bana 

25 pulib manih. Samangka ta siraji Dangdang gëndis murud saking paprangan, 
angungsi maring dewalaya, gumantung ing awangawang, tëkaning undakan, 
pakatik, juru payung lawan amawa tadab sëdab, tadab toya, panglante, sama 
milu angawangawang. Prasiddba kalab ring Daba denira ken Angrok. Lawan sira 
rayinira (sang Dangdang gëndis) dewi Amisani, dewi Hasin, dewi Paja, mang* 

30 kin sama katuran yan siraji Dangdang gëndis alab aprang, karëngö wontën 
ing dewalaya gumantung ing awangawang, mangke ta sira twan dewi katiga 
muki^b la wang kadaton pisan. Irika ta sira ken Angrok huwus ing jayasatni, 
mulih maring Tumapël, kaputër bbfimi Jawa denira. Sakakala paüjënëngira hu- 
wus kalah ing Daba 1144. 



1. B. aran . . , hvLinrnhviTig onfèreekt, — A. saariksurih. — B. satampaning. — 3. B. mpu, — 4. B. SaH 
C. id, — 5. B, Cncnparanti. — A. raca. — 7. C. alas, A. alawas kawërtanira. — A. anuwuh.— A. katur,— 8. 

A. aDgdöna.^9. A. en B. sapa.-*10. B. manawa kalah C. id, — 11 A. en C. yan ontbreekt — B. san^aa- 
dika.— 13. A. saniaogkana ta. — 14. A. anuli sira anKluru/. — 15. B. yan. — A. anékauin, B. anétani anëinun. — 17. 

B. samangkaua ta — B. rini'. — 18. B. Kantër. — A. apan^ut, — 20. C. araaran. — 2i2. B. kali. — A. walwan 
Tnnispél. — A, apah.-2J. A. wadwan Daha. — 24. B. tang. — B. Naha. — A. ranngkur piuda. -'25. A. 
mnlih — B. ta ontbreekt"^ f,1 , A. jorn jong. — A, së^a. — A. eaui anga^angawacg. — SO. A. kalab. — 31. 
B. gaoiaati 



— 15 — 

Alawas hana wërta BMg Anusapati, anakira Tunggnl amétnng, ataken 
sira ring pamongmong: „Awédi manira dening sira rama-pakanira", aturing pa- 
mongmong: „aron pakanira matfira ring sira ibn pakanira". Tan suddhanira 
Nn^apati ataken ing sirebunira : „Ibu ingsnn ataken ing sira punapa kalinganira 
bapa yen tnminghal ing isnn, pahe tinghalira kalawan sanakiugsun kabeh, tan 5 
ncapën lawan patranira ibu anom, mangkin pahe tinghalira bapa', Tnhuyan 
samasanira sang Amürvvabhünii. Sahnrira ken Dêdés: ^Kayadudn kangangan- 
dCli; yen sira kaki aynn wruha, sira Tunggul amëtnng arane ramanira ; kating- 
gal ingsun tigang ga^^ih, ya ta ingsnn ingalap deuira sang Amürwabhürai''. 
Lingira Nüsapati: „Kalingane, ibn, dudu bapaningsnn sang Amürwabhümi, punapa 10 
ta ibn padëmira bapa''. „Sang Araürwabhümi, kaki^ amateni''. M^nëng sira 
ken Dédés, arapa kaluputan dening awërta sajati ring siranakira. Lingira Nü- 
sapati: f,lhvi, vvontën duhnngira bapa antukipun Gaudring akarya, ingsan-tëdaui- 
pun ibn". Sinungakën denira ken Dodës. Sang Anüsapati amit mantuk ma- 
ring kamëgëtanira. Wontën ta pangalasanira ring Batil, inundang denira 15 
Nüsapati kinon amatenana ken Angrok, sinnng duhnng antukipun Gandriug 
akarj^a, nggenipun amatenana ring sang Amürwabbümi, ingebang wong Batil 
denira Nüsapati. Mangkat wong Batil mar'ng dalëm kadaton, kapanggih sang 
Amürwabhümi sëdëngira anadah, tëhër sinuduk sira dening wong Batil. Duk 
sira kacfirna Wërhaspati Pon ing Landep ; masanira anadah sande jabnng, 20 
sampun surup prabangkara amasang sanda. Sampuning lina sang Amürwa- 
bhfiiui, malayu wong Batil, angungsi sang Anfisapati^ matur wong Batil : „Sam- 
pan moktah sira rama-pakanira den-manira". Nëhër sinuduk wong Batil de- 
nira Nüsapati. Ujaring wong Tumapël: „Ah bhatara sirengamuk dening 
pangalasaning Batil, sira Nüsapati angëmhari amuk". Ri linanira sang Amürwa- 25 
bhOmi i Qaka 1169. Sira dhinarmeug Kagënëngan. 

Sampun mangkana sang Anüsapati anggautyani aujënëng-ratu, duk sang 
Anü^apaty angadëg ratu i (aka 1170. Alama kawërtaring vadenTuhjaya, siia 
anakira ken Angrok saking rabi anom, nama sang apaüji Tolijaya, ya ta ang- 
rëngö sapolahiranfl^apati angupahakën ing sang Amürwabhümi, moktah dening 30 
wong Batil. Sang apaüji Tohjaya tan suka moktahning sira ramanira, akirakira 
amet pamalës, margahaning kapatinira sang Anüsapati. Wruh sang Anüsapati 



1. yen anakira, C, u/.— 2. A. kamonfcmonft. — A. manira raden ina: sira.— A. kamoninncnfc»— *3. 
C. pakare matura. — 4 A. ibanin/snn, B. ihatin<(sun — A. atikon. — C. pnnapi. — A. lingaaira. — 5. 

A. iriutfson. — A. kalan sanak. — B. sakin;^>an. — 6. B. mangkin saiinghalira. — 7. A,. en B. kans; aa- 
dëli. — 8. A. ayan. — B. katiug^aann. — 9. B. ingambil, C. u/. — 1 1 • A. padémanira. — 14. B. siranzakén. — 

B. ken pé^és riug sang Anüsapati. — 16. B, amoktanana, C. id. — C. ring ken Angrok. — 17. B. smok- 
tsnana, C id, — 19. C. sédénging anadtth. — A. en C. dnkira. — 20. B. Toa ouiireeki, C, id. — 21. 
A. prabamekara ontbreekt, — A. simpnn lini — 23. A. sira ontbreekt, — A. de-man i ra. — i4. A. «ireng* 
kamak. — ^5. B. i BitiU — B. ri ontbreekt. — 11 . A. ag^-ityaai. — 28. A. en B. ang«dëh.a ratn. — A, 
1174. — A. en C. wéxta. — 29. C. kartugö.— 30. C. «-i» sang AnOiapati. — a mokU. C. »i. — SU 
A^ aini mUbrcckL 



— 16 — 

yan kinire denirapaüji Tobjaya, yatna sang Anüsapati, pagiilinganira binalung- 
bang, ring pamëngkang woug angayëugi, pikandël atata Huwus alama 
marëk sang apaiiji Tohjaya amawa sawung sira, mareng bhataranüsapati. Lingi- 
rapaüji Tobjaya: „Kaka, wontën kërisira bapa, antiikipun Gandring akarya, 

5 ingsun-tëdanipun ing sira". Tubu yan samasanira bhataranüsapati. Sinungakën 
duhung antukipun Gandring akarya denira sang Anfisapati, tinanggapan deni- 
rêpaiiji Tobjaya; siniingkëlaug, tumuli dubungira kang ingangge ringuni, sinunga- 
köning wougira. Lingirapanji Tobjaya: ^Duwëg, kaka, ta-bongbong". Suma- 
bur sang Anfisapati: „Lab, yayi". Tumuli aken angambila sawung riögjuru 

10 kurung. Lingiranüsapati: „Lab, yayi, ta adunipun pisan''. ^Singgib", lingira- 
panji Tobjaya. Saina auajcni dawak, saraa akëmbar, katungkul sang Anfisapati. 
Tubu yan sëdëng antakanira, kempër pijér angadokën sawungira, sinuduk d«- 
nirapaüji Tobjaya. Lina sang Anüsapati i Qaka 117L Dbinarma sira ring 
Kidal. 

15 Gumanti sirapaöji Tobjaya aftjënëng ratu ring Tumapël. Hana ta pu- 

tranira sang Anü^iapati, aran sira Rangga wuni, kapërnab kaponakan denirS.- 
paüji Tohjaya. Sira Mabisa wong atëlëug, sanakirapauji Tobjaya tunggaling 
bapa saos ibu, aputra ring sira Mabisa campaka, kapërnab pabulunan deni- 
rapaüji Tobjaya. Duwëgirapauji Tobjaya ingastren, pinarëking mantri sama- 

20 daya^ makanguni sira Pranaraja. Marëk sira Rangga wuni adulur lawan sira 
Kébo campaka. Lingirapaüji Tobjaya: „E mantri samadaya, makadi Prana- 
raja, dëlëngën iki kaponakaningong, kamakara rupane lawan pangadëge. Paran 
rapane musubingong ring nftsantara, dene wong roro iki, angapa denira, Pra- 
naraja". Asabur sërabab sira Pranaraja matur : „Singgib, pukulun, andika pfi- 

26 duka bbatara, apëkikpëkik ing rupa, sama wani sira kalib, augbing pukulun, 
upamanira kadi wuwudun munggwing nabbi, tan wurung sira amatyani ri pu- 
hara". Mënëng talampakanira bbatara, sangQaya karasa aturira Pranaraja, run- 
tik sang apafiji Tobjaya. Tëbër angundang ing sira Lëmbu ampal, kinon ang- 
hilangakëna ring raden kalib. Andikanirapaüji Tohjaya ring sira Lëmbu am- 

30 pal: „Mon luput denira angilangakën ing k^atriya roro iku, ko ndak-ilangaken". 
Dttk sirapanji Tobjaya akon angilangakën ring raden kalib ring sira Lëmbu 
ampal, wontën sang brabmana sëdëng anangkapaneni ring sirapanji Tohjaya, 
denira danghyang angrëngö yan raden kalib kinen ilangakëna. Awëlas sang 
brabmana ring raden kalib, awarab „yan sira Lëmbu ampal kang kinon angi- 

35 langakëna, yen luputa kalib, kaki, sira puniki denipun Lëmbu ampal, pun 
Lëmbu ampal gumanti ingilangakën denira ?ri mabaraja*'. Lingira rahaden 
kalib: „Sira danghyang tambontën ta wontën dosaningsun". Sahurira sang 

8, A. parëk. — 5, B. samayaoira. — 7. A. ingaogge uüi. — 8. A. en C, abongbong. — 11. A. sapaana- 
jeni. — 12. A. en B. ingadokëo.— 13. A. llli, B. 117. — 16. B. U^ ontbreekt. — 18. A. kahulunan. — 22. B. 

këdëngën. — A. kaponakan. — A. kamaka rupane. — 25. B. waniwani, C. iV/.— 26. A. ri pnharaoya. 81. 

B. ndnk, C. id, — A. aken angilangakëna, C. aDgilangëna. — 33. A. alaugakëna. 



brahmana: ^^Aron ta sira kaki asénötana ramuhon". Pinariringakön manawi 
brahmananira adwa, ya ta rahaden sama maring sir&panji Patipati. Andikanira 
raden: ,;Pafiji Patipati ingsun asSnÖtan ring umahira, anënggah ingsun haröp 
ilangakéua bhat&ra, yen ingsun atutharöpilangakëna^norado^aningsan''. Pina- 
rurnngokën denir&paöji Patipati : ^^Rahaden atut, yen pakanira ingilangakën pun 5 
Lëmbu ampal sinalahan". Mangkin enak denir&sënötan kalih, rinurnh sira ra- 
haden kalih tan kapanggih. Pinaramngokën tan kapamngon paranira. Yata 
sinénggeh sira Lëmbu ampal sakarayita lawan raden kalih denira bhatSra. 
Samangka sira Lëmbu ampal ingilangakën^ malajni tasënëtan ing tatangganirê.- 
pafiji Patipati. Angrungu sira Lëmbu ampal yen raden kalih hana ring sirfi- 10 
pafiji Patipati. Ya ta sira Lëmbu ampal marëk ing raden kalih, aturira Lëmbu 
ampal ing raden kalih : ^^Manira angungsi ring pakanira pukulun, do^a-manira 
kinen angilangakëna ring pakanira denira bha(&ra. Mangkin ta maniraanëda 
cinoran manawi manira tan kandël den pakanira^ enakan manira angawula 
ring jëng pakanira''. Sampune cinoran awatara kalih dina, sira Lëmbu ampal 15 
marëk ing raden kalih, matur ing raden: ;;Punapa wëkas pakanira rahaden, 
tan wontën puharanirfisënëtan, manira anuduka wong R^jasa mëne, sëdëngipun 
ababanu''. Tatkala sore, anuduk wong Rajasa sira Lëmbu ampal, ingalokën 
malayu maring Sinëlir. Ujaring wong Rajasa: „Wong Sinëlir anuduk wong Rigasa''. 
Watara kalih dina wong Sinëlir sinuduk dening Lëmbu ampal, binuru malayu ma- 20 
ring Rajasa. Ujaring wong Sinëlir: „Wong Rigasa anuduk ing wong Sinëlir". 
Wëkasan atutukaran wong Rajasa lawan pangalasaning Sinëlir, rame alolongan, 
sinapih saking dalem tan ahidëp. Runtik sir&pa&ji Toljaya, ingilangakën kalih 
batur pisan. Angrungu sira Lëmbu ampal yen wong kalih batur ingilangakën, mara 
sireng wong Rajasa sira Lëmbu ampal. Lingira Lëmbu ampal: ,, Yen sira ing- 25 
ilangakën angungsia ring raden kalih sira, apan sama hana rahaden''. Sanggu- 
ping wong Rsyasa: ,,Parëkakëua ugi, ki Lëmbu ampal, wong batur puniki". Bhi- 
nakta pinituhaning wong Rajasa, marëk ing raden kalih. Aturing wong Rajasa: 
,iPukulun pakanira sakitaha kawula ing Rajasa, sahandika-pakanira, pakanira-cora- 
na, manawi tan tuhu pangawulanipun, pahea rika denipun angawula". Mangkana 30 
wong Sinëlir, sama ingundang pinituhanipun, tunggal sanggupipun lawan wong 
Rajasa, tur pinatut kalih batur sampun kacoran, winëkas : „Mëne sore pada merenea, 
tur amawaha sahayanira sowang sowang, pada ambarananga maring kadaton". 
Sama amit mantuk wong Sinëlir lawan wong Rigasa. Eatëkan sore masa sama 
rawuh kalih batur amawa sahaya, sama marëk ing ayunira rahaden kalih, sama 35 
wano; anuli mangkat ambaranang mareng jëro kadaton. Mogha kagyat sira- 
pafiji Tohjaya, malajëng kapisah, tinumbak tan kapisanan. Marining geger, 
rinurnh dening kawulanira, pinikul pinalayokën maring Katang lumbang. Kang 

8. C. raden. — 5. A. apatat. — 7. C. tan ana paningon paranira,— 8- B. ainëngge. — 9. A. samangka 

iira , wat verder volgt ie onleetbaar, — B. hihilangakën — 14. B. en C. pakanira. — B. tan &ndëg. — 15. 

B. «mpnne ainewatcara kalih dina. — 17. B. tan wëtén. — 20. C. Sinfilir ontbreekL^'^h* B. wong arajasa. — 27. 
B. maiékakcna. — 29. B. eu C. ang.— 33. B. Miya.— C. ring; 

Vcrlu Btft, fleo^ daél XLIX. 8. 



— 18- 

amikül kasingse gadage^ katon pamnngkure. Lingirêpauji Tohjaya ri kang 
amikul: „Bëciki gadagta katon pamungkare". Sangkaning tan awet ratndene 
silit iku. Rawubireng LnmbaDg katang, mokta sira. Anuli dliinarmeng Katang 
lumbaDg. Linanira i Qaka 1172. 

5 Tamnli sira Rangga wuni angadég ratn. Kadi naga roro saleng lawan 

sira Mahi^ campaka. Sira Rangga wuni abhi^eka Wi^nuwarddbana karatnnira, 
sira Mabisa campaka dadi ratu Angabhaya, abhi^eka bhatara Narasinga. Atyanta 
patutira^ tan hana wiwal. Bbatara Wi^nnwardhana angadëgakèn knta ring 
Ganggu lor; i Qaka 1193. Mangkat sira amërép ing Mahibit, angilangakén sang 

10 Lingganing pati. Sangkaning Mahibit alah^ linëbon wong aran sira Mahi^a 
bnngalan. Pafijënëngira Qrt Rangga wuni ratu tahun 14, moktanira 1194;dhi- 
narma sira ring Jajaga. Sira Mahii^ campaka mokta^ dhinarma ring Enmëpër, 
pamëlësatanira ring Wndi kaücir. 

Qri Rangga wuni atinggal putra lanang, aran Qri Eërtanagara ; sira Ma- 

15 hi^a campaka atinggal putra lanang; aran raden Wijaya. Siraji Kërtanagara 
sira aüjênëng prabhu, abhi^eka bbatara Qiwabuddha. Hana ta wongira^ ba- 
batanganira bujniting Nangka, aian Bafiak wide^ sinungan pasënggahan arya 
Wiraraja^ arupa tan kandël denira^ dinohakën, kinon adhipatia ringSungënëb, 
anger ing Madura wetan. Hana ta patihira ndnk mahu afijënëng prabhU; puip- 

20 papata sira mpu Raganatha; nityasa angaturi rahayuaning tuhaU; tan kedëp 
denira Qrt Eërtanagara; sangkanira mpu Raganatha asalah linggih mantun apatib, 
ginanten denira Eëbo tëngab sang apaiijy Aragani. Sira mpu Raganatha gumanti 
dadi adhyaksa ri Tumapël. Sapaüjënëng Qrt Kërtanagara angilangakën kalana 
aran Bhaya. Huwusing kalana mati; angntus ing kawulanira; andona maring 

25 Malayu. Samangka akëdik kari wong Tumapël; akeh kang katuduh maring 
Malayu. Sirapanjy Aragani angatërakën^ mangsul ing Tuban, tëka ringTuma- 
pcl sang apafijy Aragani angaturi tadahan pratidina; akasukan siraji Eërtanagara. 
Hana ta pasawalanira lawan sirSji Jaya katong ratu ring Daha^ pinakamu- 
suhira siraji Eërtanagara, kempër pangaladeQaning ^atru, tan engët yan do^a- 

30 nira. Sira Banak wide atuwuh patang puluh tiga duk pamalayu, amitra lawan 
siraji Jaya katong, asurawean akenkenan saking Madura sira Baüakwide apa- 
sënggahan arya Wiraraja; mangkana siraji Jaya katong autusan maring Madura. 
Sira Wiraraja akirim surat datëng i siraji Jaya katong. Uniningsawalan: „Pu- 
kulun, patik aji matur ing paduka aji, anënggeh paduka ajiayunabuburuma- 

35 ring tëgal lama, mangke ta paduka aji abuburua; duwëg kalade^anipun tam- 
bontën wontën baya, tanbontën macanipun, tambontën bantengipun, muwah 
ulanipuU; rinipun, wontën macanipun anging guguh''. Sang apatih tuba sira 

1. B. 9adaga. — C. ring. — 2. B. gadaga. — B. tan awet sirata dene lit ikn. — 5. B. sira Rangga 
wnni ontbreekt. — 6. C. in plaats van karatnnira: tnr ika. — 8. C. lianana. — 11. B. 1174. — 14. C. Kfttnaga. — 

17. B. paMinggahan. — 23. B. samaDjëDëng. — 29. B. tan angét. — B. do^anira mangkana, regel ^2, 

ontbreekt, — S5. B. sangkets. — C. igi ontbreekt. — B. tanbontën. — 36. B. Vaya, tambontën ontbreekt.'^ 
B. tanbonttn. — 37. B. nlaliipnn. 



— 19 — 

mpn Baganatha kaDg ingaran macan gnguh; apan sampun atuha. Samangka 
sir&ji Jaya katong mangkat amërëp ing Tamapël. Safijata kang saka loring Ta- 
mapël wong Daha kang alaala^ tnnggul kalawan tatabuhan pénnh, rusak de^a 
8aka loring Tumapël; akeh atawan kanin kang amamërangakên. SafijataDaha 
kang amarga lor mandëg ing Mëmëling. Sira bhatara ^wabuddha pijër anadah 5 
^j^u& ingataran yan pinërëp sakingDaba^apahido sira^lagi amijilakënandika: 
^Eadi pira siraji Jaya katong mongkonoa ring isun^ apan sira hnwus apakenak 
lawan isan''. Dak angatarakën kang atawan kanin^ samangka sira mintaha. 
Samangka raden Wijaya tinadnh amagata safijata kang saka loring Tamapël 
ingiring denira arya dikara sira Bafiak kapak, sira Rangga lawe^ sira Pëdang^ 10 
sira Sora, sira Dangdi; sira Gajah pagon, anakira Wirarfija aran sira Nambi^ 
sira Pëtëng; sira Wirot, saöjata abëcikbëcik; kang anangkis saïïjata Daha 
babnhan lor^ sama amak, rampak^ kapalaya wong Daha kang mëta saka lor^ 
tinnt binara denira raden Wijaya. Dadi tamëdun sanjata agang saking Daha 
kang saking pinggir Aksa anajw ing Lawor, tan wineh hamanga, tan amawa 15 
tanggnl nganiweh tatabahan, tëka ring Siddhabhawana aüjagjag ring Singhasari 
pisan. Patih ring Daha sira Këbo mundarang; sira Padot^ sira Bowong pinaka- 
dining safijata Daha saka kidal. Sédëngira bhat&ra Qiwabnddha anadah sajöng 
lawan apatih, ndak sira kaparajaya sama sira angëmasi; sira Këbo tëngah apu- 
lib; mati ring Mangantar. Raden Wijaya sira tinnturakën mangalor, ingataran 20 
yan bhatfira Qiwabaddha mokta dening saüjata Daha andani saka kidul; pun 
patih taha sampan angëmasi; sama amiringi talampakanira bhatara. Samangka 
raden Wyaya mangsal; sakawalanira sama apapalayon maring Tamapël. Tëka- 
nira ring Tamapël amapalihakën tanpantak^ gamanti sira kabalik^ binara tinat 
denipan Këbo mandarang^ samëngka raden Wijaya angangsi ri sawah miring^ 25 
pak^nipan Këbo mandarang andaka ring Bantal. Raden Wijaya amaücal si- 
singkalaning amalaka^ dadanipan Këbo mandarang tëkeng makanipan këbëk 
ëndat, mandar tar angacap: „Adah taha yan dewa si pakanira raden". Sa- 
mangka raden Wijaya adam laücingan giringsing ring kawalanira sawiji so- 
wang; ayan sira angamaka. Kang dinaman sira Sora, sira Rangga lawe; sira 30 
Pëdang, sira Dangdi^ sira Gajah. Sira Sora anëmpuh, akeh longing wong Daha. 
Atarira Sora: „Mangke pangeran pakanira anëmpaha^ kalade^anipan mangke''. 
Anëmpah raden Wijaya. Mangkin akeh longing wong Daha^ tar mandar ka- 
langan wëngi^ tamali akuwa. Sëdëng sirëping wong tinat ingamak manih 
denira raden Wijaya^ samangka babar wong Daha^ akeh wong këna ring tam- 35 
baking aama-iowangipun aridu wong palajënging wong Daha. Wonten ta 
patriuira bhatara Qiwabaddha sama istri kalih siki^ jaga panggihakëna lawan 

2. B. ka sangka lor. — 3. B. Daha Daha. — 8. C. ingaturakën. — 13. C. abubuhan. — C. aflja- 
jog — 20. C. ring mati ring. — 22. B. taha sampan angëmasi, sama amiringi ontbreekt, — 23. B. tekör 
aring. — 28. C. an^at.— 30. B. angawaka.— B. Sore. — 32. C. kade^aning.^SS. B. en C. aridoa.^ C. pa* 
jëng.— -87. B. paaama. 



— 20 — 

raden Wgaya denira bfaatara Qiwabuddha; kalih sira kajarah dening wong Daha; 
rahaden istri sira sang anom apisah lawan sira sang panuba tan tonggal para- 
nira malajëng. Weting Daha ta ridu dening pangamnkira raden Wgaya. Eala- 
ning wëngi; wontén ta balëmaning wong Daha marub agëng nrnbipun. Kapang- 

5 gih raden istri panuwa irika, katinghalan sira denira raden Wijaya^ engëtyen 
raden yayistri panuba. Mangkin ta denira sambut denira raden Wijaya, tnr 
angandika ring sira Sora: „Sora, lab ta''^ angnngsëd, ^^angamuk maneb^ malar 
katëmna yayi sira sang anom''. Matnr sira Sora: „Sampnn dewa^ apan si(ra) 
rayi pakanira panuba sampun kapanggih ; pira si katabing kawula-pakanira pnni- 

10 ki". Saburing raden Wgaya : ^lya denira ikü'\ Samangka sira Sora matur 
maneb : „Duwég, pukulun pakanira mundunt; apan yan amaksakëna angamuk 
sirantuka, löbëng^ lamun sira rayi-pakanira anom kapanggib; yen tan kapanggib 
kadi lalaron anggëpok damar''. Samangka sira mundur, raden yay istri sira 
ingëmbaU; saratri sira lumaku mangalor, esuk sira tinututan dening wong Daba, 

15 katututan sira kiduling Talaga pagër. Wongira sama aganti angareni aprang 
angandëg ing wong Daba. Sira Gigab pagon katumbak pupune trus^angbing 
kawasa lumaku. Andikanira raden Wijaya: „Gajab pagon kawa^a sira luma- 
ku^ lamun tan kawa^a^ lab pada angamuk''. „Kawasa manira^ pangeran, anging 
alonlonan". Wong Daba tan patya denipun anut ing sira, awëkasan mangsul ing 

20 Talaga pagër. Baden Wyaya angayam alas lawan kawulanira sakebing angi- 
ring; sama aganti angëmban ing raden yayistri; wëkasan kawulanira abbawa- 
rasa, anggunita tingkabanira raden Wijaya. Sampun putnsing fabda, sama 
akëmbalan atur: ^Pukulun, aturing kawula-pakanira samadaya; punapa ta 
wëkas-pakanira puniki^ kang angayam alas, kabayuning kawula-pakanira sa- 

25 madaya apënëd yan pakanira datënga ring Madura wetan ; pakanira angungsia 
ri pun Wiraraja, malar kënaba pakanira- para^raya^ kadi pira tanpawilasaba, 
apan marganipun agung denira sira rama-pakanira sira sang moktab". Lingira 
raden: „lya iku lamun awila^a^ mon tan awilafa, akeb deningsun awirang". 
Saburira Sora, sira Rangga lawe, sira Nambi, sama akëdö sabur mannk : ;,Pu- 

30 kulun, kadi pira pun Wiraraja palingaba pangeran'\ Ya ta sangkanira raden 
abidëp ing aturing kawulanira. Sab sira saking jëro alas, tëka ring Pandakan, 
maring buyuting Pandakan aran Macan knping. Rahaden Wijaya sira ama- 
lampab ingaturan sëdëngan, ingaturan tinadab toyanipun, duk binëncah esi së- 
kul putih. Agawok kang tumon. üjaring wong : „Pelag dahat, apan tan hana 

35 duwëgan a-isi sëkuV*. Sira Qajah pagon tan kawasa lumaku; andikanira ra- 
den Wijaya : „Buyuting Pandakan, ingsun atuwawa wong sawiji, Gajah pagon 
tan bisa lumaku, didine ring sira". Ujaring wong Pandakan : „Dub gawe ala 
si pukulun, yen kapanggiba iriki pun Gajah pagon, masa wontëna kawulasa- 



1. B. 9iwB.— ?• B. Sore. — C. ta ontbreekt, — B. angungsid. — C. palar.— 8. C. katmwaha.—9. 
C. pannwannwa. — C. pakaniki.— 12. B. yen tan kapanggili ontbreekt, — 21. C. amban.— 25. C. kangira in 
^Umti van linginu— 29. B. Bambi.— 88. C. sëdëngan ontbreekt.^ B. etëkul. 



— 21 — 

mering Pandakan^ kahaynning kawula didinipnn wontön ing kubon alas^ pa- 
Dgaritaritan alalang, binëngang ing tëngah; pinakaryakén gabug; asépi tan wontén 
kawula sapek^a, kawula Pandakan asunga tédanipun nangkén dina''. Kantun 
6ira Qiyah pagon. fiaden Wijaya anuli maring Datar amömëngi. TëkengDa- 
tar anulumpak ing parahu. Saüjata Daha mantuk. fiaden yayistri sira sang 5 
anom tulus kajarah maring Daha, katur ing siraji Jaya katong. Suka ingaturan 
moktanira bhat&ra Ciwabuddha. Raden Wijaya anabrang mangalor, tumurun 
dra saking parahU; kawëngen ing tëngahing sawah ring dega paminggiring 
Sungënëb. Angrërëb ing sawah lalahan mëntas ginarU; galéngipun anipis. Sa- 
mangka ta sira Sora aturu knmurëb; lininggihan denira raden Wijaya lawan 10 
raden yayistri. fiing enjang sira lumaju maring Sungënëb. areren ing bale pa&jang. 
Wongira kinen atitilika, yen wontën sira Wiraraja sineba. Mangsul kang atilik 
apan sira Wiraraja wontën sineba. Mangkat rahaden Wijaya maring pasebanira 
Wiraraja. Sadatëngira raden ing paseban, sira raden Wijaya tininghalan denira 
Wiraraja, kaget sira Wiraraja tumon ing rahaden, tumurun sira Wiraraja tur 15 
anuli mantuk, datëng ing pagërhan, aluwaran sineba. Kanggëk twasira raden 
Wijaya, angandika ring sira Sora, sira Rangga lawe: „Lab paran si ujarisun, 
akeh denisun awirang, baya luhung isnn angëmasana patiduk angamukika''. Anuli 
sira datëng ing bale pafijang, wëkasan datëng sira Wiraraja marëk arantaban 
sagërha, makadi pinatihira, prasama anampa sëdah woh. Aturira Rangga lawe : 20 
^Pukulun, dede ta pun Wiraraja punika mangkin marëk''. Samangka iccha twasira 
raden. Een pinatih angaturi sëdah ring raden yayistri, sira Wiraraja angaturi sëdah 
ring raden lanang. Sira Wiraraja angaturi dumununga ring gërha kadipaten. Raden 
yayistri anitihi gilingan, rabinira Wiraraja kabeh sa mi adarat, angiring ing raden 
istri, sira Wiraraja angiring ing raden Wijaya. Tëka ring kadipaten anuli miüjëro, 25 
dinunungakën ing paturonira Wiraraja. Raden Wiraraja pinarëk ing wgil pingrwa 
denira Wiraraja sambi atutur kamoktanira bhatara sang lumah ring panadahan sa- 
jëng, malih atutur pangamukira ring wong Daha. Matur sira Wiraraja: „Mangke 
si rahaden punapa kayun-pakanira*. Sumahur sira rahaden Wijaya: „Isun 
amalaku sinakuta ring sira, yen hana pawila^anira''. Aturira Wiraraja: „Sam- 30 
pun pakanira walang ati, anghing depun-alon ugi'\ Tur sira Wiraraja angaturi 
lumiyua mantuk maring dalem. Samangka sira Wiraraja angaturi wastra sa- 
buk siüjang, sama tinampa dening rabinira, makadi ken pinatih. Andikanira 
raden : „Bapa Wiraraja, tan sipi gunge hutangisun ing sira, mun katëkan s^dhya- 
nisun, isun-parone tëmbe bhümi Jawa, sira amuktia sapalih, isun kang sapalih". 35 
Aturira Wiraraja: „Sawadinipun, pukulun, lamun pakanira jumënënga ugi'\ 
Mangkana samayanira raden kalawan sira Wiraraja. Atyanta pangupakaranira 
Wiraraja ring raden, pratidina angaturi tadah, tan ucapakëna denira angaturi 



1« C. Pa^dakan ingucap. — 2. B. wëatën.— 9. C. pangrégrëga. — 11- C. areren ing be^jang. — 12. 
C. sin r^a.— 18. B. angamnka.— 19. C. sira nga.— 20. C. sagërhan.— 21. C. dede tata.— 28. C. 
angatn.— 4 B. anilii. — 29. C. punapa kanira — 30. C. denira. — 88, C. rabirabinira.— 87. C. aasamaTa. 



— 22 — 

tadah cuyéng. Alama raden Wgaya haneng Sangënëb. Irika ta sang arya Wi- 
raraja matar: ^Pangeran, manira angambil apaya^ pakanira sewakahangi ring 
sir^i Jaya katong, pakanira apiapia anëda ingapnra^ abhai^ anangkal; lamun 
ngi Bir&ji Jaya katong ayun pakanira-sewaka^ pakanira angera ring Daha saka- 
5 rëngan, laman pakanira arupa ingandël^ wontën ta alasing wong Trik paka- 
nira-tédaha ring siraji Jaya katong, pakanira-tamkaha, kawala Madora kang 
ababad anaruka, apédëk parantnnaning kawala Madura marëk ing pakanira. 
Don-pakanira asewaka punika ta pakanira-ingëtakëna wongira siraji Jaya ka- 
tong kang taha, kang wani, kang jëjërih, kang bisa, makadi baddhinipnn Eëbo 
10 mundarang; pakanira-kawmhana, sampnn katëpas kabeb, pakanira amita ang- 
hera ring antuking kawala Madara anaraka alasing wong Trik ; pakantakipon ta 
manih manawi wontën kawnla-pakanira kang saking Tamapël, mantak manih 
marëk ing pakanira, pakanira-tanggapana, yadyan kawala saking Daha ayon 
angongsi ring pakanira, pakanira këkëhana, yan sampan kawawa safijata Daha 
15 den-pakanira. Mangke manira akirim atar ing sir&ji Jaya katong." Mangkat 
kang kinon angatnrakëna sawalan, anabrang mangidal, tëkeng Daha marëk ing 
sirftji Katong, angatarakën sarat. Unining sarat: „Pakalan, atar patik aji, denira 
sira potraka padaka aji, anëda ingapara, ayan anangkul ing padaka aji ; panika 
ta depan-kawrahanandika padaka aji, yan saka lawan tan saka." Andikani- 
20 r^i Katong: ,Paran tan sakahaningong yan kaki ar^a Wijaya ahidëpa iringong", 
tar kinon maliha kang atasan, amawS^ndikanira. Satëkaning atasan asrah andika; 
sampan winaea ring ayanira raden, ring ayanira Wiranga. Saka sira Wira- 
riga. Samangka raden Wijaya mantak maring Jawa, ingiring dening kawnla- 
nira, ingatërakën dening wong Madara, sira Wiraraja angatërakën mangsal ing 
25 Tèrang. Tëkeng Daha enak deaira asewaka ring siraji Katong, kinasihan. Da- 
tëngira ring Daha amënangi Galangan, wongira kinon asasaramaha saking da> 
lëm, hënti gawoking sang mantri ring Daha tamon, rehing sama abëeikbëcik, 
kang pinakadi sira Sora, sira Rangga lawe, sira Nambi, sira Pëdang, sira Dangdi, 
sama malaya ring pasasaramaning Mangantar ing Daha. Gamanti mantri ring 
30 Daha malaya, kang pinakadi prajarit aran sira Panglët, lawan sira Mahi^a 
rabah, sira patih Këbo mandarang, katëla pada kasoran palayanipan denira 
Rangga lawe lawan sira Sora. Alama siraji Katong angënakën sasadakan : „Kaki 
ar^a Wijaya, lab rëke sirSsasadakana, isan aynn aniningalana, mantrinisan pi- 
nakalawanira". Atarira raden : ,,Singgih pakalan". Atangkëp kang sasadakan, 
35 antyanta ramening tatabahan, kang aniningal pënah tanpaligaran, asri ka- 
palajéng wongiraji Katong. Andikaniraji KatoQg: „Atarana kaki ar^a Wgaya, 
aja mila, sapa ta wong wani alawan gastine." Awasan sira rahaden, mangkin 
t&papak patangkëping sasadakan ambara-binara ; wëkasan sira Sora anaja ring 
sira patih Këbo mandarang, sira Rangga lawe anaju ring sira Panglët, sira Nambi 

2. asewakaha. — 5. C. Trik kanira. — 6. C. kang ontbreekt, — 11. C. antuk kawala. — 13. B.yadya. — 14. 
B. angnagwpg. — 86. C. enak manira. — 26. C. sama kinon. — C. saking lëm. — 84. C. atnra iidfln. 



— 23 — 

aniya ring sira Mahi^a rnbnh, wëkasan kapalaju sang mantri Daha dening 
wongira raden Wijaya, tan hananing apulih, anali awusan. Samangka raden 
Wijaya sapek^a yan kasoran mantri Daha dening wongira. Tnmnli akirim 
andika ring sira Wiraraja^ tamoli sira Wiraraja awékas atur akon anëdaha alasing 
wong Trik. Snka sir&ji Eatong. Ya ta mulaning anaruka alasing wong Trik. Dok 5 
mahn tinamka dening Madura, hana wong alapa knrang sangnnipan ababad^ 
amangan miga, kapahitén^ sama depon-bnncal antnkipnn amm maja panika, 
kasnb yan wontën wohing miya dahat apahit rasanipun, singgih ta ingaran ing 
Higapahit 

Sampan kawilang satingkah-polahing Daha denira raden. Ring Majapahit 10 
sampan arapa de^a. Wongira Wiraraja asarawean maring Daha, aparantanan 
ing Majhapahit. Sira Wiraraja awëkas atur ing raden, polahira amita ring sir&ji 
Eatong. Samangka raden Wijaya amit anghera ring Majhapahit. Snka sir&ji 
Eatong katangkal dening sih, lawan bisanira raden asewaka, kadi taha. Sasam- 
pnnira raden Wgaya angher ing Majapahit, asung sapek^a ring sira Wirar&ja 15 
yan sampnn kawawa sang mantri ring Daha denira, dening sakawnlanira. Ra-, 
den Wgaya angajak ing sira Wiraraja amëröpeng Daha. Sira Wiraraja anayuti, 
angncap ing ntnsan: «Aja göni, hana npayanison manih, matnra sira ki panga- 
lasanira ring sira pangeran^ isan amitra lawan sang rata ring Tatar, isan-tawa- 
nane rajapatri, sira ta kaki pangalasanira, mnliha mangke iki maring Majhapahit. 20 
Sapangkarira san akirim sarat maring Tatar, apan parahn saking Tatar mangke 
hana adagang merene. Hana parahunisan, san-kon milua maring Tatar, anga- 
jak amërép ing Daha; laman hnwas kalah sang rata ring Daha, hana nyapntri 
ring Tamapël haya, sanüi^a Jawa tan han&madani, irika akaa ring rata Tatar, 
ika pangapasisan ing rata Tatar. Ataranira ring sira pangeran, malar tatata 25 
mila angalahakën Daha". Mnlih pangalasanira maring Majhapahit. Raden Wya- 
ya snka ingataran sawëwëkasira Wiraraja. Sapangknring pangalasan, sira Wi- 
raraja akonkonan maring Tatar. Sira Wiraraja angalih maring Majhapahit 
sagërha anggawa paprang saking Madnra, sakehing wong Madara kang abëcik- 
bëeik ginawa saha safijata. Satëkaning atasan saking Tatar amërëp ing Daha. 30 
Safijata saking Tatar amëtoni saka lor, saöjata saking Madura lawan kang saking 
Migapahit mëta saka wetan. Epah sir&ji Eatong, tan wrnh kang jaganën. Ya tabino- 
tan saka lor dening wong Tatar. Sira Eëbo mandarang, sira Panglët, sira Mahi^a 
rabah, ajaga saüjata kang saka wetan. Sira Panglët mati denira Sora, sira 
Eëbo rabah mati denira Nambi, sira Eëbo mandarang apagat lawan sira Rangga 35 
lawe, kapalaya sira Eëbo mandarang, katatatan ing larah Trinipanti, mati denira 
Rangga lawe. Angncap sira Eëbo mandarang ring sira Rangga lawe : «Ei Rangga 
lawe, hana anakingsan wadon, den-alapa dene ki Sora, ganjarane wani". Si- 
r&ji Jaya katong anëmpah mangalor asikëp dadap karëbat dening wong Tatar, 

5. C. Dak maha tUumüak .... ika pangaputisaa iog 'jnAxk Tatar, a, re^el 25, omÜretkL — 26. B. mila 
«e>i«m" Dtohs, C. mila akëa Diha.^30. C. saha otUbreekt---^. C. Trilnpanti. 



— 24^ 

apnhara kasikép^ sira kapafijara dening wong Tatar. Raden Wgaya 
mafijiDg ing jëro kadatöning Daha, amalayokën ing raden yayiBtri sira sang 
anom. Annli bhinakta maring Majapahit^ satékanira ring Majhapahit tëka wong 
Tatar amalaku rajaputri^ apan ganggupira Wiraraja, yan hnwuB kalah ring 

5 Daha, angatnrakëna putri kang saking Tumapël kalih pisan. Ya ta keméngan 
sang mantri kabeh; angnlati sanggupa manih. Angucap sira Sora: ,Lah isnn 
nga si angamukana ring wong Tatar yen maririki''. Sumahnr sang arya Wi- 
raraja: .Singgih, kaki Sora, hana npayanisun manih''. Mangkin ta angnlati 
sanggupa. Ponika kang pinaganémakëning mantri. Sanggnpira Sora: ^Pira 

10 antukaning angamukana wong Tatar''. Ring sore masa yan lingsir kulon wong 
Tatar tëka amalaku rajaputri. Sahurira Wiraraja : „Sawong Tatar, hayo nga sira 
age-age, sang rajaputri lagi prihatin, apan kaw us tumon ing safijata dnk kalahing 
Tumapël, makadi duk kalahing Daha, awëdi tëmën yen aninghali sarwa lalandëp ; 
ëmbesuk ta sinrahakën ing sira, winadahan pasagi pinikul ingupaeara ring 

15 wastra, ingatërakën maring parahunira; sangkaning winadahan pasagi denira 
alumuh tumona ring lalandëp, kalawan ta kang ananggapi ring sang nyapntri, 
aja wong Tatar kang alaalane, wong kang bëcike, ajamawa sahaya, apan 
sanggupira sang rajaputri yen tumona ring sarwa lalandëp, yadyan tëkaha ring 
parahu, alabuh er sira; nora ta para hilang denira atoh pati yan sang ngapntri 

20 alabuha toya". Ahidëp wong Tatar ingapus. Ujaring wong Tatar; ^^Abënër 
dahat sabdanira puniku." Tëkaning samaya asërah rajaputri, datëng agëbagan 
kang wong Tatar amalaku rajaputri, sama tan amawa lalandëp. Tëka ring jëro- 
ning lawang Bhayangkara, wong Tatar inginëban lawang kinufieen ing jaba 
ring jëro. Erisira Sora den-wulang ing pupune. Samangka den-amuk wong Tatar, 

25 denira Sora, tëlaspadëm. Sira Ranggala we angamuki kang ing jabaningpaning- 

kilan, tinut tëkeng dunungane malayu maring sohaning Ganggu, tinnt pinaten. 

Akara sapuluh dina tëka kang andon saking Malayu, olih putri roro, 

kang sawiji ginawe binihaji denira raden Wijaya, aran raden Dara pë|ak; 

kang atuha aran Daia jingga, alaki dewa apuputra ratu ring Malayu, aran tuhan 

30 Janaka, kasirkasir ^ri Marmadewa, bhi^eka sir&ji Mantrolot. Tunggal pamalayu 
lan patumapël i faka rë^i-sanga-samadhi, 1197. Pangadëg aji Eatong ratu ring 
Daha i ^aka naga-muka-dara-tuuggal, 1198. Tëka ring Jung galuh bji Eatong 
angapus kidung Wukir polaman, wusing angapus kidung mok^a. 

Samangka raden Wijaya afijënëng prabhu i Qaka rasa-rupa-dwi-f itanggu, 

35 1216. Wëkasan patntan la wan raden Darapëtakputralanang, kak^atriyanira raden 
Eala gëmët. Eunëng pulranira bhat&ra Qiwabuddha stri kalih siki, kang einayakën 
ing wong Tatar, ingalap kalih denira raden Wijaya, sira sang atuha a&jënëng ring 
Eahuripan, sira sang anom aüjënëng ing Daha. Abhii^ekanira raden Wgaya dnk 



7. B. nahangnnnkanaring. — ^9. B. Pir» antokaniag tira Mihapati atni^nnakfiD, èUuUf, S6, re* 

gel 11, ontbreekt, — 10. C. tore nuyat liugsir. — 15. C, iugatakéa, — 10. C. kang mangaoanggapi. — 31. C. 117. 



— 25 — 

prabhn 91! Eërtarajasa. Taban pafijënëDgira, orëmira awihën. Mokta sira, 
dhinarma ring Antapnra, moktanira i (aka 1257. 

Gnmanti raden Eala gëmët angadëg prabhn, abhi^ka bhat^ra Jayana- 
gara. Qrt Qiwabnddha dhinarma ring Tnmapël, bhii^ekaning dharma ring Purwa- 
patapan. Hëlët pitu-wëlas tahan adëging dharma lawan paranggalawe. Sira 5 
Rangga lawe arëp adëgakëna patih warang, margane andaga maring Tnban sira 
Rangga lawe tar angapnsi rorowang. Was kapusan wong Tubau sagnnnng lor, 
samahidëp ing sira Rangga lawe. Araning kang ahidëp pafiji Marajaya, ra Jaran 
waha^ ra arya Siddhi, ra Lintang, ra Tosan, ra Galatik, ra Tati rowangira 
Rangga lawe andaga. Sangkaning lungha saking Mfghapahit arëbat langgnh, 10 
sira Mahapati amiQunakën adërwe dandan njarira Rangga lawe: «Aja kehing 
ucap, hana ringpSrthayajfiapapaningjëjërih". Karongn ring Majhapahit yen sira 
Rangga lawe andaga. Sira Mahapati ans^atarakön. Rantik sir^i Jayanagara. 
Sarowangira Rangga lawe andaga mati, anghing ra Galatik aharip, kinon malika 
denira Mahapati. Paranggalawe i fakakada-bhumi-pak^aning-wong, 1217. Sira 15 
Wiraraja amit angnlihi ing Lamajang tigang jam, apan pasamayanira raden 
Wijaya amalihana Jawa, kanngrahan Inrah Lamajang lor kidul lawan tigang 
juru. Hawus alawas kabhnkti denira Wiraraja. Sira Nambi kari apatih, sira 
Sora dëmungy sira Tipar tnmënggang. Sor tamënggang dening dëmnng sa<* 
mangka. Sira Wiraraja tan mulih mariug Majhapahit, tan ayun angawolu. 20 
Hëlët tigang tahan paranggalawe lawan pasora. Pinisanakën sira Sora de- 
nira Mahapati, sira Sora ingilangakën mati denira Këbo anabrang, i Qaka 
baba-tangan-wong, 1222. Sira Nambi pinisanakën denira Mahapiti, tan kina- 
tonakën përange, olih kaladeQa, amit atilik ing sira Wiraraja a^ëring alara. 
Qrt Jayanagara saka, anghiug tan sinang alawasa. Sira Nambi tan tëka 25 
mauih, mënëng ring Lëmbah, agawc kuta atingkah saujata. Sira Wiraraja 
mati. Siraji Jayanagara anjënëng prabha rong tahan. Gantur palangge i 
faka api-api-tangan-tanggal, 1233. Tnmali pajaradëmang, hëlët rong tahan 
lan pasora. Patine jaini dëmnng i Qaka arta-gana-paksaning-wong, 1235. Tamali 
pagajahhira i faka rasa-gana-paksa-wong, 1236. Tamali pamandana. Mangkat 30 
angawaki sirSji Jayanagara angilangakën wong Mandana walan karo. Anali 
mangetan, sira Nambi ingilangakën. Winarah sira Nambi yen was mati jam 
dömang, patih ëmban, tamënggang Jaran lëjong, mantri parakrama, sampan 
sam^ngëmasi, ma'y anëmpah. Angacap sira Nambi : ^Kang Samara, ki Dër- 
pana, ki Tégah, pamafi Jaran bangkal, ki Wirot, ra Windan, ra Jangknng, yen 35 
landingen nora sor wong wetan iki, mali was rasük, sapa si galihe kalon, 

14. Tuuehen Jajanégara eH San>wa«^fcira Raogsca Uwe in B. en C. sin Sora inKiUngalcëa matidenira 
Këbo anabrang, wat behoudent de drie laatste voorden laffer in den tekst nog eens voorkomt en daar op zjfne 
plaats w.— 15. C. Hapati.— 16. U, en C. 1217, ontbreekt.-'lS, B. kalajcrahiii.— B. MijanK.— 19. sani^ka. — 
2i. B. en C. deiiira Këbo anabraajc ontbreekt, voor dt'ze aanvulling zie men de aanteekening bff regel 
14.— 26. C. atia^^ka— >29. B. pati.— 32. G. winara Nambi.— 35. B. BaagkaU.-^a. B. maling. 

VcTb. Bat. Gen., deel XLIK. 4l 



— 26 — 

Jabang tereweS; Lémbu pëtëng^ Ikalikalan bang, nora ingsan awëdi, den-sar 
laki^eng harép ing wnri, kongsi uga denisun sak^at aprang ing Bubat. Tékane 
wong Majapahit, pangidulira Nambi, rnsaking Ganding, kajarah pra^astine^ 
sira Nambi tinut sinélësëk, tnmandang sira Dcrpana, sira Samara, sira Wirot, 

5 sira Made, sira Windan, sira Jangknng, sira Tëgnli^ makadi sang arya Nambi 
adining auëmpuh ; dahut wong Majapahit, noranapulih. Sira Jabung terewes, 
Lëmbn pëtëng, Ikalikalan bang sama amagut ing sira Nambi mati^ sarowangira 
Namby anëmpub angëmasi^ Rabat buhayS^bang tikël, dahut payung wong wetan^ 
kalah de^a Lamajang i ^aka naganaliut-wulan, 1238. Tnnggal pawagal lan 

10 pamandana. Hëlét rong tahun pawagal lan palasëm. Sira Sëmi ingilanga- 
kën mati i soring rangdu i Qaka nora-\veda-pak^-wong 1240. Tumnli ra- 
kiiti. Hana dliarinapntra aji^ pangalasan wineli 8uka, wong 7, aran Enti. Ra 
PangQa, ra WëJëng, ra Yuyu, ra Taüca, ra Baüak, ra Kuti lawan ra Sëmi 
mati ingilangakën; piuisunakén denira Maliapati. Samangka kawaspadan sira &fa« 

15 hapati yan rajapisuna, ya ta siiükëp, winunub cinelengceleng, douane angadn 
pisuna. Dak darang mati ra Kuti, harëp angawakën abhatara maring Badandër. 
Sah ring wëngi tan ananing wrah, anghing wong Bbayangkara angiring, sakehe 
kang kataju akëmit dak abhatara lungha; hana wong lima wëlas. Sira Gajah 
mada ambëkël ing Bbayangkara samangka, katuju kénütane, sangkane angi- 

20 ring bhatara duk mimba. Alawas sira baneng BadaudCr. Hana pangalasan 
amit mulih, tan winehan denira Gajah mada, polabing kawula angiring akëdik, 
amaksakën mulih. Sinuduk denira Gajah mada, done manawa hana awawarah 
yen abhatara dumanung ring nmahipun bayuting Badandër, manawa ra Knti 
wruh. Akara sapasar amit sira Gajah mada maring Majhnpahit. Tëka ring 

25 Majhapahit^ sira Gajah mada tinakontakonan de sang amancanagara ring për- 
nahira bhatara, awarah yen hawus kasambut deniug rowange ra Kuti. Sam&- 
nangis kang winarah. Angucap sira Gajah mada : „Mënën^a, nora sira harëp- 
harëp apangerana ring ra Kuti". Sumahur kang inujaran : „ An^apa ujarira iku, 
iya dudu pangeran dewek". VVëkasan sira Gajah mada awarah yen abhatara 
30 baneng Badandër. Samangka sira Gajah mada ayom lawan sang mantri, sama 
asanggup amatenana ring ra Kuti, ingilangakën mati ra Kuti. Mantuk abha- 
tara saking Badandër, kari abuyut tur sub ing dangu. Saulihira bhatara sira Gajah 
mada mari ambëkël ing wong Bbayangkara, ring rong wulan amukti palapa, 
ingalihakën apatih ring Kahuripan, apatih rong tahun. Sang arya Tilam apatib 
35 ring Daha mati, gumanti sira Gajah mada, tinërapakën apatih ring Daha, atut 
sirapatih amangkubhumi sang arya Tadah^ kang angrojongi sira Gajah mada 
patih nng Daha. 

3. B. prajcastine. — ♦. B. linël^yék.— 5. B. sira Mara,— 11. B. 1249, C. trf.— 13. C. Pang^a.— 
C. Wa^eng. — C. Bafiuk, Keri lawan asëmi. — 16. C. harëp anga. . . . {lacune) bhatftni, linangan deoira 
bhat&ra inarin^ Badaodér. — '■■ 9. B. Bliayanickara ya mangka. — dO. C. abhatüra. — B. HUwasi haneng, C. hane. — 
21. C. ak64i. — 20. C. deae. — 28. B. Larép pan^rana ring. — 32. B. en C. danga. — 3i. B. en C. mari ngam- 
békëL— 3é. C. in^alingakftn.— A. imatUi^— B. amatib. 



— 27 — 

« 

Sir&ji Jayanagara asanak istri kakalih, saos ibn, sami tan sinungakra- 
maha ri len, aynn alapën piyambëk. Samangka ksatriya tan hana maring Majha- 
pahit^ sing katon ingilangakén, manawa har^.p ing arinira. Sira paraksatriya 
angékeb ahétëtan. Somabira Tafica aparnngon ingalan denira bhatara, sira Taöca 
ingadokën denira Gajah mada. Katuju bhatara Jayauagara bnbubën tan 5 
kawasa mgil. Sira Tanca kinon anajia, marék maring pagulingan. Tinaji 
denira Taöca pisan pingro tan tëdas, den-aturi bbatara asalaha këmitan, asalah 
këmitan sandingiragnling, tinaji denira Taüca tëdas^ linnd sinnduk denira Taöca, 
iQokta sira ring pagulingan. Sira Tanca ginëlis pinaten denira Gajah mada, 
mati sira Taöca. Lët sangang talinn pakuti lawan patanca, i (aka bbasmi- 10 
bhata-nangani-ratn, 1 250. Sira ta dhinarmeng Kapopongan, bhi^eka ring Qrngga- 
pura, prati^ta ring Antawulan. 

Samangka sira paraksatriya angambah Majhapahit. Samangka raden 
Gakradhara kalaping swayambara pinakalakinira bbreng Kabnripan. Raden Knda 
m^rta angambii bbreng Daba. Kaden KuJa mërUi anjénéng ring Wëngkër, 15 
bbreng Prarai^wara ring Pamotan, bhiscka gri Wijayarajasa. Hana tapatutan 
raden Gakradbara aöjën^ng ring Tumapël, bhi^eka gr! Kërtawardbana. 

Bbreng Kahuripan istri prabbu i Qaka Qftnya-wi^aya-pak^a-bbümi, 1250. 
Bbreng Kabnripan aputra titiga, mijil bbatara prabbu, kasirkasirira (ri 
Hayam wuruk, raden Tetep, jujulukira yen auapuk sira dalang Tritaraju, lainun 20 
amadoui sira Pagër antimun, lamun awayang baöol sira Gagak katavvang, yan 
ring ka^ewan sira mpu Janegwara, bbi^ekanira gri Rajasanagara, kaprabbuuira 
bbra sang Hyang wëkasing sukba; arinira stri kalap denira raden Larang, 
pjingadëganira bbreng Matabun, tan apuputra; sira sang pamungsu bbreng Pa- 
jang ingalap denira raden Sumana, pangadéganira bbreng Paguhan, amisan ka- 25 
lawan bbreng Kahuripan, stri bhra Gundal sang dhinarma ring Sajabung, dharma 
bhi§eka ring Bajrajinaparimitapura. 

Tumuli pasadeng. Sira Tadah patih amangkubhumi agëring sakarëngan 
tan kawasa marék, angusvvakën marëk ring talampakanira bbatara asahamang- 
kubhumi, tan tinanggapan denira bhre Koripan, mantuk sang arya Tadab, angun- 30 
dang ring sira Gajab mada, ararasan ing made. Sira Gajah mada kinen 
amatiha ring Majhapabit, tan mangkubhumi: ^Isun angrojongi sadudunira'. 
Këcapira Gajah mada: „Alëmëh siranakira, yen apatiba mangke. Lamun 
sampun saking Sadcng agëlëm apatiba, lamun kabapuraha tivvas, bisaning ra- 
nakira". „Lab kaki sakewuhira sun-rojong, sadudunira". Samangka agung 35 
hatinira Gajah mada, angrungu sanggupira sang arya Tadah. Mangkin mangkat 



1. C, rin^.— 2. B. tan ainarinG;. — 3. C. pak^atrrya — i. B anglJkëbakëb ah^t^tan — 5. B. infcadokakën. — B. 
bnyahtn. — 10. satahnn. — B. QroKK&i^pura. — 10. C. prutipta. — II. C. arabuh. — 1 k B. suyambara. — C. bhre. — 
17. B. Kërtawaddhuna. — IS. C brc. — 19. C. bhre — 21. C. atnalooani. 24. B. en C. Mdtahan, sira sinj; pa- 

mang^ii tan apupatra.— C. bhre. -23. C. bhre.— C. bhre.— 2^). C. stri bhra Ga^dal 8aaj?k.inira ru 

(mnhanj, óladx. 29, regel 8, ontbreekL—%^. B. sarëDj^an. — 30. B. angu^da rin^. — 31. B. ya daiua.ra. 



— 28 — 

Baring Sadeng. Sang mantri araraman pinadaya^ makadi sang apatih amang- 
knbhnmi pinadaya; yen sira Eémbar angruhuni angépang ring Sadeng. Sér- 
ngén sang amangknbhumi, apotusan ing sang mantri jaba ; kang mangkat woog 
limang bëkëlan^ anglilima sowang. Kapanggih sira Këmbar ring alas, angadëg 

5 ing kaya rabuh, angandalandnl^ kay&nunggang undakan tar anglimbekën cam6- 
ti datëng kang kinon amalinggiha sira Këmbar. Wanten wëkasira sang mantri 
samadaya, makadi kaki gnsti apatih amangkubhnmi, aken amalinggiha ring 
sira pnnarëke sangkanira rumnhan angëpang ing wong Sadeng. Defi-camëti 
rahine kang kinon amalinggiha Inpnt alingan kayn^ tur sira Këmbar angaeap: 

10 ^Norana den^hidëp dening si Këmbar iki^ yen ing paprangan norahidëp ing 
pangeranmu ika''. Lungha kang kinon amalinggiha^ awërta sanjarira Këmbar. 
Mënëng sira Gajah mada, tëka winahonan kinëpang wong Sadeng. Tnhan 
Wnnyn dewapntra saking Pamëlëkahan, lamun anjéplakakën pëpëcut, kamnga 
ring antarik^a. Kaget wong Majhapahit. Kancit tëka sang sinuhnn angalaha- 

15 kën Sadeng. Hëlët tigang tahun patanea lawan pasadeng i ^aka kaya-bhnta- 
non-daging, 1253. Tumuli gun tur pabanu-pindah i ^aka 1256. Tëka saking 
Sadeng sira Këmbar ambëkël ing mantry araiaman, sira Gajah mada angabebi, 
sira Jaran bhaya, sira Jaln, sira dëmang Bucang, sira Gagak minge^ sira Jënar^ 
sir&rya Kahn, sama antnk linggih, si Lëmbn pëtëng tumënggung 

20 Sira Gajah mad&patih amangkubhfimi tan ayun amnktia palapa, sira Gajah 

mada: ^Lamun huwus kalah nu^antara isun amukti palapa, lamun kalah ring Ga- 
run, ring Seran^ TaTijung para, ring HarU; ring Pahang, Dompo, ring Bali, Sunda, 
Palembangy Tnmasik, samana isun amukti palapa". Sira sang mantri samalung- 
guh ring panangkilan pëpëk. Sira Këmbar apamëleh, ring sira Gajah mada. anali 

25 ingumanuman, sira Banak kang amulnhi milu apamëleh, sira Jabung tereweS; sira 

Lëmbu pëtëng gnmuyu. Tumumn sira Gajah mada matur ing talampakan bhatara 

ring Koripan^ runtik sira katadahan kabulnhan denira arya Tadah. Akweh do^* 

nira Këmbar, sira Warak ingilangakën, tan ucapën sira Këmbar, sami mati. 

Tumuli pasunda-bubat. Bhre prabhu ayun ing putri ring Sunda. Patih 

30 Madu ingntus angundangeng wong Sunda, ahid(!p wong Sunda yan awawarangana. 
Tëka ratu Sunda maring Majhapahit, sang ratu Mabaraja, taopangaturakën putrL 
Wong Sunda kudu awiramena, tingkah ing jurnngën. Sira patihing Majha- 
pahit tanpayun yen wiwahanën, reh sira rajaputri makatnratura. Wong Sunda 
tanpasung. Sira Gajah mada matur polahing wong Sunda. Bhra prame^wa- 

35 reng Wëngkër sirasanggup ^Sampun walang ati, kakaji, ingsun-lawanane apagut". 
Sira Gajah mada matur polahing wong Sunda. Tumuli apangarah wong Maiha- 
pahit angëpang wong Sunda. Wong Sunda harëp angaturakëna rajaputri, tan 



1. B. sakinfc •'« pfaaU tan marinfr.— 2. B. angraliiinini. — 8. C. mnn (=rnfniihnii). — 10. C. dene ai 
Këmbar. — 11. C. amalnnggiüia. — 12, B. tiDëpanir.^13. C. pamëcnt.— 15. Ilélétti^n^dalinn w^^ii^4Mrii9it//Mry. — 
19. B P«ting.~2l. C. ingüiin —24. B. pésëk.— 26. C. sira Biya kaog amalahl.— 26. C. akeh.— 32. B. 
bida ftwinmeoa.— 84. B. airaja pntrL— 37. C. angatarakën ing lang. 



— 29 — 

siDiiDgan deniDg menak, asanggnp matieng Bubat tan liar^p annngknl; mang- 
gëtoha gëtih. Sangguping meDak agawe paDgnis, adining Sandanggërgnt, La- 
rang agnng; tnhan Sohan; tuhan Gëmpong^ padji Mèlong, nrang 8angkaring 
Tobong barang, Rangga cabot; tuban Usus, tiiban Soban, arang pangula^ 
nrang saya, Bangga kaweni, nrang siring, Satrajali, Jagat saya^ sakwebing 5 
wado Sunda parëng asnrak. Pinagnt ing nni dening reyong, gliflrnitaning sn- 
rak kadi gnntnr. Sang prabbu Mabaraja wns angëmasi karabun^ mati 
lan tnban Usns. Bhra paramcQwara sira maring Babat, tan sapek^ yan 
wong Sunda akeb kari; tur adinya menak anëmpub. Mangidul wong Sunda, 
rusak wong Majapabit. Kang anangkis saüjata amapulibakën sirarya Sén- 10 
tong, patib Gowi, patib Marga lëwih, patib Tëtëg, Jaran bhaya. Sakeb sang 
mantry araraman aprang saking kuda, katitihan wong Sunda, anênipnb ma- 
ngidul mangulon anuju nggonira Gnjab madn, sing tëkarëping padati wong 
Sunda mati, kadi sagara gëtib gunung wangke, bbrasta wong Sunda, tan 
bana kari, i Qaka sanga-turangga-paksawani, 1279. Tunggalan padompo pa- 15 
sunda. Samangka sira Gajab mada mukti palapa. SawClas tabun amangku- 
bbümi. 

Patining pntri Sunda bbatara prabbu angalap putri bbra Prame^wara, 
sira Paduka fori, apatutan stri bbre Lasëm sang ayu; putra lan rabibaji mijil 
bbre Wirabbumi, ingaku putra denira bbrc Daba. 

Bbre Pajang apuputra titiga, mijil bbra Hyang wi^ena, kaki^atriyanira 20 
raden Gagak sali, karatunira ^)i Wikrama, sira sang angambil bbre I^asem sira 
sang abayn, aputra mijil bbra Hyang wëkasing suka; putra manib stri bbre Lasëm 
sang alëmu kalap denira bbre Wirabbumi; putra manib stri bbre Eabnripan. 
Hana putranira bbre Tumapël, duk k§atriya raden Sotor, liino ring Koripan, 
angalih binweng Daba, anuli bino ring Majbapabit, aputra sira mijil raden Sumi- 25 
rat, angalap bbre Kaburipan, pangadégan bbre Fandan salas. 

Tumuli paQraddbanagung i Qaka pat-ula-ro-tunggal, 1284. 

Sang apatib Gajab mada atëlasan i ;aka gagana-muka-matendu, 1290. 
Tëlung tabun Loranangganteny apatib. Sira Gajab ënggon apatib i ^akaguna- 
sanga-pak^ning-wong, 1293. 30 

Bbre Daba mokta, dbinarmeng Adilangu, dbarmabbi^eka ring adri Pur- 
wawi^ei^. Bbre Kaburipan mokta dbinarmeng Fanggib dbarmabbii^eka ring 
giri Pantarapurwa 

Tumuli bana gunung aiiar i ^aka naga-leng-karnaning-wong, 1298. 

Tumuli guntur pamadasiba i gaka rësi-guuya-guna-tunggal, 1307. 35 

8. C. tnban Gëlémpo. — 4, C. Toj« ngranpr. — 6. C. injmnininfc reyong.— 9. C. adinyang. — C, anëm* 
pn.— B. Snpda maak wong Majapahit, ontbreeii. — W. B. opnpnlihukën. — B. Sëvtene. — 12. C. taka 
^da. — 13. C. pacati.— 16. B. tangtiBlanya Pouipo. — 16. C. palapan.— 19. B. deainirra. — 20. B. bhra Yeng 
wifwa.— 21. B taraaaQgaya.— 22. C. wëkas saka. — B. sirn sang alëpa.>-24. B. Sotom. — 26. B. Samirat'- 
p6. B. mangadégan. — 27 C. run. — 29. B. anggitntyiini patib. — SC. C. pakfatnnggal.— 34* B. knrvoa. — 36. B. 
famajiiiha gantar. 



— 80 — 

Bhre Tnmapël mokta sang mokta ring Qunyalaya i ^ka matangga-^n- 
nya-kayeku^ 1308, dhinarmeng Japan, dharmabhi^eka ring Sarwajfiapnra. 

Bhra Hyang wi^esapnpntra mijil bhre Tnmapël; pntrestri mijil bhre 
prabhn stri, bhi^eka dewi Snbita; manih putra pamungsn jalu bhre Tnmapël 
5 (ri Kërtawijaya. Bhre Pandan salas apntra mijil bhre Eoripan, bhra Hyang pa- 
ramefwara, siraji Batnapangkaja bhisekanira, angalap bhra prabhu istri, tan apu- 
pntra sira; manih putranira mijil stri bhre Lasëm, kalap denira bhre Tnmapël; 
pntra manih mijil bhre Daha, kambil denira bhre Tumapèl, sama pamangsu. 
Bhre Wirabhumi apntra jalu mijil bhre Pakëmbangan; mokta nduking abu- 
10 bnron; pntra manih stri bhre Mataram, kalap denira hhraHyangwi^ei^a; putra 
manih bhre Lasëm, kalap denira bhre Tnmapël; pntra manih s'ri bhre Mata- 
hnn. Bhre Tnmapël apntra jalu anjënëng ring Wëngkër angambil bhre ing Ma- 
tahnn; apntra manih bhre Paguhan; pntra lan rabi anom bhre Jagaraga, ka- 
lap denira bhra Paramegwara tan apuputra; manih bhre Taöjung pnra, kalap 
15 denira bhre Paguhan tan apuputra; manih bhre Pajang, kalap denira bhre Pa- 
guhan kalapdo tan apuputra; bhre Këling angalap ringhhrengKëmbangjënar. 
Bhre Wëngkër apuputra bhre Kabalan. Bhre Pagnhan apuputra lawan rabi 
k^triya mijil bhre Singapura, kambil denira bhre Pandan salas. 

Bhra PrameQwara Pamotan mokta i gaka gagana-rüpauahut-wulan, 1310, 
20 sira sang dhinarmeng Ma&ar, dharmabhii^eka ring Wisnubhavvanapura. Bhra 
Matahun mokta dhinarma ring Tigawangi, dharmabhis3ka ring Kusumapura. 
Sira Paduka Sori mokta. Bhreng Pajang mokta dhinarmeng Èmbul, dharmabhi^e- 
ka ring Girindrapura. Bhre Paguhan mokta dhinarmeng Lo bëöeal, dharma- 
bhi^eka ring Parvvatigapura. Bhra Hyang wëkasing suka mokta, i (aka medini- 
25 rüpa-ramekn, 1311. 

Bhra Hyang wifesa prabhu. 

Tumuli guntur Prang bakat i ^aka mukaning-wong-kaya-naga, 1317. 

Tumuli sira Gajah ënggon mati i Qaka ^ünya-paksa-kaya-janma, 1320. 
Pitn liknr tahun apatih. Bhra Hyang wëkasing suka aken apatiha ing sira 
30 Gajah manguri. 

Bhra Hyang wëkasing suka mokta, sang mokta ring Indrabhawana, 
i 9aka janma-netragni-sitangsn, 1321, sang dhinarmeng Tajnng, bhi^ekaning 
dharma ring Paramasukapura. 

Bhra Hyang wige^a sira bhagawan i ^.aka netra-paksagni-sitangsu, 1322. 
35 Bhatarestri prabhn. 

Bhre Lasëm mokta ring Kawidyadharen, dhinarmeng Pabangan, dharma- 
bhii^ka ring Laki^nnpnra. Bhre Kabnripan mokta. Bhre Lasëm sira sang alëmn 

1. B. QaDjrabyaQg. — B. patangga9utayekii. — 4. C. Satita.— 9. B. Sakëmbangan. — B. duking. — C. 
pabnbiiroQ. — 12. C. angambili. — 14. C katap denira bhre Pajang kalap denira bhre Paguhan. — C. PaniiDe9«rareng 
motan — 23. C. LoOcal —24. B. Parwatisapnra.— 25. B ratu.— C. 13 9.-27. B. tumi.— 29. Bhra hyang 
Wëkaaing suka aken apatiha ring tira Oiyah manguri, ontbreekt in B. — S2. janma ontbreekt in B. — 37. C. mokta 
•ang mokta. 



— 81 — 

mokta. Bhre Pandan salas mokta^ dhinarmeng Jinggan^ dharmabhi^eka ring 
(ri Wiipnapara. 

Bhra Hyang wi^esa apupnrikan lawan bhra Wirabhumi. Dadi denira 
dampaly abélah mati siradampul i (aka 1323. 

Hélét tigang tahun tamnli dadi manih kang parégrëg. Sama apangarah, 5 
bbre Tumapël, bbra Hyang Parame^wara, sami ingatnran. „Sapa kang 8un-ilonana'\ 
Dadi kang yuddha, kalah kadaton knlon^ kapësan bhra Hyang wi^efa. Runtik 
sim ayon langaha. Ingatnran bhre Tnmapël, bhra Parame^wara : y,Sampan age 
lungha^ isun-lawanane". Saka bhra Hyang wi^ei^, apangarah ingadégan denira 
bhre Tamapël, denira bhre ParameQwara. Kalah kadaton wetan. Bhre Daha 10 
ingemban denira bhra Hyang wi^e^; bhinakta mangilen. Bhra Wirabhumi 
Inngha ring wëngi^ tumalampak ing parahu^ tinat denira raden Gajah bhiseka 
rata angabhaya, bhra Narapati. Eatututan ing parahu, minoktan tnr pinök 
bhinakta datêng ing Majapahit^ dhinarma ta sira ring Lang, dharmabhi^ka 
ring Gorifapara, i Qaka dak parëgrëg agang naga-laranahat-walan, 1328. 15 

Patang tahan atëlasan sira Gajah mangari, i ^aka pak^a-gana^kaya-wong, 
1332. Ro wëlas tahan sira Gaja lëmbana patih. 

Tumali gantar pajalang-pajat, i (aka kaya*weda-gananing-wong, 1343. 

Atëlasan sira Gajah lëmbana i ^ka pawanagni-kaya-bhami, 1335. Ti* 
gang tahan apatih tahan Eanaka. 20 

Bhre Daha mokta. Bhre Matahan mokta. Bhre Mataram mokta. Tamali 
palantaran agang i Qaka liman-kayangambah-lëmah^ 1338. 

Tamali pahilan agung i ^aka naga-yaganahat-wong, 1348. 

Bhre Tamapël mokta i Qaka sanga-yaga-kaya-wong, 1349; dhinarmeng 
Lo kërép; dharmabhi^eka ring Amarasabha. Bhre Wëngkër mokta dhinarmeng 25 
Sumëngka. Bhra Hyang wi^esa mokta dbinaimeng Lalangon^ bhi^ekaning dharma 
ring Paramawife^apara. 

Bhra prabha stri mokta i (aka rüpanilagni-sitang^a, 1351. 

Sira tahan Eanaka atëlasan i ^aka paksawihat-gananing-wong^ 1363. 
Pita wëlas tahan apatih. 30 

Bhre Lasëm mokta ring Jinggan. Bhre Pandan salas mokta. Raden Jagala. 

Raden Gajah ingilangakën pinado^a amëki bhre Wirabami i Qaka 
bhutamanah-antëla-tanggaly 1355. 

Bhre Daha dak a&jënëng rata i Qaka manawa-paneagni-walan, 1359. 

Bhre Parame^wara mokta, sang mokta ring Wi^nabhawana i faka naga- 35 
gan&gni-sitangfa, 1368, dhinarmeng Singhajaya. Bhre Këling mokta, dhinarmeng 
Apaapa. Bhre prabha stri mokta i Qaka nawa-rasSgni-fitang^a, 1369;tanggal 
dhinarmeng Singhajaya. 

1, B. mokta.— 6. B. tamnli parëgrëg.— 7. C ingaran — B. saddha.— 8* B. deni(ng) blire. — 81. B. 
angangabbiya.— 16. B. paguua.— 17. C. apatih.— 18. B. i 9aka 133.— 19, B. i ^aka 1336.— 22. B,palantaii.— 
88. C. Btri oatbreekt.^29. B. bak9L— B. 1361.— 32. C. pinakadofa— C. ambéki.— 34. B. jènSog ring IMft. 



— 32 — 

Tamali bhre Tumapël angganteni prabha. 

Bhre Pagnhan angilangakën^ wong Ti Innggalating, katur ing Majapahit. 

Tumuli palindu i Qaka pak^a-gananahut-wulan, 13G2. 

Bhre Paguban sira sang mokta ring Ganggu dhinarmeng Sabyantara. 
5 Bhra Hyang mokta dbinarme Puri. Bbre Jagaraga mokta. Bhre Kabalan mokta 
dbinarmeng Sumëngka tunggal dbinarma. Bhre Pajang mokta tunggal dhinar- 
meng Sabyantara. 

Tumuli guntur pakuningan i (aka wëlut-wiku-anabut-wulan, 137. Bbre 
prabbu mokta i Qaka babni-parwata-kayeku^ 1373, bbi^ekaning dharmma ring 
10 Kërtawijayapura. 

Bbre Pamotan aüjënëng ing Eëling, Kaburipan, abbi^ekanira frt Raja* 
sawarddhana. Mokta sang Sinagara, dbinarma ring Sëpang i ^aka wisaya-kuda- 
nabut-wongy 1375. 

Tëlnng tabun tan bana prabbu. 
15 Tumuli bbre Wëngkër prabbu, bbi^ekanira bhra Hyang purwawi^esa, 

i Qaka brahmana-saptagnyanabut-wulan, 1378. 

Tumuli guntur palandëp i (aka pat-ula-tëlung-wit, 1384. 

Bhre Daba mokta i fakagana-br&bmanagni-tunggal, 1386. Bhra Hyang 
purwawi^e^a mokta, dbinarma ring Puri, i ^aka brabmana-nagagni-fitangfu, 
20 1388. Tumuli bbre Jagaraga mokta. 

Bbre Pandan salas aüjënëng ing Tumapël, anuli prabbu i faka brabma- 

na-naga-kaya- tunggal, 1388, prabbu rong tabun. Tumuli sab saking kadaton. 

Putranira sang Sinagara, bbre Koripan, bhre Mataram, bbre Pamotan, pamungsu 

bbre Kërtabbflmi, kapëmah paman, bhre prabbu sang mokta ring kadaton i (aka 

25 9unya-nora-yuganing-wong, 1400. 

Tumuli guntur pawatu-gunung i <^aka kayambara-sagareku, 1403. 

Iti Pararaten. 

Tëlas sinurat ing Iccasada ring Qcla pënëk, i Qaka wi^aya-guna-bayu- 
ning-wong, 15.i5. Ngkana koiivusanira sinërat dina Pa., Sa., Warigadyan, masa 
30 ki^napa^ dwitiyaning karwa. Sampun tan kapabarjaba de sang fuddh&maca. 
Tunalëwihing sastra durbhik^a tan open kwebaning na^a, mapan olibing arddba 
pun^gung mabvv asisiuahu. Oin dirgghayur astu, tatbdstu, astu, om Qubham 
astu kintu sang anurat. 



3. C. Ti^nng kMlati. — 5. C. dhinarma ring Pnri. — 8. C. paknninjean kaningao, in B. onthrtekt 
kaningHii. . . . Sëpanar.— 18. C. i 9aka ^QA-brahmiDi-kayeDln, 138^5. — 19. B. PArwdnin. — 23. ö. bhre Paio itan 
(mUreekt,'^2^ C. Pdmutio, . . . bbre Kérat péroah pimin. — 26. B parwatugauaug. — 27. C, dé koh^kj» 
Imdi kUr fAkakAlaoin^ tinar»t Ura-imk^a-aiivayeka, d, i. 1522, zonder meer. 



VEBTALIN6 



EN 



AANTEEKENTNQEISr. 



HET BOEK DER KONINQEN 



OF 



DE OVERLEVERING 



OMTRENT 



KEN ANGBOK 



HOOFDSTUK I. 

KcH Angrok (of Arok), als koning Cri Hnjasa, hhatnra sang Atni'invabhümi 

en hhdiara Gtmi. Caka 1144 — 1169. 

Alsvolgt luidt de overlevering omtrent Ken Angrok. 

(Voorspel.) Het begon met dat er, toen hij in het leven werd geroepen *), 
een weduwe te Jiput >) was, die een kind had, dat niet behoorlijk leefde, de 
banden verbrak '), en den Onzienlijke diende om er mede te bedriegen *). Hij 
verliet Jiput en vluchtte naar het gebied van Bulalak. 

Het hoofd ^) diU'ir was Mpu Tapawangkëng. Deze wilde aan zijn kluis 
een staatsiepoort igopura] maken en hem was daarvoor door den deurgod *) om 
een rooden bok gevraagd ') Tapawangkëng zeide: „Hel geeft niet of men al 
zegt dat het niet mag «); zeker zal het myn verderf (ter helle) bewerken»), zoo 
er een mensch (bij) gedood wordt, maar er is op ceu andere wijze niet te voldoen 
aan het verzoek om een rooden bok als oöer '°)". De losbandige nam (namelijk) 



1 In 't Jav. mulunira dak dinadekt'n nninusa. 

2) In 't Jav. rang4if(iniHg Jiput, 

•i In 't Jav. am'égati npt'^im : «leze uitdrukking wordt iu de rechtstaal, neven*» verschillende andereu, 
jCebruikt in den ziu van vrouwe se bender. 

4) In 't Jiiv. pinahapainaTteanaHing hijany sukima, dit zou uok kunnen beteckeueu : diende oui er den 
Onzienlijke mede te bedriegen. De bedoeling \^ onduidelijk, niet minder daik hetgeen straks volgt. 

6) In 't Jav. abatur. 

6) In 't Jav. hgamjing lawamj ; of den God van Lawang? 

7) In 't Jav. loè^tu bang tapalaki, A en B. geven gapasaki . 

8) In 't Jav. nora olihing apéningan. 

9) Lees agawea, 

10) Dat in hetgeen tot hiertoe vertaald werd, de juiste zin getrofifen is, is alles behalve zeker. 
Men lette er op, dat ook lager is den tekst herhaaldelgk zaken, waarop [voorafgaande mededeeliugcn reeds 
sloegen, en waardoor dezen alleen duidelijk wordeu, eerst later worden vermeld. 

Verh. Bat. Gen. deel XLIX. :L 



Hoofdstuk I. — 36 — Vertaldto. 

op zich het deuroffer van Mpu TapawangkëDg te zijn ; hij deed wat hij 
beloofde, om op die wijze terug te keeren *) naarWi^nu's wereld*), om zich weer 
in den midden(d. i. men8chen-)-wereld te kunnen incarneeren in iemand van 
staat; aldus namelijk yerzocht hij. Dat is het oogenblik geweest, dat MpuTapa- 
wangkëng hem toestond, dat hij zich incarneeren zou in overeenstemming met 
hetgeen hij bij zijn sterven vroeg. Hij doorleefde de zeven kreitsen. Na zijn dood 
nam hem Mpu Tapawangkëng als offer, en toen dat gebeurd was, vloog hij weg 
(verdween hij) naar Wisnu's wereld, zooals de afspraak was^ die hij gemaakt had, 
toen hy • zich als offer gaf, en verzocht in staat gesteld te worden zich beoosten 
den Eawi te incarneeren. 

{Begin van hel eigenllijke verhaal.) Batara Bhrahma zag uit *) naar iemand, 
bij wie hij een kind verwekken kon. Daarmede viel samen, dat er een jong 
bruidspaar was, dat juist de liefde pleegde. De man heette Gajahpara, en de 
vrouw Ken Ëndok. Zij bewerkten als landbouwers hun grond. Ken Ëndok 
bracht haren man Gajahpara zijn eten op de sawah. 

[2] De sawah, waarheen zij het eten bracht, heette Ayuga, en de streek 
waar Ken Ëndok woonde, Pangkur. Toen daalde Bhatara Brahma neder en hij 
besliep Ken Ëndok, op de Tëgal lalatëng. Hy legde haar een verplichting op: 
„Laat u niet weer door uwen man beslapen; als gij u door uwen man zult laten 
beslapen, zal dat zgn dood zijn, en straks mijn zoon niet louter M wezen. Die 
zoon van mij moet Ken Angrok heeten, hij zal later den toestand van het land 
Jawa geheel wijzigen ^)''. Bhatara Brahma verdween. Ken Ëndok vervolgde daarop 



1) Lees margahanira mulih. 

2) In 't Jav. maring WifnuèAuwana. Hieruit, men leze ook wat er dadelgk op volfct moet men 
opmaken, dat de am^gati apus, die das eigenijk daar thuis behoorde, en zich van daar uit wil gaau iurar- 
neeren, niemand anders dan Wi^un zelf was. In wien h\j zich zal gaau incarneeren, worit nog niet gezegd, 
doch, terwgl het zich reeds hier laat vermoeien, dat dit wezen zal in den hoofdperson van 't volgende verhaal, 
bljkt het op bladz. 8, reg. 31 volgg., dat inderdaad Ken Angrok de uitverkorene iras. Deze, door BhatAra 
Brahma verwekt, en door Bhnt&ra Guru, in een plechtige sumenkomst der goden, z g n zoon genoemd, is dus 
daarenboven ook nog een incarnatie van Wi^pu. Het is zaak, daarop hier reeds even de aandacht gevestigd 
te hebben. Dit hoogst onduidelgke voorspel, om 't zoo te noemen, moet toch zonder twijfel dienen, 
niet minder dan hetgeen later zoo veel duidelijker omtrent Angrok's afkomst wordt verteld, om diens groot- 
heid en zijn eigentlgke wezen in het licht te stellen. Ken Angrok, volgens de hier gevonden overlevering, 
de stamvader van de latere vorsten van Mi^apahit, was geen gewoon mensch. Bg het lezen van het eerste 
gedeelte van het hyek houde men dit steeds in het oog. D.it moest worden aangetoond, en het is begrjjpeljk, 
dat men daartoe de middelen bezigde, die dat^ van inlandsch standpunt, duidelgk konden en moesten maken; 
intusschen behoeft daarbg geen opzet of beraamd bedrog in 't spel te zjjn geweest. 

3> In '1 Jav. angilingilingi, 

4) Kacacamjntran, vermengd, niet zuiver en alleen m q n zoon; intusschen beteekent eampur ook gees- 
telijk onrein, besmet. 

5) Kang amutêr bhumi Jawa zou in een geschrift van lateren tgd beteekenen: „heer van Jawa, daar 
koning". In aanmerking nemende wat Ken Angrok verricht, een geheel anderen toestand op Jawa in het 
leven roepen, en het gebruik van het woord op bl. 13 reg. 15 lèla» puriüa-weianing Kawi kaputër (zoo leze 
men daar), en bl. )4 reg. 33 kaputêr bhumi Jawa denira, heeft men hier aMu/^^r naar zijn eigenljjke beteekenia 
up te vatten. 



Hoofdstuk I. — 37 — Vertaling. 

haren weg naar de mwah en kwam bij Gajahpara. Zij zeide : „Gajahpara, verneem 
dat ik op de Tégaling lalatëng door een (of den) onzichtbaren god beslapen 
ben. Hij gaf mij de opdracht: slaap niet meer met uwen man, hij zal sterven, 
als hij het mocht doorzetten met u te slapen, en mijn zoon zal niet meer louter 
zijn". Daarop keerde Gajahpara huiswaarts. Daar noodigde hij Ken Éndok uit 
met hem te slapen, haar nog eens willende beslapen. Ken Éndok wilde van hem 
niet meer weten (en zeide): „Gajahpara, ons huwelijk is ontbonden; ik ben be- 
vreesd voor hetgeen de god zeide, mij niet toe te staan mij weer met u te ver- 
eenigeu". Gajahpara zeide: „Wijfje *), wat zou het, wat zal ik er aan doen; ik 
vind het goed van u te scheiden en wat onze have aangaat, wat van u kwam *) 
keere tot n weer, wijfje; wat mij toebehoort, kome weer aan mij'. 

Daarna, na deze afspraak, ging Ken Lndok weer terug naar Pangkur, 
aan de overzijde van de rivier, in het noorden; Gajahpara bleef te Campara, op 
den zuidelijken oever. Na nog geen vijf dagen stierf Gajahpara. 

De menschen riepen: „Hoe wonderbaarlijk gevaarlijk ') is dat nog ongeboren 
kind (al); nog maar kort zijn zijne ouders gescheiden, en nu sterft zijn vader reeds''. 

Toen het kind later voldragen was, baarde Ken Êndok een jongen. Zij 
wierp hem op de pabajangan *). 

Nu wilde het geval dat er een dief, Lembong was zijn naam, die bij 
toeval op die /xibajangan kwam, (er) iets zag lichten '). Hij ging er op af, en bespeur- 
de *) een weenend kind. Ën naderbij gekomen, bleek het, dat dat schreiende 
kind dat licht van zich gaf. Hij nam het op, en droeg het in zijne armen naar 
huis, waar hij het als kind aannam. Ken Êndok hoorde het, dat Lembong een 
kind had aangenomen, — een der mannen van Lembong vertelde het, — en wel een 
kind, dat hij op de pabajangan gevonden had, en dat hij 's nachts licht had zien 
geven. Toen ging zij tot hem, (en nu) bleek het, dat het haar kind was. Zij zeide: 
„Lembong, misschien kent gij het kind niet, dat gij gevonden hebt; het is een 
kind van mij; wilt gij weten ') wat er de oorsprong van is, Bhatara Brahma heeft 
het bij mij verwekt; pas er goed op, (want) als had het twee moeders [3] en één 
vader, zoo is dit kind''. Lembong en zijne vrouw *) hielden steeds meer van hem 
hij werd langzamerhand •) grooter, en Lembong nam hem mede uit stelen. Tot 
hij zoo oud was, dat hij buffels kon weiden, woonde *®} Ken Angrok te Pangkur 

1) In het Jav. staat er nini, evenals zjj Gajahpara met kaki aanspreekt. 

2) In 't Jav. rènarhii; de vertaling is op de gis. 

3) In 't Jav. panat; kamakara, nienw-Jav. mangkara. 

4) Van bajang ; volgens Dr. van der Tuuk is pabajangan, kerkhof voor kinderen, die nog niet van 
tanden hebben gewisseld. 

5) Zie nog beneden. 

6) In 't Jav. amirëêëp, vgl. bl. 5, reg. 22, en zie nog bl. 22, rcg. 15. 

7) Wikana, conj. van ond-JaT. wihikan. 

8) In 't JaT. êotomah rhiép(?), 

9) In 't Jav. êakalawGnlawon^ langzamerhand, v. d. T. 
10) Lees anger ing. 



Hoofdstuk I. — 38 — Vertaling. 

Alles wat Ken Èndok en alles wat Lemboug bezat maakte hij op M? en tenslotte 
raakte bij, voor den amantfah van Lëbak een span buffels weidende, na eenigen 
tijd (ook) kwijt de buflFels, die bij (voor benO weiden moest. 

De amantjala scbatte ze op 8000 {kcpeng). Nu kreeg Angrok van zijn 
vader en moeder beiden hevige verwijtingen: „Jongen, — zeiden zij, — nu moeten 
wij pandeling *) worden; ook al vlucht gij niet weg, wij moeten toch pandeling 
bij den amandala van Lebak worden". Dat verdroeg hij niet; hij liep (dus) weg, 
en verliet zijn beide vaders te Campara en te Pangkur '). 

Daarop ging hij heen *) en vluchtte hij naar Kapundungan. maar tot wien 
hij zich ook wendde om er te blijven, men wilde van hem niets weten. 

Nu was er een .va;**-8peler ^) van Karuman^ Bango samparan geheeten. Hij 
verloor bij het spelen aan den maland<ing van Karuman, en kon, toen hij gemaand 
werd, niet betalen «). Bango samparan verliet nu Karuman om te Rabut jalu te 
gaan bidden ^). Uit den hemel een stem hoorende, die hem beval weer naar Ka- 
ruman terug te gaan, „Ik heb een zoon, die aw schuld zal delgen: hij heet Ken 
Angrok", verliet Bango samparan Rabut jalu, liep den gauschen nacht door, en 
vond zoo den jongen, wat hij als een bestiering Gods beschouwde, (want) het was 
werkelijk Ken Angrok. Hij nam hem mede naar Karuman en aan als zoon. Daarop 
naar het speelhuis gegaan, vond hij er den tnalandang, en speelde hij (weer) met hem; 
nu verloor de malandangj en won Bango samparan alles weer terug wat hij verloren 
had, duidelijk door Gods toedoen, en toen hij naar huis ging, nam hij Ken Angrok 
mede. 

Bango samparan was getrouwd «) met twee zusters; zijn oudste vrouw 
was Gënuk buntu, Tirthaja de jongste. De kinderen (van de laatste) ®) waren 
Pafiji Bawuk, daarop volgde Panji Kuncang; diens jongere^ broeders waren 
Paiiji Kunal, en Paüji Kénengkung ; het jongste kind was een meisje, Cucupuranti. 



1) In 't Jav. UnoiohakH; in A. titiotorakhi. 

2) Dat dit hier de Tertaling van anvnggua moet zjjn, lij?t voor de hand. 

3) Tc Campara had zijn moeder'» man Gnjahpara gewoond, maar deze was dood. Dat ook Lembong 
daar woonde, bleek boven niet. Eerder zou men zeggen, dut diens verblijfplaats te Pangkur was, waarheen 
Ken Endok terugkerrde. Ook als men r<7/w// in den zin van «onders" opvat, blijft dezelfde iiioeielijkheid bestaan. 

4) Aymh ^-r eêah i_ kesah, hier gewoonlgk aah. 

5) Wat saji voor een «pel is, is mij onbekend; in B ontbreekt het woord. 

6) In H Jav. f^npang^masi; de eigentl'^ke uitdrnkking voor sneuvelen is anghnasi pati, het met den 
dood betalen, zooals men hier nog vindt op bl. 21. reg. 18; de nieuw-Javaanschc uitdrukking is goed ge- 
zien nlechts een ellips, of een restant. 

7) Tn 't Jav. ananakti ; onwillekenrig zou men om de overecnkoirst in vorm der beide letters X^ 
en 3© in het Balineesch-Javaansche schrift, hier en bl. 8 reg 6 ahkabhakii willen lezen. De Iss. zjn 
intusschen eenstemmig. De vertaling is op de gis. Het woord schijnt te betcekenen bqv. ergens den nacht 
gaan doorbrengen om er te droomen. 

8) Tn 't Jav. awayuh. 

9) 7?^^» anom werd duidelijkheidbhslve reeds in den tekbt ingevoegd. Gënuk buntu, die geen kin- 
deren had, nam Ken Angrok aan. 



Hoofdstuk I. — 39 — VERTALnro. 

Gënnk buntn (de oudste vrouw) nam Ken Angrok tot zood aan. Hij bleef ge- 
ruimen tij<l te Karuman, maar kon het met de panjf^ niet vinden, en daarom 
verliet hij de plaats. 

Daarop vond hij te Kapundungan een jeugdigen herder, den zoon van 
Tuwan Sahaja, den hui/ul van Sagënggëng i), Tuwan Tita, en met deze werd hij 
vrienden. 

Zij hielden zeer veel van elkander. Hij bleef nu bij Tuwan Sahaja, en 
Ken Angrok en Tuwan Tita waren het nooit oneens • ). Zij wilden leeren lezen, 
(en daarom) begaven zij zich tot Janggan, te Sagënggèng 3), om bij hem in dienst 
te gaan *), en vroegen hem hun onderwijs te geven. Zij kregen daarop onder- 
richt in het lezen, [4] het gebruik der klinkers en medeklinkers, en hunne w^- 
zigingen, in de candrasanijknla ^) en de tijdrekenkunde: dagen, maanden, jaren, 
de verschillende soorten van weken en de mikus. Door het onderricht van Janggan 
werden zij zeer kundig. 

Nu had Janggan een ;Vif7i^/-boom geplant, die het sieraad van zijn tuin 
was geworden. 

Deze droeg goed, en zat rondom vol met haast rijpe vruchten. Hij had uit- 
drukkelijk verboden er de vruchten van te plukken: en niemand durfde van de 
vruchten van dien /amftiz-boom te nemen. Janggan had gezegd: .,Als diey/imfti/'.* 
goed rijp zijn, mag men ze plukken". Ken Angrok kreeg er crgen trek in, toen hij 
ze zag, en was er steeds meer van vervuld. Op een zekeren nacht, op den tijd 
dat men gewoonlijk slaapt, en ook Ken Angrok sliep, kwamen er nit zijn hoofd in 
grooten getale, en al maar door, vleermuizen ^) te voorschijn, die den ganschen 
nacht van die ya^nftir-vruchten van Janggan aten. Den volgenden morgen zag men 
ze in den tuin verspreid liggen: Janggan *s volgelingen raapten ze op. Toen Jang- 
gan de vernielde ;Vimfri<- vruchten in den tuin verspreid zag liggen, werd hij boos, 
en zeide tot een der jongelingen (die bij hem in huis waren): „Hoe komt die 
jamhn zoo vernield''. Hij kreeg van dezen ten antwoord: „Hij is vernield, heer, 
doordat er vleermuizen aan geweest zijn "), die er van gegeten hebben''. Jang- 
gan nam daarop ro/aw-doomen, waarmede hij dien jarfibii omvlocht, en hield den 
geheelen nacht de wacht. Ken Angrok sliep weer, in de zuider-gaanderij ^\ dicht 

1) Lees buyHting Soffhtggéng. 

2^ In 't Jav. tan kana wiyatanira. 

3) I>e tekst geeft sira Janggan ing Sagènggèng. Deie naam is, zooals een ieder ziet, ontstaan alt 
bhtfjangganing Sag'ènggèitg, den geleerden brahmnan Tan Sagénggédg, d. w. z. den onderwgzer daar. 

4) De verbonding van een leerling in het oosten tot zijn leermeester is behalve nug die van een 
zoon tot een vader, ook die van een knecht tot zijn beer. In 't Jav. staat er a(i amarajakmha ; voor «/r zie 
ook bladz. 9 reg. 9 en 18. 

5) In 't Jav. rupncandra, naar de beginwoorden van het tientul ?(trophen, dat bij de Javanen altgd 
als bandboekje gediend heeft tot het zoeken van woorden met een cgferwaarde om jaartallen nit te dmkken. 

0) In *t Jav. lalatrah. 

7) In 't Jav. tampaking lalavak. 

S) In 't Jav. #ff/«. 



Hoofdstuk I. — 40 — Vertaling. 

-bij de plaats, waar het gedroogde gras lag i), en Janggan soms alêp bond. Toen Jang- 
gan de yleermaizen in groote zwermen uit het hoofd van Ken Angrok komen en 
zijn yaf/i/>M- vruchten opeten zag, werd hij boos 2). Te vergeefs 3) trachtte hij ze 
met schreeuwen te verjagen. Hij werd toen nog boozer, en joeg Ken Angrok 
weg; ongeveer tegen middernacht was dat. Ken Angrok stond verschrikt en in 
de war op, liep naar buiten, en ging daar in het alangalang-ye\d liggen slapen. 
Toen Janggan (iets later) naar hem ging (kijken), zag hij midden in de alafigal/iuff 
iets lichten 4). Hij schrok, meenende, dat er iets in brand was geraakt. Hij on- 
derzocht wat hij zag lichten, en bevond toen, dat Ken Angrok dat licht van zich 
gaf. Hij wekte hem, zeide hem weer in huis te gaan en verzocht hem daar weer 
te gaan slapen; en zoo sliep Ken Angrok weer binnen. Den volgenden morgen 
beval Janggan hem de vruchten te gaan plukken. Verheugd zeide Ken Angrok: 
„Laat ik maar eens wat (grooter) worden, dan zal ik Janggan wat ik hem schuldig 
ben, betalen'. 

Ken Angrok was (nu) gaandeweg nog grooter geworden. Met Tuwan Tita 
weidde hij {kebo's\ en maakte hij een bijdorpje, ten oosten van Sagënggëng, op de 
lègar» van Sanja, om er, met zijn makker, tuwan Tita, de voorbijgangers te 
belagen. 

[5] Nu had iemand, die in het bosch van de Kapundungauers palmwijn 
tapte, een schoone dochter. Deze vergezelde haren vader naar het bosch. Zij 
werd daar door Ken Angrok verkracht en beslapen. Adiyuga heette dat bosch. 

Erger nog misdroeg hij zich ; hij belaagde ^) de voorbijgangers, en toen nu 
naar Daha het bericht was doorgedrongen, dat Ken Angrok (op die wijze ergen) 
last veroorzaakte, trachtte de akumi van Tumapël, die Tunggul amétung «) heette 
(en onder Daha stond), hem onschadelijk te maken. 

Hij verliet Sagënggëng en toog naar Rabut gorontol. „Dat mijne vervol- 
gers door het water tegengehouden 7) mogen worden'', vloekte 8) hij, .,dat er 
water te voorschijn kome uit het niet; zoo zal er een storm ö) opkomen, en op 
Jawa zal er geen last zijn'' ^o^. Zoo sprak hij. 

Hij verliet Rabut gorontol, en toog naar Wayang, naar het veld Sukamang- 
gala. Daar was een vogelaar, dien hij beroofde i^). 



1) In 't Jav. kakaKunganing alalauy, 

2) In 't Jay. afiétèh, 

3) In H Jay. kawalahan {kutcalahhi). 

4) Zie boven. 

5) Lees anawala, 

6) Deze eigennaam is op Java nog bekend, zie Babad tanah Djawi, ed. Meinsma, bladz. II. 

7) In 't Jav. kahèbèng. 

8) Soty eeo vervloeking over iets uitgesproken. 

9) In 't Jav. iahuH. 

10) Dit laatste is m\j in H verband onverstaanbaar. 

11) In 't Jav. hana ta papikatan pèrit, irikü ia tira anatoala tcong asèdaAan matutk. 



Hoofdstuk I. — 41 — Vkrtaling. 

Daarop ging hij naar Rabut Katu. Benard i), zag hij een kalu-hoom zoo 
groot als een vijgeDboom; daarin vluchtte hij. 

Vervolgens vluchtte hij naar Junwatu, de kreits van de kvottg mmpurna^ 
daarna naar Lulumbang, waar hij zijn intrek nam bij een vreemde (daar) ^), een 
krijgsmanszoon^ Gagak ingët geheeten. Hij leefde daar eenigen tijd, maar be- 
roofde (ook hier) de voorbijgangers weder. 

Hij ging (vervolgens) van daar weer naar Kapundnngan (terug), om 
er in de Pamalantënan ^) te gaan stelen. Men bemerkte hem, zette hem 
na en omringde hem, en niet meer wetende waarheen te ontkomen, klom hij 
in een /a/-boom, op den rand der rivier, maar toen de dag aanbrak, zag men, dat 
hij daar ingeklommen was, en onder aan den voet van den boom wachtten de 
Kapundungan-ers hem af, het alarmsein ^) slaande. Zijn vervolgers wilden den 
(a/-boom omhakken. Toen brak hij in weeuen uit, en riep hij zijnen vader &) te hulp, 
en nu hoorde hij een stem in het luchtruim hem bevelen (twee) /a/-bladeren at 
te hakken om die rechts en links als vleugels te gebruiken, opdat hij daarmede 
naar den oostelijken oever, de overzijde, zou kunnen vliegen; (want) het was er 
nog ver van daan, dat hij (nu reeds) sterven zou. Hij hakte twee (a/-bladeren 
af, gebruikte die als vleugels, vloog naar den tegenövergelegen oostelijken oever, 
en ontkwam (zoo) naar Ragamasa (of Nagamasa). 

Men zette hem nog na, doch hij wist den kreits van Oran te bereiken, werd 
ook daarheen weer vervolgd, maar ontkwam toch weer naar Kapundungan. 

Hij trof daar den nmandaln bezig met planten. Deze verborg hem, na hem 
tot zoon aangenomen te hebben. Die amawlala had zes kinderen, die alle daar 
aan het planten waren. Juist was er één (van hen) weggegaan om te vissehen, 
zoodat er nog maar vijf waren; in de plaats van den afwezige werd Ken 
Angrok aan het planten gezet. Zijn vervolgers kwamen en (een van hen) zeide 
tot den mnandala: „Mandalay ik zet iemand na, die het erg lastig maakte; hij 
vluchtte zoo even hierheen". De mnandala antwoordde: „(Oordeel zelf), ik ö) 
lieg het heusch niet, dat hij hier niet is. Ik heb zes kinderen; hier zijn er 
juist zes aan het planten, tel ze maar; als er meer dan zes zijn, [6] dan is hier 
nog iemand anders'*. De vervolgers zeiden: „Het is waar, dat deammi/i/i/a (maar) 
zes kinderen heeft, en er zijn er hier maar zes aan het planten''. Zij gingen 
daarop verder. De amawiala sprak toen tot Ken Angrok : „ Mijn jongen, ga heen ; 



1) KapihanaH wordt hier met „benard'' op de icis vertaald. 

2) In 't Jav. toong atnarade^a. 

3) Hier als eigenaam genomen; de juiste beteekenis is m\i onbekend. 

4) KadjaTy op de gis vertaald. 

5) Kang agafadharma ring nra .- letterlgk die voor hem roem stelde in het veryullen van i\jn plicht ; 
maar bedoeld is hier een godheid, en deze wijst hem dan ook aan wat hem te doen staat; onwiUekeuriK Trasgt 
men zich af of nit deze uitdrukking niet toehoren zou zijn het sudarma (in den zin van vader) in de nien- 
were Jav. litteratuur. 

6) Dayatamra, voornaamwoord van den Ie persoon van een brahmaan, v. d. T. 



Hoofdstuk T. — 42 — Vertaling. 

mogelijk komen die u zoeken, nog terug, (en) beredeneeren zi] wat ik zeide 
nader, (dan) geeft liet niet, dat gij tot mij uw toevlucht bebt genomen; vlucht 
naar het bosch". Ken Angrok antwoordde : „Ik zal niet wachten op die mij ver- 
volgen ' 1), en zoo is bet er toe gekomen, dat Ken Angrok zich naar het bosch 
begaf, dat Patangtangan heette. 

Daarop vluchtte hij naar Ano, en van daar naar het bosch te Tërwag, 
maar hij werd weder en nog lastiger. 

No gebeurde het, dat de nmamjnln van Luki, tegenover de nêlahati 2), zijn 
gffl(/(7-veld ging beploegen, om er een boonenveld van te maken. Hij nam eten 
voor zijn bufteljongen mede. Dat plaatste hij oj) een der stapels 3), in een ham- 
^w-kokertje. Voorovergebogen beploegde hij ijverig het boonenveld. Het eten werd 
door Ken Angrok, die er al bukkende naartoe sloop, weggenomen. Zoo deed 
hij dagelijks. De amnvflala stond er verbaasd van, dat het eten van den jongen da- 
gelgks 4) verdween, en zeide: „Hoe komt toch die rijst te verdwijnen*'. Zich 
in de nelahan verschuilende, hield hij het eten van den herder in het oog, terwijl 
hij den jongen (in zijne plaats) liet ploegen. Spoedig daarop kwam Ken Angrok 
uit het bosch, om de rijst weer weg te halen. De amanflnla sprak hem aan: 
y, Gij zijt het dus, mijn jongen, die de rijst van mijn buff'eljongen iederen dag weg 
neemt ^/\ Ken Angrok antwoordde: „Ja, ainand^ila, ik nam het eten van uw 
jongen iederen dag weg, omdat ik hongeren niet te eten heb '. De (imflw(/fï/a zeide : 
„Wel, mijn jongen, kom in mijn kluis als gij honger hebt, vraag (daar) iederen, 
dag om rijst, want dagelijks zie ik uit ot er ook gasten komen". Zoo werd Ken 
Angrok door den amnndala uitgenoodigd te Batur te komen, en op rijst en toe- 
spijzen onthaald. De anunulaln zeide tot zijn vrouw: „Xini bhatari, ik draag u 
op, om, als Ken Angrok hier mocht komen, en ik niet thuis mocht zijn, als zijn 
huisvrouw, lief tegen hem te wezen ^), hij is medelijdenswaardig''. Ken Angrok 
zoo verhaalt men, kwam daar (toen) eiken dag. 

Van daar ging hij naar Lulumbang, naar Banjar kocapet. 

Nu geschiedde het eens, dat de auuiudaln van Turvantapada van '*) Ka- 
balon terugkeerde. Deze, Mpu Palot geheeten, bezat de dharmahtwcana 8). Hij was 
een leerling van den hyaffij (nuful vjni Kabalon, den belichaamden dharmakancana- 
siddhi, siddhi = samdya, Mpu Palot keerde (dan) van Kabalon weer terug met 5 tahil 



1) In het JuTuiuisich «lUut er angher inanih kang ambunia. 
'i) De, beteekeniB is mij onhckciul. 

3) In *t Jav. iindvngHnffuug. 

4) Jn 't Jav, haryan diiui. 

.')) In plaats van ngatnet zal er wel kang amei moeten worden gelezen. 
ü) In 't Jav. kukurènèn tumuli. 

7) In den tekst staat mareng, naar. 

8) Dhar uut kali catitty iets lager dltarmakaticanasiddhi, blijkbaar ile naam van de loer, of van een 
mantra, waarmede men goud >indfn (t-f mnken) kan; siddhi betcekent tooverkunst, en hetzelfde geldt van 
^anidhya, zie B., dat volgens Dr. van der Tuuk met ifoga wordt verklaard. 



Hoofdstuk T. — 43 — Vertaling. 

mw (goud) *). Te Lulnmbang rustte hij even uit Hij zag er tegen op alleen 
naar Tur}-antapada terug Ie gaan, omdat men vertelde dat er iemand was die 
den weg onveilig maakte. Die persoon moest Ken Angrok heeten. Mpu Palot 
wist niet, dat het een en dezelfde was 2). 

[7] Hij trof er Ken Angrok aan. Deze sprak tot hem: „Wel, mijnheer, 
waar gaat gij naar toe?' Mpu Palot antwoordde: „Mijn jongen, ik kom van 
Kabalon, om weer naar Turyantapada terug te keeren- maar ik ben bang voor 
onderweg, want iemand, die Angrok heet, moet hem onveilig maken". Ken Angrok 
glimlaehte en zeidc: „Wel, mijnheer, dan zal ik u begebiden, en ik zal het 
straks wel tegen hem opnemen, als wij dien Ken Angrok mochten ontmoeten; ga 
u maar verder naar Tunantapada terug, en maak u niet ongerust". Dempuvan 
Turyantapada gevoelde zich zeer verplicht, toen hij de belofte van Ken Angrok 
vernam, en thuis gekomen, leerde hij hem de dhannahancana (tot beloouiug) Deze 
kende haar spoedig, en voor Mpu Palot deed hij, als men diens wondermacht (met 
de zijne) zou willen vergelijken, (daarna) niet onder. De kluizenaar nam hem 
ook tot kind aan, tengevolge waarvan de kluis van Turyantapada ook Mandala 
ing bapa heette. 

Nu gedroeg zich Ken Angrok na Mpu Palot als vader erkend te hebben, 
alsvolgt. Omdat Mpu Palot (nog) niet voldoende had, zond deze hem naar Ka- 
balon om de dhavmakancana bij den Injnnfi Inujul van Kabalon geheel en al meester 
te worden en het ruwe (goud), dat hij er nog had achtergelaten ^), geheel weg 
te halen. Ken Angrok ging er heen, maar de bewoners van Kabalon vertrouwden 
hem niet. Dit maakte hem boos: „Er zij emhnng in de panapen (?j" (wenschte 
hij), en hij trachtte het hoofd daar te vermoorden, maar dit vluchtte en ontkwam 
bij den Ay»/w/y hmnU van Kabalon. Alle kluizenaars van Kabalon, de gunilufamfB 
tot en met de kapunlan, werden opgeroepen; zij kwamen naar buiten met hun (//i- 
më^/i- hamers *), zetten Ken Angrok na, en sloegen hem met die hamers, om hem, 
als dat kon, te dooden ^). Maar nu hoorden zij een stem uit den hemel: „Doodt 
dien man niet, kluizenaars; hij is mijn zoon, en heeft nog veel in dit ouderm«iansche 
te verrichten". Dit hoorden de kluizenaars zich uit den hemel toeroepen. Zij hielpen 
Ken Angrok weder geheel ^j bijkomen. Daarop zwoer Ken Angrok een eed 7), 
zeggende: „Er zal bcoosten den Kawi ;;ecn kluizenaar zijn, die de f/A/i/';/i/ï/.vi/lcn/ia 
niet volkomen bezitten zal '. Daarna ging hij van Kabah>n naar Turyantapada, 
en de kluizenaar van de Mandala ing bapa verkreeg de dimrmakaucana nu geheel. 

1) In 't Jav. lakar. 

2) NI. de persoon, dien hij te Lnlamhan^ ontmoetten zou, waarheen Ken Angrok zich had begeren, 
en die gevaarljjke roover. 

8) Kaiunanira van ka{n)tuny =: kari. 

4) In 't Jav. palvgang^a, 

5) Amiiwna^ in B en C ainingronana ^ 

6) In 't Jav. kadi praïagi, als vroeger, als voorheen. 

7) In *t Jav. upata. 



HooFDSiUK I. — 44 — Vertaling. 

Hij verliet toen de Mandaleng bapa en gii^g ^^^^ de buurt van TugaraD. 
De bttyut van Tugaran wilde van hem niet weten. Hij maakte het den menschen 
daar lastig, en werd daarom door de gopala opgenomen en (weer) in de Mandala 
ing bapa geplaatst. Nu gebeurde het, dat hij de dochter van den btnjuf van Tu- 
garan aantrof, toen zij op een //a^a-veld boonen plantte. Hij verkrachtte dat meisje • 
langen tijd was de boon in de zak > ), en daarom zijn de boonen van Tugaran 
gladrond, gtoot en zoet. Van Tugaran keerde hij weder naar de Mandala ing 
bapa terug, [8] en zeide: „Als ik (ooit) wat word, dan zal ik aan den kluizenaar 
van den Mandala ing bapa een groote gift in zilver doen''. 

Kr werd naar Daha bericht gezonden, dat hij weder last veroorzaakte, en 
zich te Turyantapada verstoken had. Men trachtte hem weer onschadelijk te ma- 
keu en lieden van Daha zochten naar hem. Hij ging van de Mandaleng bapa 
weg, en vluchtte naar den berg Pustaka. 

Van daar ging hij naar Limbehan, waar de buyut met hem begaan was 
en hem optiam, doch daarop ging hij weer naar Rabut këdung Panitikan om er 
te gaan slaj^en ^). (Daar) werd hem geopenbaard, dat hij naar Rabut guuung Lëjar 
moest gaan op zwarten Woensdag van de wu/cn Warigadyan, „de goden zouden 
dan een vergadering houden*', zoo zeide de ftm/ van Panitikan, ,,(en) ik zal u helpen 
en verbergen, vader; niet iemand zal u zien; ik moet (toch) op den berg Lëjar 
gaan vegen, als er godenvergadering is". Zoo zeide zg. 

Ken Angrok begaf zich daarop naar den berg Lëjar, en toen zwarte Woens- 
dag van de ttuku Warigadyen was gekomen, ging hij naar de vergaderplaats. 
Hij verstak zich in den vuilnishoop ^), waar hij door de nini van Panitikan met gras 
overdekt werd. Daarop lieten zich de zeven geluiden hooren : rollende donderslagen, 
en korte, aardbeving, bliksem, weerlicht, wervel- en stormwinden ; er viel regen in een 
tijd, dat men die niet verwachten kon ; onafgebroken waren er regenbogen in het 
oosten en (te gelijk) in het westen te zien, en daarop zonder verpoozen stemmen te 
hooren rumoerig en onstuimig. Het gevoelen van de goden op die vergadering was : 

„Hij die het eiland Jawa hecht en sterk maken zal, als 4)" zoo spraken de 

goden, om beurten roepende 5); en ,,Wie moet er koning over het eiland Jawa 
worden", vroegen zij. Bhatara Guru antwoordde : „Weet goden, dat ik ö) een zoon 
heb, die als menschekind uit een vrouw van Pangkur geboren is, die zal het land 
van Jawa hecht en sterk maken". Nu kwam Ken Angrok uit de vuilnishoop te voor- 
schijn, en de goden keurden hem, toen zij hem gezien hadden, goed, en stelden vast, dat 



1) De uitdrukking is vermoedel^k dubbelzinnig; uiij is het verband en de eigenlijke bedoeling niet 
duideljk. 

2) Jnanakti, zie de aanteckening boven. 

3) In 't Jav. pawuhan. 

4) Er staat yaya tandi (var. tédi)mandala. 

5) In 't Jav. eualanggapan ujar, 

6) Zie boven. 



Hoofdstuk I. — 45 — Vertauno. 

hy (als koning) Bhat&ra Gum heeten zou i); zoo beslisten zij, onder luid en al- 
gemeen gejuich 2). 

Over Ken Angrok was door het lot (nog verder) beschikt^ dat hij als vader 
erkennen zou den weleerwaarden brahmaan Lohgawe^ die juist van Jambudwipa was 
gekomen, omdat hij hem te Taloka moest gaan zoeken ; zóó zijn er het eerst brahma- 
nen oostelijk van de Kawi aangeland. De tocht naar Jawa had hij niet ipet een schip 
gemaakt; op drie ftaAa/an^-bladeren had hij hem gedaan S). Hij landde in het gebied 
van Taloka, en zocht nu Ken Angrok overal. Hij ^) sprak: ,,Er moet een jongen 
zgn met lange handen en dikke knieën, in zijne rechterhand moet het radteeken en 
in zijn linker het schelpteeken te zien zijn, Ken Angrok heet hij, en ik zag hem 
in mgne devotie; hij is eene incarnatie van Bhatara Wisnu &), die mij indertgd 
in Jambudwipa onderrichtte: „Eerwaarde Lohgawe, gij hebt mijn beeldtenis nu 
reeds zoo lang aangebeden, (maar) zelf ben ik hier niet (meer) ; ik heb mij geïncarneerd 
in een mensch op Jawa ; volg ^) mij (daarheen) ; ik ben 7) (thans) Ken Angrok ; [9] 
zoek mij in de speelhuizen" '\ Spoedig daarop treft Lohgawe Ken Angrok in een 
speelhuis aan. Hij ziet oplettend toe, en werkelijk hij is het dien hij in zijp devotie ge- 
zien had. |Hij wendt zich tot hem en zegt: „Gij, mijn jongen, zijt Ken Angrok? 
Ik ken u, omdat ik u in mgn devotie heb aanschouwd''. Angrok antwoordde: 
„Juist, mgnheer, ik ben Ken Angrok''. De brahmaan omhelsde hem en zeide : „Ik 
neem u aan tot zoon mijn jongen, ik zal u helpen in het ongeluk ^), en u verzorgen 
waarheen gg ook gaat". Ken Angrok verlaat daarop Talokah, en gaat met den 
brahmaan naar Tumapèl. Daar gekomen vindt hij een goede gelegenheid ^) om, 
zooals hij erg verlangde, bij den akuwu Tunggul amétung op audiëntie te gaan ^O). 
Er is juist audiëntie. Tunggul ametung zeide: „Welkom ^^;, mijnheer de brah- 
maan, van waar komt u, dien ik tot nog toe niet zag". De eerwaarde Lohgawe 
antwoordde: „Mijn jongen, akuwu, ik kom juist van over zee; ik wilde gaarne 
bij u, mijn jongen, in dienst komen en verwijlen, en ook mijn aangenomen zoon 
hier zou dat gaarne bij u doen". Tanggul amétung liet daarop volgen : „Wel, eer- 
waarde, het doet mij genoegen, dat u bij mij wil komen verblijven". Ken Ang- 
rok diende nu gedurende een tijd bij Tunggul amëtung, den akuwu van Tumapèl. 



1) Zie later. Tit het hier gebezigde bfiixeka (oornpr. abhUeka ontstond het nieuw- Jav. bulkan, 

i) In 't Jav. asnrak a-mnggarvhan. 

3) In 't Jav. atampakau ron eoz. 

4) Lees danghyang , 

5) Zie boven. 

6) In 't Jav. tüMutureng , 

7) Lees araningong; zgn en heeten komen in het Javaans^rh op het zelfde neer. 
8^ In 't Jav. anastapa, 

9) In 't Jav. kaladega, (een goede J tgd en plaats (oni iets te doen), een terrn ontleend aan liet ]»rtj^!i- 
wezen en de daarmede samenhangende politiek. 

10) £r zal wel asesebaha moaien worden gelezen. 

11) Lees bhagea. 



HOOÏ^DSTUK ï. — 46 — Vertaukg, 

Nu gebeurde het dat er te Panawijen een geleerde ftwrfrfAa-priester *) van 
de mabayanistiBclie kerk^ was. Hij had een khiis op de velden 2) van de Panawi- 
jenerS; en heette ^) Mpu Purwa. Hij liad een dochter van vóór dat hij maha- 
yanist geworden was, een meisje buitengemeen schoon, Ken Dédés gcheeten. 
Men vertelde van haar, dat zij onvergelijkelijk schoon was, en beoosten den 
Kawi was dat doorgedrongen tot Tumapël. Tunggul amëtung hoorde het, 
hij ging naar Panawijen, naar het verblijf van Mpu Pftrwa, vond (daar) Ken 
Dédés, en was over de schoonheid van de maagd geheel opgetogen. Mpu Pur- 
wa was juist afwezig, en zoo werd Ken Dédés door Tunggul amétung met 
geweld ^) geschaakt. Toen Mpu Purwa weer terugkwam, vond hij zijn (im- 
mers) reeds geschaakte dochter niet (terug); hij begreep het niet 5), en slingerde een 
rerschrikkelijke verwensching (tegen de schuldigen; : ,,Moge de schaker van mgu 
kind het genot, dat hij van haar hebben zal, niet ten einde toe smaken, maar 
door sluipmoord met een kris ^j omkomen; en mogen de putten van de Pana- 
wijeners opdrogen, en er geen water uit de bekkens hier meer vloeien, omdat 
zij mij niet bericht hebben, dat mijn kind aangerand 7) werd; en voor mijn kind, 
die de karma atnamailamji 8) geleerd heeft, wensch ik, dat zij een zeer groot geluk 
deelachtig moge worden". [10] Zoo luidde de vloek van den mahstyanist te Pa- 
nawijen. 

Nadat Ken Dédés te Tumapél was gekomen, sliep Tunggul amétung met haar, 
en hij beminde haar teder, en toen zich de eerste teekenen der zwangerschap begonnen 
te openbaren ^), deed hij met haar voor genoegen een uitstapje naar den hof Boboji. 
Zy reed (daarbij) op een wagen. Bij het afstijgen van den wagen, in den tuin, deed 
het toeval ^^) hare bloote dij tot op haren schoot zichtbaar worden H), en zag 
Ken Angrok daar een vuurgloed. Hij raakte daardoor in de war *2), en dan, zij 
was zoo volmaakt en onvergelijkelijk schoon, dat hij verliefd werd, en niet wist 
hoe hij het had. 

Nadat Tunggul amétung van zijn uitstapje weer naar huis gekeerd was, 
vertelde Ken Angrok (wat liem overkomen was) aan den eerwaarden Lohgawe : 
ytk^rwaarde vader, wat is liet voor een vrouw, wier schoot een vuurgloed uitstraalt ; 



1} In 't Jav. boddha^thdpaka, 

2) In 't Jav. ietra\ ook begraafplaats, nl. waar de lijken wurden neergelegd. 

3) In 't Jav. apiujiata. 

4) In 't Jttv. üuafM^d. 

h) In 't Juv. tau icruh riiUj kalingaaira, 

6) In 't Jav. binahtid augèrin. 

1) In 'tJttU. den-tcalai, 

8) De kunst oiu licht to geven; wat bedoeld is, blgkt beneden. 

9) In 't Jav. ng'yfaia. 
10) In 't Jav. kaUtoon, 

il) In 't Jav. ket^U wètUira kengkah tékeng rahtutifanira, 

12) Ia 't Jav. kfnoengan. 



BoOiDSWK t. — 47 — Vl2RTi.LmO. 

brengt zg ongelak of geluk aan IV?'' De eerwaarde zeide: ^Wie is dat, mijn 
jongen?'* Angrok zeide: „Vader, er was een vrouw, wier schoot ik zag''. De eer- 
waarde Lohgawe zeide: „Zulk een vrouw, mijn Jongen, is eeue /m/vVti'cin (meeste- 
resse der vrouwen) 2)^ zij is het beste jmik der vrouwen, mijn Jongen, de ellendigste 
(armste, slechtste) man ^), die haar de zijne maken kan, wordt wereldverovc- 
raar ^)," Angrok zweeg eerst een poos, en zeide toen : „Eerwaarde vader, de vrouw, 
wier schoot dien vuurgloed uitstraalde, is de gemalin van den /lAt/rrf/ van Tumapèl : 
nu ik dat weet, zal ik hem door sluipmoord met een kris het leven benemen, 
door mijn hand zal hij omkomen, mits u het goed vindt". De eerwaarde ant- 
woordde: ^Mijn jongen, Tunggul amëtung zal door uw hand sneven, maar het 
gaat niet aan, dat ik mijn goedkeuring hecht ») aan hetgeen gij doen wilt: dat 
is geen handelwijze gepast aan een brahmaan: doe evenwel 6) wat gij wilt'*. 
Angrok zeide: «Dan^ vader, neem ik afscheid van u'\ De brahmaan zeide weer: 
„Waar wilt gij heen gaan, mijn jongen?". Angrok antwoordde: „Naar Kamman, 
daar woont Bango samparan, een speler, die mij tot kind heeft aangenomen, en 
veel van mg houdt; dien wil ik het vragen : misschien hecht hij er zijn goedkeuring 
aan". „Dat is goed, maar, mijn jongen, blijf niet lang te Karuman''. Angrok 
zeide: „Wat zou ik er lang te maken hebben". 

Ken Angrok verlaat nu Tumapël, bereikt Kamman, en vindt Tdaar) Bango 
samparan. „Waar komt gij van daan, — f zoo luidt de ontvangst daar), — gij zgt 
in lang niet bij mij geweest. Het is mij ot ik droom, dat ik u weer bij mij heb. Gij 
zijt wel lang weg geweest". Ken Angrok antwoordde hem : ,,Ik ben in Tnmapél in 
dienst bg den ahêwu geweest, vader. Hier kom ik, omd^it ik. toen zijne gemalin 
van een wagen steeg en haar .schoot (daarbij ) bloot kwam, ;j:ezien heb. dat deze een 
vuurgloed uitstraalde. Nu is er een brahmaan, die eerst onlangs, op Java gekomen 
is, de eerwaarde Lohgawe, en mij als zoon heeft aangenomen : hem heb ik gevraagd : 
„Wat is het voor een vrouw wier schoot een vuurgloed uitstraalt*', en hij heeft ge- 
zegd: „Zalk een vrouw is de bovenste l>este, zij is het di..* men ardhanannmn 
noemt: [U] zij is het die vooral geluk aanbrengt, want al wie haar tot vrouw 
krggt, die wordt wereldveroveraar '. Ik nu, vader Bango. verlang koning te 
worden : ik wil Tunggul amëtung dooden, zijn gemalin huwen om koning te wor- 
den, vader, en ik vroeg aan mijn eerwaarden vader om zijne goedkeuring (zegen >. 
De eerwaarde zeide toen: „Angrok mijn jongen, een brahmaan mig het niet goed- 
keuren '*)y dat iemand de vrouw van een ander neemt, maar doe alles wat gij 
zelf wilt". Daarom kom ik nu tot u, vader Bango. om uw goedkeuring (zegen) te 

1) In *li%r. lattattn* j^mm , 

2} Beneden snlJkoJuin^teari. 

3) In 'tJar. icomf'papa. 

4) In 'tJar. >«/« aSMkrmtemrti, 

5) In 't JsT. érmfmdfomMmM, zie ook verder beneien in den tekst. 

6) In 't JsT. oJkém^mm, r^ bl. II, reg. 5. 

7) Hier in 'tJar. mmgëjém^i 



Hoofdstuk I. — 48 — VRRTALDra. 

vragen, vader, dat ik den akuwu van Tnmapél door sluipmoord dood; zeker komt 
hg (dan) door mijne hand om'\ Bango samparan zeide: „Dat is goed. Ik, mgn 
jongen, keur het goed, dat gij Tanggul amëtung door sluipmoord met een kris 
ombrengt, maar Angrok, myi) jongen, die akuwu is krachtig gebouwd i) ; het kon 
wel eens gebeuren, dat gij niet door en door staakt, als gg hem met een minder 
goede ^) kéf^^ zult steken. )k heb een vriend te Lulumbang, Pu Gandring geheeten ; 
de krissen, die hij maakt, zUn goed ; tegen zijn maaksels is niemand bestand ; men 
behoeft er geen twee maal mede te steken. Laat hem een Icéris maken. En als 
gg die kéris hebt, breng dan Tunggul amëtung door sluipmoord om''. Dit was de 
raad, die Bango samparan aan Ken Angrok gaf. Deze zeide: „Dan ga ik heen, 
vader, naar Lulumbang". 

Hij verliet Karuman, ging naar Lulumbang, en vond daar Grandring aan 
het smeden. Angrok vroeg hem: „Gg zyt waarschijnlyk Gandring? Wel, maak 

mg dan een kéris. Hij moet in vijf maanden gereed zijn (?) ^)". 

Mpu Gandring zeide: „Dat Ifan niet binnen vijf maanden; als gij er een verlangt die 
goed is, dan duurt het wel een vol jaar vóór hg goed geklopt is'\ Ken Angrok 
zeide: „Het komt er niet op aan hoe hg gevgld is, maar in vgf maanden moet 
hg klaar zgn'\ 

Ken Angrok verlaat Lulumbang en gaat (weer) naar Tumapél. Ug komt 
bg den eerwaarden Lohgawe, en deze vraagt hem : „Waarom zgt gg zoo lang te 
Karuman gebleven''. Ken Angrok antwoordde: „Ik ben onderwgl ^) ook te Lu- 
lumbang geweest". 

Nu bleef Ken Angrok een geruimen tijd te Tumapël. Toen de vgf maan- 
den om waren, herinnerde hij zich de afspraak, die hg gemaakt had, toen hg aan 
Mpu Gandring opdroeg een kéris te maken &). Hg ging (weer) naar Lulumbang, en 
vond daar Mpu Gandring aan het vijlen, om de kêrisy waarom Ken Angrok gevraagd 
had, af te maken ^). Ken Angrok zeide: „Waar is de kéris, die ik u besteld 
heb". Gandring antwoordde: „Angrok mijn jongen, dat is juist deze, die ik zit 
te vijlen". Ken Angrok vroeg de kéris te zien, en zeide toen blgkbaar boos: 
«Het geeft ook wat of ik u een kéris bestel, want deze is nog niet af gevgld; 
hg is nog wreed 7). [12] Deze ziet er wel uit, of men er al vijf maanden mede 
bezig is geweest". Hij wordt woedend, zoodat hij Gandring met die kéris van 
zgn eigen maaksel een steek toebrengt. Daarop slaat hij er mede op den steenen 
vgzel, waarin het vijlsel opgezameld werd s); die springt in tweeën. Hg slaat 



V Tégnh, ook «onkwetsbaar". 

2) In 't JaT. kurang yotumya, 

8) Agatana gawene deningsun^ in B. agaia^ in C. etgati. 

4) In 't Jav. êumèlang. 

5) Lees anggawea, 

ft) In 't JaT. anitUgtm, 

7) In 't Ja?. (uHil, in A. (uHiL 

%) In 't Jav. psmèëbëtan. 



Hoofdstuk I. — 49 — Vebtalhto. 

er mede op het aanbeeld van Gandring; ook dat springt stuk. Toen zeide Gan- 
dring: „Door die kris zal Angrok sneven; zijn kinderen en kindskinderen zallen 
door die kris omkomen ; zeven koningen zullen omkomen door die kris'\ Na 
het uiten hiervan viel de smid dood neer. Het was Ken Angrok aan te zien, dat 
hij (er nu) wanhopig (over) was, dat Gandring was omgekomen. „Als ik, zeide 
hij, word wat ik worden wil (een groot man), (dan zallen de bewijzen van mijne 
dankbaarheid) erfelijk ^) oveigaan op de nakomelingschap van den smid van Lu- 
lumbang". Daarop keerde hij weer naar Turaapël terug. 

ïunggul amétung nu had een gunsteling, Kébo hijo, die met Ken Angrok 
zeer bevriend was. Toen deze zag, dat Ken Angrok een nieuwe kéris droeg, met 
een gevest van cauf/Lrwf/Amuty waar de doorns nog aan zaten, en die niet met 
harst vastgemaakt was, kreeg hij daar erg zin in. Hij zeide tot Ken Angrok : „Wel, 
broeder, die kêns neem ik van u*'. Kébo hijo heeft haar aangedaan, omdat hij 
dat aangenaam en haar mooi vond, en omdat hij nu die këris van Ken Angrok een 
geruimen tijd droeg, wist iedereen in Tumapël, dat Kébo hijo met een nieuwe 
keris liep. Nu moest die ketis door Angrok gestolen worden, en dat gelukte. 
Daarop is Ken Angrok 's nachts in het verblijf van den aA*(ia'u gedrongen, toen men 
daar sliep, en geholpen door het toeval, heeft hij diens slaapplaats bereikt zonder 
dat men bespeurd had ^), dat hij er heenging, en Tunggul amëtung in een keer, 
dwars door het hart, dood gestoken; de Gandringsche kris liet hij met opzet 
in den wond zitten 3), Toen het daarop dag geworden was, kwam het aan het 
licht, dat er in Tunggul amëtung's borst een /céris stak, die men herkende als de 
kerLsj die Këbo hijo dagelijks ^) pleegde te dragen. De lieden van Tumapël zei- 
den (daarom) allen: „Këbo hijo, dat is duidelijk 5)^ Ueeft Tunggul amëtung ver- 
moord, want zijn kon\s steekt immers in de borst van den akuwu van Tumapël". 
Këbo hijo is daarop door Tunggul-amëtung's familie gegrepen, en met die lierisy die 
Gandring gemaakt had, gekrist, dat er de dood opvolgde 

Këbo hijo had een zoon, Mahisa randi. Deze was erg bedroefd over den 
dood van zijn vader. Ken Angrok had met hem te doen en maakte hem katik 
(schildknaap), want hij had groot medelijden met hem. 

Nu moesten de goden het (verder) in orde brengen, dat Ken Angrok wer- 
kelijk met Ken Dëdës huwde; lang verlangden zij het, en niemand van de bewo- 
ners van Tumapël durfde iets over Ken Angrok's gedragingen zeggen; ook de 
familie van Tunggul amëtung hield zich stil, omdat niemand iets durfde zeggen, 
en zoo huwde Ken Angrok met Ken Dëdës. 



1) In 't Jav. tumusa. 

2) In 't Jav. fan katcara, 

3) In *t Jav. hinatufakëit mina ha. 
4r) In 't JaT. saèran diita, 

5) In 't Jay. kalingane, 
Verh. Bat. Gen. deel XLIX. 



Hooï'DSWK I. — 50 — Vertaliko. 

[13] Deze was toen reeds drie ^) maanden Tan Tunggul amétung zwanger, 
maar Ken Angrok besliep haar toch ^), en zij hielden veel van elkander. 

Op tijd beviel Ken Dëdës van een jongen^ het kind van Tunggul amé- 
tang; dat den naam Anasapati kreeg, en den bijnaam Anëngah. 

Nadat zij nog eeuigen tijd gehuwd waren geweest, kreeg Ken Dèdés nog 
een kind, (doch nu) van Keu Angrok, een jongen, Mahisa wong atëlëng ; daarop 
een tweede, bijgenaamd Saprang ; een derde, Agnibhaya ; en een meisje, Dewi Rim- 
bu; vier kinderen dus had Ken Angrok bij Ken Dëdës. 

Bij een selir ^)y Ken Umang^ verwekte hij een zoon, bijgenaamd Tohjaya; 
een tweeden zoon, bijgenaamd Sudhatu; een derden zoon, Twan Wërgole, en een 
dochter, Dewi Rambi. 

In het geheel dus had hij 9 kinderen, 7 zonen en 2 dochters. 

Zoo was er een verandering in den stand van zaken beoosten het Kawi-gebergte 
gekomen. Allen beoosten den Kawi hadden ontzag voor Ken Angrok, die er toen 
nog pas aan dacht ^) koning (ralu) te willen te worden, wat de lieden van Tnmapél 
(ook) verlangden. 

Nu geschiedde het, dat (als) door Gods bestiering de koning van Daha, 
vorst Dangdang Gëndis, tot de geestelijke heeren in Daha zeide: „Heeren geeste- 
lijken van de Qiwaitische, zoowel als van de buddhistische geloofsleer ((.'ett*a-^ogfa/a), 
hoe komt het, dat gij voor mij geen sêmbah maakt, want ik ben toch Bhat&ra 
Gum". De geestelijken, geen een uitgezonderd van hen, die er in Kadiri waren, 
antwoordden : „Heer, er is nog nooit een geestelijke geweest, die voor een koning 
een sembah maakte". Zoo spraken allen. Dangdang gëndis zeide : „Welnu als men 
dat vroeger niet deed, maakt gij dan nu voor mij een shnhah\ als gij mijn won- 
dermacht niet inziet, zal ik n er een blijk van geven". Hij plaatste een speer 
met de schacht in den grond, zette zich op den punt er van, en sprak: „Ziet, 
heeren geestelijken, hoe wondermachtig ik ben", (en) hij vertoonde zich vierarmig 
en drieoogig, juist als Bhatara Gurn. Doch de geestelijke heeren van Daha, (nu) 
verplicht voor hem een sétnbah te maken, wilden (het nog) niet, maar verzetten 
zich, en vloden naar Tumapël, bij Ken Angrok. Daarmede begon Tumapël zich 
aan Daha te onttrekken. 

Ken Angrok werd daarop tot vorst (prabhu) van Tumapël, wat een naam 
js van het rijk Singasari, erkend, en onder den naam Qri Rajasa, Sang Amürwa- 
bhümi, gehuldigd &) door de ^iwaitische en buddhistische geestelijke heeren van 
Daha, van welken de eerwaarde Lohgawe de voornaamste was o). 



1) Volgens A. zes, dech zie beneden. 

2) In 't Jav. kaworan, 

3) In 't JaT. binihaji, 

4) Ariwariwa, ongedurig, besluiteloos, v. d. T. 

5) In 't Jav. ingattryan, 

6) in het Jut. tuangkajpanii moet in waarde zooveel als gelgk z^n aan purokita. 



Hoofdstuk T. — 51 — Vertalikö. 

Allen, die Ken Angrok vroeger, toen hij nog niets (ongelukkig) was, lief 
hadden gehad en hem medelijden hadden bewezen, hielp hy (nu), hun hunne 
welwillendheid vergeldende, zooals bijv. Bango samparan, om niet te gewagen 
van den amandala van Turyantapada, en de kinderen van den smid Pu Gandring 
van Lulumbang. [14] Honderd smeden van Lulnmbang zouden vry zijn van de be- 
lastingen saarik purih, sntampalcing ivulukune, wadung-pacule ', de zoon van Këbo 
hijo kreeg dezelfde rechten als de kinderen van Pu Gandring; een zoon van zijn 
eerwaarden vader (Lohgawe , de jongeling Sadang (of Sada), dien deze bij een 
wisnuitische vrouw had verwekt, moest huwen met Cueupuranti, de dochter van 
vader Bango. Zoo luidde het bevel van sang Amürwabhümi. 

Singasari was zeer welvarend, men genoot er algemeene rust. 

Nadat reeds eenigen tijd zich het gerucht verspreid had, dat Ken Angrok 
koning (ratu) was geworden, bracht men vorst Dandang gëndis het bericht, dat 
(hij, thans) sang Amürwabhümi (geheeten), tegen Daha wilde optrekken. Vorst 
Dandang gëndis zeide: „Wie zou mijn land ten onder kunnen brengen? Slechts 
als Bhatara Guru (zelf) uit den hemel komt afdalen, misschien dat het dan ge- 
lukken kan ij". Dit werd Ken Angrok bericht. Deze zeide toen: „Keurt het, 
geestelijke heereu, goed, dat ik den naam Bhatara Guru aanneem". Met hunne 
goedkeuring noemde hij zich daarop zoo 2). Daaina viel hij Daha aan. Vorst 
Dandang gëndis vernam, dat sang Amürwabhümi van Tumapël tegen Daha opge- 
trokken was; hij zeide: „Wee mij, want Angrok heeft de gunst en steun der go- 
den". Tusschen de legers van Tumapël en Daha kwam het tot een treffen, 
(iets) benoorden Gantër; aan weerszijden streed men even heldhaftig en werden 
er belangrijke verliezen geleden, doch Daha verloor het. Een jongere broeder van 
Dangdang gëndis, de Icsalriya Raden Mahisa walungan, stierf den heldendood 3), even- 
als een van diens manlnSj Gubar balëman geheeten ; zij werden beiden 4) door de 
lieden van Tumapël overmand, maar men vocht verwoed (als boeta's die bergen 
verslonden) &). Daarop, nl. toen hun chef overmand was, sloeg het leger van Daha 
op de vlucht; men vluchtte als bijen, die uit zwermen, enz. ^), er was geen her- 
stellen aan. Toen trok ook vorst Dangdang gëndis zich uit het gevecht terug; 
hij vluchtte naar een godshuis {dewalatja)^ en hing zich met paard en schildknaap, 
met payungAvsigeiT en ^tViA-drager, zijn water-page en den page, die zijn mat droeg, 
op in de lucht 7j. [De overwinning van Ken Angiok op Daha was volkomen 8) ]. 



1) In het Jav. sug^an kalaha, 

2) Zie boven. 

3) In H Jav. batnakrU, van bhdma en dkrti. 

At) In 't Jav. wordt de laatste liier genoemd wadwa pinakaiihati, 

6) Amak gunung denipun aprang, 

6) De nitdrnkkingen, die hier gebrnikt worden, z\jn: bubar taicon, pungkur tcëdus, dahut pagung, 

7) In 't Jav. angatcangatcang, 

8> Deze zin, die hier niet op zijne plaats staat, moet iets lager yoorkomen, waar men. hem tosschen 
haai^et herhaald vindt. 



Hoofdstuk I. — 52 — Vertaling. 

Ea toen zijne (Dangdang gëndis's) vrouwen, Dewi Amisani, Dewi Hasin en Dewi 
Paja, vernamen, dat vorst Dangdang gëndis den strijd verloren had, en in het goden- 
verblijf was gaan zweven, toen verdwenen (ook) de drie prinsessen met kralon 
en al (uit het gezicht, door onzichtbaar te worden). 

(De overwinning van Ken Angrok op Daha was volkomen.) Nu hij zyn 
vijand had verslagen ^), keerde hij naar Tumapël terug, en had hij den stand van 
zaken op Java gewijzigd. 

Het Qaka-jaar waarin hij koning werd, dat is tevens dat van den val van 
Daha, was 1144. 

[15] Na eenigf.n tijd, zoo vertelt men, deed Anusapati, de zoon van Tong- 
gul amétung een vraag aan zijn mentor 2). „Ik ben voor uw vader bang'*, zeide 
deze, „spreek u liever s) met uwe moeder". Nusapati hield (daarop) niet op 
zgne moeder te vragen: ,,Moeder, ik vraag u, wat beduidt het toch, dat vader 
mi} zoo geheel anders aanziet dan mijne broeders en zusters, niet eens daarb^ in 
rekening brengende (myn halve broeders en zusters), de kinderen van mijn halve 
moeder, dan ziet vader nog anders". Het was duidelijk dat het einde van sang 
Amürwabhümi naderde ^), Ken Dëdés antwoordde: ,,Het heeft er veel van, dat 
gij hem niet vertrouwt; doch, als gij het verlangt te weten, uw (eigentlyke) va- 
der is Tunggul amëtung ; ik was drie maanden zwanger bij zijn dood ; daarop werd 
ik door sang Amfirwabhümi (tot vrouw) genomen". Nui^pati zeide : „^nSf moeder 
is sang Amfirwabhfimi mijn vader niet; maar hoe stierf mijn vader?" ,)Sang 
Amürwabhümi, mijn jongen, heeft hem gedood". Ken Dëdës zweeg (daarop), als 
of zij te ver was gegaan met de werkelijke toedracht aan haren zoon te vertellen. 
Nusapati zeide : „Moeder, vader (nl. sang Amürwabhümi) heeft een kris van Gan- 
dring, die zou ik gaarne willen hebben, moeder". Ken Dëdësgaf hem die. Anu- 
sapati nam afscheid en keerde naar zijn eigen paleis ^) terug. 

Hij had een patigalasan, van Batil; deze ontbood hij. Hij gaf hem bevel Ken 
Angrok te dooden, hem die kris van Gandring gevende om er sang Amürwabhümi 
mede te dooden, (en het gelukte) Nusapati dien man van Batil om te koopen ^). 
Deze ging naar de kraton, vond sang Amürwabhümi juist aan het eten, en doorstak 
hem. Hy (sang Amürwabhümi) werd afgemaakt op een Donderdag Pon van (de 
wufcu) Landëp, op het oogenblik dat hij at, het sande jahung was, (d. w. z.) de zon 
net was ondergegaan, en man de sandas aanstak. Na het vermoorden van sang 
Amürwabhümi vluchtte die man van Batil tot Anusapati, (tot wien) hy zeide: 
„Ik heb uwen vader gedood '. Nusapati doorstak hem daarop. In Tumapël zei- 



1) In 't Jav. jayeuatru. 

2) Welke vraag dat geweest moet zjn, kan inen ait het Tervolg opmaken. 

5) In 't Jav. aron. 

4) In 't Jav. êameua, afgewisseld met aniaka, 

6) In 't Jav. kamigètan* 
6) In 't Jav. ingitbang. 



Hoofdstuk I. — 53 — Aaüteekenikg. 

de men: „De koning is verraderlijk vei moord door een patiga la san yauBsLtiljinHSir 
Nft^pati heeft deze daarop op een zelfde wijze gedood". 

Sang Amürwabhümi stierf in ^aka UGO. Hij werd bijgezet i) in Kagë- 
nëngan. 

AANTEEKENING. 

In een der noten, boven bij het begin der vertaling, werd er reeds 
opgewczen op welke wij/e men verreweg het grootste gedeelte van het eerste 
hoofdstak heeft op te vatten. Het moet slechts dienen om juin te toonen welk 
een bijzondere persoonlijkheid Ken Arok, de latere Qri Rajasa, sang Amürwabhümi, 
zelfs Bhatara Gnru, geweest is, en van daar dan ook die opsomming van al het 
kwaad dat hij verrichtte: stelen , straatroof, moord en doodslag, maagdschoffeering 
en wat dies meer zij, die slechts dienen moet om het te laten uitkomen^ dat hij 
znlks ongestraft mocht doen, voorbeschikt als hij was om, van goddelijken af- 
komst als een zoon van Bhatara Brahma, als een (aangenomen) kind van Bhatara 
Gum, en nitgelezen door Bhatara Wisnu om er zich in te incarneeren, straks een 
koningstroon zich te verwer\'en, zich zelfs den meerdere te toonen van den toen- 
maligen machtigsten vorst op Java, en, wat zeker nog meer gewicht in den schaal 
heeft gelegd, met dat stichten van een nieuwe dynastie, die in zijn persoon een 
aanvang nam, een geslacht op den troon te helpen, dat een lange reeks van jaren 
achtereen het opperbewind voerde althans over een belangrijk gedeelte van Java, 
het vorstenhuis, dat straks het Madjapahitsche kan worden genoemd, aangezien 
de stichter dier plaats in rechten lijn van hem afstamde. Ken Arok toch gewon 
Wong atëlëng, deze Këbo Campaka en deze weder Raden Wijaya, die Majapa- 
hit stichtte, en als zoodanig de eerste vorst was van het rijk, dat dien naam droeg. 

Ken Arok's lotgevallen nog in 't bijzonder toe te lichten is onnoodig. 

Er zijn slechts enkele bijzonderheden, waarbij het wenschelijk is stil te staan. 

Het lichten van zulke veelbelovende wonderkinderen komt daarbij in de 
eerste plaats in aanmerking, daar het zijn nut hebben kan er even op gewezen te 
hebben dat dit in de Javaansche literatuur telkens en telkens weer terugkeert, 
zoodat men haast geen plaatselijke babad kan aanwijzen, die daarvan geen voor- 
beeld bevat. 

In de tweede plaats lette men er op dat de voorstelling van Ken Angrok als 
incarnatie van Wisnu, hoe belangrijk ook op zich zelf, geenszins alleen staat. Het 
dogma van Wi^nu's belichamingen als redder van de wereld, waar deze in nood 
is geraakt, is den Javanen zeer goed bekend, al vindt men bij hen gewoonlijk 
slechts een paar der kanonnieke incarnaties iets meer op den voorgrond. Een 
der bekendste dier nieuwere incarnaties van uitsluitend Javaanschen oorsprong is 
Raden Panji Ino Kërtapati, en het is voldoende hier nog deze genoemd te hebben. 



1) In 't Jet. dkinarma. 



Hoofdstuk I. — 54 — AAirrEEKENiKa. 

Verder zij er de aandacht op gevestigd, dat de smid Mpu Gandriog van 
Lulambang, althans tot op voor korten tijd, ook op Java nog niet vergeten was, 
daar men hem bijv. als Mpu Lumbang nog aantreft in de oudste redactie van 
de Damar wulan, nl. die welke aan Roorda van Eysinga bekend was; voorts zie 
men hetgeen beneden nog wordt medegedeeld uit een Sérat kanda. 

Van meer belang is wat er van Ken Dëcjës wordt verhaald. Den lezer 
voor het bedoelde naar de betrokken plaats van den tekst verwijzende, welke op 
zich zelf genoegzaam duidelijk is, herinner ik hem- met het oog daarop aan de 
vnnruitstralende prinses van West-Java, die vroeger voor velen eene raadselachtige 
persoonlijkheid moet zijn geweest, niet in staat als men was om den dieperen zin 
van dat verhaaltje te beseffen. Men leze Cohen Stuart's aanteekeningen in zijne 
uitgave van de Baron Sakender, bl. <mortf,, 98, 160 en volgg., en de daar vermelde 
literatuur nog eens na, en zal, het verhaaltje vergelijkende en aanvullende met het" 
geen men in de Pararaton vindt, spoedig tot het besluit komen, dat het schijnbaar 
zoo onzinnige vertelseltje veel meer beteeken t dan het zich zoo liet aanzien. Noch 
Bantën (Jakétra), noch Cérbon, zelfs het machtige Mataram niet, was in staat 
zich (blijvend) meester te maken van de erfenis van Pajajaran, die in handen viel 
van den handeldrijvenden Jan Compagnie; niet één van hen kon de vuur in 
haren schoot verbergende prinses huwen, die hun, wien van hen ook, de opper- 
heerschappij ten huwelijk zou hebben medegebracht, en voor een paar onnoozele 
kanonnetjes, zou men haast zeggen, werd zij in handen gegeven van de Hollanders, 
die zich op die wijze van hun bewind over West-Java verzekerden, en verzekerd 
konden achten. Men vindt het verhaaltje terug in vermoedelijk alle bahad's of 
sajarah's van West-Java i), wel niet altijd precies op dezelfde wijze medegedeeld, 
daar andere tijden andere voorstellingen met zich brengen, en de ouderen vergeten 
geraken, maar in hoofdzaak toch overal hetzelfde. De reeds bekend gemaakte 
redacties er van zijn niet de duidelijkste of de beste. De navolgende passage (A) 
uit een korten proza-tekst, waarvan mij twee elkander aanvullende exemplaren 
toegankelijk zijn, is zeker duidelijker, en zeer eigenaardig is de hieronder mede 
overgenomen pericope (B) uit een korte babad Cërbon in lembanq (een levensbe- 
schrijving van den stichter van het Cërbonsche vorstenhuis, de invoering van den 
islam op Java, en een korte vermelding van het daarop gevolgde verloop van Java*s 
geschiedenis, meer bepaaldelijk van Cërbon). 

A. Maka Pajajaran met'ad. Kala merad ing dina Salasa langgal padbélas wulan 
Sapar iahun Jimakir. Kang katilav puira kakalih, sawiji ingaranan Pucuk umun lan 
kapindo ingaranan Sékar mandapa. Dtipi sampan kalah Pajajaran maka Puljuk umun 
den-j ar ah dening ralu wclan, maka ralu Sekar mandapa malaiju mar ing gunung Géde 
maring ajar Sukarsa, maka aiaiapa ajar i/ai, maka anilis kamane ajar iku, maka ga- 
gang kujange ajar kalibanan kama^ maka Ratu mandapa anigar pucang dening kujang 



]) Zeker in een zeer groot aantal. Ook in verschillende exemplaren Tan de Babad tanah Cjawi treft 
men het aan, zoo o. a. in den tekst vertegenwoordigd door Jav. HSS. B. 6. no. 120. 



nooFDSTUK I. — 55 — Aaitteekening. 

ikUy maka kagaiva manine a/ar iku, ttuli kakinang deiUmj Hatu mandapa, latvas-lawa^ 
ma ka aiigandé:f. Dupi sampan leka ing rolas wulan.nuUbahar, maka kang pulra istri lur 
ayu nipancy margane dcn-arani Tanoran gagang. Maka lawaslawas kalmhir maring 
fHingeran Jakeira, maka karsa (Um-anggo, maka metu geni saking hagani/mn, maka deft- 
pundut dening ralu Cérbony m aka karsane den-anggo, make méhi geni saking baganipun 1), 
maka mili kawarla dafêtig ralu Bantén maka di^n-pimdul de^iing ratn Baulén, maka 

karsanc den-anggo metu geni saking haganipun, maka kaf ar maring kt 

gèdetig Malaramy maka kinersakén nuli meta geni malih saking hagane, maka pangan- 
dikane ki gèdeng Malaram, wong ivadon iku tws oranana gaivene, nH(n)fén dipun-imde 
daténg niisa WaUinda, PV^'^O mar ing bédil litiga, mulanc Tanduran gagang iku ana 
ing Husa Walanda, maka bétlil iku d(in)uming Malaram, enz. 

B. Inggih wong agung Wèlandi, ingkang kerla prigeliray ing fférkara dumja 
lirCy Wélanda anjaluk upahy saking sulfan Ngai/ogga, rulas negara punikuy upahujmh 
ing angrata^ sing Sala ttiekafén ugi, ika uruf paivestri, kageming Wélanda kabeh, awil 
negara BélamhangaUy dugi ming Kahèrèhésany lami-lamining lumuwuhy ralu Jaiva tu- 
marimayy ora angasfa négari, ming farima dinulangan, f la har sami-saminey Wélanda ing- 
kang anélangy karajahan ing Jaway Icérana ing kunanipun, ana puiri Pajajarany, ingkang 
ora /Hiyu lakiy kérana méfu geni munfah, saking »èri pawadonan, dupi den-dol ming 
WélandOy den-luku ika lawany jinising bédil léféluy puiri ivus binakfahahrangy^ den-tam- 
bani ning Kumfféniy waras geni fan médaly dadi istri Iséna kanggo, saf)aranli anakanak, 
kumanak ika dadiy Wélanda kang sami unggulymilanipunjendralJawayfalinggihaneng 
Balawiy sabab Balawi punika, wilayal Pajajaran rek, kutiane pufri ika, asal waris 
Pakuimny marmane dumadi ungguly dene nélang nusa Jaway, lamun jendral alinggihy 
ing fiegara welan kayUy mangsa sémana unggule, rehing dudu warisirUy mungguh Allah 
taaltty aparing il ham ing makluk, af as ing sawarisira. 

Volgens het Javaansche recht moest de streek, dien Ken Angrok aan zijn 
vriend Kftbo hijo leverde, het gevolg hebben, dat hij er zich van voorstelde, zoo 
lang de laatste niet bewijzen kon, dat Ken Arok den moord had gepleegd, en dat 
deze de dader was. Op deze bijzonderheid werd reeds vroeger door mij de aan- 
dacht gevestigd, in „Iets over een onderen Dipanëgara in verband met een 
prototype van de voorspellingen van Jayabaya", zie Tijdschr. Ind. T. L. en Vk., 
XXXII, bl. 395, waar over 't algemeen over de plaats die Arok innam, en zijne 
verrichtingen, reeds gehandeld werd; zie ook ibidemy bl. 377 en volgg., waar er 
tevens op gewezen werd, dat de herinnering aan Ken Angrok ook op Java nog 
lang in leven moet zijn gebleven, minstens tot in de 18« een w van onze jaartelling. 
Ook werd daar reeds iets gezegd over de kidung Arok uit Cérbon, die, zooals 
hierboven in de inleiding nog eens herhaald diende te worden, niets van eenig 
belang voor de behandeling van de Pararaton opleverde. 

Zonder twijfel is Arok ook bedoeld in de Hikayat raja Banjar dan raja 

1) Het ecne exemplamr breekt hier af; 't andere waaraan 't yerrolg ontleend werd, Termeldt in 't 
▼oorafgaande Jakètra niet. 



Hoofdstuk I. — 56 — Aanteekening. 

Kotaringin (Mal. kroniek vaa Bafijarmasin enz.), in het daarin voorkomende ge- 
deelte over Majapahit i). Op bladz. 289 en volgg. van Tijdschr. Ind. T. L. en Vk., 
XXIV, gaf de Heer de Clercq juist dat gedeelte van bet oorspronkelijk weer, dat hier in 
aanmerking komt, maar de tekst is erg in de war, evenals in alle hdss., die ik zag. 
In No. 200 van von de Wall's verzameling leest men : Adapon lalhala déhulu 
knla hamha (mendefigarj kabar orang y(in(j hiha'hih(iynhjhi Majapahit iht Uil knUijaman 
rajana ifu mavgkal inakayaug tinggal (lees : talkain jaman Uu mnlui rajana bertmmn 
sj^ (jSi»j, — zie de Clercq's tekst, — (lanJmnngkidniminabevnamajmfihGajah matJnb, 

dan sakallyan ouwg bmir-bésar di famth Javcaitusammvnua laaloklajmdabaycnda ilu^ 
saphti Binlan d/tn Jambi dan Palemlnng dan Bugis dan Mangkasar dan Johor dan Pa* 
lani dan Pahang dan Cem/m dan Menangkabaiv dan Aceh dan Pasay, samuivaha taalok 
kapada bagenda ifu, dan salelah iln mati (vaja aLoJiCftJ, dan nmti jnwa) (vgl. de 

Clercq's tekst, die op zijn beurt te verbeteren is naar deze) Gaiah mada ilUjnxalia 
lurun'lumumnlah kapada anakcucuna mehjadi palik di, Majapahil */«, dan rajana 
bhnama di(pati) j.&A (bij de Clercq q A\^^)[mangkubumi], dan yang jadipalihTia 

kutika ihi )j^jU (lees.ij^U, bij de Clercq .)j.<^) namana, dan tatkala jaman Uu 

dipaii ^jlib mehuruhkan sepiduh biitvak peiahn d<in orangna di Majapahil, dan man- 

Irina Uu bernama Gagak (bij de Clercq ojb r^i^), yanq akan pérgi ka Pasay, iyalah 

melamar ptUri di negeii Pasay ifu, enz., waarop het huwelijk met die prinses en 
hare komst naar Java beschreven wordt, een geheelc andere voorstelling dus 
van het bij Pasay gedane huwelijksaanzoek dan ons de kroniek van Pasay 
zelf geeft, en ook met een anderen afloop, zie beneden de aanteekening bij 
Hoofdstuk IX. 

Hoe de namen gelezen moeten worden kan niet twijfelachtig zijn, en aan 
welk anachronisme de schrijver der kroniek van Baüjar zich schuldig heeft ge- 
maakt, springt ook dadelijk in 't oog, mits men slechts even bedenkt, dat in 
die kroniek die pniri van Pasay daarbij nog de plaats inneemt van de putri 
Cëmpa in de Babad tanah Djawi, (de tante van Kaden Rahmat van Ampel ga- 
ding; de neef heet hier raden Bungsu), dat wil zeggen, dat hij het uiterste be- 
gin, het voorspel van het begin, en het einde van de Majapahitsche periode 
gelijktijdig laat plaats hebben; Arok stierf 1169 Qaka, en de putri Cémpa, volgons 
het jaartal op haar graf, in Qaka 1370 (Not. B. G., XXIV (1886), bl. 42). 

Dat Ken Dëdés, zooals indertijd door mij gezegd werd, een incarnatie van 
Dewi Qri was, wordt in den tekst niet met zoovele woorden aangegeven, maar is, 
volgens de leer der incarnatien, althans volgens de opvatting der Javanen, een 



1) Over deze kroniek zie meu Schwaner, Borneo, I, 43; Hageinan, Bijdrage tot de geschiedenis van 
fiorneo, T^dschr. Ind. T. L. en Vk., VI, 225; de Clercq, De vroegste geschiedenis van Bandjaimasiu, 
T^dfchr. Jnd. T. L. en Vk., XXlV, 288, en id., Een episode uit de ge8cLiedeni8vanMadjaiahit,»^W,1»L280. 



Hoofdstuk I. — 57 — Aa^tteekenikg. 

zoo noodzakelijk iets, dat een ieder, ook zonder dat het te kennen wordt gegeven, 
dit veronderstellen moet of begrijpen zal. 

Na zijn doel te hebben bereikt, deelt Ken Arok zijne beloonitigen uit. Men 
lette er op welk eene belangrijke plaats ook hier weder de smeden bij de Java- 
nen biyken in te nemen. Wel vindt men hier in het voorafgaande de verklaring 
van de reden waarom Mpu Gandring*s nageslacht vrijdommen verkreeg, doch 
het mluse apande loopt daarnaast toch nog in 'toog. 

Reeds Bhatara Brahma had tot Ken Ëndok gezegd, dat Ken Angrok de 
toestanden op Java geheel wijzigen zon, zie bl. 2, reg. G, en iets soortgelijks 
loopt als een roode draad verder door het verloop van den levensschets van den 
held van de eerste helft van het boek. Hij brengt het volgens het verhaal zelfs 
zoo ver, dat hij, na zich zelfstandig heer te Tumapël te hebben gemaakt, ook 
tegen Daha zelf aanvallenderwijs te werk gaat, en het te niet doet of het on- 
derwerpt. In het vervolg is daarvan intusschen niet veel te bespeuren, men zie 
het gedeelte, dat loopt over de regeering van K^rtanagara, Hoofdstuk V. Ongeveer 
een 50 jaar later vindt men toch in Daha (Kadiri) op nieuw een machtig vorst, 
Jaya katong, die Tumapël wederom onder dat rijk weet te brengen, waarvan het 
vroeger een vasalstaat was, zooals duidelijk uit het voorafgaande blijkt, zie bijv. 
bl. 13 reg. 27. 

Waar Gantér, of Kantër (volgens B), lag of ligt, heb ik niet kunnen uit- 
vinden. Dat is ook met verschillende andere plaatsnamen het geval, waaronder 
Tnryantapada aan het tegenwoordige Turen doet denken. 

Ken Arok's naam Rajasa, in het prototjpe van de pvalamhang ^) tot Ang- 
rajasa vervormd, bekleedt in de koningsnamen zijner afstammelingen een belang- 
rijke plaats; men vindt er een Kërtarajasa, een Rajasanagara, en een Rajasawar- 
dhana onder. Vermoedelijk is zijn naam slechts een rest van een langeren naam, 
en ongelukkig vindt men in de Pararaton niet altijd de eigentlijke koningsnamen 
der personen, die na hem nog, tot op het einde der 15e Qaka-eeuw, als vorst 
heerschten, en waaronder eenige vrouwen waren, vermeld. 

Na zijn dood in 1169 Qaka, werd hij bijgezet te Kagëuëngan. Zooals men 
zich herinneren zal, is dit een andere naam van Tjandi Kali tjilik ^), in het dis- 
trict Srëngat, afdeeling Blitar, waaraan men evenwel boven de poort een plaatje 
met het jaartal 1271 Qaka vindt, door Dr. R. D. M. Verbeek aan het licht ge- 
bracht 3), De voorafgaande verovering van Daha (Kadiri) door Tumapël zou het 
vermoeden wettigen, dat Tjandi Kali tjilik werkelijk bedoeld is, maar toch 
schijnt het aannemelijker te veronderstellen, dat hier van een ander Kagënëngan 
sprake is, dat men op het terrein van Tumapël zelf, in het Pasuruhansche, zou 
hebben te zoeken. 



1) T^dsclir. Ind. T. L. en Vk. XXXII, bl. 394. 

2) Saffies, History op Jav.i, II, flS17), bl. 87 (^V, .Genengau". 
8) Not. B. G. XXV (1887;, bl. 8. 



Hoofdstuk I. — 58 — Aa^teekeking. 

In dit gedeelte worden eenige opmerkingen gemaakt, of gegevens verstrekt 
over de invoering van de Hindu godsdienst op het oostelijk deel van Java, be- 
paaldelijk in de tegenwoordige residentie Pasuruhan. Kort voor de troonsbekli ra- 
ming van Ken Arok, Qri Rajasa, zouden daar in het geheel geen brahmanen zijn 
geweest. Lohgawe was toch de eerste die zich daar gevestigd hebben zou, 
en dat, rechtstreeks uit Engelsch-Indië, Jambudwipa, daarheen getogen. Daarna 
zouden, na Arok's kouingworden, de bhujan/fyas, buddhisten zoowel als Qiwaiten, 
uit Kadiri (Daha), daarheen zijn gevlucht, omdat men hen in het rijk, waar zij 
woonden, verrichtingen beneden liunne waardigheid wilde laten doen i). Daar- 
tegenover staat evenwel het bericht, dat er te Panawijen een hhujaw^ga woon- 
de 2)^ of deie moet zich daar ter plaatse, die men toch in Tumapël zoeken 
moet, gevestigd hebben na de komst van Lohgawe uit Jambudwipa, die hocUlha- 
slhdpakuj en wel een mahayanistische was, maar vroeger de mah/hjana niet volgde. 
Men mag vragen welke godsdienst hij dan wel was toegedaan. Van hindijana, 
de zuidelijke buddhistische kerk, kan op Java geen sprake zijn, en er rest dus 
slechts aan te nemen, dat hij of heiden was, of wat men gewoonlijk de brahmaan- 
sche geloofsleer noemt, omhelsde. Dat het Hinduisme reeds lang vóór den tijd, 
waarin het in den tekst verhaalde moet zijn voorgevallen, zijn weg ook naar Pa- 
suruhan gevonden had, en dat men daar reeds veel vroeger sporen vindt zoowel 
van brahmanisme (^iwaisme) als van buddhisme (mahayanisme), is uit verschillen- 
de opschriften reeds aan den dag gebracht 3). Moeielijk is het dan ook aan te 
nemen, dat er bedoeld wezen zou, dat Mpu Pftrwa, van wien er sprake is, vóór 
hij lumaku mahayanaj heiden zou zijn geweest. Doch zoo dat niet het geval was, 
wat dan? Hindugodsdienst zonder brahmanen, ook waar het het noordelijk bud- 
dhisme geldt, dat bijv. in Nepal ook brahmanen kent en erkent, en het buddhis- 
me op Java komt in zijne vormen dat van Nepal het meest nabij, is toch wel 
niet denkbaar, en Mpu Pürwa was later toch hodd/iasihdpaka] dat hij brahmaan 
was wordt wel niet gezegd, maar, zelfs al neemt men aan, dat alles wat uit de oudere 
opschriften uit die buurt aan 't licht kon worden gebracht, dat de oude toestand, dien 
wij daaruit konden leeren kennen, geheel vergeten was, toch schijnen in deze bij- 
zonderheden de hier aangetroffen berichten met elkander te strijden, ook al zou de 
boven gemaakte veronderstelling, dat mpu Pürwa na Lohgawe in Pasuruhan zou 
zijn gekomen, juist zijn, want alles en alles in het voorafgaande, dat toch in 
Pasuruhan speelt, wijst er op, dat men daar toch al geen heiden meer was. Des- 
niettemin verdient het hier wel de aandacht, dat in de lO en 11«, en zelfs in 
de 12® Qaka eeuw, van eigentlijk gezegde opschriften, of zelfs steenen met jaartallen, 
in Pasuruhan en hetgeen oostelijker ligt, geen sprake is; daarvoor zie men de 

1) Deze plaats in de Pararaton is, zooals een ieder begrijpt, de oorsprong voor de stelling der Ba- 
liers, dat alles op Oost-Java en Bali uit Daha (Kadiri) kwam. 

2) Ook Janggan of de Janggan Tan Sagënggëng, de vader van tahan Tita, was een bhujaitpga. 

3) Men denke sleclits aan Mpu Sivdok's pragdêtV^, 



Hoofdstuk ü. — 59 — Vertalino. 

uit mijne aanteekeningen aaDgevnlde lijst van jaartallen der inscriptie's op Java 
in Dr. Verbeek's Oudheden van Java, waarbij men in 't oog moet houden, dat de 
steen van Ngantang, Museum No. 9, van Q'aka 1057, eigentlijk tot Kadiri behoort ')j 
en dat Scheepmaker, uit wiens verzameling de témpayan is met het jaartal 1070? 
Mus. Bat. Gen. no. 391, vooral in Surabaya verzamelde. 



HOOFDSTUK lï. 

AnusapatL Caka 1170—1171. 

Daarop volgde sang Anusapati hem op als koning (ratu)y in Qaka 1160. 

E^nigen tijd later, vertelt men, hoorde Raden Tohjaya, de zoon van Ken 
Angrok bij diens tweede vrouw {rabi nuom) 2), tot in bijzonderheden hoe Anusapati 
iemand omgekocht had om sang Amürwabhümi, die door dien man van Batil was 
omgebracht, te vermoorden. Sang apanji Tohjaya legde zich niet neder bij den moord 
van zijn vader; hij zon en zocht een middel om zich te wreken, iets wat tot den 
dood van Anusapati zou kunnen leiden. Anusapati wist het, [16] dat Paöji Tohjaya 
hem belaagde, was op zijn hoede, en liet om zijn slaapplaats een vijver graven ; op 
het erf S) hield men de wacht ^), en vertrouwden personen waren er op post gezet. 

Na eenigen tijd kwam sang apanji Tohjaya (eens) tot den Bhatara (koning) 
Anusapati, met een klophaan, en zeide: „Broeder, vader had een kris van Gan- 
dring, die zou ik gaarne van u willen hebben'. Het was duidelijk dat het einde 
van Bhatara Anusapati naderde 0). Anusapati gaf hem de kris van Gandring. Tohja- 
ya nam hem aan, stak hem in zijn gordel, en de kris, die hij vroeger droeg, gaf 
hij aan een zijner lieden. Daarop zeide hij: „Kom, broeder, laat ons eens een paar 
jianen laten vechten'. Anusapati antwoordde: ,,Best, broeder". Hij liet zijn kooi- 
meester een vechthaan halen, en zeide: „Kom, broeder, laat ons het (maar) meteen 
doen''. „Zeker", zeide Panji Tohjaya. Zij deden ze beiden zelf de ijzeren sporen 
aan. De beide (hanen) stonden elkander, en sang Anusapati was er geheel in 
verdiept. Zonder twijfel was het uur van zijn dood daar ; terwijl hij op dat oogen 
blik öj geheel opging in het vechten, dat hij zijn haan liet doen, doorstak hem Tohjaya. 

Anusapati stierf in Qaka 1171. Hij werd bijgezet te Kidal. 

AANTEEKENING. 

Anusapati, die een naam draagt als Kaden Panji Ino Kértapati, in de Ma- 



1) Zie den Catalogus van Groeneveldt, bl. 375, een pra^dêti vaa Jayabhaya. 

2) Zie boven. 

8) In 't JaT. jpamhigkang. 

4) In *t Jav. angayhigi. 

5) Iden denke slechts om den vloek vdn Mpu Gandring. 

6) In 't Jav. kempèr; dat het een synoniem van jnnudju U, leidt men ook af nit bl. IS» reg. 29. 



Hoofdstuk II en III. — 60 — Aant. en Vert. 

lat, zie van der Tuuk in zijn Notes on the Kawi Language en Literatnre^ Joarn. 
of the R. As. Soc. of Great Britain and Ireland, New Series, XIII, bl. 51, was, 
zooals uit het voorafgaande bleek, een zoon van Tnnggul amétung. Met zijne troons- 
bestgging had dus Ken Angrok het opperbestuur nog niet voorgoed aan zijne familie 
gebracht. Eerst, nadat Kaden Wijaya, die Majapahit sticht, koning geworden is, 
is zij er voor langer van verzekerd Na dezen Anfl^pati, die intusschen weer op- 
gevolgd wordt door een zoon van Ken Arok, Tohjaya, komt nog diens zoon Kangga 
wuni (Wisnuwardhana) en diens kleinzoon Kértanagara ((^Uwabuddha) aan het bestuur. 
Omgekomen in 1171 (,^aka, wordt hij bijgezet te Kidal, zoodat men dus 
vermoeden mag, dat ook de ons bekende Tjandi Kidal, in 't Pasuruhansche, district 
Pakis, afdeeling Malang, zie Verbeek, Oudheden van Java, n*». 615 (bl. 295 en 
296), eene vorstelijke begraafplaats is. 



HOOFDSTUK III. 

Tohjaya. Ca ka 1171—1172. 

Tohjaya (een zoon van Ken Angrok bij diens tweede vrouw, ken Umang) «) 
werd daarop koning (/y//*() van Tumapël, 

Anusapati (de zoon van Tunggul amëtung bij Ken Dëdés) had een zoon, 
Rangga wuni geheeten, een neef {liaponahan) van Apaöji Tohjaya; (ook) Mahi^a 
wong atëlëng (een zoon van Ken Angrok bij Ken Dëdés) *), de halve broeder van 
Apaöji Tohjaya, had een zoon Mahi^a campaka, (mede) een neef (pahulunan) van 
Apafiji Tohjaya. 

Toen Apanji Tohjaya gehuldigd werd, waren alle mantri's, Pranaraja enz., 
opgekomen, en Kangga wuni en Këbo campaka waren daarbij. Pafiji Tohjaya 
zeide: „Mantri's, gij allen, in de eerste plaats Pranaraja, ziet hier mijne neven; 
hoe schoon zijn zij van uiterlijk en gestalte. Hoe zien mijn vijanden in andere 
rijken ') er uit? En deze beide mannen, wat zouden zij Pranaraja?" Pranaraja 
antwoordde hem met een sembali: „Inderdaad, mijnheer, zooals u zegt, zij zijn 
schoon van uiterlijk, en beiden even moedig, maar, mijnheer, men kan ze verge- 
lijken met een steenpuist op de navel, in het einde ^) leiden zij zeker tot den 
dood''. Zijne Majesteit *j werd stil; meer en meer zag hij in wat Pranaraja's 
zeggen beduidde, en hij werd er verdrietig over. 

Daarop ontbood hij Lëmbu ampal. Hij beval hem de beide prinsen uit den 



1) Zie boTen. 

2) Zie boven. 

3) In 't Jav. nuêaniara, 

4) In 't JaT. ri puharanya. 

5) In 't Jav. talampakanira bhatdra; dat uit deze uitdrukking bet voornaamwoord pakanira aproot 
is doidelgk, en evenzeer dat dit dos naar z\jn waarde een krama-'Koox^ moet zqn (.^ tampean), en eigent» 



Hoofdstuk III. — 61 — Vertaling. 

weg te ruimen. Hij zeide tot Ijëmbu ampal: ^Als ') het je niet gelukt die beide 
prinsen uit den weg te ruimen, dan doe ik liet jou". Toen Apaüji Tobjaya aan Lëm- 
bu ampal het bevel gaf de beide prinsen uit den weg te ruimen *), hoorde dat de 
brahmaan, die bij Tobjaya sangkapam was. Hij had met de prinsen te doen, en be- 
richtte hun, dat Lëmbu ampal bevel had ontvangen hen uit den weg te ruimen, en 
dat hij, als het hem met hen niet gelukte, in hun plaats door den koning zou wor- 
den omgebracht. De beide prinsen zeide: „Eerwaarde, wij hebben niets misdaan". 
De brahmaan antwoordde: [17] „Verbergt gij u maar liever 3) eerst, jongens". Zij 
twijfelden *) nog of de brahmaan misschien geen ongelijk &) /ou hebben, en daar- 
om gingen de prinsen samen naar Apaïiji Patipati, en zeiden : „Pafiji Patipati, wij 
komen ons in uw huis verbergen, want de koning wil ons uit den weg geruimd 
hebben, en wij hebben toch werkelijk niets gedaan, dat wij uit den weggeruimd 
zou behoeven te worden". Pauji Patipati onderzocht het gerucht, (en zeide): ^l^rin- 
sen, als gij (niet) ^) uit den weg geruimd wordt, dan wordt Lembu ampal daar 
aansprakelijk voor gesteld". Zij hielden zich daarop stilletjes verborgen. Zij wer- 
den wel gezocht, maar niet gevonden : er werd naar hen geïnformeerd, maar waar- 
heen zij waren gegaan, werd niet vernomen. 

Lémbu ampal werd daarop door den koning er van verdacht, dat hij het 
met de beide prinsen eens ^) was. Ër werd een aanslag op hem gedaan, en nu 
vluchtte hij, om zich bij zijn buurman Apaüji Patipati te versteken. Daar bespeur- 
de hij, dat de prinsen bij deze waren. Hij ging tot hen en zeide hun : ,Ik kom, 
mijne heeren, bij u mijn toevlucht zoeken; de koning wil mij straffen, omdat ik 
u op zijn bevel uit den weg moest ruimen, (maar er niet in ben geslaagd). Neemt 
mij een eed af, als gij mij niet vertrouwt*); ik zal u trouw dienen". Benige 
dagen, nadat zij hem beëedigd hadden ^), kwam Lëmbu ampal tot de prinsen, 
zeggende: „Hoe wilt gij '®), prinsen? Er komt geen einde aan dat verscholen 
zitten. Ik zal straks iemand van Kajasa, als hij zich baadt, doorsteken". 

Dien avond nog deed l^ëmbu ampal dat, naar Sinëlir vluchtende toen er 
alarm werd gemaakt ii). Toen zeiden de lieden van Kajasa: „Iemand van 



lijk ongepast wordt gebezigd als een hoogere het tegen een lagere gebruikt. In den tekst bier gebenrt dit 
dan ook niet. Hetzelfde geldt van inanira^ voornaamwoord van den l«*n persoon, dat by pakanira behoort, 
en naar waarschjjnljjkheid ontstond uit oud-Jav. manöhnira, uw. dienaar. 

1) Tn 't Jav. mott. 

2) Lees angilavgakhta. 
8) In 't Jav. ar on. 

4) In 't Jav. pinariringaki^n, 
6) In 't Jav. adwa, 

6) De negatie ontbreekt in den tekst. 

7) In 't Jav. takarayita, 

8) Lees den-pakanira. In plaats van tan kandfl geeft B tan dndég. 

9) B. geeft tinetoagara kalih dina, 

10) Lees wèkas-pakanira. 

11) In 't Jav. ingalokH; te lezen ingalokakën. 



Hoofdstuk III. — 62 — Vert. en Aant. 

Sinëlir heeft er een van Rajasa doorstoken''. Daarop twistten de lieden van 
Rajasa met de pangalasan van Sinëlir. Het kwam tot een hevig gevecht met vele 
dooden aan weerskanten i), en toen zij van wege den vorst uiteengedreven werden, 
gehoorzaamden zij niet. Hiejover ontstemd, liet deze de beide balur's (chefs?) 
uit den weg ruimen. 

Hoorende dat de beide battir's uit den weg waren geruimd, ging Lémbn 
ampal nu tot de lieden van Kajasa, en zeide tot hen: „Als men u uit den weg 
wil ruimen, neemt dan uw toevlucht tot de beide prinsen, want zij zijn er (nog)". 
De lieden van Rajasa beloofden het, en zeiden: Lëmbu ampal, breng deze 
wotig bafur tot hen". De oudsten van de lieden van Rajasa werden bij de prinsen 
gebracht. „Heeren", zeiden zij, ,,sluit u aan -) bij de lieden van Rajasa; alles 
wat gij beveelt (zullen zij doen) ; neemt hun een eed af tegen een mogelyke on- 
trouw, doch zoo iets zal niet voorkomen (?) ^y\ 

Ook de lieden van Sinëlir, wier oudsten ontboden werden, legden een ge- 
lofte af als de lieden van Rajasa, en de beide battirs kregen, nadat zij beëedigd 
waren, de opdracht: „Heden avond moet gij beiden hier komen, een ieder met zijn 
mannen, en op de kraton een aanval doen'\ Zij gingen daarop weer naar huis. 

Met den avond kwamen zij allen met hunne mannen tot de prinsen, allen 
vol moed ^); daarop gingen zij naar de kralon, om er amu/c te loopen. Apanji 
Tohjaya schrikte hevig, vluchtte hals over kop, doch kreeg een niet direct doode- 
lyken speerwond. Toen het rumoer bedaard was, zochten zijne dienaren hem; 
zy namen hem op en vluchtten met hem naar Katang lumbang. Daarby raakte 
van een der dragers [18] de sarung &) los, zoodat zijn achterste •) te zien kwam. 
Pafiji Tohjaya riep hem toe : „Maak je sarung in orde, je achterste is te zien''. 
Die billen waren de reden, dat hij (Tohjaya) niet lang koning was. Te Lumbang 
katang aangekomen, overleed hij. Daarop werd hij bijgezet te Katang lumbang. 
iijn dood had plaats in Qaka 1172. 

AANTEEKENIN6. 

Bij het voorafgaande valt niet veel op te merken, te minder daar in de 
vertaling voor de duidelijkheid tusschen haakjes de familieverhouding der hoofd- 
personen reeds werd toegelicht. 

Radjasa en Sinëlir werden in de vertaling opgevat als waren dat plaatsna- 
men. Het is volstrekt niet onmogelijk, dat dat onjuist is. Rajasa was Ken 
Angrok's koningsnaam, en met wong Rajasa zou dus ook een bepaald soort van 



1) In 't Jav. rame alolongan, 

2) In 't Jav. ^akitaha, 

8) In 't Jav. pahea rika denipun angawula. 

4) Lees toani. 

6) In 't JaT. gaiag. 

6) In 't Jav. pamungkur. 



Hoofdstuk III en IV. — 63 — kusr, en Vert. 

menschen, een lijfwacht bijv., kunnen zijn aangeduid; of wel het zou ook een 
partgnaam kunnen wezen. In dat geval is vermoedelijk ook Sinëlir dat. Let 
men er nu op^ dat Tohjaya gesproten was uit een hini hnji (een selir), en die 
beide neven van hem door hunne vaders, Anüsapati en Mahisa Wong atëléng, uit 
de ratu, Ken Dëdës, dan doet men onwillekeurig de vraag of de list van Lëmbu 
Ampal niet hier op neerkwam, of opgevat moet worden, als zou hij aan de eenc 
partij, die welke liever iemand aan het bewind zou hebben gezien geboortig uit 
Een Dêdës, den wang Radjasa, een gegronde aanleiding hebben willen geven, zich 
zich te werpen op de andere, de wong Sinëlir, die Tohjaya, uit een bini haji ge- 
sproten, vooistonden. Tohjaya tracht een einde te maken aan de gerezen twist 
Als hem dit niet op een zachtere wijze gelukken kan, wil hij met hardheid op- 
treden. Het hoofd van de woug Radjasa, die den eersten aanval hadden gedaan, 
wordt met den dood bedreigd en acht zich verongelukt, want een der wong Sinëlir 
had toch een der zijnen gedood ; ook het hoofd van de wong Sinëlir loopt dat ge- 
vaar, en volgens zijne opvatting al evenmin met reden, want de wang Radjasa 
hadden hen aangevallen, onder voorgeven natuurlijk, dat een der hunnen een wang 
Radjasa zou hebben geveld, en het gevolg is, dat zij zich beiden tegen hem keeren. 
Vertegenwoordigen de beide namen werkelijk die van partyen, dan is de toedracht 
sprekender, en begrijpt men den gang van zaken ook beter. 



HOOFDSTUK IV. 

Rangga wuni, als kaning Wimuwardhana. Caka 1172 — 1194. 

Daarop werd Rangga wuni koning {ralu). Hij en Mahisa campaka waren 
als twee slangen in één gat. Rangga wuni droeg als koning den naam Wi^nn- 
wardhana; Mahisa campaka werd ralu angabhaya, met den naam Bhatara Na- 
rasinga. Zij konden het uitstekend met elkander vinden, en hadden geen oneenig- 
heden i). Bhatara Wisnuwardhana bouwde de kula te Canggu noord, in Qaka 
1193. Hij trok op tegen Mahibit, om Lingganing pati uit den weg te ruimen. 
Mahibit verloor het, omdat Mahisa bungalan er binnen kon dringen. Zijn majes- 
teit Rangga wuni was 14 jaar 2) koning; hij overleed in 1194, en werd bijgezet 
te Jajagu. Mahisa campaka werd na zijn dood te Kumëpër bijgezet; zijn pamélé- 
satan (?) was te Wudi kuncir. 

AANTEEKENIN6. 

Wie Rangga wuni en Mahi^ campaka waren, kwam in het III« hoofdstuk 
uit. Veel wordt er van hen niet verhaald, maar er zij er hier de aandacht op 



1) In 't Jay. vfiwal. 

2) Dit klopt niet met de jaarcqfen. 



Hoofdstuk IV en V. — 64 — Aant. en Vert. 

gevestigd; dat Rangga wuni als vorst Wisnuwardhana heette^ en dat Mahisa 
campaka, als ralu angabhaya, den uaain Narasinga droeg. 

Wat de titel ralu angabhaifa cingentlijk aandnidt, is niet vast te stellen. 
Het schijnt wel iets te zijn als nevcnkoning of onderkoning. Ook in Hoofdstuk 
XII komt hij voor, men zie aldaar. 

Over Canggu, zie men beneden bij Hoofdstuk VI. 

In de cijfers moet een fout schuilen. Boven werd reeds het vermoeden 
geopperd; dat deze in het getal 14 steekt, in plaats waarvan men 22 verwachten 
zou, daar Rangga wuni in 1172 koning wordt en in 1194 overlijdt. Schuilt de 
fout elders, dan heeft of Tohjaya langer geregeerd of is de duur van de regeering 
van Rangga wuni 's opvolger, Kértanagara, een andere dan beneden moet worden 
aangenomen. Over fouten in de cijfers of in de jaartallen door de Pararaton ge- 
noemd, in het algemeen, wordt beneden in de aanteekening bij Hoofdstuk VII iets 
gezegd. 

Jajagu doet denken aan Jago, dat een andere naam is voorde ijamfi 
Tumpang, zie de bij Verbeek, Oudheden van Java, onder n<>. G14, bl. 294, opge- 
geven literatuur. 



HOOFDSTUK V. 

Kerfatmgara, als koning Ciwabuddha. Caka 1194 — 1197. 

Zijne majesteit Rangga wuni (de zoon van Anusapati, den zoon van Tnng- 
gul amëtung bij Ken Dl^xl^^) 'i^^ ^^^ ^^^^^ ^^y C^ï Kërtanagara; ook Mahii^acam- 
paka (de zoon van Mahi$a wong atëiëng, den zoon van Ken Angrok bij Ken Dëdés ) 
liet een zoon na, Raden Wijaya. 

Aji Kërtanagara werd koning (prabhu) i), onder den naam Bhatara Qiwa- 

buddha. 

Hij had een man, een babalangan ^) van den buyul van Nangka, Baüak 

wide geheeten ; dezen gaf hij den naam Arya Wiraraja, maar bij scheen onbetrouw- 
baar en daarom verwijderde hij hem uit zijne omgeving, hem benoemende tot 
adipali van Sungënëb, op oost-Madura. 

De persoon, die toen hij koning (prabhu) werd, zijn patik was, Mpu Ra- 
ganatha 3)^ trachtte steeds het welzijn van zijn heer te dienen, maar Qri Kërtanagara 
sloeg er geen acht op ; daarom legde Mpu Raganatha zijne betrekking neer ^), en 



1) Van hier te beginnen is de vorstentitel steeds prabhu, beboadens in een geyal, zie bUds. 81 reg. 
14, waar weer van raiu wordt gesproken, welk woord ook ten opzichte van de boven reeds opgesomde vonten 
werd gebezigd. 

2) De beteekcnis is mjj onbekend; men zou zeggen dat het iets als «onderhoorige" moet aanduiden. 

3) In 't Jay. Toor naam hier ptupapaia, 

4) In 't JaT. asalah linggih. 



Hoofdstuk V. — 65 — Vebtalhto. 

nam hy zyn ontslag als palih, vervangen wordende door Këbo tëngah sangapanji 
Aragani. Mpa Baganatha werd in plaats daarvan adhtjahsa te Tumapël. 

Nadat Qri Kërtanagara koning was geworden, trachtte hij den dolenden vijand 
(kalana) Bhaya te verdelgen, en toen deze dood was, zond hij zijn troepen tegen 
Malayu. 

Zoo waren er maar weinig lieden te Tumapël over; de meesten waren 
naar Malaya gezonden. Apaöji Aragani begeleidde ze, maar keerde van Tuban 
weer huiswaarts, en liet, te Tumapël gekomen, lederen dag, ten genoegen van Kër- 
tanagara, dezen (lekker) eten opdisschen. 

Kërtanagara stond in briefwisseling i) met Aji Jaya katong, den vorst van 
Daha, die zijn vijand was; er was nu een goede gelegenheid voor een vyand, 
en Jaya katong vergat, dat hij zich zeer schuldig zou maken. 

Bafiak wide was 43 jaar oud, toen de veldtocht naar Malayu plaats had. 
Hij was bevriend met Aji Jaya katong; hij zond druk 2) gezanten van Madura 
(naar Daha) en zoo zond Aji Jaya katong (ze ook) naar Madura. WirarSja (= Banak ' 
wide) zond een brief aan Aji Jaya katong, die luidde : ,, Heer, onderdanig doe ik u 
weten, dat als uw hoogheid op het oude veld wil gaan jagen, u het thans moet 
doen, nu het een gunstige tijd is, en er geen kaaimannen, tijgers, wilde buffels, 
slangen, of doornen 8) zijn ; er is wel een tijger, maar die is tandeloos''. Den ouden 
paiih [19] Mpu Baganatha, dien bedoelde hij met een tandeloozen tijger, omdat hy 
al oud was. Daarop trok Aji Jaya katong tegen Tumapël op. De troepen, die om 
de noord naar Tumapël togen, waren de slechtsten van Daha; (zij gingen) met 
vele vaandels en volle muziek. De streek benoorden Tumapël werd verwoest, en 
velen van hen, die hen bevochten, raakten gewond. Die troepen, die om de noord 
kwamen, hielden halt te Mëmëling. Bhatara Qiwabuddha deed (intusschen) niets 
dan palmwijn drinken. Toen hem bericht werd, dat hij van Daha uit aangevallen 
werd, geloofde hij het niet, en zeide hij nog: „Hoe zou Aji Jaya katong zoo tegen 
mij zijn; hy is immers met mij op een goeden voet'. Toen de gewonden het be- 
richt (zelf) brachten, toen (eerst) geloofde hij het. Baden Wijaya werd daarop 
aangewezen om die troepen ten noorden van Tumapël te bevechten. Hem vergezelden 
Arya dikara, Baiiak kapuk, Bangga lawe, Pëdang, Sora, Dangdi, Gajah pagon, de 
zoon van Wiraraja : Nambi, Pëtëng, (en) Wirot, uitstekende krijgslieden, die de troe- 
pen van Daha, de noordelijke afdeeling, afweerden ; zi) deden verwoede gezament- 
lijke aanvallen % en de lieden van Daha, die om de noord gekomen waren, wer- 
den op de vlucht geslagen, en door Baden Wijaya nagezet. (Maar nu) gebeurde 
het, dat een groot leger van Daha van de bewaakte grens ^), over Lawor, (naar 



1) In 't Jav. poMwalanira, 

2) In 't Ja?, asuravean, zie ook bladi. 28, reg. 11. 
8) In 't JaT. rinipuM, 

4) In 't Jav. rampmk, 

6) In deo tekst ataat pinggir AJt^a, ontlisand aan 't pinggirak^ der kdsa» Üit ket nn op dé greiu 

VerlL Bat Gen. deel XLU. h^ 



Hoofdstuk V, — 66 — AAKTEEKEKura. 

Tumapël) kwam. Aan dit leger was 't verboden gerucht te maken, en men trok 
voort zonder vaandels en zonder muziek. Het bereikt Siddhabhawana en ging van 
daar recht op Singhasari aan. De palih van Daha, Kébo mundarang, Pndot en 
Bowong stonden aan het hoofd van deze troepen van Daha om de zuid. Bhatfira 
Qiwabuddha dronk juist (weer) palmwijn met den palih, toen zij overmand wer- 
den; beiden betaalden het (met den dood). Këbo tëngah (de patih) trachtte zich 
nog te verdedigen, doch sneuvelde in de Manguntur. 

AANTEEKENIN6. 

Rangga wuni (Wi^nuwardhana) wordt in 1194 opgevolgd door zijn zoon 
Kërtanagara, die als koning Qiwabuddha zou hebben geheeten. Hij regeerde niet 
lang, verondersteld althans, dat de fout in de cijfers in Hoofdstuk IV (of III), waar- 
over in de aanteekeniug bij het vorige hoofdstuk reeds gesproken werd, niet 
schuilt in het sterQaar, 1194 Qaka, van Rangga wuni. Aan het slot van het vol- 
gende hoofdstuk wordt opgegeven, dat de veldtocht naar Malayn, zoomede de 
verovering van Tumapël, plaats had in 1197, en dat Jaya katongin Dahain 1198 
koning was. De duur van Kërtanagara*s regeering mag dus op een viertal jaren 
worden gesteld, want de bedoeling van hetgeen daar van Jaya katong wordt 
gezegd, kan wel geen andere wezen dan om aan te duiden, dat in dat jaar Daha 
wederom de bovenhand verkreeg en Tumapël weer onder zich bracht, iets waarop 
reeds gewezen werd, dat gebeuren zou, in de aanteekening bij Hoofdstuk I. 

Dat Qiwabuddha de eigentlijke koningsnaam zou zijn geweest is te be- 
twijfelen, zelfs tegenover het feit, dat boven in het eerste hoofdstuk als zoodanig 
ook reeds werd aangegeven, dat Bhatara Guru een der namen was, die Ken Arok 
gedurende zijne regeering voerde. In een der door den Heer W. P. Groeneveldt 
in zyn aan Chineesche teksten ontleende Notes on the Malay Archipelago and 
Malacca ') medegedeelde berichten, nl. dat omtrent Shih-pi, uit de geschiedenis 



ter plaatse nog te vinden Léksa (d. i. dns Rëlna, Raksa) blijkt, dat men pinggir raJtsa, de Terdedigde, in stMit 
▼an tegeuweer gebrachte grens, te lezen heeft. 

1) Uitgegeven in de Verh. van het Bat. Gen., deel XXXIX, en later nog eena in Miacellaneoiu pa- 
pers relating to Indo-Chioa and the Indian Archipelago, reprinted for the Straits branch of the Rojal Asiatic 
Society, Second series, vol. I, 126 — 262 (Trubuer, 1887>. De cgfers tusschen haalges in mjn verwqsingeli 
slaan op deze laatste uitgave. 

Anderen, die vóór den Heer Groeneveldt ten deze het hnnne leverden, waren: 

Baffles, History of Java, 2' ed., 1830, 188. 

Amiot, in Mémoires concemant les Chinois par les Jésnites de Peking, Tomé XIV (gereproduceerd 
door 6. Schlegel in T^dschr. Ind. T. L. en Vk. XX, ua bl. 32), 

Crawfard, Historj of the Indian Archipelago, 1820, IIT, 154 en volgg., doeh vooral 164 en 166; 

KUproth, Notice d'nne mappemonde et d'une cosmographie Chinoises, Jonmal Asiatiqne, X (1882)^ 
bl. 522; 

Rémnsat, Foé koaé ki on relation des royaumes Bonddhiqnes: voyage dans la Tartarie, dans TA^^ia- 
nistan et dans Tlnie, etecaté i la fin da IV« siècle, par Chy Fa Hian, tradnit du Chinoia et Oftmmmitf; 
QUTra^ posthame^ re va ete. par M\f. Klaproth et Lanlresae» 1886; 



Hoofdstuk V. — 67 — Aafteekening. 

van de Ytian dynastie (1280—1367 A D.), wordt toch medegedeeld^ dat, vóór de 
komst van de expeditie, die in 1292 A. D. (= 1214 Qaka) door Knblai Eban 
(1280 — 1295 A. D.) naar Java werd gezonden en dat eiland in 1293 A. D. (= 1215 
Caka) bereikte i), ,the king of Java, Haji Ka-ta-na-ka-la, bad already been killed 
by the prince of Kalang, called Haji Katang", IL, bl. 26 (151). Het laat zich dan 
ook veel beter aannemen, dat hier als zoodanig Kërtanagara in aanmerking moet 
worden gebracht. Ook van eene andere zijde blijkt dit. In een oorkonde nl. 
waarvan een klein stukje, het begin, reeds is uitgegeven 2), komt hij onder dezen 
naam voor, en uit die zelfde oorkonde werd door mij tevens reeds medegedeeld, 
dat men van hem ook bericht vindt, dat hij te Qiwabuddhalaya s), Qiwabuddha's 
huis, begraven of bijgezet zou zijn, wat het op zgne beurt weer waarschijnlijk 
maakt, dat de naam Qiwabuddha er een is, waarmede men den vorst, die ook ,de 
tgdens het palm wijn-drinken omgekomene'' genoemd werd, zie het volgende hoofd- 
stuk en bl. 21, reg. 27, vereerd heeft. 

's Mans lichtzinnigheid of overmoed, die zich duidelijk kenbaar maken in 
het onverstandig uitzenden van die expeditie naar Malayu, en zijne zorgeloosheid 
bij het bericht, dat Jaya katong zich tegen Tumapël ten strijde had aangegord 
en diens leger naderde, wordt nader in het licht gesteld door een andere bijzon- 



S. Maller, Bjdngen tot de kennis van Snmatra bjionder in geschiedkandig en etluK^npkiach op- 
ligt» Leiden, 1846; 

Schlegel, Iets omtrent de betrekkingen der Chinezen met Java voor de komst der Europeanen aldaar, 
in T^daclir. Ind. T. L. en Vk., XX (1878), bl. 19 (het opstel lelf is van 1870); 

L. de Rosny, Les penples de TArchipel Indien connus des anciens géographesChinois et Japonais; frag- 
ments orientanx tradoits en fran9ai8, (1871), in Mem. de TAthenée oriëntale, I, bl. 55; 

W. F. Mayers, Chinese explorations of the Indian Ocean daring the fifteenth centnry, China Review 
III (1874/76), 219 en 821; en IV (1875/76), 61. 

Na hem gaf S. Beal, Two Chinese Baddhist inscriptions fonnd at Buddha Gayft, Joamal R. A. Soc. 
of Oreat Britain and Ireland, New Series, XIII, 552; Some remarks respecting a place called Shi-li-fo>tsai fre- 
qaently named in the works of the Chinese Baddhist pilgrim I-tiing, circa 672 A. D. (in van der Lith, Mer- 
▼eiUes de 1'Inde, 1883—1886, bl. 251); en The situation of the coantry called Shi-li-fo-shai, Not. Bat. Gen., 
XXIV (1886), Bglage I. 

Voorts lie men ook Jacquet, Autres éclaircissements sur Ie planisphère et la cosmographie Chinoise, 
Joamal Asiatique, XI (1888), bl. 235; W. von Humboldt, Die Kawi Sprache, 1836, I, 15; van Hoevell in 
Tqdschr. N. I., 8e Jg., 1840, IT, 307; Walckenaer, Mémoire sur la chronologie de Thistoire des Javanais, 
et sur répoque de la fondation de Madjapahit, Paris 1842 (die nog naar eenige oudere literatuur verwast); 
Vetb, Bomeo's Westerafdeeling, 1864, I, 287; Lassen, Indische Alterthumskunde, 1861, IV, 479; de Klerck, 
Lassen's geschiedenis van den Indischen archipel, 1862, bl. 99; Veth, Java, 1878, II, 7; Kern, Over den 
invloed der Indische, Arabische en Europeesche beschaving op de volken van den Indischen archipel, 1883; 
▼an der Lith, Merveilles de l'Inde, 1883 — 1886, bl. 321; Brandes, Een jayapattra of acte van eene rechter- 
Ijke uitspraak van Qaka 849, 1887, Tgdschr. Ind. T. L. en Vk., XXXII; van der Lith, Nederlandsch Oost- 
Indie beschreven en afbeeld voor het Nederlandsche volk, 2« druk, 1893, I, 391. 

1) Over dese expeditie zelf zie men beneden. 

8) Be oorkonde van Qaka 1216, waarover beneden nader. 

3) Zie Not. B. 6. XXIV (1886), bl. 46. 



Hoofdstuk V. — 68 — AAirrEEEEKiKO. 

derheid in die Ghineescbe berichten vermeld. Het blijkt daar nl., dat de vorst 
van Java, waarmede die van Tumapél, en wel juist hij, bedoeld moet zijn, tot bet 
zenden van die expeditie door China naar Java meer dan aanleiding had gegeven, 
doordat hij Meng Gh'i, den keizerlijken gezant van daar, door diens gelaat te 
schenden, groven smaad had aangedaan, zie het bericht omtrent Kau Hsing (ait 
denzelfden tijd), //., bl. 27 (151), ,,when Java had marked the face of the im- 
perial envoy Mêog Ch'i**, en in 't algemeen verslag, //., bl. 22(148), , the lm perial 
Government has formerly had interconrse with Java by envoys from both sides, 
and has been in good harmony with it, bat that they have lately cut the face 
of the Imperial envoy, Mêog Ch'i''. Dat inderdaad Kërtanagara bedoeld was, ziet 
men toch uit het boven reeds gegeven citaat nit het bericht omtrent Shih-pi. 

In het vervolg komt Wiraraja's vroegere naam, Baöak wide, niet meer voor. 
Met het oog op de Javaansche traditie omtrent de stichting van Majapahit, waar- 
over in de aanteekeningen bij het volgende hoofdstuk het een en ander dient te 
worden gezegd, zij hier op dien naam even de aandacht gevestigd, terwijl het 
tevens van belang is er op te wijzen, dat er hier wel gesproken wordt van een 
zoon van dezen persoon, doch dat deze niet Rangga lawe heet, wiens naam hier 
ook voorkomt, zie bl. 19, reg. 10, maar Nambi i). 

Het pinggir Aha van den tekst, unnasun; werd boven in de vertaling 

reeds in pinggir raksa, wat het zijn moet, verbeterd. Het is terug te vinden in 
bet tegenwoordige Lëksa, langs welke rivier men nu nog vindt de overblijfse- 
len van een versterking, iets in den trant van den Chineeschen muur, doch nataar- 
lijk van veel minder beteekenis. Over deze ruinen sla men na Dr. Verbeek^s Oud- 
heden van Java, bl. 269 en 291 (uo. 552 en 608) en de daar opgegeven litera- 
tnar. T. a. p. vestigde genoemde geleerde er reeds de aandacht op, dat genoemde 
maar wel de grensscheiding tusschen Tumapél en Daha zal zijn geweest. 

Suménép, het oostelijk gedeelte van Madura, heet hier Sungénéb. 

Met het oog op het historische gehalte van dit hoofdstuk, dat wg lieten 
eindigen met den dood van Kërtanagara, zou hier ter plaatse reeds een heel stok 
dienen te worden aangehaald uit de reeds genoemde oorkonde van 1216 Qaka, aan- 
gezien men in die oorkonde een kort, maar officieel verslag aantreft van den hier 
voorkomenden krijg door Jaya katong met Kërtanagara gevoerd. Met den dood 
van den laatste was de veldtocht echter nog niet afgeloopen. Zooals uit het begin 
van het volgende hoofdstuk blijken kan, moest Raden Wijaya, die uitgezonden 
was om het noordelijke vijandelijke leger te verslaan, nog overwonnen worden, en 
ook dit vindt men in die oorkonde terug, evenals de verdere lotgevallen van dezen 
prins tot hij naar Madura weet te ontkomen, zooals het volgende hoofdstuk almede 



1) In de Rftngga lawe worlt Tan Ringja Lawe gesproken ala van een zoon Tan Wiranja» vgL da 
onmcrkiiig uver de San^ga lawe in de inleiding. 



HoovDSTüK V. EK VI. — 69 — Aaipt. EK Vebt. 

vertelt. Het sclignt meer doeltreffend te zijn hetgeen die oorkonde Terlianit, niet 
te splitsen^ en daarom wordt eerst straks, in de annfeekening bij het volgende 
hoofdstuk, hetgeen zij bevat en met het laatste gedeelte van dit hoofdstak over- 
eenkomt, medegedeeld; men zie dns ook nog beneden. 

Kërtanagara, met wien Tumapél valt, was de eerste die den titel prabhu 
voerde, bl. 18 reg. 16. 

Waar hij bijgezet werd, vindt men eerst later, in Hoofdstak VII, verteld, zie 
bl. 25, reg. 4. 

Over de Pamalaya, zie men bij Hoofdstak VI en IX. 



HOOFDSTUK VI. 

Inlerregnvm. (Jayakalong.) Caha 1198 — 1216. 

Raden Wijaya van wien (boven) verhaald werd, dat hij naar de noord 
was gegaan, bracht men er bericht van, dat Bhatüra Qiwabaddha door troepen 
van Daha, die ait het zaiden een aanval hadden gedaan <), gedood was, en dat (ook) 
de oade palih het met den dood had moeten betalen, evenals de overige per- 
sonen van het gevolg van zijne Majesteit. Daarop keerde raden Wijaya met al 
zijn volgelingen snel naar Tumapél terug. Daar trachtte hij, doch te vergeefs, te 
herstellen wat er verloren was; hij werd op zijn beurt teruggeslagen, fen) ver- 
volgd door kébo Mundarang vluchtte hij op de oploopende saivah^s, terwijl Kébo 
Mundarang naar Buntal wilde optrekken ^). Raden Wijaya nam het slikbord van 
een ploeg, die daar lag, en sloeg daarmede ^), zoodat Kébo Mundarang*s borst 
en gezicht vol slijk geraakten. Deze trok zich danro]i terug^ en /eide : ,> Wel ! gij 
zijt werkelijk een dewa (iemand van vorstelijke, goddelijke afkomst)*'. Daarop 
verdeelde Raden Wijaya (zijn) lanrifigan ginftffsin{ji ^) aan zijne dienaren, een ieder 
kreeg er een, omdat hij een verwoeden aanval doen wilde. Dd beleeUen waren 
Sora, Rangga lawe, Pédang, Danjli, en Galjah. Sora deed esn aanval, en vele 
lieden van Daha vielen. Sora zeide toen (tot den prins) : „Nu, prins, moet gij een 
aanval doen, nu is het de goede geleg3nheid'\ De prins deed een aanval, en er 
vielen er nog veel meer. De lieden van Daha trokken zich, door den nacht over- 
vallen, terug, en maakten zich een bivouac. Toen zij in slaap waren, overviel Raden 
Wijaya hen op nieuw, en daarop geraakten de lieden van Daha van elkander; 
velen werden er gewond door de speeren van hun eigen makkers, en er ontstond 
een verwarde ^) vlucht. 



1) AndvMi, in pi. yan andoni. 

8) In 't Jay. anduka, 

5) De nitdmkking mantjal is mj hier on^nidelQk. 

4) Zgne benedenkleedingstukken, nl. taucingan beduidt dit; giringting is de soortnaam van patronen. 

6) In 't Jav. ort^tr, sie lieneden iari4u. 



Hoofdstuk VI. — 70 — Vertaling. 

Nn had Bhatara Qiwabuddha twee dochters, die door hem voor Raden Wyaya 
tot vrouw bestemd >) waren. [20] Beiden waren door de lieden van Daha ge- 
vangen, doch van elkander geraakt, daar zij in verschillende richtingen waren ge- 
vlucht. Door den aanval van Raden Wijaya waren de Daha-ërs in verwarring, 
's Nachts maakten zij een vuur aan, dat hoog opvlamde. Daarbij werd de 
oudste 2) der beide prinsessen gevonden; Raden Wijaya kreeg haar in het oog en 
herkende haar. Hij bevrijdde haar weer, en zeide toen tot Sora: „Wel Sora^), 
val nog eens aan, opdat ook de jongste mijner jongere zusters gevonden worde". 
Sora zeide: „Geenszins, vorst, want de oudste is nu gevonden; en hoe weinig 
manschappen heeft u hier!" Raden Wijaya antwoordde: „Goed, om harentwille (?)". 
Sora zeide daarop weer: „Heer, u moest u terugtrekken; het zou zeker zeer 
goed zijn nog eens een aanval te doen, zoo u er iets mede kon winnen, en mis- 
schien de jongste prinses vondt, maai als wij haar er niet aantreffen^ zullen wy 
als witte mieren in 't vuur zijn gevlogen". 

De prins vluchtte daarop, de prinses in zijne armen dragende, en den geheelen 
nacht in noordelyke richting voortgaande, "s Morgens werd hij door den vijand 
bezuiden Talaga pagër achterhaald. Om beurten bleven zijn mannen achter om 
de lieden van Daha, vechtende, staande te houden. Gajah pagon kreeg een diepe, 
doorgaande speerwond in zijn dij, doch hij kon nog loopen. Raden Wijaya zeide: 
„Gajah pagon, kunt gij loopen; als gij het niet kunt, zullen wij ons allen dood 
vechten." „Ik kan het, heer, maar slechts langzaam". De Daha-ërs zetten den 
prins niet erg na, en keerden ten slotte naar Talaga pagër terug. Raden Wijaya 
dwaalde nu, als een boschkip, met zijne manschappen, die hem gevolgd waren, 
in de wildernis rond; om beurten droegen dezen de prinses, tot zij ten laatste 
beraadslaagden ^) en beredeneerden hoe de prins zou moeten handelen. Toen zy 
het eens waren geworden, vervoegden zij zich tot hem en zeiden: „Heer, dit 
zouden wij u willen opmerken, welk einde zal het met u nemen, als gij zoo 
in dit bosch hier rond blyft zwerven. Voliyens onze meening zou het het beste zgn, 
zoo u oost-Madura kon bereiken ; u moet naar Wiraraja vluchten, opdat u by hem 
uw toevlucht zal kunnen nemen, want het is onmogelijk, dat hij met u niet be- 
gaan zal zijn; hij is toch juist door wijlen uw vader een groot man geworden". 
De prins zeide: „Ja juist, als hy met mij begaan is, maar zoo hij dat niet is, 
dan leg ik er groote oneer mede in". Sora, Rangga lawe en Nambi stonden er 
op, en zeiden als uit een mond: „Heer, waarom zou Wiraraja zich van u keeren 5)". 
Daarom gaf de prins aan hun verzoek toe. Hij verliet de wildernis, en kwam te 



1) In *t Jav. jaga, 

2) Lees panuha. 

8) AngungsM werd niet vertaald, en uit den zin geliclit, omdat m^ de beteekenis ondnideiyk is. 
Wellieht te lezen lah ia angvngtêd, angamuk maneh. 
4j In 't Jav. abhavarata. 
5) Ia 't Jav. palingaha. 



Hoofdstuk VI. — 71 — Vertaldtg. 

Pandakan, by den buyui daar^ Macan kaping. (Daar) vroeg hij om een halfrijpe 
klapper; men wilde hem de melk ervan laten drinken, (doch) toen men haar 
openmaakte, was zij vol witte gekookte rijst. Men stond verbaasd, en zeide: 
«Byzonder vreemd, want jonge klappers met gekookte ryst er in, zijn er niet**. 
Gajah pagon kon (na) niet (meer) gaan; de prins zeide daarom: ,,Bayat van 
Pandakan, ik geef a een man in bewaring, Gajah pagon, die niet gaan kan; 
hg 1) (blgve) bij a". De lieden van Pandakan zeide: „Dat zal niet goed zijn, 
heer; hg mocht hier eens gevonden worden; er moet geen dienaar (van n) [21] te 
Pandakan zgo 2); naar onze meening moet hg in een boschtain verblijven, waar 
men boschgras aan het sngden is; in het midden kan daar een open raimte wor- 
den gemaakt ^) en daar kan voor hem een veldhaisje opgericht worden ; daar kan 
hg in de eenzaamheid gaan zitten, zonder dat iemand het merkt, en van Pandakan 
kan men hem lederen dag zgn eten brengen". Gajah pagon bleef achter. Raden 
Wijaya ging daarop naar Datar, 's nachts reizende. Te Datar ging hg scheep. 

De troepen van Daha keerden weer naar hais. Dejongste der beide prinses- 
sen bleef gevangen, en werd naar Daha gebracht en aan Aji Java katong over- 
gegeven. Deze vernam met vreagde den ilood van Bhatara (^iwabaddha. 

Raden Wgaja bereikte den overwal in het noorden (de zaidkast van }Ia- 
dara), ging aan den wal, en werd door den nacht overvallen op een sawah ergens 
op de grens van Sangènéb. Hg overnachtte daarom op die mwah, die men aan 
het bewerken wa^ ^), pas geegd had, en met smalle dgkjes voorzien was. Sora ging 
voorover op zgn baik liggen, en de prins en de prinses zaten boven op hem. Den 
volgenden moigen ging hg door naar Sangénëb, waar hg bij de groote hale zijn gang 
staakte. Hg zond iemand om te zien of Wiraraja baiten zat. Deze kwam spoedig 
terog, want Wiraraja zat baiten. Daarop ging de prins naar de fMueban. Wiraraja 
zag den prins dadelgk, toen hg ter plaatse kwam, schrok, verliet de pasehan, en 
ging in hais, waardoor de audiëntie, die hg gaf, een einde nam. Raden Wijaja 
ontstelde, en zeide tot Sora en Ranggalawe: , Wat heb ik gezegd, ik leg er groote 
oneer mede in; had ik het toch toen maar liever met den dood in den strgd be- 
taald". Daarop ging hg (weer) naar de groote baUj maar het einde was, dat Wi- 
raraja met zgne echtgenote ^) en verdere haisgenoten gezamentlgk ^) tot hem 
kwamoi, om hem betel aan te bieden. Rangga lawe zeide (toen) tot den prins: 
«Neen, heer, bet loopt geheel anden; daar komt Wiraraja integendeel tot n\ 



1) lm llsr. éi^me. 

» lm t JsT. mmgriaf 

S) b 1 JsT. êimfwfmuf imf Qmfmk. BHfmmf im Tolpas Dr. ▼. 4. Tvak ruste t 'J w i cWm Wvoosde 



4) lm ^ JsT. 

5) lm t Imw. fêmmiik, Dtte roni vorÜ tmt 4e mmw m 4ak fmtU if vn ccm mdifmü ^ r^nor- 
ca kct Ccm Pimüik f vam GteA) k ia Mk 

Imltfcr. 




Hoofdstuk IV. — 72 — Yiektujos^. 

Daarover verheugde de prins zich (zeer). De echtgenote van Wiraraja bood der 
prinses, en Wiraraja (zelf) den prins sirih aan. Wiraraja verzocht hem zgn ver- 
blijf te komen nemen in de regentswoning. De prinses steeg op den wagen, terw^l 
Wiraraja's echtgenoten haar te voet begeleidden ; Wiraraja deed dit den prins. In 
de regentswoning logeerden zij in Wiraraja's eigen slaapvertrek. Raden Wijaya ^) 
vertelde aan Wiraraja, toen deze bij hem in de tweede poort kwam, op welke 
wijze de vorst, die onder palm wijn drinken het leven liet, gestorven was, en hoe 
bij zelf tegen de troepen van Daha gevochten had. Wiraraja vroeg hem: ,En 
wat wil u nn, prins''. Raden Wijaya antwoordde: „Ik verzoek n, als gij bet 
goed vindt, hier bij n te mogen .blijven". Wiraraja zeide: „Maak n maar niet 
ongerust, (er zal wel iets opgevonden kunnen worden, om het gebeurde weer on- 
gedaan te maken), maar het moet langzaam aan geschieden". Daarop verzocht hg 
hem door naar binnen te gaan. Verder bood hij hem kleederen, gordels, en sa- 
rongs aan, die hem door 's regents vrouwen, waaronder de ken pinatih {raden ayu)^ 
werden aangeboden. De prins sprak toen : „Wiraraja, mijn vader, de verplichting 
die ik aan u heb, is niet gering; als ik mijn doel bereik, dan zal ik Jawa in 
tweeën verdeden, en gij zult de eene helft, ik de andere hebben''. Wiraraja 
zeide: „Zooals u wil 2), heer, als u maar eerst koning zal zijn geworden". Dit 
was de afspraak van den prins met Wiraraja. Wiraraja verzorgde den prins bui- 
tengemeen; dagelijks gastreerde hij hem, om niet te reppen van den palmw^n, 
dien hij hem schonk. [22] Toen Raden Wijaya reeds vrij lang te Sungénéb was 
geweest, zeide Arya Wiraraja eens tot hem: „Heer, ik heb een plan; u moet bij 
Aji Jaya katong in dienst gaan, en voorgeven dat u om genade vraagt; u moet 
zeggen, dat u zich voor hem bukt, en als nu Aji Jaya katong het goed vindt, 
dat u bij hem in dienst komt, dan moet u voor eenigen tijd naar Daha gaan; 
blijkt het dan, dat hij in u vertrouwen is gaan stellen, dan vrage u hem om de 
woeste gronden van de lieden van Trik, om er een desa van te maken. Madu- 
reezen zullen het terrein schoon hakken, en die desa aanleggen; dichtbij wonen 
er Madureezen s) en dezen zullen tot u komen. U moet bij den vorst zeil 
in dienst gaan, om Aji Jaya katong's lieden goed op te nemen; u moet weten 
wie trouw, wie krijgshaftig, wie lafhartig of bekwaam is, voornamelijk wat 
Kèbo Mundarang's karakter is. Heeft u allen goed opgenomen ^), dan vraagt 
u verlof om te gaan wonen in de desa, die de Madureezen op de woeste gron- 
den van de lieden van Trik zullen hebben aangelegd. Voorts zal het ook 
goed zijn, om als er van uwe lieden uit Tumapél weer tot u komen, hen aan te 
nemen; zelfs als er lieden van Daha tot u hun toevlucht nemen, moet gg voor 



1) Men leze reg. 26 raden W\jaya in pi. yan raden Wiraraja, 

2) In 't Jav. tatoadinijnm. 

8) In 't Jav. aparantunan, krama-vorm van oud apardr^an (waaroit pararen^ pareren^ paleren), Ub 
ook bladi. 28 reg. 11. 

4) In 't Jav. iaièpas. 



Hoofdstuk VI. ^ 73 — Vertauho. 

hen opkomeD, en als n de troepen van Daha meent te kunnen staan, (dan zal 
het de tijd zijn nw slag te slaan). Ik zal Jaya katong nu bericht zenden". De 
persoon, die den brief i) moest overbrengen, vertrok, stak over naar Jawa, en gaf 
zelf den brief te Daba aan Aji (Jaya) katong. De brief luidde: ^Heer, onderdanig 
doe ik a weten, dat uw kleinzoon vergeving verzoekt, hg wil zich aan uwe Ma- 
jesteit onderwerpen ; ten dezen late u weten wat u beslist, of u het goed vindt 
of niet". Aji katong zeide: „Hoe zou ik het niet goed vinden, dat mijn jongen, 
Arya 2) Wgaya, zich aan mij wil onderwerpen", en liet den gezant weder terug- 
gaan om wat hg gezegd had over te brengen. Na aankomst gaf deze den brief 
over, die aan den raden en Wiraraja werd voorgelezen. Wiraraja was verheugd. 
Raden Wijaya ging daarop naar Jawa terug, met zijn volgelingen, en begeleid 
door Madureezen; Wiraraja bracht hem tot Térung. 

Te Daha gekomen diende bij Aji Jaya katong trouw, zoodat deze hem 
lief kreeg. Het was juist Galungan ^) toen hij te Daha kwam. Zijn mannen kre- 
gen uit den dalem bevel om te sasarama 4). De mantri's van Daha waren uiter- 
mate s) verbaasd, toen zij ben zagen, zulke flinke lieden waren het allen, zooals 
Sora, Bangga lawe, Nambi, Pédang, en Dangdi. Zij liepen in de pasasaraman in 
de Manguntur te Daha. Op hun beurt liepen ook de mantri's van Daha hard, 
zooals de eerste krijgers : Panglét, Mahisa rubuh, de palih Këbo mundarang, maar 
alle drie verloren het in het hard loopen tegen Rangga lawe en Sora. Iets later 
organiseerde Aji (Jaya) katong een (kris)steekspel : „Mijn jongen Arya Wijaya, 
kom, gij moet eens (met uwe kris) schermen, ik verlang dat te zien ; mijne mantri's 
zullen uw tegenpartij zijn". De prins antwoordde: „Zeker, heer!" Het steekspel 
had plaats, onder zeer luidruchtige muziek, ten aanschouwe van ontelbare toe- 
schouwers. Aardig was het hoe de lieden van Aji (Jaya) katong op de vlucht 
gingen. Deze beval (toen) : „Zeg aan mijn jongen, Arya Wijaya, dat hij niet meer 
mee moet doen; wie zou zijn heer durven staan" ^). De prins deed (toen) niet meer 
mede, en de partijen stonden elkander bij het steekspel (nu) gelijk, nu eens moest 
deze wijken, dan die ; (maar) op het laatst ricbtte Sora zich tegen den patih Köbo 
mundarang, Rangga lawe zich tegen Panglét, en Nambi [23] zich tegen Mahisa 
rubuh; het slot was dat de mantri's van Daha door Raden Wijaya's mannen op 
de vlucht werden gejaagd, zonder zich te kunnen herstellen, en toen hield men 
er mede op. 

1) In 't J»y. sawala, 

2) In 't Jay. ar§a. 

S^ Inlandflch {wuku) nienivjaar, vaUende op den Woensdag yan Pangnlan, welke wuku daarom bj de 
Javanen Galnngan heet. 

4) Blikbaar beteekent dit woord een zekeren wedatrgd bonden Men vindt bet temg onder festi- 
-viteiten bg een bmilofUfeest aan bet bof van Majapabit, f^j^ji» ^° Hoofdstuk XIV van deSigarab Ma- 
layn, ed. Singapore, bl. 159. 

6) In 't Jav. MnH. 

6) Te leMn saj^a ia wong wania Imoun guttme. 



Hoofdstuk VI. — 74 — Vbrtaliko. 

Raden Wijaya had nu gezien, dat de mantri's van Daba het tegen zijne lieden 
moesten afleggen. Hij zond daarop aan Wiraraja bericht, en deze raadde hem aan 
om de woeste gronden van de lieden van Trik te vragen. Aji ( Jaya) katong vond 
het goed. Zoo zijn de woeste gronden van Trik voor het eerst tot een bewoonbare 
plek gemaakt. Toen de Madoereezen met den aanleg net begonnen waren, wilde 
een hunner, die honger had, en niet voldoende lijfkost bij het omkappen had 
(medegenomen), eenige ma/a-vruchten eten; zij waren hem te bitter, en hy wierp 
alle maja's van de soort, die hij gezocht had, weg. Het werd bekend, dat (daar) 
nui/a-vruchten waren, die zeer bitter smaakten, en inderdaad (daarom) is (die 
plaats) Majapahit genoemd. 

De prins had den toestand in Daha nagegaan, en Majapahit zag er reeds 
als een desa uit. De lieden van Wiraraja gingen druk naar Daha en verbleven te 
Majapahit. Wiraraja raadde (daarop) den prins, hoe bij het aan Aji (Jaya) katong moest 
vragen om heen te mogen gaan. Hij vroeg te Majapahit te mogen gaan wonen. Aji 
(Jaya) katong vond het goed, verleid door zijne genegenheid en de voortreffelijke wyze, 
waarop de prins hem had weten te dienen, als meende hij het oprecht. Nauwelijks 
te Miyapahit gekomen, gaf de prins Wiraraja er kennis van, dat hij en zijn mannen 
tegen de manins van Daha opgewassen waren. Hij noodigde Wiraraja uit tegen 
Daha op te trekken. Wiraraja hield het nog wat tegen en zeide : ^), „Niet te 
haastige), ik heb nog een plan. Zeg gij, pangalasauy den vorst, dat ik bevriend 
ben met den koning van Tatar; ik zal (hem zeggen, dat ik) voor hem de prinsessen 
buit zal maken. Ga gij, pangalasan, dadelyk naar Majapahit terug. Na uw 
vertrek zal ik naar Tatar schrijven, want er is (hier) juist een schip van daar, 
dat hier handel is komen drijven. Een schip van mijzelf zal ik naar Tatar laten 
mede gaan, om den vorst uit te noodigen tegen Daha te velde te trekken. Als 
de vorst van Daha verslagen zal zijn, dan zullen de schoone prinsessen van Tu- 
mapël, die op het geheele eiland Jawa baars gelijken niet hebben, het eigendom 
verklaard worden van den vorst van Tatar 3); zoo zal ik dien vorst vangen. Zeg 
gy aan den vorst, dat hij zich (dan bij hem) moet aansluiten om Daha mede ten 
onder te brengen''. De pangalasan keerde naar Majapahit terug. Baden Wijaya 
was verheugd over hetgeen Wiraraja aanbevolen had. Na het vertrek van den 
pangalasan zond Wiraraja iemand naar Tatar. Zelf verhuisde hij met geheel zijn 
huisgezin naar Majapahit, van Madura medenemende wat tot den strgd noodig 
zou zijn, alle bruikbare Madureezen, en de noodige wapenen. 

Toen de gezanten (met de troepen) van Tatar gekomen waren, viel men 
Daha aan. De troepen uit Tatar trokken van het noorden op, die van Madura en 
van Majapahit van den oostkant. 

Aji (Jaya) katong geraakte in de war, en wist niet waar hij het meest voor 

1) In *tJay. AnayuH. 

2) In 't JftT. yhm. 

Z)' Ib 't JftT. irika akua rin^ ratu Ttdar, 



Hoofdstuk VI. — 75 — Vertalhtg. 

waken moest. In het noorden had hij het hard te verantwoorden tegen de Tatar's. 
Eëbo mundarangy Panglét en Mahisa nibuh moesten op de troepen^ die nit het oosten 
kwamen, passen. Panglét werd door Sora gedood, en Kébo rubah door Nambi; 
Eëbo mundarang streed met Rangga lawe en werd op de vlucht geslagen, in 
Trinipanti achterhaald, en (toen) door Rangga lawe gedood. Hij zeide tot deze: 
, Rangga lawe, ik heb een dochter; dat Sora haar neme, als een belooning voor 
zijne dapperheid". Aji Jaya katong deed om zich te verdedigen een aanvalnaar 
het noorden, (maar) werd door de Tatar's [24] overmand, zelfs gegrepen en door 
hen gevangen gezet. Raden Wi)a} a drong dadelijk de kraton van Daha binnen, en 
haalde de prinses weg, die jongste (van de twee, waarvan boven is gesproken). 
Hij bracht haar naar Majapahit, waar de Tatar's dadelijk daarop om de prinssesen 
kwamen vragen, daar Wiraraja had beloofd, dat hij, als Daha gevallen zou zijn, 
de beide prinsessen van Tumapël uitleveren zou. De manlns wisten nu geen 
raad, en zochten een uitvlucht. Sora zeide : „Nu, ik zal ook in dit geval wel op 
de Tatar's losgaan, als zij hier komen'*. Arj^a Wiraraja hernam : „Sora mijn 
jongen, heel goed, maar ik weet er nog wel wat (anders) op". Men zocht nog voort- 
durend naar iets waarmede men de Tatar's zou kunnen paaien. Daarover rede- 
neerden de mantri's. Sora zeide, vertrouwende de zaak uit te kunnen maken: 
,Wat zou het een succes hebben, als wij de Tatar's aanvielen'*. Des avonds, toen 
de zon in het westen stond, kwamen de Tatar's de prinsessen opvorderen. Wiraraja 
antwoordde hun : „Tatar's, overhaast u toch geenszins ; de prinsesssen zyn nog be- 
droefd, want zij hebben, toen Tumapël, en ook toen Daha viel, het zwaard zien ge- 
bruiken; zij zien er in hooge mate tegenop eenig wapen, welk ook, te zien ; morgen 
zullen ze u uitgeleverd worden, en in Werkanten zetels (f andus?) i) geplaatst en ge- 
dragen, in staatsiekleederen, naar uwe schepen worden begeleid. In vierkanten 
zetels worden zij geplaatst, omdat zij geen wapen willen zien, en verder mogen 
de lieden, die de prinsessen in ontvangst zullen nemen, geen gewone Tatar'szijn, 
het moeten de besten onder u wezen, en zij moeten komen zonder gevolg, want de 
prinsessen hebben zich vast voorgenomen om zich te verdrinken, als zij eenig wapen 
zouden zien, zelfs al zouden zij het schip reeds hebben bereikt, en gij zult het niet 
ongedaan kunnen maken 2)^ al zoudt gij uw leven er voor willen geven, als de prin- 
sessen zich eens verdronken'*. De Tatar's gaven toe en liepen er in. Zij zeiden: 
„Wat u daar zegt, is zeer juist". Op den tijd, dien men overeengekomen was, 
kwamen 3) de Tatar's allen ongewapend, in grooten getale (?), om de prinsessen 
te halen. Zij werden, toen z^ de poort Bhayangkara door waren, ingesloten, en 
de deuren werden van buiten en van binnen gegrendeld. Sora had zijn kris op 
zijn dij gebonden 4), Hij viel toen de Tatar's verwoed aan, en stak ze allen over 



1) In 't Jav. pasagi. 

2) Lees parahiltmg, 

8) In 't Jav. agHbagan. 

4) I|i 't JaT. den-wulang ing puptme^ 



Hoofdstuk VI. — 76 — Vert. en Aast. 

hoop. Rangga lawe viel die aan, die buiten de pasehan wareD ; hij zette hen na tot 
waar zij ylnchten, de haven te Canggu ^)y waar zij achterhaald en afgemaakt werden. 

Een tien dagen laten ongeveer 2) kwamen de troepen, die Malaya waren 
gaan veroveren, terug, met twee prinsessen. Een van hen, prinses Dara pétak 
werd door raden Wijaya tot hinihaji (selir) gemaakt; de oudste, Dara jingga, huwde 
met (een) dewa en werd de moeder van den koning van Malayu ^), Tuhan Janaka, 
wiens /casirkasir Qrt Marmadewa was, en die als koning Aji Mantrolot heette. 

De veldtocht tegen Malayu en de val van Tumapél hadden plaats in het- 
zelfde Qakajaar, 1197. Aji (Jaya) katong werd koning (ratu) in Daha in Qaka 
1198. Te Junggaluh gekomen (waar hij geïnterneerd werd), dichtte hg dekidung 
Wokir polaman (Vischvijverberg), en toen hij die gereed had, overleed hij. 

AANTEEKENIN6. 

In dit hoofdstuk wordt, zooals men gezien heeft verhaald wat er geschiedde 
tydens Jaya katong, de vorst van Daha (Kadiri), heer en meesteer was over de 
streken, waarvan in de Pararaten voornamelijk sprake is. 

Hoewel met den val van Tumapël nog niet geheel meester van het terrein, 
omdat de te velde getrokken troepen onder Raden Wijaya, die naar het noorden 
waren gezonden, nog verslagen moesten worden, kau men zijn interregnum toch ge- 
voegelijk met dat feit een aanvang laten nemen. Dit gescliiedde dan in 1197 of 
1198 Qaka, zie het einde van dit hoofdstuk, bl 24 reg. 30 en volgg. In Qaka 
1216 of in het jaar daaraan voorafgaande viel- hij weder, en daarmede eindigde het. 

Gedurende dat tgdsverloop hadden er gewichtige gebeurtenissen plaats. 

Het verhaal vertelt ons, dat in de jaren van zijn bewind het bekende Ma- 
japahit werd gesticht, en dat in de nabijheid daarvan een door den vorst van 
China uitgeruste expeditie op Java voet aan wal zette, en medehielp Daha (weer) 
ten onder te brengen; ook meldt het ons welke lotgevallen Raden Wijaya nog 
had te doorleven vóór hij naar Madura, van waar uit hij zijne operaties tegen 
Jaya katong begon, ontkomen kon. 

In de aanteekening bij het vorige hoofdstuk werd er reeds opgewezen, dat 
van deze lotgevallen ook gewaagd wordt in de oorkonde van Qaka 1216. Met 
een enkel woord werd er verder aan herinnerd, dat erin 1293 A. D. = 1215Qaka, 
werkelijk een Chineesche expeditie op Java landde. 

Hieronder volgt nu in de eerste plaats het gedeelte van die oorkonde, dat 
hier van belang is, nl. blad I — VI, waarachter ongelukkig een stuk ontbreekt; 
daarop een verslag over die Chineesche expeditie, en dan wat er over de stichting 
en den ouderdom van Majapahit in het algemeen op te merken valt. 

1) In 't Ja?, êohaning Cangyu, 

2) In 't JftT. akara. 

8J In 't Jay. alaki dewa ajmputra ratu ring Malayu, 



Hoofdstuk VI. — 77 - Aaitteekeking. 

Terwijl de/ koperen platen zelf verloren zijn, althans nog niet zijn temg- 
gevonden, beeft bet een heelen tijd moeten duren, vóór men van deze interessante 
oorkonde^ die ± 1780 A. D. reeds gevonden werd, iets meer te weten kwam, 
en werkelijk maken kon. 

Gevonden op den gunung Butak, in het district Surabaya, omstreeks het 
genoemde jaar, — zooals blijkt uit eene aanteekening bij een afteekening van bet 
grootste gedeelte dezer platen, aangetroffen in een kist behoorende tot de nala- 
tenschap van Mr. S. I. E. Bau, die aan de Leidsche rijksuniversiteits-bibliotheek 
geschonken werd i), — en nadat er reeds in 1816 door Raffles een transcriptie 
met latijnsehe letter werd uitgegeven van hetgeen op twee der platen te vinden 
was (plaat III en VI), in zijn ^^Gopies of two of the ancient insicriptions on copper 
plates dug up in the vicinity of Surabaya, rendered from the ancient Kawi cha- 
racter into the Koman'* ^)y Verh. Bat. Gen., VIII, en Raffles daarop in 1817 
ook nog een facsimile plaatste in zijn History of Java, van plaat I, kon eerst in 
1886 door het vinden van een afschrift van plaat II in een bundel van den Sul- 
tan van Suménép, in de verzamelingen van het Bat. Gen., „Toelisan boeda darie 
Soeltan Soeménép'', Jav. Hss. B. G. 42, aan het licht worden gebracht, dat deze frag- 
menten bijeenbehoorden, zie Not. B. G. XXIV (1886), bl. 46. Daarmede een 
belangrijk eind gevorderd tot de juiste waardeering dier restanten, op wier be- 
Ungrijkheid Dr. van der Tuuk de aandacht van schrijver dezes had gevestigd, 
kwam in bet jaar 1888 een afteekening uit den boedel van den Heer Raa 
voor den dag, van plaat I, III — VI, VIII en X — XII, van welker bestaan Prof. 
Kern mij dadelijk berichtte, iets later mij ook een copie zendende S). Er moest 
dus meer dan een eeuw verloopen, vóórdat, en dan nog op zulk eene wijze, met 
behulp van surrogaten, de disjecta membra taliter qualiter weer bijeengebracht 
konden worden. 

Met het voorhandene is men echter in staat van het begin den doorloopen- 
den tekst te geven, welke alsvolgt luidt. 



1) Die aanteekening luidt: ^Dit Handschrift, zooverre hetzelve met zwarte inkt it verraardigd, ia een 
kopie Tan zooveele kuopere gegraveerde plaaten, lang rugm 1 (?) voet breed 7 a S dnymen welke platen ge- 
vonden z^n ouitrent den jaar 1780 op den Goeooeng Boetak (: of blinden berg) in het district Soorabaya. 
Dezelve zjn in 1782 eo 1783 op Java bg den Kej'^er en Sultan bg de Priesters en alom me elders rondgezonden. 
Welke allen verklaarden 't zelve oud-Javaansch tchrift te zijn hetzelve wel te kunnen lezen, en ook in het tegen- 
woordige Javaansche schrift overbrengen, gelgk ook vervolgens door deskundige met Rooden inkt de letten in 
modem Javaansich zjjn overgesteld, dog allen betuigden het voor zoo oud-javaana te houden, dat het door 
niemand konde ver-taan worden. 

2) Plaat 8 heet daar verkeerdelgk 5, wellicbt slechts ten gevolge van een abuis. 

8) Men zie Not. B. 6.. XXIV, bl. (1H86), 43; en XXVI (1888), 62 en 131. De eerste regel van 
Rafflea's facsimile vindt men nog gereproduceerd in Crawfard'« History of the Indianarchipelago, IT, bl. 211. Frie- 
derich leverde in J857 een transcriptie van die gehcele plaat T, in zgn Over inscriptien van Java en Sumatra 
voor het eer^t ontcgferd, Veth B 6., XX v f, bl. 87 en 93, en Cohen Siuart gaf er nogmaals een transcriptie 
van in Kawi oorkuuden in fAcamile met inleiding en transcriptie» Leiden 1876; men zie daar no. XXVII op 
bL 36. 



Hoofdstuk VI. — 78 — Aaittbekenino. 

Swasti cakawarsatUny 1216, hhüdrapddamasa, tithi pancami krmapaksa, ha, «, 
ga, wdra madangkungmij baynhyaslha ffrnhacara, rohininaksalra, prajapatidewaiój 
mahendramandalay siddhiyoga, werajyamuhürtla, ymnapnnvweca, telilakarana, kanya- 
raci irika diwasanydjhd cri mahdwhatamecwardnandUn parakramottunggadeway mahd- 
baldsapatnddhipawindcaknrana, vildsdragumrupnivinnyoUamdnuyuktay sama^layawadwi- 
pecwarüj saknlasujanadharmmasnngraksam, nnrasinghanagaradharmnmwicesasantanQy 
narctëinghamnrltisuidtmajay krianaga (2a) raduhildsnmdgamnsampnnnny krtardjasajaya- 
warddhnnandmardjdbhüiekay linadah de rakrynn man tri Icalrini, rakryan mantri hinOy 
dyah pamasiy rakryan mantri haluy dyah singlar, rakryan mantri sirikan, dyah 
palisiry kahiring de rahijan mantri ranamadhyariputrdsakaray paramasddhuprapanna 
mapasanggahan sang prdnardjay rakryan mantri samarakdryyagahanaku^ihy mahacura- 
twasampanna mapasanggahan sang nayapati, rakryan mantri dwipdntaraQatrumarddana- 
kdrana sarjjawalittaranjitay mapasanggahan sang aryyadilcara, makddi sang mantri 
mahdwiradikara, wiwiddmitrapranayaliaray sakaldmdnujdnurdgay mapasanggahan sang 
aryya wirardjay saksat sugisya de cri ma (2b) hdrdja krtanagara, tan kantun rakryan 
mantri sewakottatnagunajnay mawasthd kanuruhany rakryan mantri guratamendra, 
mawasthd dmang l), makadi rakryan mantri wimitrdriprabhitakara mawaslha patih, 
saksat prah . . . mratisubaddhalién (pa)ngadég cri mahdrdjangkéfi icwarapratiwimba, 
tankawuntat sang sinalahan wyawahdrawiccedakay sang pamget i tirwan sangkya- 
wydkaranagds trapar isamdptay puspapdta dang dcdryya kusumayuddharipu, mapanji 
paragatay sang sampat i pamwatan sangkya(wydkarana)gastraparisatndptay puspapita 
dang dcdryyanggaraksay sang samget i jambiy nyayawydkaranagastraparisamdptay pus- 
papita (dang d)cdryya rudray rakryan jurn krlanagara, sunayaduskarajnay {pnngkwi 
padlêgan) dharmmadhyaha ri kaccwany pu (3a) spapata dang dcdryydgraja pungkwi 
padlégan ^) dharmmadhyaha ring kasogatan hoddhatarkacdstraparisamépta ndtnabhiseica 
dang dcdryya gindntaka, i pingsornydjhd en mahdrdja kumonaketi ikang voanwe kudadu 
angga sang hyang dharmma i klémCy padamélakna rdjapracdsti macihna krtardjasa- 
jayawarddhana umunggwc salahsiking upalariptatdmra kapangkwa denikang karamdn 
i kudadu magehakna kaswatantrdnikang wan we kudadu j an sampun sinusuk simddég 
ringgit de cri mahdrdja tkeng gagdrenèknya salbakwukirnya Icabeh maryya kdngga de 
sang hyang dharmma i kléme, kabhuktya denikang rame kudadu kalêmwa kalilirana 
deni santdnapratisantananikang rame kudadu mne hlém tèka ri dldhaning dlahay 
sambandha (3b) gatinikang rdme kudadu prayatna marmmdngiwtaken i cri mahdrdja 
ngunin turung prabhu, makasangjhd nardryya sanggramawijaya, sdéfigniran kawa^^asak 
kawaweri(ka)ng wanwe kudadu tinut pinct dening calruy Icarana cri mahardja mang- 
kana, gri krtafiagara sang Una ring giwabuddhalaya ngüni timlcdn de gri jayakatyèng 
sakeng glatigglang, sdksdt prangmukhan lumampahaken krtalpaswakarmma, mitradrO' 
haka, samayalangghyana mahyun humaristdkna grt krtandgaran hanerikang ndgare 
tumapel sdéng i sanjata gri jayakatyèng karengyan teke jasun tvungkal, irikd ta gri 

1) De oade Yorm u dmung, 

2) In 't oonpr. padlagan. 



HOOFDBTÜK VI. — 79 — 

maharaja mwang sang arddharaja inutus de cti krttanagara mapagakna sdhjata cri 
jayakatyengy mantu parnah sang arddharaja mwang cri maharaja de crt krianagara 
kunéng sang arddharaja sa (4a) ksai puira de cri jayakaly eng, ryyangkat cri maharaja 
mwang sang arddharaja sangke nagare tumapèl, dalénq irikang tvanive kdung plut, 
irika iambe cri maharaja manggih catruy aprang bala cri maharaja ring samangkana, 
ala tekang lawan cri maharaja alaralaju tan kinaivruhan kivehing Iwangnya lumaku 
ia sanjaia (ti maharaja daténg i lémbahy tan hana catru kapanggih angulwan la fri 
maharaja sangke lèmbah anujwi batang, hana ta catru kapanggih dening sanjaia pam- 
barep (ti maharaja, mundur ta ya tanpanglawan, haliwai cri maharaja sangke baiang, 
daiéng i kapulungan kapanggih tekang catru muwah, irika ta yanaprang wadwa cri 
maharaja kulwaning kapulungan, alah tekang catru cri maharaja, alaralaywakweh 
Iwangnya an mangkana, lumaku ta muwah sanjaia cri tnaharaja da(é (4b) ng t 
rahui carat, tan asowe ikang kala, masö tekang catru sakakulwan, irika ia cri maha- 
rdjanaprang sahawadwanira kabeh, alaralayu muwah catru cri maharaja, akweh 
Iwangnya Cèhér atinggal, yayanpangdawuta kabeh smuni lawan cri maharaja, ring 
samangkana, hana ia tunggulning gatru layülayü katon weiani haniru, bang lawan puiih 
warnnanya, sakaionikang tunggul ika, irika ia yanpangdawut sanjaia sang arddharaja, 
lumakwakénan sayaprawrii, alayü niskarananujwi kapulungan purwwakani sanjaia (ri 
maharaja rusak cri maharaja pwaiyaniadrdabhakii i cri krianagara, ya ia maiang- 
nyan kari ia cri maharaja t rabul carai, makawasanang guminiir angalor da- 
(eng i pamwaian apajeg loring Iwah, diara nematus kweh (5a) ni rowang cri ma* 
hardja, ring sakatèmbéhjing, ika tekang catru, anül i tri maharaja pinapag deni 
bala cri maharaja, kondur ta ydde ulihnyanalayü, tathapinyan mangkana, yayan 
sangcayakdik wadwd cri mahdrdja, lunglidholong awaknya tuwinggalakén i ^i maha- 
rdja, wdi cri mahdrdja pwa kesisana, irika ta cri mahdrdjanparasarasan lawan 
rowang, hana idngenangên cri mahdrdja daiéng e trung, angucapucapa lawan ikang 
akuwwi trung makangaran rakryan wurwagraja, sdksdl kawu de qri krianagara, ro^ 
wanga cri mahardjangayaiakén ikaty wwang weian i trung, mwang salor-weian i 
trung, an mangkamngenangen cri mahdrdja, pada suka ia wadwd frt mahdrdja, ika- 
nikang wngi pwa ya ia, mangkal ta cri mahdrdja mahawan i kulawan, wdiniran 
kekuia (5b) tta dening catru, makanimilldtydnla kwehnikang galm, ri ika cri mahd- 
rdja i kulawan, atnanggih ta sira catru, irika cri mahdrdjan binuru dening galru 
lumingsir ia cri mahdrdja mangalor, mungsire kémbang ci*i prayanira, ri ika fr» 
mahdrdja pwe kéfnbattg cri, amanggih la sira galru muwah, binuru ia sira muwah, 
irika ia gri mahdrdjan alayu mangalor amgal bangawan sahabalanira kabeh, alanghwi 
ya garawalan, akweh Iwang wadwd cri mahdrdja mdlyangla(ng)hwi waneh katutuian 
ginalah dening cattm, ikang ahurip kasamburai adudwan paran, kari ta rwawlas siki wadwd 
gri mahdrdja rumakso 1) sira, rahina sakamaniyan ri prabhdtakdla, irika la gri ma- 
hdrdjan kawawerikang wadwe kudadu luhyanglih gokasanta (6a) ntapa, lanpangharé* 



1) 



Hoofdstuk VI. — 80 — Aasteeksstso. 

pakn agsanga, atyanta göngnikang duhka iutname sira, ri tka grt maharaja irikang rame 
kudadu, atyanta marmma samhramawilasanikang rame kudadu, makawyakti mang- 
haturakèn ya bhaktapana mwang bras, atéhêr angkétaken i ^r\ maharaja, wicaksanamet 
sanimilta crl maharaja tan katmwa pinetni(kang) gatru, makawkasan tumuduhakén 
humateralwn ring hnu, makahinganing sima rèmbang, mutigsire madura ista (Ti maha- 
raja, nahan ta karana cri maharaja ngtinin Icawalasak kawawerikang wanwe kud€uiu, 
gatinikang rame Itudadu pwekang atyanta marmma sambramawilasa i pri maharaja, 
yatikangdadyakên paramasantmti gr\ maharaja, ^ri maharaja pwa prabhu deng^a, 
saksat swarggawatirnan jagatpdlaka, tan wnang tan malés aweh suka ring huwus aweh 
inak ambe (6b) k, ya ta karananyan tumumn wardnugraha gri maharaja irikang rame 
kudadu, an susukén sima swatantradég ringgit Imah sthdnanya i kudadu de frt maha- 
raja, tkeng gaga-renèknya salbakwukirnya kabeh kabhuktya denikang rame kudadu, 
katmwa kalilirana deni santdnapratisantdnanikang rdme kudadu, mne htém tka ring 
dldhanitig dldha, sangsiptanya, mdri tekang wanwe fcudadu pinakangga de sang hyang 
dharmma i klétne, mari kaparabyapara, apan sampun dadi sima swatantradég ringgit 
de grt mahdrdja kunéng nimitta gri mahdrdja wani malapangga sang hyang dharmma 
i kléme (ika)nang wanwe kudadu, mapaknerikang rdme kudadu, grl jayukatyéng 
ngüni ri huwustiiran humilangakén gri krtanagara gumégwanirikang nagara daha, hana 
tojar gri jayakatyeng sinrawanakén irikang sayawadwipa, irenikang da. (Het bier 
dadelyk op volgende gedeelte ontbreekt). 

In bet Hollandscb: 

Heil! Qakajaren verloopen 1216^ in de maand Bhadrap&da, op den 6^ yan 
de donkere belft der maand, Haryang, Umanis, QaneQcara i), van de wuku-vfeék 
Madangknngan, terwijl de planeet in het Zuidoosten staat onder bet maanbais 
Bobini; waarvan de godheid Prajapati is, en dat behoort tot den kring van Ma- 
hendra, tijdens de yoga Siddhi, en bet uur Werajya; onder Yama als beer van 
den knoop, op den karana-dsig Tetila, en onder bet dierenriemsteeken de Maagd, 
op dien dag is afgekomen het bevel van zijne Majesteit, den allerheldbaftigsten 
slechts te pryzen vorst, den moedigen hoogverheven koning, die verdelging bracht 
aan zgne tegenstanders de vorsten met groote legers, die boog begaafd is met ka- 
rakter, kracht, deugd, schoonheid en plichtbesef, den beer van heel bet eiland 
Yawa, den beschermer der rechten van alle goedgezinden, voortgesproten uit het 
geslacht van Narasingba de (belichaamde) rijksrechten-quintessence, den zoon van 
den uit Narasingha's evenbeeld geborene, (den man) die het voorrecht bad te 
huwen de dochter (of dochters) van Eêrtanagara, en die als koning gezalfd werd 
door den naam Ertar^asa Jayawarddhana, welk bevel eerbiedig aanvaard is door 
de drie rakryan manlri's, (nl.) rakryan mantri hino, dyah Pamasi; rakryan mantri 
'halu, dyah Singlar, en ra/cryan mantri sirikan, dyah Palisir, die begeleid werden 
door den rakryan mantri, die den vijand op het slagveld schrik weet aan te jagen 



1) Ziderda^ 11 September 1294. 



Hoofdstuk VI. — 81 — Aauteekbkiko. 

en begaafd is met groote voortrefiFelijkheid, Franarfija geheeten ; den ralcryan manlriy 
die zich dapper gedroeg in de diepten van het oorlogswerk; en allerheldhaf- 
tigst iSy Nayapati; en den rakryan mantriy die de oorzaak was van de verdelging 
der vijanden op de andere eilanden en een flinken geest bezit, Arya Adikara; 
voorafgegaan door den ralcryan mantri, den hoogsten chef der helden, die het ver- 
trouwen van verschillende vrienden weet te wekken, en voor alle menschen toege- 
negenheid heeft, Arya Wiraraja, dien men den leerling van zijnen Majesteit den ko- 
ning Krtanagara zou kunnen noemen, terwijl niet achterbleef de rakryan m/in/ri zoo 
kundig in de beste voortreffelijkheden der dienstdoenden, de kanw^han, en de 
rakryan manlri het hoofd der groote helden, de demung, alsmede de rakryan 
mantri, de paiih, die schrik verspreidt onder de vijanden, zóó de heerschappij 
van Zijne Majesteit den koning, als ware hij het evenbeeld van Ifwara, met 
hechte banden bevestigende; bij alle welke personen zich uit vrijen wil nog aan- 
slooten de tot procesbeslissers aangestelden : de pamgel i tirwan, die volledig thuis 
is in de Sangkhyaleer, de weleerwaarde leeraar Eusumayuddharipu, ook bekend 
als Paragata ; de samgal i pamwatan (mede) volledig thuis in de Sangkya-leer, de 
weleerwaarde leeraar Anggaraksa; de samgal i jambi, die in de Nyaya-leer 
volledig thuis is, de weleerwaarde leeraar Rudra; de rakryan juru Krtanagara, 
die de moeielijkheden van het goede beleid weet op te lossen ; Mijnheere van 
de padlégan de dhyaksa voor de Qiwaiten, genaamd de weleerwaarde leeraar 
Agraja; (en) Mijnheere van de padlégan, de dhyaksa voor de Buddhisten, die 
volleerd is in den leer der Buddhisten en de weleerwaarde leeraar Gin&ntaka 
heet. 

Het afkomend bevel van zijne Majesteit den koning verordineert voor het 
gehucht Eudadu, dat een deel uitmaakt van het heilige rechtsgebied van Kléme, 
een koninklijk besluit te maken^ voorzien van het zegel van Ertarajasa Jayawar- 
dhana, op steen en op koper, en te bewaren door de dorpshoofden van Kudadu, 
dat vast zal stellen den vrijdom van het gehucht Eudadu, daar het door zijne 
Majesteit den koning tot een vrijgebied wordt gemaakt, met al zijne hooge en 
lage velden, zijne bergen en dalen, en ophouden zal deel uit te maken van het 
heilige rechtsgebied van Eléme, ten bate van het dorpshoofd van Eudadu, erfelyk 
(ook) te genieten door zijne kinderen en kindskinderen, voor nu en later tot in 
lengte van dagen. 

De aanleiding er toe was het gedrag van het dorpshoofd van Eudadu, dat 
indertijd Zijne Majesteit den koning zorgvuldig een schuilplaats verleende, toen 
deze nog geen koning was en nog Nararya Sanggramawijaya heette, bij gelegen- 
heid, dat hij in ongelegenheid in het gehucht Kudadu werd gevoerd, door den 
vgand vervolgd en nagezet, ondor de navolgende omstandigheden: 

Zijne Majesteit de toenmalige koning, Z. M. Ertanagara, die te Qiwabuddha- 
laya het tijdelijke met het eeuwige verwisselde, werd indertijd aangevallen door 

Ycrlu Bat Gen. deel XLIX. Ox 



HooFDöTüK VI. — 62 — Aaitteeéekinö. 

Zijne Majesteit Jaya katyëng *) van Gëlanggëlang % die als vijand optredende, 
dingen deed beneden zijne waardigheid, zijn vriend verraadde en tegen zijne over- 
eenkomst in Landelde, uit begeerte Zijne Majesteit Krtanagara, die in bet rijk Tu- 
mapël zetelde, ten onder te brengen. Toen het bekend werd dat er een leger van 
Zijne Majesteit Jaya katyëng tot Jasun wungkal was gekomen, toen zond zijne 
Majesteit Krtanagara Zijne Majesteit den (tegenwoordigen) koning en Arddharaja 
tegen de troepen van Zijne Majesteit Jaya katyëng. Arddharaja en Zijne Majesteit 
de koning waren beiden schoonzoons van Zijne Majesteit Krtanagara, maar Arddha- 
raja was tevens, zooals men weet, een zoon van Zijne Majesteit Jaya katyëng. Nadat 
Zijne Majesteit de koning en Arddharaja van Tiimapël waren opgetrokken, en het 
gehucht Kdung plat bereikt hadden, stuitte Zijne Majesteit het eerst op den vijand. 
Zijne Majesteits troepen leverden een gevecht, en de vijand verloor het en vluchtte, 
na zeer groote verliezen geleden te hebben. Het leger van Zijne Majesteit trok 
daarop naar Lëmbah, doch men vond daar geen vijand. Men trok daarop westelijk 
voort, van Lëmbah naar Batang, en de voorhoede van Zijne Majesteits troepen 
ontmoette op nienw vijanden, doch dezen trokken zich terug zonder gevochten te 
hebben. Batang voorbijgetrokken kwam Zijne Majesteit te Kapulungan. Daar trof 
men den vyand weer, en toen vochten ten westen van Kapulungan de troepen van 
Zgne Majesteit op nieuw, en (wederom) leed de vijand een nederlaag, kommerlijk 
wegvluchtende, na groote verliezen. Zoo stond het, toen Zijne Majesteits troepen 
weer voorttrekkende, te Rabat carat kwamen, en niet lang daarna uit het westen 
(op nieuw) vijanden naderden. Daarop streed Zyne Majesteit met al zijne man- 
schappen, en vluchtte de vijand na hevige verliezen weer, en het scheen dat zij allen 
voor goed vluchtten (?). Onder die omstandigheden vertoonden zich echter ten oosten 
van Hauiru wapperende, roode en witte, vijandige vaandels, en toen onttrok zich 
Ardharaja aan den strijd, zich schandelijk gedragende, en doelloos naar Kapulungan 
vluchttende. Hierdoor ging het leger van Zijne Majesteit te niet. Zijne Majesteit 
evenwel bleef trouw aan Zijne Majesteit Krtanagara. Daarom bleef Zijne Majesteit 

te Rabut carat, en ging vervolgens ? noordwaarts naar Pamwatan apajég, 

benoorden de rivier. Ër waren toen nog ongeveer zes honderd man bij Zijne Majesteit. 
Met het aanbreken van den volgenden morgen kwam de vijand, Zijne Majesteit 
achterop. Zijne Majesteits troepen trokken hem tegenmoet, en hij trok zich terug 
en raakte aan het vluchten, maar al was dit zoo, de troepen van Zijne Majesteit 
waren nog al minder geworden, want er deserteerden er, die hun lij f zochten te ber- 
gen en hem verlieten, en zoo hij werd bevreesd geheel ontbloot te raken. Daarop 
overlegde Zijne Majesteit met die (nog) bij hem waren. Zijne meening was naar 



)) Dat met dit Katyëng Katong is bedoeld, werd door Prof. Kern aangetoond in Bgdr. T. L. Vk.,Taii 
Ned. Ind., 5e volgr., IV, 291 (Regelen van klankverbinding in 't Oad^Javaansche). 

2) Zooals de Heer Ronffker mg iadertgd deed opmerken, vindt men dezen naam naar alle waarschgnlgk- 
heid temg op de kaart in de Jonge's Opkomst, enz., VlI^ waar men, beweslen den Wilis, een .Egg^inglangh» 
«en geweesen koninckrgek na woest" Tindt. 



BoofDSTüK VL — 83 — AAirrEEKSSTDro. 

Trang te moeten gaan om met den akutvu daar, Rakiyan Wnra agraja, die doof 
Krtanagara tot kttwtt was aangesteld, te overleggen opdat hij Zgne Majesteit zon 
helpen de lieden oostelgk en noordoostelijk van Trang te verzamelen. Allen 
waren het hiermede eens, en na het invallen van de nacht ging Zijne Majesteit 
over Knlawan, nit vrees door den vijand^ die zeer talrijk was^ achterhaald te wor- 
den. Te Knlawan stuitte hg weder op vijanden ; hij werd door hen vervolgd, maar 
onttrok zich aan hen door noordwaarts te gaan, om als het kon naar Kémbang 
(rt te ontkomen. Ook daar vond hij weer vijanden, die hem vervolgden, en toen 
vlnchtte hg met allen, die bij hem waren, zoo spoedig zg konden, zwemmende, 
noordwaarts de groote rivier over. Daarbij kwamen er velen om, anderen werden 
door den vgand achterhaald en met den lans afgemaakt, en die hun leven red- 
den, raakten overalheen verspreid. Er bleven er slechts twaalf ter bescherming 
Tan zgne Majesteit. 

Met het aanbreken van den dag kwam Zgne Majesteit hongerig, vermoeid, 
verdrietig en bedroefd, en wanhopende aan zijn leven, bij het volk van Kndadn. De 
ramp, die Zgne Majesteit trof, was buitengemeen groot, maar toen hij bij het dorpshoofd 
van Kudadu kwam, was dat dorpshoofd zeer heusch en medelijdend in zgn ont- 
vangst, zooals bleek uit het aandragen van eten en drinken en van rijst, en hg 
gaf Zgne Majesteit een schuilplaats, er op uit Zijne Majesteits doel te bereUnacdat 
deze niet gevonden mocht worden, als de vgand hem zou zoeken, terwijl hg hem 
ten slotte den weg wees en begeleidde tot aan het gebied van Rëmbang, op dat 
Zgne Majesteit, zooals hg wenschte, (van daar) naar Madura zou ontkomen. 

Zoo werd Zgne Majesteit indertgd, in ongelegenheid, naar Kudadu gebracht, 
en gedroeg zich het dorpshoofd van daar zeer heusch en medelgdend in zijn ont- 
vangst van den vorst, en dit heeft Zgne Majesteit zeer dankbaar gestemd. 

Zgne Majesteit is (daarna) koning geworden en dus en de 

beschermer der wereld, en hg moet dus noodzakelijk (het ondervondene) vergelden, 
en een genoegen doen aan hem, die hem eens aangenaam stemde, en daarom dan : 
ook ontvangt het dorpshoofd van Kudadu van Zgne Majesteit een schoon genade- 
blgk, (Kudadu) zg van wege Zijne Majesteit, zoo uitgestrekt als het is, met al zijne 
hooge en lage velden, bergen en dalen tot een zelfstandig vrij rechtsgebied, met 
een lieeld, verklaard, ten bate van het dorpshoofd van Kudadu, erfelijk (ook) 
te genieten door zgne kinderen en kindskinderen, tot in lengte van dagen; men 
begrgpe het wel, het gehucht Kudadu houdt op een deel uit te maken van het 
heilige rechtsgebied van Klëme, voortaan mag dit er zich niet meer mede be- 
moeien, want Zgne Majesteit heeft het tot een zelfstandig rechtsgebied gemaakt, 
met een beeld er op. 

£n wat het nu betreft dat Zijne Majesteit zich verstout een deel te ont- 
nemen aan het heilige rechtsgebied van Kléme, nl. het gehucht Kudadu, ten voor- 
deele van het dorpshoofd van Kudadu, (wete men), dat Zijne Majesteit Java ka- 
ty&lg, toen hg Zgne Majesteit Krtanagara gedood had, in vertrouwen op zijn r^k 



Hoofdstuk VI. — 84 — AANTEEKENma. 

Daha; gezegd heeft, zooals algemeen oTer geheel het eiland Yawa bekend is ge- 
worden, (Het vervolg onbreekt.) 

Het is wel niet te veel gezegd, als men beweert, dat hetgeen deze oorkonde, 
tegen wier echtheid bezwaarlijk argumenten in het midden zullen kunnen worden 
gebracht, ons verhaalt, aan dit en het vorige hoofdstuk van de Pararaton, ten 
minste gedeeltelijk, een heel relief geeft. Bij alle op te merken verschil treedt 
de overeenkomst zoo op den voorgrond, dat er niet aan getwijfeld worden kan of 
beiden, èn de oorkonde èn de Pararaton, geven een verslag van dezelfde feiten, en 
reeds dit dwingt ons tegelijkertijd te erkennen, dat er in de Pararaton iets meer 
wordt aangetroffen dan vertelseltjes alleen. 

Gaat men het in bijzonderheden na, dan ziet men in de eerste plaats, dat 
Raden Wijaya inderdaad gehuwd is geweest met de dochter of dochters van Kér- 
tanagara, die vorst van Tumapél was, en dat dat rijk niet lang vóór 1216 Qaka door 
Jaya katong van Daha veroverd werd. Men vindt er de verklaring van Ertanagara's 
anderen naam Qiwabuddha. Het blijkt ook, dat Raden Wyaya (in de oorkonde 
Nar&rya Sanggramawyaya) Jaya katong weer versloeg, en daarna koning werd, 
terwyl ook hier de term prabhu is. En er is nog meer. In de loftuitingen (de 
titels) aan Raden Wijaya, als koning, gegeven, wordt niet vergeten te vermelden, 
dat hy van een met Narasingha, of een Narasingha, in verband staand geslacht 
voortsproot, wat in herinnering brengt hetgeen Hoofdstuk IV en V van de Pararaton 
reeds mededeelden, nl. dat Raden Wijaya een zoon was van Mahi^a Campaka, 
die ook Bhatara Narasingha heette Men vindt er Wiraraja terug, en in een positie, 
als hem ook volgens de Pararaton toekomen zou, zelfs geprezen op eene wijze, 
die ons als van zelf zijne verrichtingen en handelwijze voor den geest roepen, 
zooals dezen in dat boek beschreven zijn. 

Vergelykt men het verslag van Raden Wijaya's zwerftocht in de oorkonde, 
met hetgeen er in den tekst hierboven van staat, dan ziet men dat dit laatste 
slechts een flauwe weerspiegeling is van het in het officieele stuk medegedeelde. 
Het heet er, dat hij van Talaga pagër naar Pandakan gaat, daar door den buyut 
geholpen wordt, en van daar over Datar het strand weet te bereiken, om naar 
Sangénëb te ontkomen. In de oorkonde vindt men achtereenvolgens de namen 
Jasan wungkal, Tumapél, Këdung plut, Lémbah, Batang, Kapulungan, Rabat carat, 
Hafiiru, nogmaals Kapulungan en Rabut carat, Pamwatan apajëg (?), Tmng (waar 
hij niet komt), Kulawan, Kémbang ^ri, de Bangawan^ Kudadu op het gebied van 
KlÖme, en Rémbang (nl. het Pasuruhansche). 

Evenmin vindt men in de oorkonde de andere persoonsnamen van de 
Pararaton terug, dan de reeds genoemden, doch hier kan geenszins tevens wor- 
den gezegd, dat de verder nog voorhandenen althans niet gedeeltelijk dezelfde 
personen aanduiden. Geeft de Pararaton nog : Raganatha, Këbo téngah s= Ara- 
gani, Bafiak kapuk, Rangga lawe, Pêdaog, Sora, Dangdi, Gajah pagon, Nambi 
(zoon van Wiraraja], Pótëng, Wirot, ea Matjan kaping, in de oorkonde zyn ge- 



Hoofdstuk YI. — 85 — AABmnanBe. 

noemd: dyah Pamasi, dyah Singlar, dynh Palisir, Pranaraja i), Nayapati, Arjra 
Adikara, een kaminthan, een déniang (= démung\ een palihj Paragata, Anggarak^a, 
Rndra, Krtanagara (een ander dan de voret van dien naam), Agraja, Ginantaka, 
Wnra agraja, en het dorpshoofd yan Kadada^). Dit zegt echter nieta. Deinde 
oorkonde voorkomende namen zgn, behalve de drie eersten, wat men zou kannen 
noemen titel-namen, namen gekregen bg het innemen yan een zekeren rang, en 
die anderen kindemamen of zolken, als waaronder de personen in de wandeling 
bekend waren. Zonder twgfel behooren die der oorkonde gedeeltelgk aan an* 
dere personen toe, maar het is tevens hoogstwaarschgnlgk, al is het niet oit te 
maken hoe, dat in weer anderen juist eenigen der personen schuilen, die in de 
Pararaton als Raden Wgaya's gezellen worden vermeld. 

De vergelgking verder voort te zetten is niet noodig, slechts zg er nog 
opgewez^i, dat de oorkonde alleen, een zoon van Jaya katong noemt, Ardharija, 
die evenals Raden Wgaya met een dochter van Krtanagara w^'s gehawd. 

In de tweede plaats moet hier even stilgestaan worden bg de Chineescbe 
expeditie van 1293 A. D. (= 1215 Qaka). 

In dit opzicht komt de eer geheel toe aan den Heer W. P. Groeneveldt, 
al kende hg de Pararaton niet Maar hg was het die, terwgl anderen vóór bon 
de hier van belang zgnde Chineescbe berichten althans gedeeltelgk reeds kenden, 
zie de bovenopg^even literatuur, reeds in 1875, in zgn boven reeds eenmaal 
tot staving van de juistheid van het een en ander in Hoofdstuk V, aangehaalde 
Notes 3), wees op de zakelgke eenheid van verschillende bgzonderheden in het- 
geen men vindt in Raffles's Historj of Java, II, hl. 108, als ,a different account 
oi the first establishment of the Majapahit empire'', zooals dat wordt g^even ,in 
a manuscript recently obtained from Bali'*, en de overeenkomstige in de Chi- 
neesche berichten, welke handelen over de expeditie naar Java onder Kublai khaii 
in de jaren 1292 en 1293 A. D., d. i. Qaka 1214 enz. Ook wees hg tevens 
op het voorkomen van dezelfde traditie, als bg Raffles, in Friederich's Verslag, 
zie daar onder Rangga lawe ^;, en in wezen had hg het dus ook voor de Para- 
raton reeds uitgemaakt, daar toch Raffles's mededeeling moet berusten op de Rangga 
lawe, en dit boek weder op de Pararaton^ waarvoor men de aanteekenipg boveo 
bg de inleiding en die inleiding zelf zie. 

De bedoelde stukken, waarover hier een verkort, samenvatiend referaat volgt, 
vindt men in de genoemde Xotes op bL 20 ^146) — 30 ri55). Zg bestaan uit 
een algemeen verslag en drie berichten^ resp. over het leven en de krggsbedrgven 



1) VmmrH^ heet ia ^ FknnU« ^ pmUk omLa Totjaja, zie HooCbtak III. 

2) Op Mad &i ca 11< TokL wmm êat »« gri^frHrtjk mog ttm^ mLSm FiMMJia, K «pfti, Airj. 
aikin, Arjm Wlniiim ca Kitatt^u». ca Urn TAm*^ SMjMfÊd, ca Anr* Wi(ift)4ia. Of«r étm betirt» 

zie Mca ^ Bsi&iUtMk VUL 

S) XolCM, U. Si (IM). 

41 VMriMfig vcnlw vaa kei ékMmi Béü, ïBSO, Vak. Bal. Gca. XXm. kL 21. 



Hoofdstuk VI, — 86 — Aahteekendtq. 

der drie aan het hoofd dier expeditie geplaatste officiereD: Shihpi; Kan-HslDg en 
Ike Mese. 

Boven, bij Hoofdstuk V, werd de aanleiding tot de expeditie reeds aan ge- 
geven. Een der gezanten van Kublai Khan (1280 — 1295 A. D.) ^), was door 
den koning van Java zwaar beleedigd, en wel op eene wijze, dat die beleediging 
ook den keizer zelf gold, en daarom zond deze in den aanvang van het jaar 1292 
(:= Qsika, 1214) eene expeditie van 20.000 man onder de drie reeds genoemde 
bevelhebbers naar het eiland om die beleediging te wreken. 

Wat er verder bericht wordt, is het navolgende. 

Zij kregen bevel duidelijk te laten uitkomen, dat zij gezonden waren om 
de Javanen voor het gebeurde te straflFen, en bereikten Java in het begin van 
1293 (= Qaka 1215). Hoe de reis gemaakt werd, doet niets ter zake. Bg het 
eiland Eolan (Bëlitung) gekomen, maakten zij hun krijgsplan op. Ike Mese ging 
met 500 man en 10 schepen vooruit, doch werd later door de overige troepen, 
die over Karimon (Karimon Java) naar Tupingtsuh (Tuban) stevenden, bij de 
laatste plaats weer ingehaald, of had hen daar afgewacht. Men kwam toen tot 
een ander plan. Er werd nader besloten, dat de eene helft de tocht n<^ oostelijker 
over zee zou voortzetten, en de andere direct landen. Nu ging Shih-pi over zee, 
tot aan den mond van de rivier Sugalu (Sëdayu), en Ike Mese met Kau Hsing 
aan den wal. Van Sugalu uit zond Shih-pi drie hoofdofScieren naar de „floating 
bridge'* van Majapahit ^), om de boodschap van den keizer over te brengen, en met 
het bevel om zich, na zich van hun taak gekweten te hebben, weer bij de troepen 
te voegen, die onderwijl zouden voorttrekken naar de kleine rivier Pa-tsieh (Kali 
mas) ^), waarheen over land ook de andere helft van de expeditie, bereden troepen 
en voetvolk, zou tijgen. 

De vooruitgezonden officieren komen spoedig bij Shih-pi terug, met het 
bericht, dat de schoonzoon van den vorst van Java, Tuhan Pijaya, zich wilde 
onderwerpen, maar zijn leger niet verlaten kon, omdat hij in oorlog was met den 
vorst van Kalang, Haji Katang ^), die den door de Chineezen gezochten vorst van 
Java, Haji Ka-ta-na-ka-la 5), welke al dood en Tuhan Pijaya's schoonvader bleek 
te zijn, kort te voren gedood had ö). Tuhan Pijaya was met Haji Katang een oor- 

1) Die deze in het begin zjner regeering, zegt de Heer Groeneveldt in z^n Notes bl. 81 (167), dos 
in 1280 A. D. of iets daarna, naar verscliillende streken moet hebben gezonden, om kennis van s^n optraden 
te geven ; men zie echter nog beneden, en vergl. over de qnaestie van het begin zqner regeering, behalve de noot 
op bladz. 21 (147) der Notes, von Fries, Abriss der Geschichte China's seit seiner Entatehnng, 1884, bL240. 

2) De naam dnidel^k, ook elders in deze vier stakken, genoemd. 

8) In den Chineeschen tekst Pa-tsieh kan, door den Heer Groeneveldt geidentifieerd met Pacëkan 
(Paljekan) bezuiden Sarabaya, dat voorkomt in het Aardrqksk. en Stat. Wdb. Ook de overige hier tnsschen 
haakjes voorkomende gelijkstellingen z^n van liem afkomstig. 

4) In de oorkonde Qri Jaya katyëng (= katong) van Gëlang-g^lang, zie Zb. Haji is het Javaansche 
(Polynesischel woord, voor vorst. 

5) Zie Hoofdstak V. 

6j Dr staat: At that time Java carried on an old fend with the neighbonring country, Kidang, and 



Hoofdstuk VI. — 87 — AasteekeMko. 

log begonnen, doch bad hem nog niet knnnen overwinnen, en daarom bad hg zich 
na naar Majapahit teruggetrokken. Hij zond een verslag over de rivieren en zee- 
havens van zijn land, en een kaart van Kalang ^), en berichtte, dat in zijne plaats 
zijnen eersten minister 2) Sih-la-nan-da-cha-ya 8) en veertien anderen zouden ko- 
men. Er werd daarom bevel gegeven deze personen te gaan halen. In dien tus- 
schentijd hadden zich alle Ghineesche troepen op de afgesproken plaats verzameld. 
Dat punt was zeer goed gekozen, want bet kon den toegang geven tot (geheel) 
Java; als men de rivieY, aan de monding waarvan men zich bevond, opvoer, zou 
men van zelf het paleis van den vorst van Tumapan ^Tumapél) bereiken. Het bleek 
evenwel, dat men besloten had die plaats tegen de Chineezen te verdedigen, en 
daarom was het dan ook, dat de eerste minister ^) der Javanen, Hiningkuan ^), 
die zich op een vaartuig bevond, om te zien hoe het gevecht af zou loopen, zelfs 
na een herhaalde sommatie niet voor den dag kwam. Er werd daar een ver- 
sterkt campement gemaakt, en nu trok men gedeeltelijk te water, op vaartuigen, 
en gedeellelijk, de cavallerie en de infanterie, langs den oever, vooruit. 

Dit gezien hebbende, ging Hiningkuan van het schip, waarop hij was, af, en 
vluchtte dien nacht nog weg. Men maakte meer dan 100 groote schepen buit, met 
6(i/a-koppen op de voorplecht. Na eene bezetting in Patsieh, de thans bezette en 
versterkte plaats, te hebben gelegd, ging men verder voort. Nu kwamen er gezan- 
ten van Tuhan Pijaya, om te vertellen, dat de koning van Kalang, Tuhan Pijaya's 
tegenstander, dezen tot bij Majapahit had nagezet, en dat hij daarom om hulp vroeg. 
Ike Mese ging dadelijk tot hem, en een afdeeling der troepen volgde dien bevelheb- 
ber als reserve tot Changku ^). Ook Kau Hsing trekt naar Majapahit, maar blijft 
daar niet. Hij gaat weer naar Patsieh terug, als hij verneemt, dat men niet weet 
of de troepen van Kalang nog ver weg, dan wel reeds dicht bij zijn, doch hij krijgt 
straks van Ike Mese weer bevel om toch weer naar Majapahit te komen, daar men 
den vijand dien nacht kon verwachten. Spoedig daarop naderen de troepen van 
Kalang van drie zijden, en den daarop volgenden dag verslaat Kau Hsing de co- 
the king of Java, — om dezen te straffen was men gekomen, — Haji Ka*ta-na-ka-la, had already been killed 
by the prince of Kalang, ralled Haji Katang. Kërtanagara kwam volgens de Pararaton om in II 97 Qaka, 
d. i. 1275 A. D. Toch wordt hq genoemd als de bedrijver van de te straffen waniaal. Dit maakt het waar- 
sehqnlgk, dat het zenden van Meng ch'i naar Java reeds vóór 1280 A. D., het eigentlgke jaar van het begin 
der regeering van Knblai Khan, moet hebben plaats gehad. Kublai Khan zelf dateert het begin zgner regee* 
ring van 1264 A. D. Dat hg reeds vóór 1280 hier en daar gezanten heen zond, ziet men in vou Fries, //. 

t. a. p. 

1) Al deze bgzonierheden nit het bericht omtrent Shih«pi, bl. 26 (151). 

2) Zie hieronder noot 4. 
8 Sira dang dcdrya? 

4) Deze term is hier, zooals de Heer Groenevelit mg inlichtte, in den Chineeschen tekst metander« 
woorden uitgedrukt dan boven, waar in de vertaling dezelfde uitlrukking staat. 

5) Hinweng Koripan^ 

6) Door den Heer Grocneveldt vereenzelvigd met Canj!;kir, zie de noot op bl. 4R (174) der Notes, 
Dat het het Canggu van den Javaanschen tekst moet zgn is duidel^k, men zie nog beneden. 



Hoofdstuk VI. — 88 — AAinisBKENnfa. 

lonne, die haar aanval deed nit bet znidoosten, en daarna ook nog die welke uit 
het zuidwesten kwamen^ maar door Ike Mese te vergeefs gezocht waren. Acht da- 
gen later trekt men^ na zich in drie corpsen verdeeld te hebben^ tegen Kalang op, 
met de afspraak om op den vierden dag daarna elkander te Taha (Daha) te vin- 
den^ en dan gelijktijdig op een afgesproken sein^ den aanval te doen. Een ge- 
deelte der troepen volgde den loop der rivier. Ike Mese trok om de oost en 
Kan Hsing om de west, terwijl Tuh^n Pijaya hen met zijne troepen in den mg 
volgde. Na een hardnekkige verdediging wordt op den bepaalden dag Taha ge- 
nomen, de kratotiy waarin de vorst, Haji Katang, zich teruggetrokken had, om- 
singeld, en deze gemaand om zich over te geven, hetgeen geschiedt. Een veer- 
tien dagen daarna overvalt Tuhan Pijaya een escorte, dat hem naar Majapahit 
brengen zou, om daar de schatting in ontvangst te nemen, na zijnen begeleiders 
eerst steels ontgaan te zijn, en weer een drie weken later verlaat de expeditie 
Java weer, medevoerende, zooals er staat, de kinderen en officieren van Haji 
Eatang i), meer dan 100 personen, een kaart van het land en een bevolkings- 
staat 2), en een met gouden letters geschreven brief, die door den koning was 
aangeboden. Tuhan Pijaya had nl. ook van andere gelegenheden gebruik gemaakt 
om de Chineesche troepen nog verder te overvallen; zoo kon hij ze van elkander 
scheiden en leden zij groote verliezen S). 

Ook hier wederom kan men na het lezen van deze ons van een geheel 
onafhankelijke zijde toegekomen mededeelingen, slechts komen tot een zelfde ge- 
volgtrekking als boven reeds gemaakt moest worden, billijke twijfel aan de 
juistheid en den historischen achtergrond van de hoofdzaken, die men in Hoofdstuk 
V en VI van de Pararaton aantreft, is niet mogelijk. 

Zonder twijfel verdienen de Chineesche berichten op verschillende punten 

1) Een zoon van dezen, Silali-pat-ti-Sili*lah-tan-pu]i-hah, geheeten, en Hoji Katang zelf werden volgens 
het bericlit oyer Kan Hsing, door de Chineezen yoor hnn vertrek gedood, bl. 28 (153). De Heer Groeneveldt 
merkte mq op, dat het lah in Si4ah-pat-ti bezwaarlgk aan na in 't Jav. zon knnnen beantwoorden. SenapaH 
kan er dns niet in scbnilen. Mogelgk zon het knnnen i^n nrdpaiih (?). Omtrent Sih-lah-tan*pah-hah durf 
ik nog geen gissiog te wagen. 

2) Deze kaart en deze staat zonden die knnnen zqd, welken, zie boven, volgens het bericht over 
Shih-pi, Tnhan Pgaya aan dien bevelbebber bad gezonden. 

3) Zie het bericht over Shih-pi, bl. 26 (152). Elders in de Notes, op bl. 47 (172 volgg.), vindt 
men als een bgzonderheid omtrent deze expeditie nog het navolgende medegedeeld, dat niet voorkomt in de 
hier weergegeven verslagen. Men -leest daar : .Taban is the native name of a place with somewhat more 
than a thousand families, all nnder one chief; .... On the seashore is a small pond with fresh, potable wa- 
ter, which is called the Holy water. It is said that in the time of the Yü&n dynasty the imperial generala 
Shih-pi and Kan-H»ing having come to attack Java, were a month witbont obtaining any advantage; the water 
on board the ships was exhansted and the army was ia a precarion» state; the two generals then prayed to 
heaven, saying*. we have received the imperial command to snbdne the barbarian«, if heaveo u with os 
may a well spring np, and if not, let there be no water. Having finished this prayer they thmst tbere 
spears with force into the seashore and immediately water spring np from the place where the speart had 
strnek; the water was good for driuking, all drank of it and were «aved by this as»i«tance from heaven. The 
well ezista np to the present day". 






Hoofdstuk VI. — 89 — Aaktkekkniko. 

meer geloof dan het Javaansche, zooals bijv. ten opzichte van de opgegeven reden 
der komst van die Chiueesche troepen, hoewel het volstrekt niet onmogelijk is, 
dat die beide prinsessen, bijv. aan de bevelhebbers, toch toegezegd zijn, en het 
verraad aan het escorte gepleegd zeer wel hebben plaats gehad op de in de Para- 
raten beschreven wijze, doch het is niet noodig zich daarin verder te verdiepen. 
Alleen dien ik er hier, behalve op hetgeen boven in een noot reeds op- 
gemerkt werd over het jaar, waarin Meng Ch'i moet zijn gezonden, op te wgzen, 
dat ik in een zeker opzicht met den Heer Groeneveldt meen te moeten verschil- 
len in de opvatting van de uitdrukking Javanen, die men ook in het hier gege- 
ven referaat aantreft in het gedeelte, waar men zich tegen de landing der ex- 
peditie verzetten wil. Blijkens bl. 33 (159) der Notes is het zijne overtuiging, 
dat men er troepen van Kalang of andere Javanen, die zich aan hen hadden on- 
derworpen, in zien moet, op mij maakt het den indruk, dat zulks de bedoeling 
niet kan zijn. Met opzet intusschen heb ik hierboven het betrokken gedeelte der 
Notes zoo weer gegeven, dat de onzekerheid ook hier in dat referaat niet is weg- 
genomen. Maar er dient opgemerkt te worden, dat hier in deze Ghineesche teksten 
met Java blijkbaar bedoeld is het oude Tnmapél, en met Tumapan dus ook Java. 
Er wordt uitdrukkelijk onderscheid gemaakt tusschen Java en Kalang. Eenmaal 
heet het: Java en de daar dichtbij gelegen streek Kalang, en dan weer, als 
Java zich met Kalang verbindt, zie bl. 26 (151) en 26 (152). Als de Chineezen 
reeds tot Majapahit zijn voortgetrokken en zij zich daar bevinden, komen de troepen 
van Haji (Jaya) katong van Kalang pas uit het zuidoosten, het zuidwesten, en uit 
het ? , en vóór hun komst wist men niet waar zij waren, terwijl Tuhan Pyaya een 
boodschap zond, die toch hierop neerkomt, dat zijn vijand hem reeds tot in Majapa- 
hit zou hebben gezocht. Aan te nemen, dat deze gelegerd was tusschen deze plaats 
en die waar de Chineezen hun kamp hadden gemaakt, gaat moeielijk, en als dit 
juist is, dan kunnen de Javanen, die de landing wilden beletten, ook weer geen 
lieden van Daha (Kalang) zijn geweest. Wel is waar wordt er in de Ghineesche 
teksten niet uitdrukkelijk gewaagd van verraad door Tuhan Pijaya gepleegd in 
het begin der expeditie, doch die drie gezonden hoofdofficieren waren toch naar 
Majapahit, en niet naar Kalang gedirigeerd geweest. Ook brachten zij een antwoord 
van dür, en niet van Haji (Jaya) katong, van wiens bestaan^ zulk een indruk 
maakt het althans op mij, zij eerst later kennis kregen. Ook is het niet wel te 
denken, dat de aan de monding der bedoelde rivier gelegerde Javanen, zoo dit 
lieden van Haji (Jaya) katong waren geweest, die drie oflScieren déAr, waar zij toch 
passeeren moesten om de plaats hunner bestemming te bereiken, zouden hebben 
doorgelaten, om zich tot Tuhan Pijaya te begeven. Nu blijft nog wel de mo- 
gelijkheid open, dat lieden van Haji Katang die plaats zouden hebben bezet, nadat 
de vooruitgezonden oflScieren hun, duidelijkheidshalve zegge men eerste, bezoek 
aan Tuhan Pijaya hadden gebracht, doch alsdan is hetgeen er verder wordt ver- 
haald evenzeer niet goed te begrijpen, want Tuhan Pijaya meldt daarop, dat 



Hoofdstuk VI. — 90 — 

men bem dü, terwijl dit toch uiet waar was^ want, toen men in Majapahit kwam, 
was er nog geen vijand te zien, tot in Majapahit teruggejaagd had (er staat ver- 
volgd had\ en daarop komen dan nog later Haji Katang's troepen, men zie boven, 
vooral uit het zuiden. In het verslag staat van drie zijden, maar opmerking 
verdient het, dat er verder slechts sprake is van het verslaan van een vyand in 
het zuidoosten en het zuidwesten, en men moet aan nemen dat, ook al waren de 
Javanen, die bij het landen tegenstand hadden geboden, eigenlijk tegenstanders ook 
van Tuban Pijaja geweest, op dat oogehblik de streek om de noord toch vrij was. 
Dat de handelwijze van Tuban Pijaja, als mijne opvatting van de toedracht en den 
loop der zaken de juiste is, typisch Javaansch zou kunnen heeten, behoeft niet 
nader aangetoond te worden ; men leze bijv. 'slechts de Babad tanah Djawi. 

De persoons- en de plaatsnamen in deze Chineesche berichten voorkomende 
geven 6f zeer weinig moeite of zijn vooralsnog raadsels. Zooals men zelf zag, of 
door den Heer Groeneveldt reeds opgemerkt werd, is Tuban Pijaja = Raden Wijaja, 
Katanakala = Kërtanagara, Haji Katang = Haji Katong (of beter Haji Jaya katong, 
in de oorkonde Jaya katyëng), Tumapan = Tumapël, Kalang = Gelang (in de oor- 
konde Gélanggëlang), Taha = Daha, en Majapahit de bekende plaats van dien naam. 
Ten opzichte van Patsieh (of Patsieh kan) uitte de Heer Groeneveldt het vermoeden, 
dat het gelijk zou zijn aan Pacëkan (zie de noot boven), en Ghangku meent hij, 
zooals mede reeds in een noot werd gereleveerd, in Cangkir terug te kunnen vinden. 

Omtrent Ghangku, dat zonder twijfel het Jasraansche Ganggu is, vindt men 
in de Notes, op bl. 47 (173) nog de volgende belangrijke mededeeling: 

„Going eastward from Tuban for about half-a-day, one comes to Ts'e-ts'un, 
of which the native name is Gërsik. .... Going southwards from these two 
villages, a distance of about seven miles (twenty li), one comes to Surabaya. . . 
Going from Surabaya in a small boat, to a distance of 70 or 80 /* (about 25 miles), 
one comes to a marketplace called Ghangku; going ashore here and walking 
southward for a day and a-half, one comes to Modjopait, where the residence of 
the king is. In this place there are about 200 or 3()0 native families, andseven 
or eight chiefs, who assist the king". i) 

In de Pararaten treft men den naam driemaal aan : op bl. 18, reg. 8, waar 
gesproken wordt van een Canggu lor (noordelijk Canggu), waar Wisnuwardhana 
(Rangga wuni) een versterking laat maken; op bl. 32, reg. 4, waar medegedeeld 
wordt dat er te Canggu iemand stierf; en op bl. 24, reg. 26, dus in dit hoofdstuk, waar 
sprake is van de sohaning Canggu, de haven van Canggu *^). Van welke waarde 

1) Het is ondnidelgk of deze laatste zin op Chan^kn, dan wel op Majapahit slut. 

2) Ook dit leidt er toe de juistheid vun de ▼erondcrstellin^ door den Heer Groeneveldt ten oprichte 
▼an het Changkn der Chineesche teksten gemaakt, te betwijfelen, doch waar de plaats dan wel zon hebben 
gelegen, is nog niet uit te wij /en. De laatste uit de Pararaton aanzetogen plaats dwinvt aan een haven te 
denken, ook al lag deze niet vlak aan zee. In 't Bal. is sowan het gewone woord voor de nitwatering of 
monding etner rivier, zie van Eck's Eerste proeve vuu een Balineesch-Hollandsch woordenboek. Hierb^ fou 
men na ook kannen denken aan de plaats, waar een zglak zich met de hoofdrivier vereenigt. In den tek*t 



Hoofdstuk VI. — 91 — J 

de plaats werd geacht^ leert een oorkonde nit 1318 ^aka, das nit den Majapahit'schen 
tgd, en zonder twijfel ook uit dat rijk zelf afkomstig, nl. Kawi-Oorkonden IV 
van Cohen Staart, waarin men èn den naam Majapahit aantreft (Ia, 2) èn het 
navolgende leest (26 5): Zij vrij van de verplichting zout te maken, den weg 
op te hoogen, en Canggu in orde te houden, van alle soorten van heerendiensten, 
luptUing sosorohan garhn, hurugxirugan dalan, bebhih^an ing canggu, sakalwiraning ra- 
jakarya pulajenan ^). Het lijdt toch wel geen twijfel of ook daar is deze plaats 
bedoeld, die zooals hier blijkt in heerendienst onderhouden moest worden. 

Kwam het door het bij dit hoofdstuk reeds bijgebrachte aan het 
icht, dat de mededeelingen van de Pararaten inderdaad vertrouwen verdienen, — 
en het zal nog nader blijken dat zij dit ook elders doen, men zie b^v. by 
Hoofdstuk XII, — er rest nog een belangrijk punt hier te behandelen, het bericht 
of de voorstelling hier gegeven van de stichting van Majapahit. Wat er in de 
Pararaten van verhaald wordt heeft de lezer gelezen, het is hier niet de quaestie 
uit te maken of de stichting van Majapahit door Raden Wijaya zich werkelijk zóó 
heeft toegedragen, als daar wordt verteld, wèl of Majapahit werd gesticht in den 
tijd, die er hier voor wordt aangegeven, dan ^el niet. 

Daarvoor lang stil te staan bij hetgeen de Javanen van Java omtrent den 
oorsprong dier plaats verhalen, is niet noodzakelijk, te minder omdat men reeds 
elders het noodige daarover gezegd vinden kan. In mijn opstel „Iets over een 
ouderen Dipanëgara .in verband met een prototype van de voorspellingen van 
Jayabaya, Tijdschr. Ind. T. L. en Vk., XXXII, bl. 375 en volgg., werd over de 
oude geschiedenis der Javanen, naar de traditie der Javanen van Java, men neme 
als grens het opkomen van Mataram, reeds gehandeld, en ik geloof met het weinige 
wat daar gezegd werd, reeds voldoende te hebben bijgebracht om te bewijzen, 
dat het eerste gedeelte van de babad maakwerk is. Men dient daarbij te weten 
dat alle babad's, waarin over dit onderwerp iets gezegd wordt, hetzij zij uitvoerig 
zgn, of beknopt, en al bestaan er kleine verschilpunten in de beschrijving, over 
de stichting van Majapahit altijd en altijd weer hetzelfde leveren, zoodat men zon 
kunnen zeggen, dat de voorstelling als het ware een kanonieke is geworden. Dit 
geldt zelfs van de babad in haar geheel, maar men heeft het vooral in het oog te 

der Panraton staat echter tinitt têkeng dunnngane malaga maring tohaning CanggUy das zoover aU zij maar 
vlncliteii konden, tot aan de monding van de Canggu, waarmede moeieljjk iets anders kan z\jn bedoeld dan dat 
z^ naar hunne schepen vluchtten, welke men in de eerste plaats in den haven zoeken zal, al zonden er de rivier 
opgevaren kunnen z^n. Dit is ook de opvatting in de Ran^ga lawe. Deze plaats van de Paraiaton, welk 
boek niet altgd en overal door den dichter van dat gedicht is misverstaan, luidt daar: sdisana lumkas karo 
amrajaga tira wong Tatar lagi matane ana^h kedkan kasalayah pjah sawaneh akanin ^esaning pjah pada 
malaktoinurip» dadi katawan iumUt tang stri karawlan tinüteng Canggu maJih bahitra inanang kimuta tang 
bharana ingonjaleng Majapahit tikdiahanga siddhaneng sandisandi. Na a in de Rangga lawe schier ge- 
regeld eng voor ing. 

1) De hier genoemde zijn niet de cenigc vrg stellingen, die in dat stuk gegeven worden; putajtnan 
moet geljjk z^n aan het oudere bioatkajyan — rdjakérya, waarop Dr. Jonker reeds wees, zie Een ond-Javaansch 
wetboek vergeleken met Indische rechtsbronnen, bl. 232 (Aaut. b\j art. 262^. 



Hoofdstuk VI. — 92 — AiHTEEKKHnre. 

honden bij het gedeelte, dat over de ondere geschiedenis loopt, en ik Toor mf 
geloof, dat, als men dat niet vergeet, het gaandeweg gelnkken zal in dat gedeelte 
een beter inzicht te verkrijgen, dan ons tot nog toe was gegeven, en dat men 
eenmaal in staat zal zyn het althans voor het grootste gedeelte naar de het aur 
menstellende bestanddeelen uiteen te leggen. Waar het ten opzichte van M^ja- 
pahit het meest op aankomt, den tijd waarin het gesticht werd, jaist op dat 
stnk bestaat er slechts een zeer gering verschil, daar algemeen wordt erkend, dat 
Majapahit het laatste der groote rijken was vóór de invoering van de Islam op 
Java, en men den tijd van het ontstaan er van toch taliter qaaliter steeds om 
en bg dien, welke de Fararaton ons verplicht daarvoor aan te nemen, wil gezocht 
hebben i). 

Wanneer wij hier dan eerst ook nog even in 't kort verhalen wat men door 
de Javanen over die stichting verteld vindt, dan is dit alleen om daardoor de 
aandacht te kannen vestigen op eenige merkwaardige punten van overeenkomst, 
welke er tusschen die Javaansche traditie en die van de Pararaten bestaan. 

Qri pamëkas, d. w. z. Z. M. de laatste vorst (van Pajajaran), zoo verhalen 
de babad's, had drie zonen: Arya Bangah, Raden Susuruh en een door een q/or op 
bovennatuurlijke wijze bij een selir van den vorst in het leven geroepen zoon, 
die opgevoed wordt door een paar oude luidjes, die hem, nadat men hem de rivier 
hadden laten afdrijven, tot kind aannamen. Deze laatste heette eerst Siynngwir 
nara, doch kreeg, nadat bij, groot geworden, weer bij zijnen vader terecht en in 
dienst was gekomen, den naam Baöak wide. Arya Bangah werd koning in Galnh, 
en Raden Susuruh zou zijn vader opvolgen. Baïïak wide weet zijn vader evenwel 
gevangen te nemen, en verslaat Raden Susuruh, die dezen te hulp wil komen en 
verlossen. Raden Susuruh vlucht naar het oosten, en wel eerst naar Kali gnnting. 
Daar vindt hij een onderkomen bij een weduwe, die hem tot kind aanneemt, en 
die drie zonen had: Ki Wiro, Ki Nambi, en Ki Baudar. Als Raden Sasnmh 
gevlucht is, vaardigt Arya Baöak wide een bevelschrift uit, dat niemand hem huis- 
vesting mag verleenen, en wel onder bedreiging met de doodstraf. Als dit be- 
kend wordt, gaat Raden Susuruh verder. De weduwe en hare zonen verlaten hem 
niet. Over den berg Eombang, waar aan Raden Susuruh voorspeld wordt, dat hg 
recht oostwaarts gaande een maja-boom vinden zal met bittere vruchten, en hij wordt 
aangespoord daar een stad te stichten, bereikt hij de plaats, waar hg Majapahit 
laat verrijzen. Daarna verjaagt Baiiak wide ook zijn broeder Arya Bangah nit zijn 
rijk. Raden Susuruh trekt nu tegen Pajajaran op. Er heeft een gevecht plaats, 
tusschen Raden Susuruh's en Banak wide's troepen, doch in het eind beslni- 
ten de beide prinsen, Raden Susuruh, die als vorst van Majapahit den naam Bra 



] ) Men z^ slechts herinnerd aan de c^fers door Raffles medegedeeld in zjjn Hlst. of Java, IT, bl. 85 
(ISOl), bl. 86 (1158), bl. 87 (1221), alles in inlandsche jaartrlling. Men zou hier nog andere jaartaUen 
nevens Ininnen plaatsen, doch het zon van geen nat z^n ze te verzamelen of ze te gaan zoeken. Over de 
geschiedenii van het rqk volgens de Javanen vindt men benedtn nog eenige nienwe mededeelingen. 



Hoofdstuk VI. — 93 — AijrrEEKENiNa. 

Wgaya had aaDgenomen, en Arya Baüak wide (alias Siyung wanara)^ samen Jara 
te deelen '). 

Terwijl hier punten van overeenkomst als het vluchten van den toekom- 
stigen stichter van Majapahit naar het oosten^ of het op eenzelfde wijze ver- 
klaren van den naam Majapahit^ veilig zeer onbeduidend of toevallig kunnen 
worden genoemd, daar Pajajaran in het westen, en Majapahit in het oosten lag, 
en de naam van dit laatste rijk, zelfs al zou hij een geheel anderen oorsprong 
hebben % toch door een Javaan zoo zou worden opgevat, zijn er anderen, die zóó 
merkwaardig zyn, dat één bron aan de beide tradities toch het leven moet hebben 
gegeven. De vader van Baden Susuruh, in de Pararaton de schoonvader, wordt 
gedood en hij daarna, terwijl hij den overweldiger toch nog te keer wil gaan, 't 
rgk uitgejaagd. Op zijne vlucht vindt hij een onderkomen, en dit is het eenige 
feit, dat er van vermeld wordt. Onder de lieden, die zich bij hem aansluiten, 
er worden er maar drie genoemd, is een Nambi en een Wiro S), en met een Ba- 
fiak wide 4) maakt hij een afspraak Java te deelen. En mag men ten slotte niet 
vragen of hetgeen ongelukkig van de oorkonde van Qaka 1216 verloren ging, be- 
halve meer, niet bevat moet hebben een zelfde proclamatie als in de babad Siyung 
wanara (Bafiak wide) uitvaardigt om te voorkomen, dat Raden Wijaya zich ergens 
20n kunnen verschuilen? Qri Ertarajasa Jayawardhana, de Bra Wijaya van Ma- 
japahit, dorst, dit zegt hij zelf, een stout stuk bestaan met Eudadu, dat in vrijdom 
reeds aan een heiligdom toekwam, te verheffen tot een zelfstandig vrijgebied, 
waardoor dat heiligdom toch schade leed, en hij handelde tegen hetgeen door 
den schenker indert^d was vastgesteld, en moreel althans gedreigd. Hij moet wel 
een dringende reden gehad hebben te handelen als hij deed, en is het dan niet 
waarschgniyk, dat in het ontbrekende vervolg iets moet hebben gestaan, als dat 
hij het dorpshoofd van Eudadu daarom zoo begenadigde, omdat deze, zelfs met den 
zekeren dood voor oogen, toch niet anders had meenen te mogen doen dan hij 
deed, d. w. z. dat het verloren gegane bevel van Qr! Jaya katong niet anders 
was dan wat in de babad Baiiak wide uitvaardigt, dat niemand aan Raden Wi- 
jaya huisvesting zou mogen verleenen, op straffe des doods? 

Men ziet het, dat bij slot van rekening de westelijke en de oostelgke 
traditie van de stichting van Majapahit nog meer punten van overeenkomst bie- 
den, dan men op het eerste gezicht zou kunnen hebben gezegd. 

Stelt men hen beiden tegenover elkander, dan blijkt het, dit deed het 
immers reeds, dat er voor de oostelijke tot staving harer geloofwaardigheid en 

1) In da door Meinsma nitgefreyen proza-omwerking van een babad wordt sl^clits yerteld, dat Raden 
Snsimih Pajigaran teniet doet. Voor hetgeen mt-n lii>r in din tekst lecst, zie men bgy. Raffles, Hiit. of 
JaYB» ir, bL 108. Andure bqzonderh den kunnen bier onvermeld blqyen. 

2) Hoe Toorzicbtig men bg bet etymologiseeren vooral van plaatsnamen zqn moet, werd niet lang ge- 
leden nogmaals door in j in bet licbt gesteld in bet opstel Yogjakarta, Tjdscbr. Ind. T. L. en Vk., XXXVII, 45. 

8) Deze laatste naam doet denken aan den Wirot van de Pararaton. 
4) In de Pararaton de onde naam van Wiranga. 



Höóï'DSttTft Vt. — 94 — AaiïteekenIko. 

dat, terwijl er niets in het voordeel van de westelijke kan worden bijgebracht, 
zooveel kan worden aangevoerd, dat twijfel aan de hoofdzaak eigentlijk geen reden 
van bestaan heeft, en er zou aan die oostelijke traditie over de stichting van 
Majapahit, nu zij beter bekend is geworden, denkelijk dan ook niet getornd worden, 
ware het niet, dat er indertijd op gegevens, waarvan nu hier de waarde nog te 
onderzoeken is, geconcludeerd moest worden, dat Majapahit veel ouder was dan 
de Javanen van Java vertelden. 

Hiermede is reeds in enkele woorden gezegd, dat de nu sedert de laatste 
twintig jaren reeds gangbare voorstelling van een zeer hoogen ouderdom van het 
rijk Majapahit, dat men aannam als reeds in de 9« eeuw bestaande, eene onhoud- 
bare is. Zij is dat inderdaad, en het is niet moeielijk zulks aan te toonen,alzal 
eenige uitvoerigheid daarbij onvermijdelijk zijn. 

De geheele voorstelling van een zeer hoogen ouderdom van Majapahit, 
van het bestaan er van reeds in de 9^ eeuw van onze jaartelling, berust toch, 
nauwkeurig toegezien, slechts op het voorkomen van den naam op een koperen 
plaat, die deel uitmaakt van een stel, dat door Cohen Stuart als n^ II in zyn 
Kawi oorkonden werd opgenomen. 

Deze oorkonde geeft in het begin het jaartal 762 Qaka (840 A. D.) te 
lezen, en aan het slot vindt men er den naam Majhapahit. 

Toen indertijd deze oorkonde voor het eerst bekend werd, ontbraken de 
middelen om haar te controleeren, en het is niet te verwonderen, dat men vindende 
wat men daar vond, gekomen is tot het maken van de conclusie, die gemaakt 
werd. Toenmaals toch kon men niet weten, dat die oorkonde geheel voos is, en 
niet iemand was, zelfs nog jaren daarna, in het bezit van de gegevens om in te 
zien, dat zy dat is. 

Hoever dat evenwel gaat, zy hier, wat de hoofdzaken aangaat, even in het 
licht gesteld. 

Hoe een oude pt^agdsti in elkander moet zitten, werd elders reeds mede- 
gedeeld^). Zulk een stuk is, en zulks is begrijpelijk, daar het officieele acten 
zyn, geregeld ; zulk een stuk draagt ook steeds de kenmerken van zijn tijd, en ook 
dit werd elders reeds opgemerkt, iedere tijd heeft ook in dit opzicht zijn eigen 
kenmerken. De bedoelde oorkonde nu doet zich voor als een mengelmoes uit 
verschillende tyden, ook uit jongeren dan de tyd, waaruit zij zou dagteekenen, en. 
dat nog wel, terwijl zy ons een jaarcijfer geeft, dat op zeer weinige uitzonderingen 
na haast het oudste is dat men op Java aantrof. 

Terwijl straks een overzicht over het stuk in zijn geheel zal volgen, dat 
zal kunnen doen zien op welk eene wijze het in elkander zit, hoe de onderdee- 
len er van op elkander volgen en welke dezen zijn, eerst iets over eenige details. • 

Het stuk wemelt van fouten, die men (thans) dadelijk zien kan, en zonder 

I « » ■ ■ — .—^——^—^^-—^ • •- 

1) Groeneveldt, Catalogu» der Archeologisclie veraameling yan het Bat. Gen. van K. W., 1687, bl. 
865 en Tolgg. 



Hoofstuk VI. — 95 — ku^tEissvsa. 

tw^fel berat het er nog meer, die nu nog niet eens in het oog springen, omdat 
men öf de bedoeling nog niet kan vatten 6f stuit op onverstaanbare woorden. 
Onder die fouten bevinden er zich zeer velen, die wijzen op een vrij laten tijd, op 
een tgd van verval in de taal, en wel dien, waarin het ond-Javaansch reeds tot 
het nieuw-Javaansch overging of overgegaan was, naar het einde dus der Maja- 
pahitsche periode, naar de 14^ Qaka-eeuw, naar een zes eeuwen later. Zie hier 
eenige voorbeelden. 

Reeds de spelling trekt de aandacht. Met lette daarbij niet op het mis- 
spellen van Sanskrit woorden en het verzuimen of verkeerd aangeven der quantiteit. 

De h heeft hare waarde niet meer. Men vindt haar, waar zij niet staan mag, 
en waar zg wezen moest, wordt zij gemist; hannpuha voor anapuka, hurutan voor 
urutan, hawur, hanambangi enz.; omgekeerd umalung in pi. van humalung^ ingan 
voor hingan'^ zoowel het een als het ander ziet men in her aji voor er haji. 

Een schrgfwgze als inarapwl voor marapuy wijst op een uitspraak, waarin 
de t in den tweeklank reeds den boventoon heeft, apwjj apwi, api. 

Een vorm als Itvar voor lor is eerst mogelijk als oud twi = o is geworden, 
want eerst dan kan men o (= oud a + ii) aan wa g\an gelijkstellen, lor (uit ou- 
der laur) is reeds in 't oudste ons bekende Jav. lor. Ook een eigennaam als colika 
kan slechts onder dezelfde omstandigheden civalika worden. 

Lawasang voor lavoas sang, wkasang voor whas sang, tlasinural voor lias sinurat, 
samgetirwan voor samgét lirwan is een nieuwerwetsche spelling. 

Vormen als pararajégj pabebekel, palulumuh zijn oudtijds onbestaanbaar. 

Pinarengökén is oudtijds onmogelijk, evenzeer als een pinarufig waken. Het 
had moeten luiden /^mar^/t^tm^^, en waar rengö tot rungu is geworden, is pinarungokên 
in eerste instantie het vereischte. 

Jong is ook W)okna, niangiseniy lamangghanani (waarin ook n een fout is). 

Kanislhamaddhyamotlama, voor nislhamaddhyamoUama is in een zoo ouden 
tijd evenmin mogelijk. 

Radilya in plaats van adilyaj dus ook ra in pi. van d, is slechts in jongeren 
tgd te verwachten, en wel zou het vreemd zijn, dat men den vorm reeds in zóó 
ouden tijd zou gekend hebben, om hem gedurende eenige eeuwen achter elkander 
niet weer te gebruiken. 

De fouten tegen de grammatica zijn niet onbeduidend. Hier vindt men 
pinarengökén dening pinggir siring, en daar pifiarungwalcen ring pinggir siring, terwijl 
beiden hetzelfde moeten beteekenen. Men vindt een (ka sang makudur, wat 
wezen moet Ika ri sang mah^dur; samberren (met 2 r's) ring glap in pi. van sam* 
bërèning glap; sininghat % sapi, in pi. v. ing sapi; simaning hulun ri campaga naast 
nma sang hyang dharmma ring campaga; pinarengökén ri pdrasamya onmiddelgk 
gevolgd door ring kanislha enz., rengö la in pi. van al rengö; lan lama simanira 
io pi. . van tan lama ri simanira ; lan pdrabyapara sang makilald in pi. v. 
ta» kapdrabyapara de sang malcilald ; lumon angadoh aparö in pi. v. luman adoh 



Hoofdstuk VI. — 96 — AAiïTEEKENiirG. 

aparö] nxangsö ta sira in plaats van manfisöaken] hinanakenira denira in pL hi- 
nanakén denira. £n over het algemeen kan men zeggen dat de kortgevatte stijl, 
men zie bijv. het einde van de pracaslij èn voor den ouden tijd èn voor het oud- 
Javaansch zeer vreemd is. 

Fouten van een anderen aard zijn: sungqang voor sungka, dara voor dura] 
pangkur Uril voor pangkur tawan lirip ; pati voor palih ; cêmpa voor campa ; katanga- 
ran voor kalatiggaran ; kepung voor iépung'^ wapd voor wipali'^ adyun voor angdyun] 
kasambural ing nalar voor kasawur ing nalar ; mindah voor indah ; jwah lasrrM voor 
jah tasmal] karémaknanya voor karmaknanya\ saddhana voor sddhana. 

De datum is niet in orde. De vollemaansdag aangeduid met /tVAi/iancadap 
trekt de aandacht, en deze liihi treft niet samen met een karana Bdlawa^ daar de 
eerste helft van dien dag WiHi en de tweede Bavoa is. Ra moet zijn d, en de 
wuku was, in plaats van Manahil, Prangbakat i). Parwwosa moet zijn parwwega, 
en bago deugt niet, evenmin als piwd^yd goed kan zijn. Ook bevat hij voor een 
zóó ouden tijd te veel termen, en daaronder die men in de opschriften eerst zooveel 
later gebruikt ziet ^). 

De datum is ook niet in overeenstemming met de in het stuk voorkomende 
vorstelijke namen. 

In het begin van 't stuk wordt een andere, eigentlijk geen, koningsnaam 
gegeven dan in het eind. Vindt men achterin gri maharaja Dharmodaya Maha- 
satnbhüj vóórin heet het gri tnahdrdja gri lokapala (wat geen eigennaam is, ook al 
wil het stuk het ons iets later doen gelooven) hariivanggolunggadewa, d. i. Z. M. 
de koning, Z. M. de vorst, de oppervorst uit Hari's geslacht, en dit gevolgd door 
ndmardjdbhiseka, onder dien naam tot koning gezalfd. 

Niet minder fraai is de opsomming van de namen der hooge ambtenaren, 
die hier den vorst dulur. Vindt men, almede in het eind, mwang mahdmantri 
dak^olama, bahubajra, pratipaksasanggaya, wat zijn moet mwang mahêmaniri daksotama- 
bahubajrapralipaksaksaya, en de naam is van één persoon, die indertijd ook man^n' 
hino (mahdmantri i hino) was 3)^ vóórin vindt men dezen naam en dien titel in 
stukken geknipt en bij gedeelten als namen aan drie personen toegekend; men 
leest daar mahamanlri katrini, rakryan manlri hino, dalcsolama (één stuk), rakryan 
mantri halu, pratipaksasanggaya (!) (derde stuk), rakryan mantri sirikan, mahd" 
mahino (een verknoeiing van mdhamantri i hino) (stuk van 's mans titel). Het kan 
haast niet fraaier, althans niet als men daarbij in het oog houdt, dat de hier be- 
doelde personen Dharmodaya MahS^gambhu en Dak^ottamabahubajrapratipak^ak^aya, 
voorkomen in verschillende oorkonden, maar dan ook gaaf, die minstens een 
60 & 70 jaren jonger zijn dan de hier behandelde zich voordoet 4). 



1) Hierop wees Colieii Staart reeds. 

2) Zie mQne opmerking in Groeneveldfs Catalo^s. 

8) Het is voldoende hier te verwgzen naar het reels opgemerkte in Groeneveldt^s catalogni, bL 858 en 359. 

4) Zie t. a. p. 



HoovDOTTTK VI. — 97 — Aantbekening. 

De volgorde der onderdeelen van de oorkonde is absurd. 

Datum; de koningSDaam (op de aangegeveD wijze); naam van het vrijgebied; 
Tiitgednikt met Imah waharu kuti ngaranya, wat beteekenen moet : „(het vrygebied), 
dat Euta heet, en gelegen is op den grond van Waharu''; iets dat in ouder, men 
kan wel zeggen oud-Javaansch, op een andere wijze gezegd zou zijn ; daarop wor- 
den de grenzen er van aangegeven ^). Vervolgens worden er t w e e redenen opge- 
geven voor het maken van het vrggebied; nimiianyan sinuksuk dharmasima swalan- 
tra ikang kuti hana ta enz., zoo heet het eerst, en dadelijk daarop weer: saddhd- 
naning (lees sadhananing) sinuk (naast sinuksuk) dharmasitna ilcang kuti hana tha, teV' 
wgl het woord nimita vreemd gebruikt is. Hierop volgt nu, terwijl men tot den 
datum moet terugkeeren, want mangkana diwaganira is het vervolg van dien sam- 
bandha, waarin niet verteld wordt, waarmede de begiftigden hun vrijgebied ver- 
diend hadden, de reeds medegedeelde opsomming dier drie hooge ambtenaren, oogen- 
blikkelgk weer gevolgd door ikang ulihiranuk dharmasima ring kuti, wat, als het 
hier zin hebben zou, had moeten luiden ikang ulihira (moet zijn nira) sinuksukakén 
of sinukakén dharma enz., öfulih als hulpwoord bevat, iets wat, zoo er in oude stukken 
al eens een enkele maal een voorbeeld van voorkomt, een phenomeen is. Volgen 
de namen van eenige privilegies, waaronder verscheidenen, die men elders slechts 
in stukken van jongere afkomst vindt, en waaronder men ook aantreft kadyang^ 
gdnmg matyangipi, mati kaUbu, mati tiba, mati sininghati sapi, mati dinmaking macan, 
mati sinahuting uld, mati sinambering glap, ^, sterft onder 'tdroomen, in een put ge- 
vallen, neergestort, door een rund gestooten, door een tijger besprongen, door een 
slang gestoken, door den bliksem getroffen", een stuk uit een eedformulier! De 
opsomming is in haar geheel genomen bespottelijk, en herhalingen ontbreken niet, 
doch het is niet noodig, dit hier in bijzonderheden aan te toonen. Daarna wordt 
er weer een vrggebied genoemd, dat te Gampaga, zonder dat het blgkt wat er 
mede geschied is of mede geschieden moet. De pericope wordt ingeleid met mu- 
wah ana ta simaning hulun^ als oud-Jav. opgevat, „en er is een vrijgebied van een 
onderdaan"; 's mans naam wordt niet genoemd. Nog vreemder zou het zyn zoo 
hier hubm als voornaamwoord van de 1« persoon staat, aangezien het dan op den 
vorst zou slaan, en deze zich, zoo al, in oud-Jav. wel mahulun, maar geen hulun zou kun- 
nen noemen. Na de vermelding der getuigengiften, waarin de soort der geschon- 
ken kleedg niet genoemd wordt, en het telwoord sawidji zeer opvalt, wordt er 
op nieuw een plaats genoemd, Hnt, al weer evenwel zonder dat blykt wat er me- 
de geschieden zal, daar dit eerst heel aan het einde der oorkonde aan den dag 
komt, waar vermeld wordt, dat zij aan een der geprivilegieerden vervalt. Een vrij 
lang, zeer afwgkend eedformilier volgt dan, en daarop wordt de acte afgesloten met 
eenige zinnetjes, die belangryke verbeteringen vereischen vóór zg leesbaar zyn, 



1) Mamikululdwd xal wel geljk zjjn «an mamkw-laUwa, maakt een Tleermmihoek; Toor den Torm 
UiUnoa in pL Tan lawalawa zie men boTen. 

Ytik. Bit Gen. ded XLDL 7« 



Hoofdstuk VI. ^ 93 ^ AijTTEEKsamfo. 

en waarachter iets prijkt wat men den titel van het stuk zon kannen noemen, 
i/l prasasli ring latjiy pavisamapta tlasinuraij ring niajhapahit. 

Wie na deze uiteenzetting het stuk zelf nog eens inziet, zal tot de eon- 
closie moeten komen, dat al werd er hier reeds op veel gewezen, nog geenszins 
alles is genoemd, wat in deze pra^asli^ althans haar plaatsende in den tijd, waar- 
uit zij naar hare eigen mededeeling moet da;: teekenen, gisping zon verdienen. Het 
stuk is, zooals reeds werd gezegd, voos, tot in de hoogste mate, kan zooal^ liet 
daar ligt, onmogelijk afkomstig zijn uit 762 Qaka, en dient dus als een onecht 
stuk gebrandmerkt te worden. 

Terwijl dit hier dan ook nogmaals geschiedt >), kan het ter voorkoming 
van verkeerde opvattingen evenwel zijn nut hebben er op te wijzen, dat het mo- 
gelijk is, dat men bij het vervaardigen er van gebruik maakte van een of meer 
oudere oorkonden. Dit is zelfs zonder twijfel gebeurd, want hoe zou men anders 
aan die namen zijn gekomen, maar hetgeen er werd overgenomen, werd zoo ver- 
knoeid, dat men, als men niet wist wat er werkelijk staan moet, dat ook niet 
ontdekken zou. In de uiteenzetting werden daarvoor de voorbeelden reeds ge- 
geven, maar er werd tevens ook reeds op gewezen, dat de vervaardiging er van 
moet hebben plaats gehad in het latere gedeelte van den Majapahitschen tijd, 
daaronder nl. verstaande wat ik als zoodanig reeds elders daarvoor aangaf, de 
periode van Qaka 1200 — 1400, doch als men de opgesomde reeks van fouten na- 
gaat, en dezen bijv. eens controleert met wat n<*. IV van Gohen Stuart*s Eawi 
oorkonden (uit Qaka 1310, 1317 en 1318) te zien geeft, dan zal men moeten toe- 
geven, dat, al is wat men daar ziet een geheel andere taal dan die van n^ II, het 
opgelezene, dat voorkomt in een kader, waarin het niet behoort ^), juist passen 
zou in eene taal als die van n**. IV is, terwijl de fouten van anderen aard het 
weer duidelijk in 't licht stellen, dat n\ II niet is een oorkonde van oudere dag- 
teekening, slechts in een zooveel lateren tijd gecopieerd, maar wel een soort van 
later maakwerk van de alleronbeholpenste soort. 

Voor het doel, waarmede hier zoo uitvoerig reeds bij deze oorkonde werd 
stil gestaan, is het volstrekt niet noodig om ook een onderzoek in te stellen naar 
de reden, die tot de vei vaardiging van bet stuk aanleiding zou kunnen hebben 
gegeven. Ook al zou het nooit blijken uit wat drijfveer men er toegekomen is 
het stuk te maken, en het is zeer waarschijnlijk dat dat nooit gelukken zal, met 
het aantoonen van de grove onwaarheid, die in het stuk schuilt, en de tevens mo* 
gelijk gebleken bepaling van ongeveer den tijd waarait het stuk wel kan zgn, 
en zijn moet, valt er op den zin, waar het hier op aankomt, een geheel ander licht. 



.. *< 



1] Men zie bjv. Not Bat Oen XXIV (1886), 43; Oroeneveldf s Catalo^ns bl. 358, en m|jn Jaympat in. 

2) Wat het kader eeniitszins hal moeten zijn, kan mm opmiken nit hetgeen in mgn Jayapattrm op- 
gemerkt werd oyer de taal der prafatti*B van Mpn Sindok; aan dezen vortt fnngen Mpn Dakfottamahihaba- 
jcapratipakiakfaya en Mahft9ambhn vooraf, en dan zon men, daar deze laatste ona reedi een goed eind in de 
^ (^aka-eenw voert, ongeveer nog een halve eenw temg moeten gaan. 



HoOfi>9TüK VI. — 99 — Aa 



Die zin is de Uuitste ran het stuk, boren reeds als de titel er ran ge- 
qnaüficeerd. 

Immers vervaardigd in een tijd, dat Majapahit werkelijk reeds bestond, kan 
het geen bevreemding wekken, dat men er dien naam, en dat wel zooals hg er 
voorkomt, in aantreft. Die laatste zin van het stnk, die met het stuk wel ver- 
band hondt, doch er geenszins mede samenhangt, en achterwege had kannen big* 
Ten, is in werkelgkheid niet anders dan de titel, de kolophon, zooals men dien 
gewoon was achter andere geschreven stukken, blijkens de inscriptien zoo goed 
als nooit achter officieele, te plaatsen. Deze titel van het stuk veihaalt ons nn, 
als men na goed toeziet, zelf, niet dat Majapahit zoo oad is, als de tgd, waarait 
de piagém wordt voorgesteld te dagteekenen, zon aangeven, neen, omgekeerd ver- 
telt hg ons, dat die schijnbaar zoo oade oorkonde een gewrocht is ait den tijd 
dat er een Majapahit was, dat zg geschreven (en gemaakt) werd, toen Majapahit, 
dat daarom volstrekt niet oud behoeft te zijn, reeds bestond; hij vertelt on^. met 
andere woorden, niet dat Miyapahit oad is, wèl dat de oorkonde jong is, en daar- 
mede vervalt de eenige basis, waarop de stelling van Majapahit's hoogen oalerdom 
berost, maar wordt alweder iets bijgedragen, waardoor de historische waarde van 
de Pararaton in het licht treden kan i). 

Bleek het na reeds in het voorafgaande, dat dat geschrift vooral in dit ge- 
deelte veel vertroawen verdient, en kon dit worden aangetoond door een verge- 
Igking van verschillende bgzonderheden er van met hetgeen men aantreft in de 
oorkonde van 1216 Qaka, en de gereleveerde Chineesche berichten, ook ten op- 
zichte van den tgd der stichting der plaats in den tijd, dien het boek er voor 
aangeeft, leveren die Chineesche teksten nog het hanne ter bevestiging van de 
jaislheid dier opgave. 

Wie de Notes kent, weet dat hier niets nieaws geopperd wordt. Er be- 
hoeft eigentlgk slechts verwezen te worden naar de noot op bladz. 33 (158) aldaar, 
waar de Heer Groeneveldt hetgeen ons de Chineesche teksten op dit stuk leeren, 
reeds alsvolgt formuleerde: ,Modjopait must therefore have been founded bet ween 
the virit of the Mongol envoy Meng Ch*i, say 1280 (but probably later), and 
the arrival of the expedition in 1293'*. 

Er dient hier slechts dit aan toegevoegd te worden, dat, zooals boven in 
een aanteekening eigenlijk reeds werd opgemerkt, de terminus a quo, 1280 A. D., 
vermoedelgk niet juist genomen is. Is het Ertanagara geweest, die den gezant 
de beleedig^ng aandeed, en daarop wijst uitdrukkelijk hetgeen men in het verslag 
omtrent Shih-pi, Notes, bl. 26 (151), aantreft, en in die noot werd aangehaald, en 
niet minder 's mans doen en laten, zooals in de aanteekening bg Hoofdstuk V 
rdcds uiteen werd gezet, dan moet het strafbare feit reeds hebben plaats gehad 

1) Zooals men net, blijft er geen ruimte over voor een opvatting ali ion de naam Migapahit ia dit 
itnk eenig Terband honden met het jaartal 7 )2. ZelCs al ware de oorkonde, hoe dan ook, van origine er een 
van ondere dagfteekening, ook dan nog kan men er voor Majapahit niets nit afleiden, men sie nog beneden. 






Hoofdstuk VI. — 100 — AAirrEEKh^nNo. 

vóór 1197 Qaka = 1275 A. D. Voorloopig bestaat er geen reden ernstig aan de on- 
juistheid der meeste in de Pararaten gegeven jaartallen, dan daar waar zij duidelijk 
foutief zijn, en tevens verbeterd kunnen worden i), te twyfelen, en ook ditjaaris er 
een, dat in het onderlinge verband, waarin men het aantreft, geen twijfel verwekt. 

Hoe de Heer Groeneveldt tot zyne conclusie, dat Majapahit pas kort vóór 
het komen der expeditie in 1293 A. D. gesticht was, is gekomen, is duidelgk. 
Geen der oudere Chineesche berichten vermeldt den naam, en zou deze wel on- 
vermeld zijn gebleven, zoo Majapahit reeds vroeger had bestaan, en beroemd was 
geweest? Wel is waar zou men tegen het juist gezegde in het midden kunnen 
brengen, dat het desniettemin mogelijk is, dat de plaats toch nog ouder was, dan 
ook die Chineesche berichten doen vermoeden; dat bijv. de Chineezen, in vroegere 
tijden, de streek, waar het lag, niet bezochten, en dat het slechts daardoor on- 
vermeld bleef. Ten bate van deze veronderstelling zij hier zelfs aangevoerd, dat 
de eerste maal, dat de naam in die Chineesche berichten voorkomt, er van ge- 
sproken wordt op eene wijze, die eene vroegere bekendheid met de plaats zon 
doen veronderstellen, zie Notes, bl. 23 (148). Doch men vergete daarbij niet, dat 
die verslagen opgemaakt zijn geworden, nadat de expeditie weer terug was ge- 
keerd, en dat hij hun toen zeker bekend was, en verder, en dat is de hoofdzaak, dat 
Majapahit, zelfs al bestond het reeds in zeer oude tyden, toch niet het Majapahit 
was, waarover hier gehandeld wordt, en dat men te zoeken heeft, zoolang als 
het nog niet het beroemde Majapahit is, wat het eerst wordt na den tyd, die door 
de Pararaten en de Chineesche berichten ons als den vermoedelgken stichtingstgd 
er van wordt aangewezen. 

Aan het voorafgaande dient nog iets toegevoegd te worden, minder evenwel 
omdat er nog iets op te merken valt dat ter zake dienen kan, als wel om hier 
ook te wijzen op nog een paar bijzonderheden, die het voor sommigen zouden 
kunnen doen schyuen, dat er toch sporen van een vroeger bestaan van Majapahit^ 
dan volgens het bovenuiteengezette aanneembaar is, zouden kunnen worden ver- 
meld. Ook by dezen is het daarom van belang hier nog een oogenblik stil te 
staan, terwijl er tevens uit blijken kan, dat zij, hoewel tot nog toe niet ge~ 
noemd, toch geenszins voorbijgezien werden, waar het den schijn van zou kun- 
nen hebben, als er niet even van werd gewaagd. Op zich zelf is het geenszins 
direct onmogelyk, dat, al weten wij het ook niet of niet bewijsbaar, er reeds in 
overoude tijden een Majapahit bestond. Het is bekend dat, waar zeker niemand 
van droomde, zelfs niet, waar uit Cohen Stuart's Kawi oorkonden l, parujar % Urip 
sang sianggll, anale banua i Malaram kamanikan walak Icahulunan, het bestaan van 
eene plaats of land Mataram, ergens in Midden-Java, in het midden der 9« Qaka- 
eeuw ^), sedert 1875 reeds bekend was, het uit de oude opschriften onverwachts 
aan den dag is gekomen, hoe beroemd deze naam, Mataram, reeds in dien tgd 

• 1) Zie de aanteekening bg het Tolgende hoofdstnlc 

: 8) Cobea Stiuurfi Kawi oorkonden I is oit 841 Qaka (919 A. D .}. 



•• 



Hoofdstuk VI. — 101 — AAirrEEKEKiiro. 

was, — men denke aan de verscheidene malen voorkomende formnle sakwehta de- 
Hwte prasiddha tnangraksang kadaiwan cri mahdrdja i mdang i bhümi tnataram, gg 
allen goden, die steeds het rgk van Z. M. den koning van Mëdang in het land 
van Mataram bewaakt i), — en, waar het met dezen eenen naam heeft kannen 
gebeuren, dat hij geheel vergeten werd, of men ten minste er niet dat meer van 
wist, wat er zeker het meest bijzondere van was, waarom zou dit dan ook niet met 
een anderen, met dien van Majapahit, geschied kunnen zijn? Zoolang niet alles 
wat toegankelijk is, of dat nog worden kan, ten deze grondig is onderzocht, en 
zelfs daarna voorzeker nog, blijft de mogelijkheid steeds open, dat het later nog 
eens blijken kan, hoe ook Majapahit, naast Mataram, dat wij tevoren slechts in 
een zoo veel lateren tijd kenden, maar bleek lang vóór Majapahit bestaan te heb- 
ben, zich glorieus op een zeer oude afkomst beroemen mag; maar zoolang evenwel, 
als de redeneering ten deze berusten moet op de ons bekende feiten, en zij daar- 
buiten niet behoeft te gaan, onthoude men zich ervan door een soortgelijk betoog 
te trachten staande te houden wat eenmaal schijnbaar juist geacht moest worden, 
doch dit zonder twijfel, zooals aan de hand van de toegankelijke gegevens bleek, 
niet is. Het onderzoek heeft zich gaandeweg kunnen uitbreiden, maar wat het 
ook opleverde, een nader bewijs, neen eenig bewijs, voor de stelling, dat Maja- 
pahit ouder zijn zou, dan de tgd, dien de Javanen daarvoor ongeveer opgeven, 
werd niet gevonden, wèl zoovele aanwijzingen voor het later bestaan er van, juist 
in den tijd, dat men het verwachten zou 2). 

Op een in vroegeren tijd reeds voorhanden zijn van Majapahit, zou men 
kunnen zeggen, wijst het te zamen als contemporair optreden van den vorst van 
dat rijk met die van Eoripan, Daha, Gagëlang en Singasari, zelfs met Méndang Ea- 
mulan, bepaaldelijk in de zoogenaamde Paüji verhalen. Zulke verhalen zyn er nl. 
voorhanden, en wat ten deze nog meer zou zeggen, men vindt het ook in de Ma- 
leische verhalen van deze soort, die zeker ouder zijn dan de ons bekenden van deze 
categorie van Java. Immers, het is nu eenmaal bekend, dat hetgeen de Javanen 
van Java, en dezen hebben wij hier alleen op het oog, ons van de oudere geschie- 
denis verhalen, maakwerk is, en het zou dus geenszins ongepast zijn, ook in dit op- 
zicht die Javaansche geschiedboeken onjuistheid van voorstelling te verwijten, al is 
nu hetgeen men leest in hunne Pafiji-verhalen, die trouwens in den vorm, waarin 
wg ze kennen, ook al van jongere dagteekening zijn, schier altijd in overeenstemming 
met wat men in de geschiedboeken aantreft. Immers, zoo zou men nog verder 
kunnen redeneeren, men loopt gevaar al evenzeer geloochenstraf t uit te komen, als 
wanneer men bijv. in die zelfde Maleische verhalen den vinger ging leggen op het 
daar ook aan te treffen Mataram, en nog andere namen, die ons elders worden voor- 
gesteld als in Java's geschiedenis eerst in zooveel lateren tijd van waarde 3). Edoch, 



1) OroeneTeldft Catalogus, bL 861. 

2) Zie Tqdsclir. Ind. T. L. en Vk., XXXII, 894. 

8) Zoo yindt men ook liier in de Fararaton, men zie Blechts beneden, tijdens Migapahit prinsessen 



Hoofdstuk VI. — 102 — AANTSEREmiro. 

en dit dient daar tegenover te worden gesteld^ ook in de meesten der Maleische 
Pafij i-verhalen ontmoet men van die voorstelling geen spoor^ en het is mij ook 
niet bekend^ dat men iets dergelijks zou kunnen aanwijzen in de vermoedel^k 
weer oudere Javaausche verhalen van deze soort^ die men bij de Balineezen terug 
vindt. En is dit laatste juist, dan weegt wat die enkele Maleische verhalen ons 
leeren al even weinig als bijv. het voork omen van den naam van dat rijk, als con- 
temporair met het oude Mi^ndang kamulan, in de door Colien Stnart ongelukkig 
slechts gedeeltelyk bekend gemaakte redactie van de Jayalëngkara ^)y een tekst 
die vervaardigd werd in 1758 A. J. = 1831 A. D. Toch past het daarnevens ook 
nog te wijzen op het feit, dat zulk een besluit nog niet van die afdoende waarde 
is als het zou moeten zijn^ aangezien de kennis der Paöji-verhaleU; laat staan dus 
de kiitiek ervan, nog niet reeds zoo ver reikt, dat men uu al in staat wezen zou 
een degelijk gegrond oordeel over dezen cyclus te hebben. 

Van een geheel anderen aard is het argument, dat men zou kunnen putten 
uit eene plaats in de ji^l v^^ls^x: <^Ia^, een bundel verhalen uit de lO eeuw- 
van onze jaartelling, dien Prof. van der Lith, in vereeniging met den Heer Devic, 
in tekst, vertaling en aanteekeningen, io 1883 — 1886, uitgaf, men zie aldaar 
op bl. 150, en in de aanteekeningen bl. 231 en volgg. 2). Levert de tekst 
daar in een verhaaltje van een zekeren Abu Thfihir van Bagdad, die een reis 
naar Zfibej (Java, 6f Java niet) maakte, en een der steden op dat eiland be- 
zocht, voor die stad den naam jj.i;^«, Prof. van der Lith wil daarvoor gelezen 
hebben Jo.U v^* = Majapawid, Majapahit, en ziet er dus dien naam in. In de 
gegeven tgdsomstandigheden was er voor deze hypothese, zooals de schrgver t. 
p. op bl. 232 ook opmerkt, juist aan te voeren, dat men a déjé, prouvé d'une 
maniere qai ne laisse plus de place au doute, que d'après des documents trouvés 
k Java même, il y avait déjè, en 840 un Onttongadéwa — roi suprème — k Madja- 
pahit. Doch hoe nu, nu het aan den dag kwam, dat het eenige stuk waarop de 
veronderstelling gebouwd was, die oorkonde met het jaartal 762 Qaka, want een 
andere, waaruit het af te leiden is, is er niet, niet alleen is van een allooi waarop 
niets te bouwen is, maar zelis maakwerk moet zijn uit den tijd, waarin ook de 
Javanen beweren, dat Majapahit reeds bidstond? De basis voor de hypothese viel 
daardoor weg, de eenige steun, dien zij had en die een hechte scheen te zijn, ontbreekt 
haar nu, terwijl, in verband met andere feiten, er toch indirect weder een nieuw 
bewijs geleverd worden kon, nu niet voor de onjuistheid van de berichten der 

met den naam Bhre Pigang en Bhre Mataram, waaruit tegeu de geloofiraardigheid van de berichten io dit ge- 
■chrift toch ook geen wapen kan gesmeed kan worden. 

1) Bjjdr. T. L. en Vk., van N. I., I, bl. 44 en volgg., en IT, bi. 161 en volgg., gestaakt, zooals dv 
overlevering is, omdat men znlke referaten van minder belang achtte. In de Javaansehe letterkunde bestaan 
er drie verschiUende Jayalèngkara's, die aUen weer in verschillende redaetiea voorhanden z^jn. Het zijn de 
Jayaléngka a Pahji, de hier bedoelde tekst; de Jayalëngkara wulang, een zedekundig geschrift; en de pakhn 
(wetboek) Jayalëngkara, aUen drie door Raffles reeds genoemd, men zie zjjn History of Java, If, bl. 439, 441 en 440. 

2) Ook in de werken van het Orientalistea-coogres in 1883 gehouden te Leiden. 



HoopDSTüK VT. — 103 — AAsmseassTSQ. 

Jayanen, wel toot het zeer aannemelijke van een onderdeel hnnner traditien, nl. 
dat hetwelk handelt over de stichting van Majapahit en den tijd^ waarin deze 
moet hebben plaats gehad, en evenmin als men het voorheen geloofwaardig zou 
hebben gevonden, vóór de stelling der hoogere oudheid van Majapahit zich aan de 
beoefenaren der Javaansche letterkunde en geschiedenis moest opdringen, dat de 
tekst van de Merveilles de linde t. a. p. ons den naam Majapahit te lezen geeft, 
zal men er zich thans, nu van die veronderstelling niet meer gesproken zal kunnen 
worden, mede kunnen vereenigen. Ook dan, wanneer men in het overgeleverde 
jj^'j^ een bedorven Majapahit zien wil, is men verplicht tot het aanbrengen van 
verbeteringen, en wie zegt ons in dit geval, waar het juiste blijkbaar nog niet 
getroffen is, of wellicht niet juist de letters, die men wil vervangen, de goed 
gespaarde zijn en de fout in anderen schuilt. Hoadt men daarbij in het oog hoe* 
veel moeite niet alleen in de oude Arabische teksten, maar even goed in de Chinee- 
sehe, de Portugeesche en zelfs de oude HoUandsche, ons de overgeleverde plaatsna- 
men in den Archipel, of men bepale zich tot Java alleen, van Java, geven, en niet 
alleen het boek van Prof. van der Lith geeft daarvan voldoende voorbeelden, dan 
voelt men zich zonder twijfel, met schrijver dezes, huiverig om, zonder meer, alleen 
op het voorkomen van dien plaatsnaam, in een toch zeker bedorven uiterlijk, in het 
genoemde boek, er met den Hoogleeraar in te zien wat hij er begrijpelijkerwgze 
in zocht, ook dan, wanneer men daarbij tevens erkennen moet niet in staat te 
zijn tegenover of naast de z^ne een andere hypothese te opperen, welke de waar- 
échgnlgkheid meer voor zich hebben zou. Hoevele plaatsnamen zelfs in de oudere 
Javaansche geschriften, men neme bijv. die, welke in de Pararaton voorkomen, 
in de namen der daar genoemde leden van het Majapahitsche vorstenhuis, zie 
beneden en den geslachtsboom, zijn nu niet meer, of althans nog niet, terecht te 
brengen, en vreemd zou het zeker niet zijn zoo men er onder de vooral in de oudere 
berichten vermelden aantrof, waarmede dit ook nooit gelukken zal ^). 

Na het verjagen der Chineezen keerden de naar de Maleische landen uit- 
gezonden troepen, welke die waren van wier vertrek in Hoofdstuk V werd ge- 
sproken, eerst terug. Dezen moeten dus ook gedurende den geheelen duur van 
het interregnum van Jaya katong zijn uitgebleven, zoodat zij langer dan acht 
jaren van Java afwezig waren. Dit scliijnt vreemd. Wat zij eigeutlijk verrichtten, 

biykt niet. Ook is het niet eens zeker wat liier met Maliyu wordt bedoeld. In 
de aanteekening bij Hoofdstuk IX moet daarop teruggekomen worden. 

Het in de namen der Maleische priusessen voorkomende Dara (Dara. p^tak, 

en Dara jingga) herinnert aan twee der opschriften van Sumatra, welk in lb89 

en 1891 (zie Not. B. G., XXVII, bl. 28, en XXIX, bl. 83) bekend konden worden 



1) Over de qnaestie yan Migapaliit's vroesrer bestaan deden Prof. van der Litli en Prof. Kern, volgens 
toenmalige conrantenberichten, rich ook nog hooren op het te Stockholm gehoulen Orientalisten-conirret ; de 
werken van dit congres werden tot nog toe bier niet ontvangen. Het laatste ter zake is van der Lith^ 
Nederlandich Oost-.ndië, beschreyen en afgebeeld voor bet Nederlandscbe volk, 2e druk, 189$, J» 401. 



Hoofdstuk VI — VII. — 104 — Aant. en* Vkbt. 

gemaakt, nl. Beschreven steenen Bat. Gen. n^. 53 en 85, waarvan het eene een Dara 
pana en het andere een Dara nayana vermeldt. 

Deze opschriften, die van West-Snmatra afkomstig zijn, luiden voluit, no. 53 ! 
anumodandnda tnahacendpali pamdnan hhagi Uninda dara panu gharininda pi ampuku 
külus, hangjaya su . , . (bewijs van hulde van den Generaal Pamanan aan zijne 
moeder Dara panu, de gemalin van Z. M. Seigneur Külus (of Tfilus), overwinnen- 
de ...), en n®. 85 ; caüya bhagi dara nayana sampangkagambuddhandm hhawali 
(caitya voor Dara Nayana ... die tot inzicht is gekomen ?). Een derde soort- 
gelijk opschrift (Beschr. steenen B. G., n». 65) luidt: anumodandnda mahdsenapati 
pamdium ekalabira bhagi anakda prajhawardhani (bewijs van hulde van den Generaal 
Pamdnan ekala, bira (?) aan zijne dochter Prajnawardhant), en een vierde uit dezelfde 
streek (Beschr. steenen B. G. n^. 84), dat eenjaartal levert : swasti sakawarga atita 1294 
(of 1194, zie t. a. p. Not. XXIX, ook 't cijfer 4 is onzeker, daar het een 5 zou 
kunnen zijn) bulan asuji cuklapaksa trayodaqi manggala wara sana talakala (lees: 
tatkala) caitya bhagi sira .... (Heil, Qakajaren verloopen 1294 (of 1194) Asuji- 
maand, den 13cn van de lichte helft van de maand, zevendaagschen weekdag Dins- 
dag, toen (daar) te dier tijde (is) de < ailya voor .... (opgericht)). De dubbele on- 
zekerheid in het jaartal maakt het onmogelijk den datum door berekening vast te 
stellen. Is 1194 (of 1195) de juiste lezing, dan valt dit opschrift, en ook die ande- 
ren (?), op een merkwaardige wijze geheel samen met de pamalayu, 1197 — 1215 Qaka. 

Het in de vertaling onvertaald gelaten dewa zou een stuk van een naam 
kunnen zijn, terwijl het Marmadewa, een der namen van den ratu ring Malayu, die 
ook Tuhan Janaka en Aji Mantrolot heette, en de zoon was van Dara Jingga, 
dwingt om te denken aan het warma in den koningsnaam (vermoedelgk beter -namen) 
van de andere inscripties van West-Sumatra, die beneden, bij Hoofdstuk IX, nog 
eens in herinnering gebracht moeten worden. 

De kidung, die Jaya katong tijdens zgn gevangenschap gedicht heet te heb- 
ben, de Wukir polaman, schijnt verloren te zyn gegaan. Men ziet, dat ten opzichte 
van zyn uiteinde de Ghineesche berichten en de Pararaten verschillen, Notes, bl. 
28 (153), en Pararaten, bl. 24, reg. 32. Met de plaats, die genoemd wordt als 
die waar h^ gevangen zal, Junggaluh, is wellicht dezelfde bedoeld als door mg, 
zooals elders werd medegedeeld, Tgdschr. Ind. T. L. en Vk. XXXII, 394, ineen 
opschrift werd aangetroflfen, en door Dr. R. D. M. Verbeek, Not. B. G. XXVII 
(1889), bl. 10, onder voorbehoud, vereenzelvigd is met Mégaluh, aan de Brantas-rivier, 
op de grens van Eédiri, tegenover de uitmonding der rivier Béng in de Brantas. 



HOOFDSTUK VII. 

Raden Wijaya, als kaning Kértarajasa. Caka 1216 — 1217 (?). 
Toen werd Baden Wgaya koning (prabhu), in 1216. 



Hooi D8TUK Vn. — 105 — Vert. en Aaitt. 

I^ter kreeg hij by Raden Dara pëtak een zoon, wiens ksatriya-nsoLm Raden 
K'^la gémët was. De beide dochters van Bhatara Qiwabuddha, met wie de Tatar's 
om den tnin geleid waren ^)y nam hij beiden tot gemalin; de oudste woonde te 
Kahnripan, en de jongste te Daha. 

Als koning heette Raden Wijaya Qri Kërtarajasa. [25] Zijne regeering 

dunrde ? jfwur. Zijn ziekte (?)^)- Na zijn dood werd hij bijgezet te 

Antapura. Hg overleed Qaka in 1257 (lees 1217). 

AANTEEKENIN6. 

Uit de oorkonde van 1216 Qaka bleek boven reeds wat Raden Wijaya^s 
koningsnaam was. Hij is hier dus goed opgegeven, met dien verstande evenwel; 
dat hg langer was, en voluit luidde Qrt Kërtarajasa Jayawardhana. Zijn andere 
naam is voluit Nar&rya Sanggramawijaya, een titelnaam, die door de mantri 
hino (een prinses) tijdens Erlangga^ + 950 Qaka^ reeds gevoerd werd, zie Cohen 
Stuart, Eawi oorkonden n®. V, rakryan mahdmanlrl hino cri sanggramavoijaya 
dharmaprasddoitunggadewt. 

Ik heb naast het jaar van den tekst, 1257, tusschen haakjes : lees 1217, 
geplaatst. Als men den tekst vergelijkt, zal men zien, dat hier de sengkaUiy die te 
beginnen met het einde van het vorige hoofdstuk schier geregeld gegeven wordt, 
wordt gemist, zoodat het niet doenlijk is na te gaan of 1257 werkelijk bedoeld 
is. Dat het gegeven jaartal niet juist kan zijn, blijkt reeds dadelijk uit het vervolg, 
het begin van het volgende hoofdstuk. De cijfers loopen, behoudens eenige fouten, 
die gemakkelijk te verbeteren zijn, en zich als zoodanig ook direct laten erkennen, 
het geheele boek door geregeld op, en zoo zou hier tusschen 1216 en 1217 slechts 
een 1216 of 1217 te pas komen. Het laatste is hie/ het aangewezen jaartal, en 
de fout is alleen, dat er een 5 in de plaats van de 1 is gekomen. Wel is het 
bekend, dat een vorst zich wel eens vóór zijn dood uit de regeering terugtrekt, 
en dus eerst sterft na het optreden van zijn opvolger, doch daarvan wordt hier, ter- 
wgl er beneden in Hoofdstuk XI een duidelijk voorbeeld van is aan te wijzen, niet 
gesproken; Kërtarajasa sterft en wordt begraven. In dit geval komt er nog dit 
bg, dat een gedeelte van het onmiddelijk voorafgaande onverstaanbaar is, maar 
met een kleine verbetering, die voor de hand ligt, als Kërtarajasa werkelijk slechts 
maar één jaar prabhu was, hersteld worden kan. Aan het fahun panjenengira gaat 
namelijk vooraf ^r! Kërtarajasa. Neemt men aan, dat er een weglating heeft 
plaats gehad van een lettergreep sa, na de laatste syllabe van dien naam, (orajasa), 
die eveneens sa luidt, dan zou er vroeger gestaan hebben : . . . . ^ri Kërtarajasa, 
saiahun panjenengira, „ . , . . Kërtarajasa. Zijne regeering duurde één jaar'', en 



1) In 't Jay. einayaJtën. 

2) In 't JaT. arëmira awiMn. 



Hoofdstuk VII— Vm. — 106 — Aant. en Vket. 

dit zoa met het jaar cijfer 1217 overeenkomen. Men zie verder ook nog deaan- 
teekening bij het volgende hoofdstak. 

Nog andere fouten in de jaartallen in de Pararaten zijn: bl. 31 reg. 18: 
1343, wat 1333 moet zijn; bl. 31 reg. 29: 1363, wat te verbeteren is in 1353; 
en bl. 32 reg. 3: 1362, waarvoor te lezen is 1372, ook al geven de sengkalor 
woorden wat men in den tekst ziet staan. Men lette er slechts op tnsschen welke 
getallen deze hier als foutief aangewezenen voorkomen, daarbij in het oog houdende, 
dat alle anderen, behalve nog het reeds genoemde sterfjaar van Kërtarajasa, dat 
intusschen naar alle waarschijnlijkheid in hetgeen er inderdaad schijnt te moeten 
staan, hersteld kon worden, geregeld opklimmen, waarbij het 137 . (?) van bl. 32 
reg. 8 nog tot 1373 kan worden aangevuld. 

Meer moeite geven het lahun 14, bl. 18 reg. 11, boven reeds besproken; 
het rong lahun, bl. 25 reg. 27 (te lezen rolas lahun ?)\ en het rong lahun, bl. 25 
reg. 28 (waarvoor evenzeer rolas lahun noodzakelijk is), doch het is waarschijnlijk 
dat wat de tekst geeft, niet in orde is, en men er voor in de plaats heeft te stellen 
wat hier er reeds nevens werd geopperd. 

Op bladz. 31 reg. 17 en 19 zijn de getallen daarentegen in orde, maar is 
de omgeving, waarin zij staan, geschonden; men zie de noten bij de vertaling 
t. a. p., en de aanteekening bij Hoofdstuk XIII. 

In welk jaar de prinsessen Bhre Kahuripan en Bhre Daha, en zoo ook 
Dara pétak, overleden zijn, wordt ook in het vervolg niet aangegeven. Daarop zij 
reeds hier de aandacht opgevestigd, voor zoover de beide eerste personen betreft 
onder verwijzing naar de aanteekening bij Hoofdstuk IX. 



HOOFDSTUK VIII. 

Kala gétnêl, als vorsl Jayanagara. Caka 1217 — 1250. 

Hem volgde als koning Raden Kala gëmét op, onder den naam Bhat&ra 
Jayanagara. 

Qrf (^iwabuddha werd bijgezet te Tumapël, waar het vrije heiligdom den 
naam Pnrwapatapan kreeg. Tusschen de oprichting van dat vrije heiligdom en 
den opstand van Rangga lawe verliepen zeventien jaar. 

Rangga lawe verlangde tot palih aangesteld te worden, doch dat geschiedde 
niet, (en) daarom ging hij naar Tnban en stond hij op, vele gezellen verleidende. 
De Tubanners van den noord lieten zich medesiepen, en volgden Rangga lawe. De 
namen van hen, die hem volgden, zijn Panji Marajaya, Jaran waha, AryaSiddhi, 
Lintang, Tosau, Galatik en Tati; zij stonden met Rangga lawe op. Hij verliet 
Majhapahit, omdat hij een hoogeren rang ambieerde. Mahapati wist hem in 
verdenking te brengen, en gebruikte daarvoor de uiting van Rangga lawe : ^Praat 



Hoofdstuk VUL — 107 — Vertalhtg. 

er maar luct verder v^n, ook in het Parthayajöa i) is er een plaats voor lafhar- 
tigcu* . Men vernam te Majhapahit, dat Rangga lawe opgestaan was; Mahapati 
hxn ::t het aan. Aji Jayanagara binderde het zeer. Die met Bangga lawe waren 
v^gestaan, kwamen allen om, behalve Galatik, die op bevel van Mahapati weer 
afnel. De opstand van Bangga lawe had plaats in 1217. 

Wiraraja vroeg verlof terug te gaan 2) naar Lamajang tigang jam, immers 
Raden Wijaya had beloofd Jawa (met hem) te zullen deelcn. Hij kreeg het ge- 
west Lamigang, noord en zuid, en de drie jurus. Geruimen tijd had Wiraraja er 
genot van. Nambi bleef als apalih (te Majhapahit) ; Sora was déniung en Tipar 
txménggung. Toenmaals was lumenggung minder dan dhnung. Wiraraja kwam niet 
weer te Majhapahit terug, niet van zins in de achtste (moeson-) maand op au- 
diëntie te gaan, (zooals dat anders de gewoonte was). 

Drie jaren na den opstand van Rangga lawe had de geschiedenis met Sora 
plaats. Mahapati klaagde Sora aan. Hij werd door Këbo anabrang uit den weg 
geruimd in 1222. 

(Ook) Nambi werd door Mahapati in verdenking gebracht, maar hg liet het 
niet blgken, dat het tegen hem had; toen hij een goede gelegenheid vond, vroeg 
(Nambi) verlof Wiraraja (zijn vader) 3), die ziek was, te gaan bezoeken. Qri Ja- 
yanagara vond het goed, maar stond hem niet toe lang weg te blijven, doch Nam- 
bi kwam niet terug; hij bleef te Lëmbah, waar hij een kuia maakte, en een leger 
formeerde. Wirar^a sterft dan ^), Aji Jayanagara was (toen) twaalf jaar >) 
koning (prabhu). 

Bergstorting in de Lungge (?) «;, in gaka 1233. 

Daarop de gebeurtenis met den jut^ démung, twaalf jaar 7) na die met Sora. 

De dood van den juru démung had plaats in Qaka 1235. 

Daarop (volgde) de gebeurtenis met Gajah biru, in Qaka 1236. 

Vervolgens die te Mandana. Aji Jayanagara ging zelf ^) mede om de lie- 
den van Mandana tenonder te brengen, in de tweede (moeson-) maand. 

Vervolgens trok hij naar het oosten, om Nambi onschadelijk te maken. Men 
vertelde aan Nambi, dat de juru démung , de palih émhan, tuménggung Jaran lëjong en 
de mantri Parakrama (?) ö), allen reeds gesneuveld waren. Nambi zeide: ,,Samara, 
Dërpana, Tëguh, oom Jaran bangkal, Wirot, Windan, en Jangkung, als men 
(het westen met het oosten) vergelijkt, dan doen de lieden van het oosten hier niet 

1) Een kikawin, 

2) Te gaan waar h\) thnis behoorde, omdat het hem geschonken was, of: vroeg verlof er bezit van 

te gaan nemen. 

8) Zie boveu. 

4) Hier begint het verhaal hü« lan/er hoe abrupter te worden. 

5) Lees roku tahun in pi. van rong tahun.^ 
(J) Of: bergstorting en de Lnngge-episole. 

7) Lees rofas iahtm io pL van rong tahun, ook hier? 

8) In 't Jav. amgawaki» 

9) Behoeft geen eigexmaa m te z^n, en is dat hier vermbedeligk ook niet. 



Hoofdstuk VIII. — 108 — Veetaldsö. 

onder ; het herstelt zich weer, als het ten onder is gegaan ; (en) wie zgn dt [28] hart- 
aders van het westen : Jabang terewes^ Lémbn pétëng^ Ikalikalan bang ; (goed, maar) 
ik ben niet bang, al zet men er 10000 (van zulke menschen) vóór mij en achter ui ij, 
laat het maar zoo ver komen, ik vecht als te Babaf'. De lieden van Majapahit 
kwamen. Nambi trekt naar het zuiden ; Ganding wordt vernield ; de pra^asli wordt 
ingetrokken; Nambi wordt hardnekkig i) nagezet; Darpana, Samara, Wirot, Made, 
Windan, Jangkung, en Tëguh strijden, met Arya Nambi voorop; de Majapahiters 
worden op de vlucht geslagen, en kunnen zich niet herstellen. Jabung terewes, 
Lèmbu pëténg, Ikalikalan bang vechten met Nambi ; hy (?) sneuvelt, (en) alle gezellen 
van Nambi vallen in den strijd; Rabut buhaya abang wordt vernield; de troepen 
van het oosten slaan op de vlucht, en Lumajang valt in Qaka 1238 (weer in 
handen van Majapahit). 

De gebeurtenis van Wagal viel samen met die van Mandana. 

Drie jaar na de eerste geschiedde die te Lasém. Sémi werd onder een 
wilden kapok-hoorn gedood, in Qaka 1240. 

Daarop volgde de geschiedenis met Knti 2). Er waren dharmapulra' s van 
den vorst, pangalasan's aan wie iets veroorloofd was *), een zevental, Kuti, (Sëmi) *), 
Pang^a, Wëdëng, Yuyu, Tafica, (en) Banak; Kuti en Sëmi werden uit den weg 
geruimd, door Mahapati valschelyk aangeklaagd. Daardoor kwam het aan het 
licht, dat Mahapati intrigeerde. Hij werd gepakt, en gedood met celeng's, s); hy 
werd schuldig verklaard aan twiststokerij door valsche beschuldigingen. Toen 
Kuti nog niet gedood was, wilde de vorst zelf o) naar Badandër gaan. Hg ging 
's nachts weg zonder dat iemand het wist: slechts de Bliayangkara's, die juist de 
wacht hadden, toen de vorst heenging, gingen met hem, een vijftien man. Gajah- 
mada was toen belwl bij de Bhayangkara's 7); het was juist zijne wacht, daarom 
ging hy mede, toen de vorst wegging. Toen hij eenigen tijd te Badandër was, 
vroeg een der pangalasan's om terug te mogen keeren, maar Gajah mada stond 
het hem niet toe, omdat er maar weinig volgelingen waren, doch de man stond 
er op S). Gajah mada stak hem overhoop, in het oog houdende, dat (zoo) iemand 



1) In 't Jav sitaiisèk. 

3) Hetgeen volgt is in de war, en de vertaling, hier dus in 't bj zonder, slechts met voorziclitig* 
heid te aanvaarden. 

3) In 't Jav. vnneh »uka, 

4ê) Er moeten er zeven z^n; het is dus waarschjnlijk dat Sëmi overgeslagen is. Uit het vervolg zou 
men evenwel opmaken dat Kuti, die toch de voornaamste onder deze lieden was, eigen tijk alleen dkarmapufra 
was; van daar de interpunctie in den Jav. tekst, die een andere vertaling zou vereischen, hier door de gege* 
vende vervangen, ook om op de moeieljkheid te wjzen. 

5) In 't Jav. maü einelengeeleng. 

6) In 't Jav. anffawaiën. 

7) Te lezen ambëkël ing wong Bhayangkara. 

8) In 't Jav. polaking kataula angiring akédik amakêakèn mulih, «(wat) een handelw^se van een 
dienaar, als er maar weinig volgelingen zjn, om er op te staan terug te mogen keeren" (?). 



HoorDöTUK Vm. — 109 — VERTiLLnro. 

het wel. eens zou kannen vertellen, dat de ahhalara bij den bttyut van BadandÖr 
in hiii«t was, en zoo Euti dat te weten zou kannen komen. Na een pasar-weék 
vroeg Gajah mada (zelf) naar Majapahit te mogen gaan. Te Majapahit vroeg 
hem de amahcanagara waar de bhalara was; hij vertelde hem, dat deze door 
de gezellen van Kati gedood was. Allen die het vernamen, (bleken daarover) 
bedroefd te zijn. Gajah mada zeide (toen): ,, Houdt u maar bedaard; gij wilt 
das Euti niet tot uw heer hebben?'' De toegesprokenen antwoorden: „Wat be- 
doelt gg daarmee, hij is onze heer toch niet". Toen vertelde Gajah mada ein- 
deiyk, dat de abhatdra te Badandër was. Gajah mada zocht daarop bescher- 
ming 1) bij de mantri^B en zy beloofden Euti te dooden, (en) Euti werd gedood. De 
abhatara keerde van Badandër terug, de huyut bleef er achter, en mh (?) 2) op den 
langen duur. Nadat de bhatdra teruggekeerd was, werd Gajah mada uit zijn 
betrekking van békel bij de Bhayangkara*s ontslagen, twee maanden at hij (nu) palapa, 
en daarop werd hij aangesteld tot apalih van Eahuripan, wat hij twee jaar was ; 
en toen Arya Tilam, de patih van Daha, stierf, werd hij in diens plaats daar aan- 
gesteld ; te dier tijde was Arya Tadah palih mnangkubhumi-, deze ondersteunde het 
dat Gajah mada patih van Daha werd. 

[27]. Aji Jayanagara had twee halve zusters, die hg niet wilde, dat met 
een ander huwden, daar hij ze zelf wilde nemen. Daarom vermeden de ksatriya's 
Majapahit; die er gezien werd, werd gedood; hij mocht soms een zijner zusters 
willen hebben. De ksatriyd's verstaken zich 3). De huisvrouw van Tafica ver- 
spreidde het gerucht 4), dat de vorst haar kwaad had gedaan. Taüca werd daarop 
door Giyah mada in rechten betrokken. Toevallig had Jayanagara een bubuh 
(gezwel), waardoor hij verplicht was binnen te blijven. Tanca kreeg bevel het 
(hem) op zgn bed te gaan snijden. Hij sneed er één-tweemaal in zonder gevolg. 
Ug verzocht den vorst zgn kémilan^)n( te leggen. Dit deed deze, het naast zijn bed 
leggende. Nu sneed Tafica (nog eens), en het ging goed, maar tevens doorstak hij 
den vorst, zoodat deze in zgn bed stierf. Tanca werd daarop dadelijk door Gajah 
mada van kant gemaakt. Tusschen de geschiedenis met Euti en die met TaBca 
liggen negen jaar; (de laatste had plaats) in Qaka 1250. 

Hg (Aji Jayanagara) werd bijgezet te Eapopongan, dat de naam Qrngga- 
pura kreeg; in de maand (Was)anta (?). 

Daarna betraden de ksalriya's Majapahit weder. Raden Cakradhara was 
de keuze van Bhreng Eahuripan bij haar swayambara, en werd haar man. Raden 
Euda mörta huwde met Bhreng Daha. Raden Euda mërta stond te Wëngkër, 



1) In 't Jay. ayom. 

8) Wat êu6 hier bedaiden moet, is m^ niet doidemk ; kasub, Woemd, i» yoldoende bekend. 

8) In 't Jay. anpim aJkéiëtan. 

4) In 't Jay. apanmgon, 

5) Veüigkeidskleed ? 



Hoofdstuk VIII. — 110 — Vkrt. en Aax^. 

(en is dezelfde als) Bhreng PramiQwara van Pamotan, die ook Qrt Wyayarajasa 
heette (?). Een zoon van Raden Cakradbara^ Qri Kërtawardhana, stond te Tnmapél. 

AANTEEKENIN6. 

In de aanteekening bij bet vorige boofdstuk werd aangenomen, dat Kérta- 
rajasa (Raden Wijaya) in 1217 Qaksi overleed. Zijn opvolger, Kala gëmët, volgde 
hem dus in dat jaar op. Alles in het begin van dit hoofdstak wijst daarop. By 
den opstand van Rangga lawe vindt men, zie bl. 25, reg. 1 3, gesproken van nin/iA 
siidji Jayanagara; iets lager, reg. 25, staat, als Nambi verlof vraagt om heen te 
gaan, Crl Jayanagara suka] weer iets lager, reg. 31, mangkal angawaki siraji Ja- 
yanagara, om de lieden van Mandana te verslaan, en ook het verband van het 
verhaal, dit in zijn geheel genomen, doet het zien. Da vermelde of aangeduide 
jaren bevestigen het almede, dat 1217 Qaka het bedoelde jaar moet zyn geweest. 
De opstand van Rangga lawe heeft plaats in 1217; het geval met Sora drie jaar 
later, dus in 1220, doch eerst in 1222, dat daarop volgt, wordt hij gedood; en 
Wiraraja sterft dan eenige jaren daarna, als Jayanagara reeds 12 jaar (lees rolas 
tahun) koning is, d. i. in 1229, waarop dan weer volgt 1233, 1234, 1235, 1236 
enz., eene geregelde opklimming. Maar met dit al staat men voor een eenigszins 
vreemd feit. 

Zooals men zich herinnert, had de expeditie van de Chineezen, waarover 
boven reeds gehandeld is, plaats in 1293 A. D.^ verliet zij Java weer in het einde 
van Mei van dat jaar, en kwamen daarop de troepen, die naar Malayu waren 
geweest, terug. Eerst na dien tijd kon Raden Wyaya van de eene derMaleische 
prinsessen, Dara pétak, een bini haji maken, en het is volmaakt in orde, als de Pa- 
raraten, zooals het boek dat doet, zegt, dat hij bij haar eerst een zoon heeft ge- 
kregen, na zijne troonsbestijging in 1216 Qaka (1294 A. D.). Die zoon was Kala 
gëmët, dien wij nu hier, reeds in 1217, vinden als zyn opvolger, nadat Kertara- 
jasa in dat jaar overleed. 

Kala gëmët of Jayanagara was dus hoogstens nog pas een zeer klein kind, 
toen hij zijn vader opvolgde, en het maakt dan ook een eenigszins vreemden in- 
druk, als men van hem als regeerend vorst, reeds in dien tyd, en nog eenige jaren 
daarna, gesproken vindt, alsof hij toenmaals reeds zelfbewust was opgetreden. 

Toch zoeke men hierin niets tegen de geloofwaardigheid van het boek. 
Ook hier kan weder gewezen worden op een zekere en opmerkelijke juistheid 
van de berichten der Pararaten, ook omtrent dezen vorst, terwijl daarby een zeer 
merkwaardige tegenhanger van het hier aangetroffene, als kind reeds optreden 
van een vorst, uit de geschiedenis van Java, zij het dan ook uit lateren tyd en 
nit een andere gedeelte van het eiland, in herinnering kan worden gebracht. 

Voor het eerste is het slechts noodig hier nog een gedeelte uit de oorkonde 
van 1216 Qaka te citeeren (plaat 106, de laatste woorden, en het vervolg), en 
daarbij even stil te staan. 



Hoop^HTüK Vin. — 111 — Aanteekekino. 

Meri vindt daar: haywa (an kumaya (Ha) tnakèn lurunyanugraha pdduka 
^ fiinhdi'dfa amagehakén ri kaswalaniranikang sUna ri kudadu, inkang kdla mang- 
Hühivakèn ta samasanak ri kudadu ri crl mnharnja pasekpugeh 1), ma sü, lOy tr^ihan 
i-djay : % takryan bini haji, mdy süy 8, kinapalanira,ci'ijayanagaraytndsü,4:,mwang 
sa$u li/rt katriniy rakrydn manin hino, ma sü ma 4, rakrydn manlvi sirikan^ ma 
sA ma Aij rakryan maniri halu, ma su ma 4, umingsar i paramaniri rifig pakirakiran, 
sang prdnardjay ma su md 4, sang nayapali, ma su ma 4, maka/frumuka sang 
aryyd wirdjay wineh pasék, md sü 1 (?) md 4 mwang sang wyawahdra [wyd] w i cche^ 
daka, samgél (t irwan, md 10, samgel jamh[i), md \0, samgél (11b) pamwafan^ md 
10, pungkwi padlégan, ma 10, mwang rdma Ipi siving, ri llnsning maweh pa$ak^, 
ri landa rakryan makahchan^ mwang rama tpi siring, somilu ri kasusulmnikang 2) sima 
ri kudadUf piuarnnah teka snji sangahudnr kadyangganing haydm, hanliga sasiringnya 
satvidhiwidhdnaning tnan(u)s u)k sima ring lagi, ngkane sorning wifdna, munggnhi 
[ni]ng pasabhauy mamüjd la sang wiku salwpfikara ring dikwidik, mangglar bhüfabali, 
mwang yajnd ring dewaidy ri huwusning mamujd mandiri fa sang makudur mwang sam» 
gel ryyayyam tyas, huwus molarasanggha 3), makalambi sangke harèp, amuknmukan 
bandhana, mandélan f)dda 4), hinarepakning mangheyakurug dnak ihdni ngkdne sorning 
turumhuhatty lumlca (12a) s fekang makurug manguyufuyul, manlek guluning hayam 
mamanlingalién hanliga humarep ring krodhade^a, angulu manapalliani, amdngmdng 
sumambat ri sang minangmang ring danguy makaprayojana ri kapralisutaddhanika- 
nang sima ri kudadu y lan hananing amumflnlmuingkiYangniddhamarawa^amari- 
ksirnnakfia mne htém, ika ri dldhani dldha, nihan iingnya enz , d. i. ^Zij moeten niet 
aflaten te waken voor het afgekomen genadeblijk van Z. M. den koning, bevesti- 
gende den vrgdom van het gebied van Kudadu. Bij die gelegenheid boden de lieden 
van Endada Z. M. den koning als pasék pageh (men zou thans bukli zeggen >, 10 
suwarna'f^ en een den koning passend kleed aan; aan de rakryan sèlir {bini haji 
staat er) 8 suwarnas\ aan Qrf Jayanagara, zyn (of haar) kinapatan, 4 suwarna*S] 
en aan de 3 mantri's, enz. 

Het trekt hier reeds dadelijk de aandacht, dat bijeen en in de allereerste 
plaats genoemd worden de vorst, Kërtarajasa, diens bini haji en een zekere Ja- 
yanagara, dien men onwillekeurig met hen beiden in verband brengt, en in welken 
men, na kennis genomen te hebben van hetgeen de Pararaton vertelt, dan ook 
direct den daar genoemden Jayanagara, d. i. Kala gémët, den zoon van Kërtarajasa, 
en Eërtarajasa's bini haji, terugvindt. 

In hoeverre dit mogelijk is, en of dat werkelyk zoo is, daarvoor geve ki- 
napalan den sleutel. 

Zooals men reeds weet, is de oorkonde, waaraan ook dit laatste citaat ontleend 
werd, uit 1216 Qaka=1294 A. D., en wel uitgereikt op den ll«i^ September 

1) Er sUat pasëi poiék. 

2) Sr staat •nitam, 

8) Br staat motaratasanga, 
i) Sr staat pdna. 



HOOFDSTTTK Vtll. — 112 — AAirrEEKf:\IN&. 

van dat jaar. Voorts is het boven gebleken^ dat Dara pëtak eerst in Jnii' 1293 
op Java Ran zijn gebracht; en eerst daarna door Raden Wijaya gehuwd. Langli^^^^^ 
hun huwelijk dus nog niet geduurd^ en het zou dus niets vreemds zijn, zoo bier 
ter plaatse gesproken werd van haar eersten kind, en wel juist van dat, waar- 
van ook de Pararaton gewaagt Kinapaian nu doet zich duidelijk voor als een 
afleiding van Impal; kapal is de „vierde'', en als zoodanig zelfs voornamelijk 
de vierde maand van het jaar; kinapaian iets of iemand, waarvoor of voor 
wien de vierde maand reeds verloopen is, of nog loopt, 6f, als men er een tech- 
nischen term in zien wil, bijv. iemand voor wien het offer van de vierde maand 
reeds verricht is. Zonder tw^fel zullen velen hier dadelijk denken aan het bekende 
offer, dat ook in die maand van de eerste zwangerschap der Javaansche vrouwen 
wordt gebracht, doch het is geenszins zeker, dat dit juiste is. Men zou hier voor 
het bijzondere feit staan, dat een kind reeds voor zijn geboorte, en dat vrg lang 
daarvoor, al een naam zou hebben ontvangen, en beschouwd zou zyn als een be- 
langrgk persoon, en het is daarom waarschijnlijker om vooralsnog er iets anders, 
in een 2elfden trant, in te zien, en wel dat het jongetje reeds vier maanden oud 
was, en, toen reeds beschouwd als toekomstige troonsopvolger, en dan ook om 
die reden, deelde in de eerbewijzen den vorst en zijne familie, en den verder ge- 
noemden hoogen ambtenaren bij die plechtigheid bewezen. Doch middelerwgl kwam 
dan toch aan het licht, dat werkelijk omstreeks den tyd, dien de Pararaton daar- 
voor aangeeft Raden Wijaya, toenmaals reeds Eértarajasa, uit een hini haji, een 
zoon geboren was, die, en daarop komt het hier wel aan, ook den naam van Jaya- 
nagara heeft gedragen. 

Wat het tweede betreft zij de lezer herinnerd aan wat er in Bantën heeft 
plaats gehad, omstreeks den tijd dat de Hollanders voor het eerst deze gewesten 
bezochten. Het voorbeeld, hier aan te halen, is dubbel merkwaardig, omdat in het 
genoemde rijk, onmiddelijk achter elkander, twee kinderen aan de regeering 
zgn gekomen, het eene volgens het verhaal op negenjarigen leeft^d, en het andere 
als een pasgeboren zuigeling. 

Hieronder volgt in 't kort wat men over de krooning dier beide bedoelde 
Banténsche vorsten aantreft in de (grootere) sajarah of hahad Bantën ^). 



1) Over deze b4iAad Bantën zie men de noot op bL 426, in mqn opstel Yogyakartt, in T^dschr. 
Ind. T. L. en Vlc., XXXVII. Deze babad is een hoogst merkwaardig boek. Behalve de bijzonderheden, 
waarop ik t. a. p. reeds wees, z\j hier nog even aangestipt, dat men er de genealogie der vorsten van 
Mataram, en de opkomst van dat rqk, meteenige eigenaardige afw^'kingen, in beschreven vindt op een zelfde 
w^ze als in de Babad tanah Jawi. Daar het boek naar alle waarschjnl^jkheid in 1662/63 A. D. geschreven 
werd, leert men er dns ook uit, dat dat gedeelte van die laatste bt^d toenmaals reeds een vasten vorm 
had aanfl^enomen, iets wat met het oog op de vraag in welken tgd het eerste gedeelte van de Babad tanah 
Jawi z^n beslag gekregen heeft, van zeer veel gewicht is. Zoo is ook de beschrqving van het gezantschap 
naar Mekka, dat voor Bantën den eersten soltanstitel haalt, zeer lezenswaardig, al ware het alleen om de 
naiviteit, waarmede het verhaal wordt gedaan. De cqfers hier ter aanduiding van de zangen gebruikt, gel- 
den niet voor alle exemplaren, omdat de verdeeling in 't begin van het boek niet in alle exemplaren dezelfde ia» 



Hoofdstuk VIII. — 113 — Aanteékening. 

Als Molana Yusup gestorven is, volgt hem Molana Muhamad op. Deze brengt 
in niets wat door zijn vader ingesteld was, verandering. Hij bevordert het geloof 
(den islam) zeer, door boeken te laten afschrijven, en dezen tot \mkap \e maken, 
en gaat in den leer bij Pangeran Kasunyatan, waarbij hij zijn rang van vorst geheel 
op zg zet, zoodat dit te Surasowan spreekwoordelijk wordt. Ondertusschen bloeit 
het rgk Bantén zeer. 

(XXIII) Nu vraagt Sandisastra aan Sandirasmi ^) of de mo^na (Muhamad) 
dan werkelijk indertijd zelf naar Palembang len strijde was getogen. Deze be- 
looft aan Sandisastra het thuis in de priwfmi na te zien, daar hij zich niet alles 
even goed herinnert, en 't dan voor te lezen. Hiermede begint hij in den volgen- 
den zang (XXIV), de geschiedenis echter weer iets hooger ophalende. 

Toen Yusup, zoo verhaalt hij, — er wordt slechts gesproken van molana 
gust ij — op sterven lag, voerde de mnnqlnhumi het opperbewind, en nu hoorde 
pangeran Japara (een jongere broeder van Yusup, die zich te Japara bevond) van 
handelslieden, dat zijn oudere broeder (de vorst van Bantën) zwaar ziek was. Hij 
gaat daarom met een groot gewapend gevolg naar Bantën, waar men hem in Pa- 
gébangan een verblijf aanwijst. Spoedig daaroj) sterft Yusup, zoodat Muhamad, 
de pangeran ratu (de toekomstige troonsopvolger), als een klein kind door zijn 
vader wordt achtergelaten. Diens voogden waren de kali van Surasaji ( = 
Surasowan), senapati Pontang, dipati Jayanagari, Wadyaji en Wijamanggala; 
men handelt eenstemmig en alles gaat goed, daar men naar den patih mang- 
kupraja (den mangkubumi) luistert. Nu stelt echter deze voor pangeran Japara 
tot ratu aan te stellen, doch als dit aan den kali ter oore komt, informeert deze 
daarnaar, en het blijkt hem, dat het zoo is. Dadelijk schrijft hij den mangkubumi 
zóó, dat deze begrijpen moet, dat hij er van weet, en tevens denken moet dat 
ook hij toegeeft. Nu zendt de mnng/ndmmi aan pangeran Japara een olifant, opdat 
deze zich dadelijk tot koning zal laten uitroepen. Maar buiten verschenen met 
démang Laksamana *) en den mun fktdnimiy en reeds tot voor de Darparagi 3) ge- 
komen, die aan de overzijde van een rivier lag, laat de mangkubumi hem 
daar een oogenblik achter, om (tegen zijne verwjichting) den kali^ met den klei- 
nen Mohamad op zijn schoot gezeten, daar reeds te vinden, in gezelschap van 
de vier andere voogden, en inziende dat er nu niets meer aan te doen is, bericht 
hg Pangeran Japara dat zijn zoon (d. w. z. zijn neef, Muhamad, de daardoor eigent- 
Igk reeds geinstalleerde nieuwe vorst) hem verbiedt een stap nader te komen op 
straffe des doods, en hem beveelt naar Japara terug te keeren, waarvoor drie sche- 
pen in gereedheid zijn gebracht. Daarop ontbrandt er een govecht, waarbij Dé- 



1) Sandirasmi heet in het boek gewoonlijk Sniidiinnya, rii vertelt. hI^ 't ware in korte Hehetsen, aan 
Sandisastra de geschiedenis yan Bantén. 

2) Z\jn eerste di^^naar. 

8) De naam yaa de alun-alun of een fredeelte daarvan; men vond er de traringiu turunff, en de 
«UuapUm werden er gehoulen. 

Verh. Bat. Gen., deel XLIX. ^. 



Hoofdstuk VIII. — 114 — Aaitteekeniko. 

mang Laksamana sneavelt, en Pangeran Japara overhaast wegvlucht, scheepgaat^ 
en wegzeilt; waarna de krooning van Muhamad tot ratu Surasowan voltooid wordt, 
terwijl de kali de voogdijschap verder aan den mangkubumi overdraagt. 

Nadat er nu vervolgens verhaald is, dat er een Frankenschip (Pérnggi) op 
de reede van Bantën gekomen was, en dit was afgeloopen i), wordt er verder 
(XXV) medegedeeld, dat een verwante van den sultan van Dëmak, Pangeran 
mas, een vroom man, die veel van reizen hield ^), te Surasowan komt. Bij hem 
gaat Bantën's vorst in de leer (aguguru). Bij een zekere gelegenheid vraagt 
deze aan zijnen leermeester, hem op het afioopen van dat schip wijzende, waar 
hij den heiligen krijg zou kunnen gaan voeren, daar hij dat gaarne zouwenschen 
te doen. Pangeran mas wijst hem op Palembang s)^ waar hij op zijn reizen een 
abdan, Soro, had achtergelaten, dien hij hem schenkt, en die hem daar helpen zal 
Muhamad laat een vloot klaar maken, en gaat, hoezeer de mangkubumi het hem ook 
afraadt, er heen, vergezeld van Pangeran mas en den mnngimbumi, terwijl de 
kali met het bestuur belast wordt. Bij zijn vertrek liet Muhamad eene zijner 
vrouwen, de puiri adi mulya, een prinses van Bumi gëhi, vijf maanden zwanger 
achter ^). Men bereikt Palembang, na de punggawa's van de Lampung's, Tnlang- 
bawang, Putih en Sëmangka, opgeroepen te hebben, om Palembang over land 
aan te vallen. Men vaart de rivier op. De Palembangers hebben een vierdub- 
bele benleng van tambesuAiOwi gemaakt. Daarnaast werpen de Bantëners er 
een op. Er wordt hevig gevochten, doch onder het gevecht komt de tijd voor 
het avondgebed (magribj. Muhamad laat een sein geven het gevecht te staken; 
men zal het gebed doen. De vorst is met zijn gevolg op een papattggungan ge- 
klommen. Niemand durft imam te zijn, en daarom is hij 't zelf. Daarna dikir't men. 
Onderwijl vuren de Palembangers steeds, en vooral op het schip van den vorst, 
de Indrajaya, op de papatiggungan mikkende. Een kogel ketst tegen het lansen- 
rek, en wondt den koning en nog een ander. De tnangkubumi vliegt op hem toe, 
neemt hem op, en brengt hem in zijn salon, waarna hij zich in de deur daarvan 
zet. Hij verlaat die plaats niet, maar geeft na drie dagen uit naam van zijn heer 
bevel huiswaarts te stevenen, terwijl Pangeran mas met de troepen blijven zal. 
Te Bantën gekomen wordt er bericht naar de wal gezonden. Oodertusschen is de 
mangkubumi steeds op zijn post gebleven. Daar zendt de kali de boodschap, dat 
er een zoon is geboren uit de puiri van Bumi gëhi. De mangkubumi laat hem 
zeggen, dat hij 't lijk naar de suratnbi van de groote moskee zal brengen, en 



1) Men maakte hierbij kanonnen bnit, waarvan er een dea naam Kalautaka en een ander dien van 
Urang ayn kreeg. Be yoorstelling is dat dat afioopen Tan dat schip een Toeren van den heiligen kqjg ia. 

2) Dit is de bekende Pangeran Dëmak, diea de HoUauders b\j hun eerste verbluf in Bantën daar 
aantroffen, de Junge, Opk »m»t enz., II, 196. 

3) Palembaog wa< dns toeumaala nog niet tot den ulam oTergegaan. 

4) Hier ia ieta weggelaten» over een eveneens zwangere sèlir, nit welke later Wangpadipa geboren 
wordt en door deu loUaa aan Kéntot Dalit waa geachonken. 



Hoofdstuk VIII. — 115 — Aanteekening. 

verzoekt hem daar ook het kind te brengen^ uitgedoscht met alle rijksiDsignien^ 
en zoo wordt dat bij bet lijk, als het ware door zijn vader zelf, oogenblikkelijk tot 
koning uitgeroepen. Voogd over het kind wordt Jayanagara *). Het overlijden had 
plaats (hing manluk ing rahmalingsih) in prabu lepas tataning prang 2). Mnhamad was 
25 jaar oud, toen hij overleed, en daarvan was hij 16 jaar koning geweest. Na 
zijnen dood heette hij Pangeran seda ing Palembang. Dit is wat er van bekend is. 

Daarop volgt nu in Zang XXVI tot en met XXVIII wat met den naam 
paüir wordt aangeduid. 

Eerst wordt er nog iets verhaald van Pangeran Abdullah Kadir 8). Njai 
Emban Rangkung was zijn gouvernante, amongmong, de patih amatigktibumi zorgde 
voor de bestuurszaken, en de gusli kreeg les in het ngaji van den kali. Toen 
de prins (gusti) wat ouder was geworden, overleed de manghtbumi. Dit gaf 
een groote stoornis en nu kwam het bestuur in handen van Njai gCde Wanagiri. 
Zoo ging het een tijd goed, tot men haar den raad gaf te huwen, waarbij men 
het eens was, dat de dipali mangkubumi ^) hare man moest worden. Nu zorgde 
ook deze voor den prins. Hij deed dit op een voortreflFelijke wijze, nooit liet 
hij hem alleen, en hij liet hem alle eer geschieden, die hem toekwam, zelfs wer- 
den de sètonan [sasapUm) gehouden, waarby de mangkubumi dan 't kind vóór zich 
op het paard nam. Het schijnt echter dat dit op den duur bij de edelen niet 
in den smaak viel, daar zoo doende ook aan den mangkubumi herhaaldelijk vor- 
steiyke eer bewezen werd. Het kwam tot eene samenzwering, aan het hoofd 
waarvan pangeran Manggala en panget^an Mandura stonden, en waarin men ook de 
kali haalt, doch op stuk van zaken verricht men uit medelijden met den jongen 
prins (die op den mangkubumi zeer gesteld was) niets. Ten slotte neemt dipati 
Yudanëgara het op zich den mangkubumi te dooden, op voorwaarde dat men 
hem straks tegen den prins, die zeker verwoed zijn zal in bescherming zal ne- 
men. Hy sticht nu brand in de kralan, waardoor de mangkubumi alleen naar 
buiten komt, en daarop afgemaakt wordt, zgn toevlucht eerst nog tot den kali 
genomen hebbende, welke zegt zich, omdat hg een wong pakir is, buiten alles te moeten 
houden. Den jeugdigen prins tracht men te sussen, en men geeft hem toe, dat 
de schuldige te straffen is. Pangeran Kulon, Pangeran Singaraja, Ratu bagus Ri- 
dul en Ratu bagus Prabangsa leggen zich daar niet bij neder. Yudanëgara vlucht tot 
hen, en bij hen sluiten zich ook nog aan Rangga Loleta, Andamohi Kalang, Dira- 
manggala, Singajaya, Kyai Sabandar, Tumënggung Anggabaya en Paöji Jayeng 



1) Ook hier is iets weggelaten over die zelfde sèlir. 

2) 1601 (?), wat wezen zoa 1581 A. D. Zooals men weet, heeft het feit ia 1596 A. D. = 1527 
plaata gehad, Veth, Java, II, 271. De strophe laidt in haar geheel : kang mantuk ing rakmating tik prabu 
lëpas iatatUng prang, kang kapanggik ing aastrane kaumia darma ninilad, sampun dening kaku lamang, 
kang HH kang kaduwur, wut raharja jaman ika. 

8) De jeugdige vorst, 

4) Sr moei das ioiniddrls een nieuwe mangkubumi gekozen zgn. 



Hoofdstuk Vin. — 116 — Aakteekeniko. 

tilam^ die alle zich naar de lagergelegen land begeven^ milir i), nl. naar pasar 
Kapalembangan. Alles wat benedenstrooms van de moskee woonde^ roept met 
hen Pangeran Kilen tot vorst (ratu) uit. Pangeran Arya pëpatih en Pangeran 
(Rana)manggala trekken tegen hen uit (XXVII). Nu had Wijamanggala zich 
bg de opstandelingen^ hoewel in de ilir wonende, juist niet aangesloten. Hg 
tracht naar Saruni te ontkomen. Bij Pulo Dadapan wordt hij door Tudanagara 
achterhaald en gedood, terwijl lieden van Batawi ^) de buit rooven. Dan trekt 
men tegen Bantën op. (XXVIII) Pangeran Ranamanggala en de jeugdige vorst 
zien het gevecht van boven de bolwerken aan. De aanval wordt afgeslagen. 
Daarna komt de pangeran van Jakétra te Surasaji. Hij weet den twist bij te leggen. 
Alle edelen, die zich niet willen schikken, zal hij naar Sulakérta (= Jakëtra) 
medenemen. Pangeran Eilen, Pangeran Singaraja en Tubagus Prabangsa volgen 
hem daarom naar Eatawi. Vier jaar blijven zij daar, dan keeren zij naar Bantën 
terug. De pailir had plaats in lampa -guna-lataning-perang ^), zoo kwam Bantën 
tot rust en weer bij. 

(XXIX) Eenigen tijd daarna wil men nog eens tegen Palembang optrek- 
ken. Het gaat evenwel niet door, omdat de vorst nog zoo jong is. Sumënëpers 
die naar Bantën waren komen vluchten, toen Mataram Madura veroverd had 
zendt Pangeran Ranamanggala enz., om geen ongenoegen met Mataram te krg- 
gen, weer weg; in Mataram worden zy verbrand. Pangeran Pajajaran, en even- 
zoo Pangeran Pringgalaya, en hun volk, krijgen echter wel verlofin Bantën 
te blgven^ als zy daar om een zelfde reden hun toevlucht zoeken, daar zij in fa- 
milierelatie tot het vorstelijke huis stonden. De laatste gaat inwonen bij Di- 
pati Pontang. Enz. ^) 

Beschouwt men hetgeen er uit de regeering van Jayanagara verhaald wordt, 
opmerkzaam, dan zijn er verschillende zaken op te merken, die het waarschijnlijk 
maken, dat er met hem een kind op den troon was gekomen. De een voor de 
ander na, stuk voor stuk, staat men tegen hem op, en bet is een tyd van hevige 
onrust. Toch geldt wel beschouwd het herhaalde verzet niet zijn persoon, maar 
is het meestal gekeerd tegen Mahapati, die intusschen met vaste hand weet te 
regeeren, en zich tot 1241 Qaka staande houdt, zie bl. 26, reg. 14. 

De eerste opstand, waarvan gewaagd wordt, is die van Rangga lawe, die 
palih had willen worden, doch wien dit niet gelukte. Deze opstand schijnt wel 
niet de belangrijkste te zijn geweest, maar heeft voor ons een byzonder belang, 
omdat hij door den dichter van de Rangga lawe vooral met voorkeur behandeld 
is, in het geschrift, dat naar dezen held genoemd pleegt te worden, maar ook den 



1) Vandaar de naam Pailir. 

2) Een reekv namen van opstandelingen is bier overgeslagen; evenzoo de beschrjjving van het gevecht, 
dat volgt, en van inlandsch standpunt belangrgk is. Batavri wordt hier anachronistisch gebruikt. 

8) 1630, Vfu4 Hnhigiran dmk Uigya pirang pailir tampagtma tataning prang. 
4; Het vervolg handelt over de komst van Koen en de gevolgen daarvan. 



Hoofdstuk VIII. — 117 — AAnmBEKEiraiG. 

titel Paüji Wijayakrama voert i). Zooals boven, in de inleiding, echter reeds is 
gezegd; heeft de maker er van de Pararaton veelvuldig niet begrepen. Een der be- 
langrgkste fouten^ die hij gemaakt heeft, is dan ook wel, dat hij die opstand laat 
plaats grgpen onder Kértarajasa^ zoodat, hoewel de lectuur van het geschrift om 
zgne literaire waarde, welke zeer groot is % ter lezing kan worden aanbevolen, er 
toch tevens een waarschuwing bijgevoegd dient te worden, dat het öf niet óf uiterst 
voorzichtig als bron voor Java's geschiedenis te gebruiken is, iets waarvan na het uit- 
geven van de Pararaton, waarop het boek berust, wel geen sprake meer wezen zal *). 

In dit hoofdstuk verkrijgt Bafiak Wide (= Wirarfija) hetgeen hem volgens 
de (oude) afspraak, die hij met Raden Wijaya maakte, van Java toekwam. On- 
lukkig is het niet uit te maken wat er bedoeld is met de tigang juni. Onwille- 
keurig vraagt men zich af of het onder Wiraraja gekomen gedeelte van Java niet 
iets moet zijn geweest als overeenkomen zou met het rijk van Balambangan, zoo- 
als men zich dat gewoonlijk, en niet ten onrechte, voorstelt, al zijn de grenzen er 
van niet altijd dezelfde geweest. 

Over de daaropvolgende opstanden kan niets in het bijzonder worden op- 
gemerkt. Die van Kuti, — mag men hier, al is dit hier een persoonsnaam, de plaats- 
naam Kuti van de geincrimeerde oorkonde n^ II mede in verband brengen? — 
schijnt verreweg de gevaarlijkste te zijn geweest, en moet aan Gajahmada de ge- 
legenheid hebben gegeven meer op den voorgrond te komen. In het vervolg treedt 
hij steeds meer en meer vooruit. De beroemde naam, dien hij ook nu nog bij de 
Javanen heeft, was blijkens hetgeen er in de Pararaton van hem verteld wordt, 
niet onverdiend. Achtereenvolgens fungeert hij onder den vorst van dit hoofdstuk, 
diens opvolgster, en haren zoon, tot hij in 1290 Qaka, dus op een zeer rijpen leef- 
tijd, door den dood wordt weg gerukt, doch men zie hierover verder bij Hoofdstuk 
IX en Xin. 

Jayanagara, die van zins was zijn beide zusters (halve zusters) te huwen ^), 
komt om ten gevolge van een derde liefdesgeschiedenis; ten minste als de op- 
vatting in de vertaling van hetgeen er in het Jav. staat, de goede is. 

Het laatste gedeelte van dit hoofdstuk zal in de aanteekening bij het vol- 
gende, waar opnieuw de juistheid van het door de Pararaton geleverde getoetst 
kan worden, weer blijken van zeer veel belang te zijn. 

G^let op het wederverschijnen der ksalriya'% te Majapahit, en de vooraf- 

1) Deze titel is ontleend aan Zang VII, str. 152: haprd^iaha paffji WffayairaMa, sdmptm imgagtren 
maUk, denira 9ang dwyd„ uni caturoframa, tiddhdugattutyakhui ringt amangku jan>a, tumh^keng Majapar 
At'/. tDotUiya ion enueap panèngranira, fri mdrdja apanji^ Wyayamottama, tindteng tandgara^ ikeng pror 
nd^dnlarering, sami kdwofa^ nra anakrawarü. De inhoud van de Rangga lawe berust op hetgeen men in 
de Pararaton aantreft in Hoofdstuk V, VI, VII en het begin van VIII. 

2) Het boek staat als zoodanig zeer hoog, maar is Teelvuldig zeer zwaar te verstaan. 

S) Eene vergelgldng zou nog verschillende zaken van het gehalte als "het juist in den tekst genoemde 
aan het licht kunnen brengen. 

4) Zie hierbj hetgeen voorkomt in Hoofdstuk X, en de aanteekening daarbj. 



Hoofdstuk VIII — IX, — 118 — Aant. en Vert, 

gaande mededeeling omtrent de verhouding van Jayanagara tot zijne beide halve 
zasters; schijnt het meer aanbeveling te verdienen in de Bhreng Kahuripan en de 
Bhreng Daha, die in dit slot genoemd worden, die twee halve zusters te zien, dan 
Jayanagara's stiefmoeders, de beide weduwen van Kértajasa, die de dochters van 
Eërtanagara waren, en zoo heetten, vergl. Hoofdstuk VI en VII. 

Van de eene, Bhreng Kahuripan, wordt er verhaald, dat zij huwt met Raden 
Gakradhara, die een zoon had Kërtawardhana geheeten, en van de andere, Bhreng 
Daha, dat zij in het huwelijk treedt met Wijayarajasa, immers Raden Kudamërta, 
die te Wëngkér stond, is tevens de Prami^wara (d. i. Parame^wara) van Pamotan, 
die dien naam droeg. Op een andere wijze is de tekst, bl. 27 reg, 15, moeielijk 
te verstaan, en het zal blijken, dat het juist is. 

Tot op bl. 30 reg. 5 is er van geen anderen Prami5wara(of Parame^wara) 
sprake, en de daargenoemde heet dan nog Hyang Paramen wara (op bl. 31, reg. 8, 
10 en 35, evenwel Paramegwara zonder meer), zoodat met PramcQwareng Wëngkër, 
bl. 28 reg. 35; Prame^wara, bl. 29, reg. 8 (zoo hier te lezen in pi. van Parame- 
^wara), en Prame^wara, den vader van Paduka Qori, bl. 29 reg. 8, één en dezelfde 
persoon bedoeld is, wiens overlijden in 1310 Qaka op bl. 30 reg. 19 wordt bericht, 
met de woorden Bhra Prame^wara Pamotan trwkla. In dit laatste ontmoet men 
het Pamotan van bl. 27 reg. 16 weer, evenals men het Wëngkër van ibid. reg. 
15 reeds weerom vond in het Prame^wareng Wëngkër van bl. 28 reg. 35. Louter 
toevallig kan het zijn, maar het verdient toch de aandacht, dat behoudens op 
die ééne plaats, bl. 29 reg. 8, de eerste dezer beide laatste personen (= Baden 
Kudamërta) steeds aangeduid is met Prame<;wara (of Prami<;wara), en de tweede 
met (Hyang) Parame^wara. 



HOOFDSTUK IX. 

Bhreng Kahuripan. Ca/ca 1250 — ? 

Bhreng Kahuripan, eene vrouw, werd koning (prahu) in Qaka 1253. 

Zij had drie kinderen, Bhatara prabhu, ook geheeten Qri Hayam wuruk en 
Raden Tetep; bijnamen van hem waren, als hij xmyang speelde i) dalang Trita- 
raju, tegenover vrouwen (?) 2) Pagër antimun, bij de scherts-u'ai/awjf Gagak kata- 
wang, pIs (iwaiet Mpu Jane^wara, als koning bij zijn krooning Qrt Rajasanagara, 
doch als koning ook Bhra sang hyang Wëkasing sukha ; op dezen volgde een 
meisje, dat met Raden Larang huwde, die Bhreng Matahun heette, kinderen had 
deze niet; de jongste was Bhreng Pajang, die huwde met Raden Sumana, alias 



1) In 't Jav. anafmk. 

^) In 't Jav. amadoni, in C. amtuhf^Hh 



Hoofdstuk IX. — 119 — VHtTALnro. 

Bhreng Pagahan, een neef van Bhreng Kahnripan, de vronw van ^) Bhra Gnndal, 
die te Sajabnng werd bijgezet, dat als dharma Bajrajinaparimitapnra heette. 

Daarna had de geschiedenis te Sadeng plaats. Tadah, de palih amangku- 
bhumij was ziek en kon na en dan niet op an.Iientie gaan; hij verzocht ^) Hare 
majesteit hem als mangkuhhumi te ontslaan ^\ wat niet werd aangenomen. Hij 
keerde daarop paar hais terug, riep Gajah mada, en zij hadden een gesprek 
in de paulapa. Hij beval Gajah mada palih ^) te Majhapahit te worden, doch 
nog geen manghtbhumi : ,,1k zal u stennen bij alles wat n lastig wezen zal*' s). 
Gajah mada zeide : , Jk wil nu nog geen pafih worden. Als ik van Sadeng terug 
zal zijn, dan wil ik het wel; als het mij vergeven zal zijn, dat ik ongeluk heb 
gehad, dan zal ik het kunnen doen*'. ,.Goed, mijn jongen, ik zal u steunen in 
alles wat u moeite geeft of la.' tig wezen zal". Toen, toen hij Arya Tadah's be- 
lofte hoorde, herleefde Gadjah madams moed weer. Hij vertrok daarop [28] naar 
Sadeng. Den mantri's araramatiy en ook den apailh amangkiihhumiy werd wijs ge- 
maakt ^), dat Kémbar het eerst voor Sadeng had gelegen. De amangkubhumi werd 
boos, hg zond er buiten-mafi/ri s (op uit); er gingen xiji bêkérBy ieder met vijf man. 
Zij vonden Eémbar in het woud dwars 7) op een omgevallen boom zitten, als zat 
hg te paard, en hij sloeg met S) zijn karwats naar hen, die in opdracht hadien 
op hem te gaan zitten (?) ^). De manlris en de kaki gmt'% de apatih amang- 
kubumiy hadden de opdracht gegeven op hem te gaan zitten (?), omdat hg het eerst 
de lieden van Sadeng omcingeld had. f^n der gezondenen, die hij in het gezicht 
wilde slaan, ontkwam achter een boom. Kémbar zeide : ,Ik onderwerp mij niet, 
ik vecht liever dan dat ik mij aan uwen heer onderwerp". Zij gingen daarop 
heen, en berichtten wat Këmbar gezegd had. 

Grajah mada zweeg, omdat men hem voor geweest was, en de lieden van 
Sadeng al omcingeld waren (?) lO). 

Tuhan Wuruju was een detvaputra van PamëléKahan; als deze met zgn 
zweep klapte, dan hoorde men het overal, en schrikte men er te Majapahit van. 

Elen korten tijd later kwam Zijne Majesteit (zelf) Sadeng ten onderbrengen. 
Drie jaren na de gebeurtenis met Tanca had die met Sadeng plaats, in 1233. 

Daarop had er een aardstorting, die van de Baöupindah, plaats, in 1256. 

Van Sadeng gekomen werd Këmbar bekel van de manlris araraman, en 

* 1) Het if geensziiks xeker dat de TertaliDg hier goed, eTenmio a1« dat de opyatting van bet vooraf 
gaande de jniete sun zja. 

2) In 't JaT. mn^MSwaiëm. 

8) In 't JaT. asoAa, te leien asaloAa.^ 

4) Lees apoHha. 

5) In 't JaT. êodudmnira 

6) In 't JaT. piuadaya. 

7) In 't JaT. oMffauduümdul. 

8) In 't JaT. mnglimbekèn, 

9) In 't Jav. amalingffiha. 

10) In 't JaT. fikü winaAanan Hnèpau^ wong Sad€ng, 



Hoofdstuk IX. — 120 — Vert. en Aant. 

Oajah mada afigahehi; Jaran bhaya, Jalii, démang Bucang, Gagak minge, Jénaren 
Arya Raha kregen allen een betrekking; Li^mbu pötëng werd (umenggung. 

Gajab mada^ de apah'h amnngkuhhumi, wilde geen palapa eten i) : „Als 
(de) nusanfara (de archipel?) onderworpen zullen zijn, als Giirun, Seran, Tafijung pura> 
Haru, Pahang, Dompo, Bali, Sunda, Palcnibang en Tuniasik onderworpen zullen 
zijn, dan (eerst) eet ik pakpa\ De wanins zaten (toen hij dat zeide, er) allen 
(bij) op de pasehan. Kénibar gaf zijn ongeloof aan ('t succes van) Gajah mada te 
kennen, hij werd uitgescholden; Banak smaadde ^) hem ook, al mede zijn on- 
geloof betuigende, en Jabung Terewes en Lëmbn pëtëng lachtten. Gadjah mada 
verliet daarop de pasebauj en vertelde het aan de hhatdra van Koripan; hij was 
verdrietig, dat hij door Arya Tadah dus gesmaad was (?) ^). Këmbar had al veel 
misdaan; Warak werd uit den weg geruimd, en Këmbar evenzoo. 

AANTEEKENING. 

Was het bij de vorige hoofdstukken mogelijk de juistheid van verschillende 
bijzonderheden, ook in hun onderling verband, aan te toonen door middel van een 
belangrijk oud stuk, ook bij dit hoofdstuk, dat de regeering van de eerste vrou- 
welijke regent onder de Majapahitsche vorsten, de eerste koningin onder de ko- 
ningen van dat rijk, omvat, staat ons gelukkig iets dergelijks ten dienste. Het 
stok dat bedoeld is en hier aangehaald moet worden, is het helaas slechts by frag- 
menten voor ons bewaard gebleven opsclirift op den beschreven steen no. 38 van 
het Bataviaasch Genootschap. Voor zoover het hier noodig is, wordt hier daarom 
zoo dadelijk een gedeelte daar\^an medegedeeld, dat, hetgeen van te voren reeds 
moet worden opgemerkt, ongelukkig ook nog vol gapingen zit. Uit het stuk 
steen, waarvan het boven- en het ondereinde verdwenen zijn, is ook nog een 
hoek over het voorvlak weggeslagen, juist in het gedeelte, dat hier vooral van 
belang is. 

Voor het stuk hier echter gegeven wordt, dient de lezer nog even gewezen 
te worden oj) het einde vJin het vorige hoofdstuk. Wat daar te vinden is, dient 
men er bij in het oog te houden, de reden dan ook, dat in het slot van de aan- 
teekening bij dat hoofdstuk, de daar aangetroffen bijzonderheden reeds opzettelijk 
werden gereleveerd. Verder zij er de aandacht op gevestigd, dat in het begib van 
dit hoofdstuk wordt medegedeeld wie de kinderen waren van de Bhreng Kahu- 
ripan, die in 1250 Qaka aan de regeering kwam; daaronder vindt men in de 
eerste plaats genoemd Hayam Wuruk, ook met diens bhiseka Rajasanagara *). 



1) Vgl. boven bladz. [26]. 

2) In 't Jav. amuluhi; de Tertaling is geheel op de gis. 

3) In 't Jav. katn/iahan kabuluhan ; ook hier is het verband weer meer door ondnidel^k. 

4) Wat dezen naam betreft zie men ook b|i het volgende boofdstnk. 



Hoofdstuk IX. — 121 — Aanteekeïniko. 

Het begin van het genoemde fragment-opschrift luidt alsvolgt: 

na, tularaqi, irika diwaganydjTid paduka tri mahdrdja qr\ w(i)snmva {r)ddha 

garamahdrdjadohilra, cri krlardjasajayawardilhanamahdrdjapulnlid, ma nindi- 

tajagadigwardy sakalayawamandalahahjddiparadivipekacchdlra, alwmjadharmmajndna 

yydgesaksa 

tribhuwanotlunggadewl jayawi^nmvarddhanindmardjahhisekd, p-i hbaldrn krlaivorddha" 
namahdr, . . . sahawarata, mwang djnd ftv mnhdlnhmyawaldray dahanagaryyadhisti' 

iananlawikramoU drarupanriiddi . . md . ikdj sajjnnahrdayakumuda- 

^a^angkasadr^dy dyah wiyat, pu windmtirdjdhhiw/idy bha- 

lara cr\ wijayardja(sa)mahdrdjnbaritasahild, iuiring denydjhd mara, ajan- 

ma^uddhabhuwane^ara, jiwanardjynpralistUn, dyah hayam wuruky bhaldra gri rd 

dmardjdbhisckdy makamanggalydjnd bhaldra kriavdjasapatniy buddha- 

marggdnusari lifia .... nlri kalrini rake mantri hino, ri liahnripan^ dyah sondeiy 

rake maniri sirikan dya f^fifar^f, ra/cc mantri halu, dyah ipohy nadahitai 

kalrini kapwa su^-ilasurupay umi , . i tanda rakryan makabehan^ sang wrddhaman- 
Iriy sang dryyadewardjtty pw adilya^ sang dryya dhirardjuy ndrdyana, rake mapalih 

ring nxajhapahity pu gajah maday rake mapalih ring kahuripany pu . . , , rake dmangy 
pw dluSy rake kanuruhany pu bajily rake rangga, pu ba . , mang . ri . , ;yi . . mingg . , 
pu Imbu naUiy dharmmddhyaksa ring .... „(op den kara)na (dag ? ), en onder 
de Weegschaal i), op dien dag is er een bevel gegevep door Hare doorluchtige 

Majesteit de koningin^ de van Z. M. W(i)^nuwarddhana, de kleindochter 

van gara, de dochter van Z. M. Krtarajasa Jayawarddhana^ de 

makellooze wereldheerscheres., die onder één payung heel het land Yawa, Balien 
vele andere eilanden houdt, de in de kennis van wat recht en plicht is zeer 
, de . . . . overschot vernielende, . . . . , , de . . . hoog ver- 
heven koningin der drie werelden, die tot koningin werd gezalfd onder den naam 
Jayawi^nnwarddhant, en tot Z. M. Heer Krtawarddhana (in eene betrekking staat) 
als tot haren . . . ., (?), alsmede door Hare Majesteit de menschwording 
van de groote Laki^mi, die gesteld is over het rijk Daha, de hoog verheven ein- 
deloos machtige (vorstin), (?), die vergele- 
ken worden kan met de maan der hartebloemcn der rechtschapenen, dyah Wiyat, 

Hare Majesteit, die tot koningin gezalfd is onder den naam wi, 

en met Z. M. Wijayaraja(sa) in het huwelijk vereenigd is, welke beide bevelen 
gepaard gingen (met een derde, van een persoon van een iets minderen zang) 
nl. van . . . , den heerscher der bovennatuurlijke reine wereld, die over het rijk 
Jiwana staat, dyah Hayam Wuruk, als koning gezalfd onder den naam Heer Z. M. 

R& , doch voorafgegaan waren door een bevel van Mevrouw de gemalin 

van Ertarfijasa, een volgster van de leer van Buddha, alle welke bevelen eerbiedig 
aanvaard werden door de drie manlri%y rake maniri hino, van Kahuripan dyah Son- 
der, rake maniri sirikan dyah .... ^e^wara, rake maniri halu dyah Ipoh, 

1) Yennoedemk dus in October. 



Hoofdstuk IX. — 122 — AAirrEEKENiirG. 

drie .... (?)^ die allen even schoon en deugdzaam zyn^ en van hen kwamen 
tot de rakrynn ambtenaren^ den oudsten mantri, Arya Dewaraja, pu Aditya, Aiya 
Adhir&ja^ pu Narayana^ rake de palih van Majapahit^ pu Gajah mada, rake de 
patih van Kahuripan^ pu . . ., rake de démang, pu Alus, rake de kanuruhan, 
pu Bajily rake de rangga pu Ba ...... . enz. 

Vier, van verschillende personen afkomstige, bevelen worden er genoemd, 
drie van drie dames, van ieder één, en een van een mannelijk persoon. Die dames 
zijn, zooals men ziet, de over Java, in een zekeren tijd, regeerende vorstin, een 
regentes over Daha en eene gemalin van Kërtarajasa, terwijl de prins, die genoemd 
wordt, regent heet van Jiwana i). 

Gaat men in het bijzonder na wat van ieder dezer personen wordt gezegd, 
dan verkrijgt men het navolgende. 

De regeerende vorstin, Jayawisnuwardhant geheeten, een naam die in de 
Pararaten niet voorkomt, was een dochter van Krtarajasa Jayawardhana, d i. de 
vorige vorst, voorts was zij een kleindochter (duhitra) van een vorst wiens naam op ^ga- 
ra eindigde, en nog iets anders van een vorst wiens naam zonder twijfel Wi^nuwar- 
dhana was. De laatste naam is die van Rangga wuni als ra/u, 1172 — 1194Qaka. 
Rangga wuni was de vader van Kërtanagara, en met een of beide dochters van deze, 
zie de oorkonde van 1216, was Raden Wijaya = Kërtarajasa gehuwd. De eerste 
gaping in het stuk moet dus iets bevat hebben, waarin deze verhoudingen werden 
aangegeven, nl. in 't Hollandsch: Wisnuwardhana's achterkleindochter, Kërtana- 
gara's kleindochter, enz. En aangezien hare moeder, als zijnde een dochter Tan 
Kërtanagara, niet was de Maleische prinses l^ara pëtak, was de in het opschrift 
aangetroffen vorstin inderdaad een der beide halfzusters van Jayanagara. Ook is 
duidelijk welke. Zij was iemand die in een betrekking stond tot Kërtawardhana, 
en kan dus niemand anders geweest zijn dan de Bhreng Kahuripan, die volgens 
de Pararaten in 1250 prab'u werd, en dus hier opnieuw, en van een andere zijde, 
blijkt niet te zijn geweest de weduwe van Kërtarajasa, Kërtanagara's dochter, die 
dien naam ook droeg, maar zijne dochter zie bl. 24, reg. 37. 

De tweede dame, die genoemd is, staat over Daha en zou dus Bhreng Daha 
kunnen wezen. Ook de naam van haren gemaal wordt genoemd, Wijayaraja (sa^, 
dat is PramiQwara ring Pamotan, d. i. Raden Kudamërta, d. i. ook in de Pararaten 
de gemaal van die Bhreng Daha, welke in één adem te noemen is met de Bhreng 
Kahuripan, die ons dit opschrift deed weten, dat Jayawisnuwardhant heette, 
dus de tweede halve zuster van Jayanagara, en weer niet zijn stiefmoeder van 
dien naam. 

De derde vrouwelijke persoon heet slechts de gemalin van Kërtarajasa. 
Daar het niet wel te denken is, dat, zoo deze dame de moeder was van een der 



1) Baar Jiwana hier naast Kahuripan voorkomt, veronderstelde ik indertijd, dat er Jnwana mede 
bedoeld zon zjn. Maandschrift voor de hniselgke opvoedina; en het schoolwezen in Nederlandsch-Indië, I, 
492; dit bl^ft nog mogel^k, doeh op zich zeU xon het ook een vertaling van Kaboripan kunnen wesen, 



Hoofdstuk IX. — 123 — Aanteekeniho. 

beide yoorafgaande vorstiDneDy dit er niet bij vermeld zou zijn, te meer daar althans 
de moeder van Jayawisnuwardhani een dochter van Kërtanagara was, zoo ligt het 
voor de hand er de ons reeds bekende hint haji in te zien, die de moeder was 
van den voorafgaanden vorst Jayanagara, den halfbroeder van de thans regee- 
rende vorstin. 

En ten vierde, is het na het voorafgaande duidelijk^ dat de gaping in bet 
gedeelte, waarin men Havam waruk's naam aantreft, aangevuld moet worden tot 
bhalara cri ra(Jasanagarnn)nmardjdbhiscka. 

Trouwens nauwkeurig toegezien vertelt ook de oorkonde, dat deze vier 
personen tot elkander in een familierelatie staan, als door de Pararaton is aan- 
gegeven. 

De twee eerste dames toch komen er voor als hadden zij gelijke rechten, 
en als waren zij gelijkgradig (zusters), zij geven beiden onafhankelijk van elkan- 
der tegelijkertijd het bevel: Rajasanagara (^Hayam wuruk; bekleedt een mindere 
plaats, en staat dus roet hen niet op een zelfde lijn, maar lager, en kan dus ook 
van een jonger geslacht zijn (inirintj), terwijl aan de derde dame, hoewel in de 
laatste plaats genoemd, toch door de regeerende vorstin de noodige eerbied wordt 
bewezen {makamanggalya), omdat zij zooveel ouder, haar stiefmoeder, is. 

Met de gegevens door de Pararaton hier en in het volgende hoofdstuk ons 
aan de hand gedaan, en deze in verband gebracht met hetgeen het bekende op- 
schrift op bet Manju^ri-beeld aan het licht bracht i), is het thans niet meer 
moeielijk den tijd, waaruit het aangehaalde opschrift dagteekent iets nader te 
bepalen ^). De beide grenzen waartusschen het valt, kannen nu veel nader wor- 
den aangegeven, en als men, wat na al het voorafgaande wel door niemand meer 



1) Het opsclirüt op het Mafijo^ri-becld, dftt Dr. Verbeek in zijne Oadheden ran Jara, onder no. 56S, 
bL 87S, gist dat Tan Panataian afkomstig zon z^n, werd behandeld door Friederich, in Zeit«cbrift der D. M. 
G., XVm, bL 4M en door Prof Kern in Xot. B. 6. XVIII (1880;, bL 106 en rolnr. De door den laatste 
gcgcTcn rertaling loidt: ,De oppenrorst nit Arya-stam heeft het beeld van) Maüja9ri en règle opgerieht in 
het jaar r^f-zet- twee-een M. i. 1265 Taka tot Tenneerdering ran de dkarwa (wet en geloof in Bnddh. zin) 
in den JinllaTa (of in Jinalara/' ; en .Ook beeft bij Adityawarman, in 't rijk beheerd door H. M. de opper- 
koningin, (hij) nit haar geslacht af<tammende, met zni veren zin 'd. i. Troom), ibescaafd) met nitstckeade eicen- 
sek^ipeB, leer Toomaam staatsdienaar, op Javaan«cben boilem in de ^tad van den Bnddha-tempeL een rer- 
wonderijk sehooncn tempel gebouwd, met het doel om zijne onders en verwanten nit het ondermaansch bestaan 
(d. i. nit de kwalen dezer wereld) te voeren tot de vreagde van het Xirw&na'\ .in het ^',t^ jaar 1265". 
Dit opaehnft is door Prof. Kern in verband zebrarbt met 'lie van Batn beragnng en van Pagar mvnng. Te zamcn 
leefCB S9 dat er in dioi tjd in het Mananzkaban'^ehe een Javaansche rorrt heer»chte van dien naam en verwant 
aan het Mi^pahitsclie vontenhnis. Over AtK laatste opschriften, zie men Friederich'* Over inseriptien van 
Java en Snmain voor het eent ontegferd, Verh. Bat. Gen. ^1857.. maar vooral Kern en r>>hen Staart in 
Bijdr. T. L. en Vk. t. X. I., 3e vohrr. VII. 289: VITI. 16: en 4e voIct. I. 159. Het .beheerd door H. 
M. de cpperfcooingin'' loidt in 't Maijjocri-opfchrifl ^riwcararéjayatniicijitrJC-, dit zon ook vertaald knnnen 
worden .vennrcrd door de gemalin van Z. M. den oppervorst", hetgeen een anderen indmk geeft. In de opvat- 
ting sfant ik H!) b§ Prat Kern aan. 

2} Dit net het oog op hetgeen er reed^ gc^<^ ^^ ^ Groeneveldt's Catalogns» bL SS6. 



Hoofdstuk IX. — 124 — AAKTEEKEinKG. 

als iets ondoordachts of onvoorzichtigs zal worden beschouwd^ daarbg ook reke- 
ning houdt met bijzonderheden door de Pararaten verteld, dan kan dit zelfs tas- 
sehen vrij enge grenzen geschieden. 

Hoewel het uit de Pararaten niet blijkt, wanneer de opvolger van deze 
vorstin, die zelf in 1250 Qaka aan het bewind kwam, in hare plaats de regee- 
ring aanvaardde, is het toch uit het volgende hoofdstuk duidelijk, dat hij in 1279 
Qaka reeds koning was. Ook schijnt men te mogen besluiten dat Bali, dat in het 
opschrift genoemd wordt als een onderhoorigheid van Java, in 1256 Qaka, zie bl. 
28, reg. 16, zulks nog niet was. Eerst na de vermelding van het in dat jaar plaats 
hebbende feit spreekt de Pararaten van de door Gajah mada afgelegde gelofte 
Gurun, Seran, Taüjungpura, Haru, Pahang, Dompo, Bali, Sunda, Palembang en 
Tumasik te zullen onderwerpen. Hiervoor moet toch weer eenige tijd verloopen 
zijn, ook al zou het Bali alleen betreffen, en zoo blijkt het dat ook dit opschrift, 
afkomstig van dezelfde vorstin, als op het Mauju^rt- beeld, doch daar niet met 
name vermeld, ook uit ongeveer denzelfden tijd, (Jaka 1265, moet dagteekenen ^). 

Waar het Sadeng, waarvan de tekst spreekt, gezocht moet worden, blijkt 
niet. Mogelijk is het, dat de plaats thans zelfs niet meer bestaat. Daar alles in de 
Pararaton op oost-Java schijnt te spelen, zou men er het Sadeng in de residentie 
Pasuruhan, district Rëjasa, of wellicht nog liever de Sadeng, in de residentie 
Bësuki, district Pugér, voor in aanmerking kunnen brengen. Er dient daarbij ge- 
wezen te worden op het feit, dat in de omgeving van dien berg restanten van 
bouwwerken zijn gevonden, men denke slechts aan Tjandi Këdaton, Kuta Bara, Kuta 
Këdawung, Kuta Krajingan, Gora manis, Pontang, en Kuta Blater, zie Verbeek Oud- 
heden van Java, n^ 647, 648, 649, 653, 654, 652 en 651 (bl. 321 en 322), op twee 
waarvan de jaarcijfers 1260 en 1292 Qaka (Pontang en Tjandi Këdaton) zgn aange- 
troffen, die van het jaar der Pasadeng, 1253 Qaka, niet zoo heel veel verschillen. 
Deze jaarcijfers wijzen het uit, dat althans eenige dier bouwwerken, welken gedeel- 
telijk van jongere dagteekening kunnen zijn, uit de tweede helft der 13« Qaka-eenw 
dagteekenen, en dat in het zuidwestelijk en zuidelijk gedeelte van de residentie 
Bësuki in dien tijd iets meer te doen moet zijn geweest, dan bijv. in vroegere 
dagen daar het geval was. Het kleinste dezer jaartallen valt in de regeering van 
Jayawi^nuwardhant, en, hoewel men zich daarmede waagt op het gebied van zuiver 
gissen, want hier weet men, met de toegankelijke gegevens, goed gezien, toch 
eigentlijk niets positief, onwillekeurig is men geneigd om tusschen het genoemde 
eenig verband te ontdekken, zelfs waar de Pararaton leert, dat de Pasadeng gun- 
stig voor Majapahit afliep, doordat de sinuhun (vermoedelijk de gemalin van de 
vorstin, Gakradhara) Sadeng ten onder bracht, bl. 28, reg. 14 2). 



1) Dat SuQ^^ Pompo en Palembang in den t\jd, dat de belofte van Oajah mada door bemrolgensde 
Pararaton genit werd, inderdaad nog niet veroverd waren, zal beneden nader blaken, zie de aanteekening b$ 
Hoofdstuk X. 

2) Voor Kuta Ke^awnng in verband met bet latere rqk van Balambangan, zie men bet Verslag over 



Hoofdstuk IX. — 125 — Aanteeks(hihq. 

De zooeyeD reeds gereleveerde gelofte van Oajah mada doet ons weten, 
dat op dat oogenblik de er in opgesomde landen nog niet door Majapahit ten 
onder waren gebracht. De tijdsomstandigheilen, zooals zij in het voorafgaande 
geschetst werden, hadden de gelegenheid daartoe benomen, en van een herwinnen 
van verloren terrein wordt in den tekst niet gesproken, want van een opstand 
tegen den suzerein wordt niet gewaagd, wat toch zeker wel gebeurd zon zijn, als 
er een zoo omvangrijke opstand had plaats gehad, dat te gelijkertyd al die ge- 
noemde gewesten in verzet zonden zijn geweest. 

Slechts enkelen der namen zijn bepaald onduidelijk. Seran, Haru, Pahang, 
Dompo, Bali, Snnda en Palembang geven geen moeite; ook Gurun doet dat ver- 
moedelijk niet. 

Met Ham wordt bedoeld het oude rijk van dien naam op Sumatra's oostkust, 
aan den mond van de Rokan i). Pahang ligt op de oostkust van het schiereiland 
van Malaka, en met Dompo wordt men verplaatst naar Sumbawa '). Bali, Sunda 
LU Palembang zijn te bekend dan dat het noodig is er bij stil te staan, en zulks 
is ook met Seran, het eiland (Geram) in de Molukken, het geval, in de nabijheid 
waarvan men vermoedelijk het Gurun heeft te zoeken in de Goram-eilanden, welker 
inlandsche naam in werkelijkheid Gorong is^). 

Zoo resten slechts Taöjung pura en Tumasik, die men, zooals het ver- 
band doet zien, ook buiten Java te zoeken heeft, maar niet geidentifieerd konden 
worden. 

Veelvuldig komt de laatste naam voor in oudere Javaansche en in de Ma- 
leisehe Panji-verhalen. Wat bedoeld is, en waar men het rijk of de plaats van dien 
naam te zoeken heeft, kan slechts gegist wordt. Nergens werd hij door mij nog zoo 
aangetroffen, dat de tekst een voldoende vingerwijzing gaf. Hier zij het vermoeden 
uitgesproken, dat er wellicht de inlandsche naam (Tumasik van (asik) in terug te 
vinden is van het oude Samudra op Sumatra's oostkust ; de laatste naam toch, die 
later op het gebeele eiland (Samudra, Samatra, Sumatra) overging, zou de fraaiere, 
de versanskritiseerde benaming van de plaats kunnen zijn, daar samudra gelijk is 
aan Uuik. Toch dient daarnevens nog op iets anders gewezen te worden, en wel op 
het feit, dat in de Silalatassalatin 4), in Hoofdstuk III, verhaald wordt dat Sang 



een l>abad Balambangan, in Tqdschr. Ind. T. L. en Vk., XXXVII, 388 noot 4; terwjl hier tevens nog eens 
Terwezen wordt naar de Babad Bandawasa, zang XIV, in Not. Bat. Gen. XXXI (1898), bglage VIII. 

1) Zie de aanteekening in bet Aardr. en stat. wdb. van Ned. Indie, artikel Snmatra, bl. 718, waar 
er aan herinnerd wordt, dat men den naam nog aantreft op de kaart van Valenten. 

2) Over Hindn-ondheden gevonden op het eiland Snmbawa, zie men Tjdschr. Ind. T. L. en Vk., X, 
874 en XI, 167. 

3) Zie Riedel, De sluik- en kroesbarige rassen tnsschen Celebes en Papna, Hoofdstuk IX. 

4) Dat is de bekende Si^'arah Malayn, uitgegeven te Singapore in 1830 (? ; een herdruk, bezorgd 
door den Heer Klinkert, verscheen te Leiden in 1884; inmiddels gaf in 1866 (P, zie Aardr. en Stat. Wdb. 
van N. I., deel III, bL 784) Dulaarier nog een nieuwe uitgave van het beg^n, met varianten, in zjjn Col- 
loction des principales chroniques Malayee; vertaald werd de tekst, zoover alt h\j uitgegeven is, doorLeyden» 



Hoofdstuk IX. — 126 — Aakteekenino. 

Nila utama; als hij op Bintan gehuwd eu achtergebleven is, op een zekeren tijd 
zin krijgt Tanjung bëmban te gaan bezoeken en daar gekomen, op een grooten 
steen geklommen, aan den overkant een schoon wit strand ziet, hetwelk men hem 
inlicht, dat de kust is van het uitgestrekte ^iC-l^. De schoonheid van het land- 
schap trekt hem zoo aan, dat hij er zich met zijn gevolg dadelijk heen begeeft, 
wat niet zonder ongelukken gebeurt, zoodat Nila utama zelfs zijn diadeem aan 
de zee moet prijsgeven, maar geland vestigt hij er zich dadelijk voor goed, de 
streek den naam Singhapura gevende. 

Ook Taüjung pura is zeer moeielijk te localiseeren, en wel om dezelfde 
reden. Wel doet hier het noemen van Taiijung pura naast Ham, aan Sumatra's 
oostkust denken, waar men een plaats van dien naam benoorden Deli vindt, maar 
omgekeerd dwingt een gedeelte van Hoofdstuk II der zelfde Maleische kroniek, 
als waarnaar zooeven reeds verwezen werd, ons het elders te zoeken, daar het 
daar voorkomende (en dus beroemde) Tanjung pura zuidelijk van Palembang moet 
hebben gelegen, tusschen Palembang en een zeker gedeelte van Java (er wordt 
van Majapahit gesproken), en van Palembang uit slechts over zee te bereiken was ^). 
Het Tafijung pura in Palembang zelf kan hiermede niet bedoeld zijn, en evenmin, 
naar het schijnt, dat, hetwelk men vindt in Lais (Benkoelen), doch ook tusschen 
het op Bomeo (in Matan, Westkust) en op Java (in Krawang) gelegene is het 
moeielijk een bepaalde keus te doen, daar eensdeels voor het eerste pleiten zou, 
dat het een Maleisch staatje zou vertegenwoordigen, maar naar het tweede de 
opgegeven koers {selalan, zuid) weer wijst 2). 

Onder de voorkomende namen, die schijnen te verhalen, dat noch de oost- 
kust van Sumatra of de streken, die men in de nabijheid daarvan aantreft (Tu- 
masik (?), Ham, Palembang, Pahang op het schiereiland, Tafijung pura (?) ), noch 
het oostelijk gedeelte van den Archipel (Bali, Dompo, Gumn, Seran) op dat oogen- 
blik onder Majapahit's opperbewind gebracht was, mist men den naam Malayu, 
waarheen, zooals Hoofdstuk V vertelde, reeds in 1197 Qaka eene expeditie was 
uitgezonden, die eerst in 1215 Qaka van daar terugkeerde, zie het einde van Hoofd- 
na Mriens dood Raffles in 1821 die vertaling in 't licht gaf; en aanteekeDingen op deze vertaling, die hier en 
daar gew^zigd, niet verbeterd werd, leverde BraddeU in 't Journal of the Indian Archipelago, Vol. V en VI 
(1861 en 1852); voorts zie men over 't boek ook nog Roorda van Ejsinga's Ontwikkeling van het Ma- 
leische werk ^^XJ) JÜ)Um enz., in T^'dschr. van Ned Ind., 1843, 6e Jg., III, bl. 244. 

1) Saièlah kaluwar dan kuwala Palembang lalu hiérlayar ménuju sëlatan ënam hart hutm malam 
jatuh ka Tanjung pura maka rtya Tanjung pura pon kaluwar mhtgalaw^kan bagenda dëngan sarba kahë- 
saran dan kamuligaan dibatoana masok ka nagëri didudukkanna, diyatas singgasana kart^aan dihomuUind 
dèngan sapèrtinay satèlak kadhigaran ka Majapahit bahuwa raja iurun dart bukit Sëganfung itu ada di- 

Tanjung pura maka batara Majapahit pon bërangkat héndak bërtëmu dèngan tang Sapurba fk^yiunj. 

2) In de Hans; Tnwah maakt men de reis van Malaka naar Majapahit steeda over Palembang, Ja 
yakëtra en Tnban, en omgekeerd. Toch is het zeer de vraag of men hieruit iets in het voordeel van het 
Tanjung pura in Krawang mag afleiden , want omgekeerd zou de traditie van den oorsprong van het vontenhuia 
lan Sokadana» oit het Siigapahitsche, weer eerder naar Borneo'a westkiut wqzen. 



Hoofdstuk Et. — 127 — Aaitteekekinq. 

stok YI, en zooals men vermoeden moet, niet geheel onverrichter zake. In het inte- 
gendeel zon men dien naam ook hier verwacht hebben, waar hij nu niet voorkomt. 
Reeds om die reden voelt men zich geneigd de streek; die in het bgzonder den 
naam Malaya zon hebben gedragen^ ook elders op te sporen, dan daar waar men 
hem met de ons bekende gegevens het eerst zou zoeken, d. w. z. niet op de oostkust 
van Snmatra of in den daar dichtbij gelegen eilanden wereld, of op het schiereiland, 
maar op de westkust van het eiland. Daartoe bestaat ook van een andere zijde eene 
gegronde aanieiding, want het bleek, zooals boven reeds in herinnering moest wor- 
den gebracht, dat op de westkust, in de Mënangkabau'sche landen, omstreeks het 
jaar 1265 Qaka een vorst regeerde, die aan de Majapahitschepra6Au t^/n'I verwant 
was, en Adityawarmadewa heette >). Toch stuit men ook hier weder op bezwaren, 
en van de weinige gegevens, die ter beschikking zijn, mag er geen veronachtzaamd 
of verwaarloosd worden. 

Zooals bekend is leveren ook de Maleische kronieken nog het een ander 
over Majapahit's veroveringen. Ten dien opzichte dient er vooral gelet te worden op 
de ^*.lj r ) LU>. en de jktUl 211m; de kroniek van Pasay 2) en de Sajarah 

Mélayn s). 

In het eerste boek wordt vrij uitvoerig en zeer geregeld over Majapahit's 
veroveringen gesproken. De schrijver komt er toe, doordat hij de verovering, en 
zoo den val, van Pasay door de lieden van Majapahit te verhalen heeft. Als de 
aanleiding daartoe wordt het volgende opgegeven. Als Marah Silu Samudra 
gesticht heeft, sticht hij, na de geboorte van zijn zoon Malik-al-Thahir, ook Pasay, 
waar die zoon koning wordt, zijn vader intusschen later ook te Samudra opvol- 



1) WeUicht iqjst ook de naam der princessen, die uit Malaya kwamen, met hun Dara, op die streek, 
zie boYen bg Hoofdstuk VI. 

2) De Hika)rat radja-radja Pasay werd naar een handschrift uit de Raffles verzameling in 184S uitge- 
geven door Dnlanrier in z\jn Collection des principales chroniqnes Malayes. 

S) De oTerige mq bekenden, de Hikayat raja Bafijar dan raja Kotaringin, de Salasilah raja Sambas, en 
de tSalai il ah Kntay, gaven niets van belang. Voor de eerste zg men Yerwezen naar de aanteekening op 
Hoofdstak f, waar de passage die in aanmerking zon kannen worden gebracht, in haar geheel werd orerge- 
nomen; meo viadt er zelfs gesproken Tan Aceh, en de schrjjver is zeer anachronistisch. In de Kroniek van 
Sambas, waarover men zie Netscher in Tydsehr. Ind. T. L. en Vk., I, hl. 1, vindt men slechts: Katurumam 
ytMg aJtam jadi rmja bitar-ièsar didalam siUalah ifU yaitu asalna daripada êong raiu Majapahit, wtaka 
ada^to» gamg raiu Majapahit itu béranakkiM Bratcijaya, maka itulah yang pèrgi kanigèri Sukadana 

(jJtJjLü») duduk di Bamuwa lama maka iyalah yang mëndjadi raja dititu, maka iya bèranakkmm raja 

Porong \è%j^)} enz,, wat niets van beteekenis bevat voor hetgeen hier in den tekst voorkomt, doeh van ge- 
wicht is met het oog op hetgeen men vindt in de Jaran sari Jaran pamsma, zie Not. B. G., XXXI (1893), 
bL 44, en vgL ook Vcth, Bomeo's wester-afdeeling, f, 180 volgg. De Salasilah Katay is een boek van zeer 
jonge dagteekeniog, althans in 't exemplaar van den Heer Tromp, dat mq door Dr. Snoock ten gebmike 
werd afgftitaan Het Javaansch dat er in voorkomt, is dat van den jongsten tqd. De lange pericopen, die 
daar ook Ifijapahit ten tooncele brengen, leveren niets dat hier een opzettelgke vermelding zon verdienen. 
Om dexe SalaaUak zie mea Tiomp in Bqdr. T. L. en Vk. van N. L, 5e Volgr., lil, bL 1, en Snooek. 
tWLhl. 109. 



Hoofdstuk IX. — 128 — AAimnsKEHiKO. 

gende i). Van de zonen van deze^ Malik-al-Mahmnd en Malik-al-Mansnr^ draagt 
de eerste de regeering over aan Ahmad; zijn zoon^ als hij zijn broeder Malik-al- 
Mansur onttroond en verbannen beeft, en deze Ahmad nu doodt dan later zgne 
beide zoons, Sibrahim bapa en Abdaljalil, den laatste, omdat eene prinses van 
Majapahit op hem verliefd geworden was, en hij haar hem misgunde 2). De 
prinses, die eerst niet had willen huwen, had overal portretten van de schoone 
prinsen laten maken, en op het zien van dat van Abdaljalil, deze dadelgk uitver- 
koren. Op haar aandringen had de vorst van Majapahi ^) haar laten gaan, om 
hem te gaan huwen, maar het doel van hare reis ten naastebij bereikt hebbende, 
verneemt zij^ dat hare geliefde door zijn vader is gedood, en verdrinkt zg zich 
met heel het schip, waarop zij zich bevond. De vloot, die haar begeleidde^ keert 
naar Majapahit terug; dadelijk wordt daar tot een expeditie besloten, die, hoewel 
na een hevigen strijd, Pasay inneemt en vernielt (bl. 95). Daarna verhaalt de 
kroniek verder, dat de troepen op de terugtocht Jambi en Palembang aandoen, 
en dat deze gewesten zich goedschiks onderwerpen (bl. 96), en vervolgens (bl. 98), 
dat de vorst van Majapahit besluit tot een veldtocht tegen het gebied van Aeu 
koning van Hujung tanah (^iU A^^a ^K .^l»».) *). Ook deze tocht wordt met 

een gunstig resultaat bekroond, daar de onderhoorigheden zich allen onderwerpen : 
Timbalan, Sia(n)tan, Jëmaja, Bunguran, Sërasan, Subi, Pulaw laut, Tiyoman, Pulaw 
tinggi, Pëmanggilan, Karimata, Bélitung, Bangka, Lingga, Riyaw, Bintan en Bu- 
lang &). Dit behaalde succes had de gezondenen blijkbaar geprikkeld. Nadat men 
zoover gekomen was, begaf men zich naar het vasteland (tanah darat, Bomeo), en 
onderwierp daar Sambas, Mëmpawah, Sukadana, waarop men verder trok naar Kuta 
waringin, naar Banjar masin, naar Pasir, naar Kutay en naar Bëraw, welke staten 
zich allen al evenzeer onderwierpen, en ten gevolge waarvan een twee jaar i^xc) f^%<) 

later die zelfde vloot ook nog veroveringen in het oosten van den archipel ging 
maken, en Bandan, Seran en Larantuka onderwierp, om op den terugreis ook 
Bima, Sumbawa, Selaparang, Bali en Balambangan te vermeesteren, en met zeer 
veel buit thuis te keeren ^>). 



1) Het was deze vorst die daar aan de regeering was, toen in 1846 of 1346 A. D. lbo Bathatlift 
daar landde. 1845 A. D. ^ 1267 Qaka. 

2) Jahalav) si Abdaljalil tiyada ku-hunuh harajaanhu jangan kèhal dan puiri Q^èmhrèneing pon 
jangan ku-përoleA. 

5) De paliA van Mi^apahit heet hier Gajah mada. 
4) Het schiereiland van Malaka, kaap Ronmanië. 

6) De identificaties allen volgens Veth, Java, IT, bl. 133, noot. 

6) Over deze lijst van Majapahit's onderhoorigheden, zie men de volgende literatanr : Dulaurier, 
Journal Asiatique, 1846, 4e Ser., VII, 544; Pynappel, ibid., 4e Ser., VUT, 644; Logan, Journal of the 
Indian Archiepclago, 1848, II, bl. 604, noot; Dulaurier, Journal Asiatique, 1849, 4e Ser., XIII, bL 52S ; 
Dulaurier, Collection des principales chroniques Malaves, 1849, bl. 98; Lassen, Indische Alterthumslrande 
1861, IV, 494; Dr. A. W. de Klerck, Lassen's Geschiedenis van den Indischen Archipel, 1862, bl. 114 volgg.; 
van der Tuuk, in ióid., de aant. ; Veth, De onderhoorigheden ?an Madjapahit, in T^dscbr. v. N. I., 1867, 
I, 88 en 293; Meinsina, Tqdschr. N. I. 1867, II, 96; Veth, Java II, bl. 133 noot 



Hoofdstuk IX. — 129 — Aanteekeniko. 

Waren nu deze beide expedities^ die tegen Pasay, welke de onderwerping 
van Jambi en Palembang in haren nasleep had, en de veroveringstoeht naar de 
landen yan den vorst van Hajnng tanah, die weer verliep in een algemeene 
veroveringsrondreis door den Archipel, zooals men het zon kannen oitdrakken, 
gelakkig afgèloopen, met een derde expeditie door Majapahit naar de boiten- 
bezittingen, bepaaldelijk Snmatra, gezonden, ging het niet zoo voorspoedig. Na al 
die veroveringen gemaakt te hebben meent Majapahit's vorst zich ook meester 
te moeten maken van ^ J J^ (pulaw pércah), — welke streek bedoeld is, big kt 

dadelgk i), — maar ziet tevens in, dat dit met wapengeweld niet zal gelukken en 
er dus een list te baat moet worden genomen, die daarin bestaan zal, dat hg er, 
met een leger, een buitengewoon grooten kerbaw (een wonder-tórftaw), dien hg 
bezat, heen zenden zal, om ter plaatse een wedstrijd te voeren (bl. 101) ^). Men 
begeeft zich nu naar Jambi, trekt het land in naar de bovenlanden van Jambi (hulu 
Jambi) en bereikt zoo Priyangan, waar palih Siwatang ') de troepen laat inhalen, 
maar straks, zijn list stellende tegenover de hunne, met den buffel van Majapahit 
een uitgehongerd buffelkalf laat vechten, dat den buffel voor een buffelkoe aanziet 
en hem door zijn wijze van doen den strgd doet verliezen. Dan van alle kanten, 
na door patih Siwatang en palih Katumënggungan op een feestmaal te zgn ge- 
noodigd, overvallen, worden de Javanen op de vlucht geslagen, en gaan zg huis- 
waarts, waarna het landschap den naam Ménang kérbaw, ,yde buffel werd over- 
wonnen", krggt *). 

Vergelgkt men deze mededeeling met de beide berichten in de Pararaten 
dan zou men juist tot een gedeeltelijk althans tegenovergestelde gevolgtrekking 
komen. Want bevestigt zij eensdeels, dat de eigentlijke veroveringen nog plaats 
moesten hebben na 1267 Qaka, en zelfs eenige jaren daarna, daar zij eerst een 
aanvang nemen, als de kleinzoon van Thahir te Pasay den troon reeds bestegen 
had, onder de nog te veroveren gewesten ook vermeldende die, welke ook de 
Pararaten als zoodanig noemt ^), anderdeels spreekt zij het tegen, dat Sumatra's 
westkust, de Ménangkabau'sche landen, door Majapahit reeds vóór dien tijd ver- 
overd zouden zijn. Integendeel zij worden eerst het laatst vermeld, en men slaagt 
er niet ö). 

1) Wat dexen naam aangaat, lette men er op, dat hq hier niet Toorkomt, f>b een algemeene naam 
ran het eiland Snmatra, maar slechts een gedeelte er yan, en een zeer bepaald, aanw\jst. 

2) Saiëlak hèhèrapa lamaSk maka pikir sang nata êamuwana nighri habit taalok tkiUUnkan Pulaw 
pêreak jugtt yot^g èëhm logt taalok baiklak aku mënuntk Pulatr p^rcak dèngan sasuwatu kikmat ku-tuntk 
mëngadu kërèaw, 

8) p)ym ijM, elder Datn Pérpatih Sëbatang. 

4) Dit selfde verhaal vindt men in een eenigszins afirj kenden vorm, doch niet op Majapahit toegepast, 
in Netscher's Vertameling van overleveringen van het rqk van Mftnangkftbau» nit het oorspronkelijk Maleisch 
vertaald, in Indiseh Archief, III, hl. 68. 

5) Ta^jong pnra en Tumasik zqn onzeker. 

6) Zooala hierboven in 'tlieht werd gesteld, is de opsomming in de Hikajat rajar^ja Pasay niet 
Yoli. Bat Gen., deel XIJUL •. 



Hoofdstuk IX. — 130 — AAFTEEKENnra. 

Tot een zelfde besluit^ nl. dat men in het Malayu van de Pamalaya der 
Pararaton de oostkust niet zoeken mag, maar men er Maleiers ter westkust of in de 
nabijheid daarvan in ontmoet, voeren ook de eerste berichten omtrent de Javanen 
in de Sajarah Mëlaya. Terwijl Java in dat boek reeds in den eersten aanvang 
met den naam van Majapahit wordt aangeduid, zie de plaats boven reeds vermeld 
by de behandeling van de mogelijke ligging van het Taïïjung pura der Pararaton, 
en dus daar het bestaan van dat rijk reeds in de elfde Qaka-eeuw verondersteld 
wordt ^), geeft het boek eenige zeer opmerkelijke berichten over krygstochten 
door Java (Majapahit) ondernomen tegen de Maleiers in de Riaw lingga archipel 
woonachtig, welke niet minder in een tijd vallen, dat Majapahit, volgens het by 
Hoofdstuk VI boven verkregen resultaat, nog niet bestond. In Hoofdstuk IV en X 
nl. van de Sajarah Mélayu is sprake van twee tochten door krijgslegers van 
Majapahit ondernomen tegen Singhapura, de eene met een kwaden en de andere 
met een goeden uitslag. 

Ook hier is het noodig de geschiedenis voor eene duidelyke uiteenzetting 
iets hooger op te halen. 

Nadat in Hoofdstuk II het verslag over de tochten van Sang Sapurba ten 
einde is gebracht, met het verhaal dat hij, na zijne ontmoeting met den vorst van 
Migapahit, te Tafijung pura, zich naar Lingga, straat Sambor, begeeft en, van 
daar door de koningin van Bintan naar Bintan geinviteerd, op deze plaats zgn 
zoon Nila utama, die onderwijl met de dochter dier koningin, Wan Sri bini s), in 
het huwelyk was getreden, achterlaat, als hij zelf zyn tocht voortzet naar de bo- 
venlanden van de Kwantanrivier, welke hij over Ruku en Taöjung balang be- 
reikt en zoo koning van Mënangkabau, en voorvader der vorsten van Pagar ru- 
yung wordt, bericht Hoofdstuk III de stichting van Singhapura, daar waar vroeger 
Témasik (?) te vinden was, door Sang Nila utama, die nu den naam Sri Tribuwana 
gaat voeren s)^ en Hoofdstuk IV den dood van dezen vorst, die door zgnen zoon 



•Ueen een geog^phisch ordeljke, maar er ook eeoe, die de Teroveringen in chronologiscbe Tolgorde opsomt. 
Br dient hier tevens gewezen te worden op de moeiel^kheid den onderdom van die kroniek te bepalen. Aaq 
het slot wordt als het jaartal der voltooiing H^rah 1235, Ja, opgegeven. Wat bedoeld is de Toltooiing van 
het boek of van bet hds. wordt niet duideljk gezegd. H^rah 1286 is te verbeteren in Hijrab 1280, dit jaar 
een jaar Ja z^nde, terwjl 1285 een jaar Alip was. Dit laatste zon ook beantwoorden aan 1819 A. D.,toen 
Raffles, in wiens verzameling Dnlaorier bet boek aantrof, Indië reeds verlaten bad. 1280 Hjrah = 1814 A. D. 
Op een vr^ laten t\jd van vervaardiging wjst, niettegenstaande bet afbreken van bet verhaal reeds bq het pont 
tot waartoe de schr^ver gekomen was, en waarna Pasay's geschiedenis nog een heel eind zou knnnen worden 
voortgezet, ook het vele Javaansch dat men in den tekst aantreft, eo de vorm waarin bet optreedt, welke die 
is van het Javaansch in de Maleische irayaM^-verhalen en Pafiji-legenden. 

1) Men honde hierb^ echter in het oog, dat, zooals de inleiding van den schrgver bj de Sajarah 
Mëlayn vertelt, dit boek in '1021 H^rab ^ 1612 n. Chr., vervaardigd werd. 

2) Zjne moeder was Wan Snndari, de dochter van Dëmang Lebar dann. 

3) Dat de namen *, ^ n i, en ^U*l Só ontleend zgn aan die van de beide widadari's Saprabbft 

en Tilottaml, evenals CJljuL«; zie beneden, aan dien vao Menaka, merkte van der Tuuk reeds op, in Ba- 
takack leesboek. IV. lU. 



HooFDSTÏJK IX. — ^^131 — Aanteekekino. 

Riga këcil bësar; onder den titel van Paduka Sri Wikramawira wordt opgevolgd. 
Singhapnra is intusscheD tot lioogeh bloei gekomen^ en dit komt (Hoofdstak V) 
den vorst van Majapahit ter oore. Gevoelig er over, dat de vorst van Sing- 
bapara, die toch familie van hem, zijn neef, was, hem geen hulde bewyst, maakt 
hij hem daarop eerst minzaam opmerkzaam, maar vindt in het antwoord een reden 
tot het dadelgk uitzenden van een expeditie, die echter eindigde met een ge- 
dwongen terugkeerén van den Javaanschen vijand naar hun land. 

Maar nadat nu Sri Wikramawira opgevolgd is door Sri Ramawikrama (ein- 
de Hoofdstuk V), en deze weder door diens zoon Paduka Sri Maharaja (Dasya raja, 
einde Hoofdstuk VI), volgt er op nieuw een overval van Singhapura door troepen 
van Majapahit (einde van Hoofdstuk X), die, gekomen op de roepstem van een 
bandahari van den zoon van Sri Maharaja, Raja Sëkandar Shah, welke zgnen 
vader weer had opgevolgd, en de dochter van dien dienaar van hem een zware 
beleediging had aangedaan, Singhapura veroveren en Sëkandar Shah van daar 
jagW; wat nn de stichting van Malaka op den vasten wal, door dezen vorst, 
tengevolge had. 

Brengt men de hier gememoreerde feiten in jaartallen, waarvoor hier die 
worden genomen welke Dr. de Hollander in zijn Kort overzicht van de geschiedenis 
der Maleiers >) geeft, dan zou de eerste tocht hebben plaats gehad tusschen 
1208—1223 A. D. en de tweede kort voor 1252 van diezelfde jaartelling 2), of 
tot Qaka-jaren herleid tusschen 1130 — 1145 en vóór 1174, en het is dus zeer de 
vraag of men zich niet gedwongen moet gevoelen, ten minste in dien tweeden 
tocht tegen Singhapura de pamalayu van de Pararaten te zien, Qaka 1197 — 1215, 
en mogelgk is het, dat by eene nieuwe berekening der cijfers van de Hollander, 
die t. a. p. zelf reeds varianten opgeeft, de gissing wel eens juist zou kunnen 
blgken te zijn s). 

1) In zijn Haodleiding bg de beoefening der Maleiscbe taal- en letterkunde, 5e druk (1882), 3e deel, 
Hoofditnk I, zie bl. 278 en 279. 

2) De HoUander geeft : 

Sri Tribnwana, ? — 1208, 

Sri Wikramawira, 1208—1228, 

Sri Ramawikrama, 1223 — 1280, 

Sri Mabanja, 1 286 — 1249, 

Sri SSkandar Sbah, 1849—1274. 

De inname Tan Singhi^ara zou plaats gehad hebben in *i 3e jaar der regeenng yan den laatate, 
tn daarna Halaka in 1263 (= Qaka 1174) gestieht zjjn. De Singhapore editie yan de Sanjah Mélayu 
•preekt echter van een yerbl^f van Sëkandar shah te Siogapura van tiga puluh dutoa toAu», wat tot 1281 
(•==Qaka 1208) leiden ion. 

8) De leier wj hier verwezen naar de in de vorige noot reeds medegedeelde afwijkende lezing van 
den Singapore tekst, die, aangenomen dat het jaar 1249 correct is, leidt tot 1208 (j^aka voor de stichting van 
Malaka, terw^l de gebeurtenissen op Oost-Java volgens de Pararaton te dien t^de en in de jaren daarna 
voorgevallen, een verklaring zouden kunnen geven van het feit,, dat in den eersten t\jd na èie pamalayu mtü. 
zich op Java minder met bnitenlandsche zaken bezig hield, door binnenlandsche onlusten meer op zich zelf 



Hoofdstuk IX. — 132 — Aanteekening. 

Zoodat; zooals men ziet^ andere berichten weer voeren .tot een geheel ander 
besluit; en het wel het veiligste is, voorshands in deze moeielijke kwestie niet 
verder te beslissen dan het stellen van Majapahit's groote veroveringen in een late- 
ren tyd na 1265 Qaka, zooals boven reeds werd aangenomen, en met het oog hierop 
kan dan voorts nog gewezen worden, zoowel op hetgeen de Sajarah Mélaja ons 
omtrent die veroveringen, zg 't dan ook slechts indirect, nog verder bericht, in 
Hoofdstak XIV, als op hetgeen men daaromtrent door de Javanen van Java wordt 
medegedeeld i). 

Daar die berichten echter aitdmkkelijk wyzen naar een lateren tgd dan 
die waarover het hoofdstuk der Pararaton loopt, waarbij de hier gegeven toe- 
lichtingen noodig waren, vinde het verdere hierover eerst beneden zijne plaats. 

Zooals reeds gezegd werd geeft de Pararaton niet aan, wanneer deze vor- 
stin door haren opvolger vervangen werd. Wekt dit reeds bevreemding, een nauw- 
keuriger toezien brengt het verder nog aan den dag, dat ook andere feiten, welker 
vermelding evenzeer te verwachten was, gepasseerd zgn. Naar het kader van het 
boek toch hadden er in dit hoofdstuk, tenzg op een opmerkelyke wijze van den ge- 
wonen regel is afgeweken, verschillende zaken bericht moeten zyn, die men nu 
mist. Zoo vindt men byv. ook niet opgegeven, wanneer Arya Tadah, de patih 
amangkubhumi, 'tzg door den dood, 'tzg door zich geheel terug te trekken, van 
het tooneel verdwijnt. Evenmin wordt er bericht wat het jaar was van het over- 
laden der beide dochters van Kërtanagara, de weduwen van Kértangasa, die in 
het voorafgaande zulk eene hoewel passieve, toch belangryke rol speelden. 

Dit leidt er toe te veronderstellen, dat tusschen het slot van dit hoofdstuk 
en het begin van het volgende, een lacune moet bestaan. In dat opzicht zijn dan 
de beide handschriften, welken voor dit gedeelte toegankelyk waren (B en C), op 
een zelfde wijze gebrekkig, en die lacune zou er dus reeds eene van vrg oude 
dagteekening moeten zyn, daar B en C, ten minste de teksten waarop B en C 
berusten, betrekkelyk oud zijn, en zy toch niet uit elkander kunnen zgn ontstaan. 
Dit laatste volgt toch direct daaruit, dat in beide teksten op verschillende plaatsen 

1) De ligfi^ing Tan Malaya op de ooftknst van Sumatra is in verband met andere gegevenu, laatêtel jk 
behandeld door Prof. van der Lith, in z^n Livre des merveilles de l'Inde, enz. 1888 — 1886, bl. 247 en Tolgg., 
zeker wel de meest waarschgnlqke. Men ziet bier intusscben op nieuw boe netelig de qnaesties der plaatsbe- 
palingen van deze soort z jn, en bet .tegen" dient evenzeer goed onder de oogen worden gezien als het «voor". 
Uit de Hikayat ngaraja Pasay zou men desnoods nog kunnen opmaken, dat in de Pamalayu van de Pa- 
raraton toch de Manangkabauscbe landen slaken, maar veroverd door een troepenmacht, die op de oostkust 
was geland, doch èn de chronologische volgorde in dat boek èn de daar berichte afloop schenen het te ver- 
bieden aan hetzelfde feit te denken. De verklaring van dezen volks- of landnaam door van der Tuuk, als 
voortgesproten uit het omhelzen van den Islam door de Male iers, is tegen over de Chineesche berichten, waarin 
men hem reeds aantreft in de 7e eeuw van onze jaartelling (Beal, Itsing, zie de boveuopgegeven literatnur) 
onhoudbaar. De gissing zelf heeft wel haar oorsprong in hetgeen men vindt op bL 24 der uitgave van de 
Hikayat ng'anga Pasay door Dulaurier. Men leest daar: adapon dteèridrakan oUh orang yang awipuna cè- 
rifèra ada tuwatu kaum orang dalam. Mëgëri Uu Hyada iya mau masoi igama islam maka iya lort ka hulu 
nmgay patamgan wuUta karëna iiulaA dinamai orang dalam n^gër i Uu gayu hingga datang Marang im'. 



Hoofdstuk IX. — 133 — AAHTEEKEiniio. 

groote stokken worden aangetroffen, die omgekeerd in het andere hds. worden 
gemist. Eensdeels herinnere men zich dat bl. 24 reg. 9 — bl. 25 reg. 11 alleen 
voorkomt in C, dat uit Qaka 1522 is, maar gemist wordt in B, een hds. waarvan 
de legger van 1535 dateert^ en anderdeels, dat iets lager bl. 27 reg. 26 — bl. 28 
reg. 8 slechts uit B kon worden gegeven, daar dat gedeelte in G niet voorkomt. 
Dat jde verschillende handschriften dos belangryke leemten bevatten, is doidelgk, 
en het is aannemelgk zulks ook hier te veronderstellen^ zelfs nu de beide hand- 
schriften op dit punt uniform zijn. 

De dood van de vorstin van dit hoofdstuk kan slechts op bl. 29 reg. 32, 
in Hoofdstuk X, vermeld zgn, waar men leest, dat er tusschen 1293 en 1298 Qaka 
een Bhre Eahuripan zoowel als een Bhre Daha overleed. 

Behoudens van de drie echtgenoten van Kërtarajasa (Raden Wgaya) werd 
het afsterven der personen van het geslacht, dat voorafgaat aan dat van Jaya- 
nagara en diens halfzusters, in het voorafgaande behoorlek geboekstaafd. Om die 
reden zou bij de eerste vermelding van den dood van een Bhreng Kahuripan en 
een Bhreng Daha het eerst aan die weduwen moeten worden gedacht, terwijl 
het mogelgk zou kunnen zgn, dat die van Dara pétak, als zijnde een bini haji, 
maar niet vermeld was geworden. Toch gaat het niet aan op de genoemde plaats 
in die beide dames nog Eértanagara's dochters te zien. Immers Tumapël was in 
1197 Qaka gevallen, en op dat oogenblik moet men stellen, waren deze beide toch 
minstens reeds meisjes van een jaar of tien, om maar een cijfer te noemen. Zij 
zouden dus in 1293 Qaka beiden reeds meer dan honderd jaren oud zijn geweest, 
maar hoezeer het ook mogelijk zou kunnen zijn, is het toch zeker niet zeer waar- 
schjjnlgk, dat zij, en dat nog al beiden, dien hoogen leeftijd bereikt zullen hebben. 

Na deze beide personen, de gemalinnen van Kërtarajasa, komen zijne 
dochters voor die plaats in aanmerking. Ten opzichte van dezen, kan men slechts 
vaststellen dat zij om en bij 1217 Qaka het levenslicht moeten hebben aanschouwd ; 
eerder is mogelgk, later echter niet. Nu wordt, als men den tekst verder volgt, 
na de beide sterfgevallen op bl. 29 reg. 31 en 32, van het afsterven van een 
Bhre Eahuripan eerder niet weer gewaagd dan in 1323 Qaka, bl. 30 reg. 37, 
terwijl een Bhre Daha als gestorven pas weer voorkomt in 1338 Qaka, bl. 31 
reg. 21. De verhouding zou in dit geval nog ongunstiger zijn dan bij het in de 
vorige alinea gestelde. Bhre Eahuripan zou minstens 106 jaren en Bre Daha 
volgens dezelfde uitrekening 121 of meer jaren oud zijn geworden. 

Er rest dus geen andere conclusie dan in de Bhre Eahuripan van bl. 29, 
reg. 32 werkel^k de eerste prabhu siri te zien, en in de Bhre Daha hare zuster. 
Ook zóó zouden deze beide personen toch nog vrij oud geworden zgn, meer dan 
76 — 81 jaar, doch het is moeielijk er nog andere personen van den zelfden naam 
in te ontdekken, zooals bg het volgende hoofdstuk blijken zal. Bevreemding wekt 
het intusschen, dat er bij Bhre Eahuripan's overlijden niet vermeld staat, dat zg 
de prabhu islri was, evenzeer als men, waar het die Bhre Daha geldt, ook on- 



Hoofdstuk IX en X. — 134 — Aaht. en Vert. 

gaarne de nadere aanduiding mist; dat zij de zuster van deze of een dochtervan 
Eërtarajasa was. 

Bhre Kahuripan moet zich, zooals nu uit het voorafgaande volgt, uit de 
regeering hebben teruggetrokken. Na haren dood t. a. p. wordt toch niet gezegd, 
dat daarmede voor een nieuwen vorst eene plaats was open gekomen, of dat 
iemand haar opvolgt. Ook dit bevestigt hetgeen boven reeds omtrent een ver- 
moedeiyke leemte in den tekst, op bl. 28, werd opgemerkt. 



HOOFDSTUK X. 



Hayam Wuruk^ als koning Rajasanagara en Sang hyang Wekasing 

mkha. Caka ? —1311. 

Daarop volgde de gebeurtenis met de Sundaërs te Bubat. Zijne M^esteit 
de koning (prabhu) >) begeerde eene prinses van Snnda. Patih Madn werd ge- 
zonden om de Sundaërs uit te noodigen (er zich mede te verecnigen) ; zij stemden 
toe, dat zij huwen zouden »). De koning (ratu) van Sunda, Maharaja, kwam (zelf) 
naar Majhapahit, doch zonder prinses. De Sundaërs wilden nu in ieder geval awira- 
mena, tingkahing jurunghi *). De patih van Majhapahit wilde niet, dat de vorst haar 
huwde, omdat de prinses makaturatura 4). De Sundaërs stonden dat niet toe. G^ah 
mada vertelde toen hoe zij zich gedroegen. Bhra Prame^wara van Wëngkërnam 
het op zich : ,,Wees niet ongerust, broeder koning, ik zal ze staan in den strgd". 
[Gajah mada vertelde toen hoe de Sundaërs zich gedroegen]. Daarop maakte men 
te Mighapahit het plan de Sundaërs te omcingelen. Dezen wilden de prinses [29] 
geven, maar de nienak's stonden dat niet toe, en zeiden te Bubat te zullen sterven, 
zich niet te zullen bukken, mocht het al tot bloedstorting komen ^). De gelofte van 
de menak'% verwekte groote krggslust, de Sunda'sche hoofden (?) ^) verlangden 
den strgd, Larang agung, Tuhan Sohan, Tuhan Gëmpong, Pafiji Mëlong, de lieden 
van Tobong barang, Rangga eahot, Tuhan Usus, Tuhan Sohan, Urang panguln, Urang 
saya, Rangga kaweni, Urang siring, Satrajali, Jagatsaya, alle Sundaërs hieven 
tegel^k een krijgsgeschreeuw aan; versterkt '') door het klinken der reyotij's klonk 
het krijgsgeschreeuw als een aardstorting. Koning Maharaja sneuvelde het eerst, 
hy stierf met Tuhan Usus. Bhra Prame^wara begaf zich naar Bubat, niet wetende, 
dat er nog veel Sundaërs over waren en dat de voornaamste *) menak'% in het 



1) 


Hiermede moet Hayam Warak bedoeld z^n. 


2) 


In 't Jav. awawaran^ana. 


3) 


Wat deze woorden moeten beteekenen, weet ik niet zelfs niet te gissen. 


4) 


Zie de vorige aanteekening. 


5) 


In 't Jay. wumggitoka giUh. 


6) 


In 't Jav. éuU, 


7) 


In 't Jay. ptmagnl. 


8) 


Ook hier mdi. 



Hoofdstuk X. — 135 — Vertalirg. 

gevecht waren. De Snndaërs maakten een znidwaartsche beweging, de Majhapa- 
hiters verloren het. De aanval werd echter weer afgeslagen en de troepen werden 
weer tot stand gebracht door Arya Sëntong; patih Qovn, patih Marga lëwih, 
paUh Tötëg, en Jaran bhaya. De mantri's araraman vochten te paard; (daarop) 
verloren de Snndaërs het, zij deden (nog) een aanval naar het zuidwesten juist 
daar waar Gajah mada waS; maar iedere SundaneeS; die voor zijn wagen kwam, 
kwam om. Als een zee van bloed (was 't slagveld), er lag een berg van lijken, 
alle Snndaërs werden zonder uitzondering afgemaakt, in Qaka 1279. 

De tocht naar Dompo viel samen i) met de bestrijding der Snndaërs. 
Daarna gebruikte Gajah mada (weer) palapa. Elf jaar was h^ amangkubhumi. 

Na den dood van de prinses van Snnda huwde de koning (prabhu) met 
de dochter van Bhra Pramefwara, Paduka fori, en kreeg bij haar een dochter, 
Bhre Lasëm, de schoone, bij een selir (rabihaji) had hij een zoon, Bhre Wirabhumi^ 
die door Bhre Daha tot zoon werd aangenomen. 

Bhre Pajang s) kreeg drie kinderen: Bhra Hyang wife^a, wiens ksalriya 
naam Raden Gagak sali was, en die als ralu Aji Wikrama heette, deze huwde 
met Bhre Lasëm, de schoone, en kreeg bg haar een zoon, Bhra Hyang Wëkasing 
suka; het tweede kind was een meisje, Bhre Lasëm, de dikke, die met Bhra Wi- 
rabhumi huwde; het derde eene dochter, Bhre Kahuripan. 

Bhre Tumapël had een zoon, die als ksatriya Raden Sotor heette, him van 
Eoripan was, daarna hino van Daha, en daarna hino van Majhapahit werd; hg 
had een zoon. Raden Sumirat, die Bhre Kahuripan huwde, en Bhre Pandan sa- 
laa werd. 

Daarop had het groote crocUAa-offer s) plaats in 1284. 

De apalih Gajah mada overleed ^) in 1290. Gedurende drie jaren werd 
er niemand in zijn plaats als apaiih aangesteld. Gajah ënggon werd (eerst) apatih 
in Caka 1293. 

Bhre Daha sterft en wordt bijgezet te Adilangu, dat als dharma de Pur- 
wawi^e^a-berg heet. 

Bhre Kahuripan sterft en wordt bijgezet ie Panggih, dat als dhamia de 
Pantarapurwa-berg heet. 

Daarop ontstond er een nieuwe berg, in Qaka 1298. 

Daarop had in (de wuku) Mada(ng)siha een bergstorting plaats, in Qaka 1307. 

[30]. Bhre Tumapël, nl. die te Qunyalaya stierf, stierf in Qaka 1308 ; hg 
werd bggezet in Japan, dat als dharma den naam Sarwajfiapura kreeg. 

Bhra Hyang wi^e^ had tot kinderen: (1) Bhre Tumapël; (2) eene dochter 
Bhre prabhu istri (de tweede koningin van Majhapahit, die zelf regeerde), als 

1) Lees kmggal Um, 

2) Zie boven. 

S) FofraddJkaM, Tan ^addJkJ, het offer aan de gertoiren familieleden. 
4) In 't JaT. aüUutm, 



Hoofdstuk X. — 136 — Vert. en Aurr. 

koniDgiD Dewi Snhita; en (3) een zood^ zijn jongsten kind, Bhre Tnmapël Qil 
Eërtawijaya. 

Bhre Pandan Salas had tot kinderen; (1) Bhre Koripan d. i. Bhra Hyang 
ParameQwara, Aji Ratnapangkaja volgens zijn koningsnaani; die met de prabhu 
islri huwde; doch geen kinderen had ; (2) een dochter Bhre Lasëm, die huwde met 
Bhre Tumapël, (3) nog een dochter Bhre Daha, die huwde met Bhre Tnmapël, 
die het jongste kind was evenals zij. 

Bhre Wirabhumi had (1) een zoon, Bhre Pakëmbangan, die op de jacht 
stierf, (2) een dochter, Bhre Mataram, die huwde met Bhra Hyang wi^e^, (3) een 
dochter, die huwde met Bhre Tumapël, (4) eene dochter, Bhre Mataram. 

Bhre Tumapël had (1) een zoon, die te Wëngkër stond, en met Bhre Ma- 
tahun huwde; (2) Bhre Paguhan; (3) bij een tweede vrouw een dochter, Bhre 
Jagaraga, die huwde met Bhra Parame^wara, maar kinderloos bleef; (4) Bhre 
Tan^ung pura, die huwde met Bhre Paguhan doch evenzoo kinderloos bleef; (5) 
Bhre Pajang, die evenzoo de vrouw van Bhre Paguhan werd, maar evenzoo kin- 
derloos bleef. 

Bhre Eëling nam Bhre Këmbang jënar tot vrouw. 

Bhre Wëngkër's zoon was Bhre Kabalan. 

Bhre Paguhan had bij een hatriya-yroixw eene dochter Bhre Singapura, 
die huwde met Bhre Pandan salas. 

Bhre Prame^wara van Pamotan jstierf in Qaka 1310, hij werd bijgezet te 
Maftar, dat als dhartna den naam Wi^nubhawanapura droeg. 

Bhra Matahun werd na haar dood te Tigawangi bijgezet, dat als dhartna 
Knsumapnra heette. 

Paduka Sori sterft. 

Bhreng Pajang wordt na het overlijden bijgezet te Ëmbul, als dharnui 
Girindrapura geheeten. 

Bhre Paguhan sterft en wordt bijgezet te Ij) bëücal, als dhanna Parwa- 
tigapura geheeten. 

Bhra Hyang wëkasing suka stertt, in ^aka 1311. 

AANTEEKENIN6. 

Met tumuli pasunda-buhal moet er een nieuw hoofdstuk begonnen worden. 
De bhre prabhu, die daarop wordt genoemd, moet een man zijn geweest, wat de 
in het voorafgaande aan het bewind zgnde persoon niet was ; en waarom het voor- 
afgaande nog tot de regeering van deze, Jayawi^nuwardhani, werd getrokken, 
werd in de aanteekening hg het vorige hoofdstuk reeds in het licht gesteld >). 

In het begin van dat hoofdstuk ook, vindt men den naam of beter nog de 



1) Ten oTenrloede s^ hier nog geweien op de mtdrokking sira Qt^ah wuuia mmtur in^ kUamfokam 
ökafdra ring Koripan^ bl. SS rcg. 26. 



Hoofdstuk X. — 137 — Aahtebkekino. 

namen van den vorst; die haar moet hebben opgevolgd, en nu hier plotseling aan 
het bestnur gevonden wordt. Het is niemand anders dan de onS; ook uit de Babad 
tanah Djawi, bekende Hayam wnrnk; wiens namen^ voor zoover zij hier noodig 
zijn, zooals t. a. p. blijkt, o. a. waren: Bhatara prabhu, Hayam wuruk, Rsga- 
sanagara en Sang hyang Wëkasing snkka. 

Daar het niet noodzakelijk was, werd er bij het VIII*^ hoofdstuk niet in het 
bgzonder op gewezen, dat daar Jayanagara, als hij niet met name wordt genoemd, 
boewei hg prabhu was, wordt aangeduid met abhaldra of na een a met bhatara, zon- 
der meer, zie bl. 26. Om hier het belang van Hayam wuruk's eersten naam in 
het oog te doen springen, verdient dat echter de aandacht wel, aangezien in dit 
hoofdstak de eenige malen dat er van den regeerenden vorst gesproken wordt, 
behalve daar, waar zgn dood wordt vermeld, ook een vaste uitdrukking, een an- 
dere, gebezigd is, nl. bhre prabhu of bhatara prabhu bl. 28 reg 29; 29, reg. 18. Dit 
mag louter toevallig schijnen, in werkelijkheid is het niet, want het zal straks aan 
den dag komen, dat Hayam wumk juist bij dezen naam (titel) aan de Chinezen 
van zgn tgd bekend was. 

Met zijne namen Hayam wuruk . en Riyasanagara vindt men dezen vorst 
genoemd in de bij het vorige hoofdstuk reeds besproken oorkonde, waarin van 
den naam Rigasanagara evenwel' niet meer gespaard was dan de eerste lettergreep. 
Toch behoeft hier niet getwijfeld te worden. Vulden wij daar de gaping in het 
opschrift aan door middel van den tekst van de Pararaten, hier dient deze be- 
vestigd te worden door nog een andere oude oorkonde, die uit 1295 Qaka dag- 
teekent, en met een stuk dat door dezen vorst geitereerd is geworden, reeds in 
1880, door den Heer E. F. Holle in facsimile en transcriptie is uitgegeven i), 
wat nog in hetzelfde jaar aan Prof. Kern aanleiding gaf die beide piagein'% nog- 
maals te transcribeeren en voor het grootste gedeelte vertalen 2). 

De oorkonde uit Qaka 1295 noemt Z. M. R&jasanagara, Dy ah Hayam wuruk, 
als regeerend vorst, op de navolgende wijze: yatika nimitta dyah parth pt^anamya 
bhakti pdduka bhatara gri rdjasanagara, dyah hayam wuruk^ nianghyang ri waluydni- 
kang bungur muliha dharmasitndnuta sarasaning pragdsti ring puhun malama; ndd 
tan tinénget de pdduka bhatdra fri haydm wuruk, makakaram deni kadrdahhaktin 
dyah parth mwang kawidagdan rasika marki pddulca bhatdra (7*i rdjasawarddhani, 
mwang yugalanira gti ranamanggala, apan ^i rajasawardhani duhitd sangkeng sdnak 
pamungsu de grt haydm wuruk, muang (ri ranamanggala putra sangkeng sdnakagraja 
de QTt mahdrdja, „naar aanleiding hiervan dan heeft Vrouwe Parih zich onderdanig 
baigende voor Z. M. R&jasanagara, Dyah Hayam wuruk, gesmeekt, dat Bungur 
op nieuw een (vrg) rechtsgebied mocht worden, overeenkomstig den inhoud van 
de in vroegeren tijd uitgevaardigde acte, en Z. M. Hayam wuruk heeft zulks 
ingewilligd, uit consideratie van de onwankelbare onderdanigheid van Vrouwe 

1) Verh. Bftt. Oen.. XXXIX. 

2) VenL en Meded. Kon. Ak« Tan Wetenschappen, afd. Letterk., 2e Rkt., X. 



Hoofdstuk X. — 138 — Aanteekenihq. 

Parih en van de bekwaamheid , waarmede zij Z. M. Rajasawardhant en haren 
partner Z. M. Ranamanggala heeft opgepast; nu is Z. M. Rajasawardhan! eene 
dochter van den jongsten broeder (of zuster) van Z. M. Hayam wuruk, terwijl Z. M. 
Ranamanggala een zoon is van den onderen broeder (of zuster) der konings" ^), 
maar levert zoo tevens weder de gelegenheid om aan te toonen^ dat in het Hyang 
Wëkasing suka in de vierde strophe van de Arjunawijaya zijne persoon schuilt ^), 
die, zooals uit de Pararaton blgkt^ ook dien naam droeg. 

Naast Rfijas^anagara vindt men er toch een neef van hem genoemd, die Rana- 
manggala heette, een naam, dien men zoowel in de Sutasoma als in het juist genoemde 
gedicht, aantreft als dien van den fautor van Mpu Tantular, den maker dezer beide 
kakawin^s. Ziehier de gedeelten dezer beide gedichten, die ter zake van belang zijn. 
Terwijl uit zang LXXIII (den voorlaatsten zang) van de Arjunawgaya 
blijkt, dat het gedicht door Mpu Tantular vervaardigd werd, want men leest daar 
in de eerste strophe: 

ndhan juga watérikanafig kalhabuka dacdsyacaritan inikéif 
nddn arjunawijaya ngaranya rakwa karéngö tilir inujarakén, 
anluk rasika sang aparab mpu tantular amarna kakawin alangö, 
ndd tan lular ika ri gatinya tan vunih i rusitning aji milu léngang,, ^) 
luidt het begin van dit gedicht: 

om gri parwatardjadewa huriping sarwa pramdneng jagat, 
sang sdksal paramdrthnbuddha kinetiep sang siddhayogigwara, 
sang Iwir tirtha kiteng mahardhika wisdmbékteng mahddurjana, 
nirwighnopama suryawimba tumibeng wway qdnia ring rdt kabehj^ 
donktmngastuti jong bhatdra huningan setnbahning anggöng langö, 
siddhdning makasang wulung ya palakungkwachanda bhdseng karas, 
mwang swasthdnira sang yawendra sahaputra mivang suputriniwö, 
dhirghdyuh sira mukya sang paimkasing tustnpageheng puray^ 
Idwan kdrananing hulun cumatakdmrih mangdawdkén kathdy 
wintangwintanga donya rakwa ya tekap sang Iwir gagdngkeng langöy 
panggil rakwa wènang panuddha rena sih sang ndtha mangkweng langöy 
nghing sang gf*i ranamanggaleki sira sang grddhdn parëkning hulun y^ 
ndan bhrdtrdtmaja rakwa tanggehira de sang hyang wekasning suka^ 
lékwan mantu sakeng artki wèkasan de gri narend/ ddhipa, 
ndah yogyan sira manggalangku mikétang parwdtémah padika, 
sang sdksdt pagartraning masa kapat tapwan madoh mangö^^ ^) 



1) Mjne vertaling hier w^kt uit een open reden, bepaaldel^k in de eigennamen, van die van Prof. 
Kern eenigszins a£. 

2) Hierop werd reeds gewezen in De koperen platen van Sémbiran (Boeleleng, Bali), oorkonden in het 
ond-Javaansch en het oud-Balineesch, in Tgdichr. Ind. T. L. en Vk., XXXIII, 80, noot. 

8) De maat is die van Zang XXIII en XXXII van de Aijunawiwiha. 
4) De maat is de g&rdülawikiidiU, Wrttasaficaya, 88. 



HooKDSTiTK X. — 139 — Aantebksnino. 

Ook hier Yindt men Ranamanggala, en al evenzeer als een broederszoon 
van den regeerenden vorst van Java^ Yawendra, die vermeld wordt onder verwij- 
zing tevens naar zijn zoon en zijn dochter (neef en nicht), terwijl van Ranamang- 
gala n<^ gea^egd wordt dat hij ook de schoonzoon van den jongeren broeder (of 
de jongere zuster) van zijn oom was, die hier, waar hij met name wordt genoemd, 
aangeduid is met Sang hyang Wékasing sakha. 

Een eendere combinatie, hoewel niet zoo uitvoerig wat de familierelatie 
betreft, levert het slot van de Sutasoma. 

naham haniyanikang katkdtigaya boddhacaritanginitëly 
de sang kawyaparab mpu tanlular amat^na kakawin alangó, 
kydtmgrdl purusdda^nta patigaranya kaiuturakéna, 
dkrghdyuh sira sang ruméngwa tuwi sang niatnaca uianulisaj, 
bhrd^tang durjana gunyakdya kuniétër mawédi girigirin, 
de gri rdjasardjya bhupati sang angdivi raiu ri jatva, 
guddhdmbék sang asewa tan salah ulah pawarahira Unül, 
sek wirddhika inewu yeka viagawe resauing ari Cékoy, 
rdmyang sdgaraparwaieki sakapunpunani sü^a langö, 
mwang tang rdjya ri wiltvatikta pakardjyaniran anupama^ 
kirnekang kawig'Ua lambang aluhdnvoam umarèk i hajiy 
Iwir sang hyafêg gagi rakwa pürna pangapusniran anuluh i rdty^ 
bheda mwang dafhéling hulun kadi patanggan umiber i témah, 
ndan duran madane kajHin wwang aCunuda kumawihalangöy 
Iwir bhrdntagati dhai*itianing Icawi turung wruh ing aji sakathdy 
nghing sang gtn ranamanggaleki sira sang titir anganumatay, 1) 
waarin men den naam van den dichter, Mpu Tantular; den titel van het gedicht 
„Puru^&da tot kalmte gebracht"; den naam van den vorst van Java, hier Jawa 
en niet Yawa, R&jasarajya = Rajasanagara ; den naam van het rgk, Wilwatikta 
^Majapahit; en Ranamanggala als den fautor aantreft. 

Bleek het nu op deze wijze reeds, dat ook ten opzichte van Hayam wuruk 
aan de gegevens ons door de Pararaton aan de hand gedaan, het vertrouwen niet 
mag worden ontzegd, bevestigd als zij werden door gedeelten voor oude oorkonden 
op steen of op koper, en een paar literaire producten uit zijnen tgd, het is hier 
verder ook nog van belang na te gaan wat de door den Heer Groeneveldt uitge- 
geven Chineesche berichten over zijnen tijd mededeelen. 

Men heeft daarvoor te raadplegen wat dezen ons verhalen als voorgevallen 
in de jaren 1357 — 1389 A. D., aangezien dit tydsverloop beantwoordt aan 
1279 — 1311 Qaka, het eerste jaarcgfer, dat men in de Pararaton aantreft als 
vallende onder zijne regeering, en het jaar van zgn dood, zie bl. 30 reg. 24. 
Slaat men de Notes weer op, dan vindt op bladz. 35 (161): 



1) Be mui is die yan Aijanawiwiha XXXVI. 



Hoofdstuk X. — 140 — Aantebkenikq. 

„In the 9th month of the same year (1370 = Qaka 1292) the king Sri- 
pah-ta-la-pö (d. i. cri bhat4ra prabhu) sent envoys with a letter written on a sheet 
of gold, and products of the country as tribute. The envoys were treated accor- 
ding to the prescribed forms. 

„In the year 1372 ( = (^'aka 1294), when the imperial envoy, Ch'angK'o- 
ching, came back to China, the king of this country sent an envoy with tribate 
tribute along with him, bringing back three imperial decrees which they had 
received from the Yuan dynasty. 

„In the year 1375 (= Qaka 1297) they sent tribute again. 

„In the year 1377 (=Qaka 1299) the king Pa-ta-na-pa-na-bu (d. i. Bha* 
idra prabhu) sent envoys with tribute to the imperial court. 

„In this country there is a western king and an eastem king, the latter 
is called Bogindo Bong-kit and the former Bu-la-po-bu (d. i, Bhra prabhu)\ both 
of them sent envoys with tribute, but as their politeness was not sincere, the em- 
peror ordered them to be retained, and it was only after some time that they 
were allowed to return. 

„In the year 1379 (=Qaka 1301) the king Pa-ta-na-pa-na-bu (A.uBhaid^ 
ra prabhu) sent envoys with tribute, and so he did in the foUowing year. Some 
time before imperial envoys had been sent to carry a seal to the king of eastem 
Somatra (San-bo-tsai) ^), and those of Java deluded and killed them ; the emperor 
was highly incensed, and detained their envoys more that a month, with the 
intention to punish them, but ultimately they were sent back with a letter to their 
king, in which he was reproved for what he had done ^). 

„In the year 1381 (= Qaka 1303) they sent envoys, who brought as tri- 
bute 300 black slaves and products of the country. The next year they brought 
again black slaves, men and women, to the number of a hundred, eight large 
pearls and 75.000 catties of pepper''. 

Bhatdra prabhu dus ook in de Chineesche teksten, als quasi-naam, voor den 
vorst, die gedurende die jaren geregeerd moet hebben, belangrijk vooral daarom, 
omdat men die uitdrukking ook in de Notes niet verder aanwijzen kan, daar de vorst 
er anders steeds 6f met een anderen titel 6f met een zijner namen wordt aan- 
geduid 8). 

Te betreuren is dat het Bogindo Bongkit niet is te identificeren, daar zonder 
twijfel, indien dit kon gelukken, de overeenkomst nog wel nader in 't licht kon 
worden gesteld. 

De alinea over het jaar 1379 (= Qaka 1301) verschaft echter, door hetgeen 
zij mededeelt, te zamen met nog een andere bericht, weer de gelegenheid de juist- 



1) De oude naam voor Palembang, het Samboja der Ja vaansche teksten, dat iets anders is dan Kamboc^a. 

2) Orer deze alinea beneden. 

3) Sen nitzondering hierop is, het .de koning Pa-la-bn" in .In the year 1462 (i=Qak» 1874) th« 
king Prabn sent «nToys to conrt with tribute", van bl. 89 (166). 



Hoofdstuk X. — 141 — AAHTSEKENnra. 

het van een gedeelte der passage over de te ondernemen veroveringen door Gajah 
mada, in Hoofdstuk IX, bl. 28 reg. 20 en volgg., behoorlgk te toetsen. 

In die alinea toch wordt, zooals zoo dadelijk uitvoeriger hier nog eens in 
herinnering zal moeten worden gebracht i), gezinspeeld op de verovering van 
Palembang door de Javanen in 1377 ( = 1299 Qaka), een verovering, die dus 
inderdaad eerst zooveel later plaats had, dan in de Pararaton, t. a. p. Hoofdstuk 
IX, Gajah mada belooft dat en andere gewesten te zullen gaan onderwerpen. 

In verband met die gelofte staat zonder twijfel ook het geheele gedrag van 
G^jah mada in de Pasunda; hg toch is op dat oogenblik de palih van Majapahit, 
bl. 28 reg. 32. Sunda was een der landen geweest, die hij aan Majapahit onder- 
geschikt maken zou, maar wanneer dat huwelijk tot stand gekomen was, dan zou 
althans een gedeelte van de belofte door hem onmogelijk kunnen zijn volbracht, 
daar de verhoudingen tusschen de beide rijken van zulk een aard zouden zyn 
geworden, dat er aan veroveren niet meer gedacht zou kunnen zgn. Welk een 
indruk zgne gelofte maakte op de omgeving, bleek uit het slot van Hoofdstuk IX 
duidelijk genoeg. Zooals men het geval daar beschreven vindt, was het voor 
Gigah mada inderdaad een eerezaak geworden z^n woord gestand te doen. En 
was het hem, zooals in de aanteekening by het vorige hoofdstuk aan den dag 
kwam, reeds met Bali gelukt, de gelegenheid hem gegeven door het vriendschap- 
pelgk betreden van het gebied van Majapahit door den vorst van Sunda met zyn 
gevolg, was voor hem een te schoone dan dat hy haar voorbg kon laten gaan. 
Zoo viel na Bali, en nog andere gewesten,' welken weten wij niet, Sunda, en, zoo- 
als de tekst oogenblikkelyk daarop laat volgen, Dompo (Sumbawa) in 1279 Qaka 
( ^ 1357 A. D.). Doch toch mocht het Gajah mada niet ten volle gelukken reeds 
bg zgn leven Majapahit die uitbreiding te zien krijgen, die hij aan het rgk had 
toegewenscht en beloofd te verschaffen. Hij overleed in 1290 Qaka ( = 1368 A. 
D.), bl. 29 reg. 28, en in dat jaar stond bgv. Palembang nog niet onder Maja- 
pabit's souvereiniteit, daar het eerst in 1299 Qaka (==1377 A. D.) veroverd werd. 

Van Palembang's verovering zelf wordt in de Pararaten niets bericht. Het 
viel intnsschen nog tijdens de regeering van Hayam wuruk, zooals reeds gezegd 
werd, 1377 A. D. (= gaka 1299). 

Volkomen duidelgk is daaromtrent het Chineesche bericht over Palembang 
of,San-bo-tsai, bl. 69 (193) der Notes, dat tevens in 't licht stelt, waarom de Chi- 
neesche keizer er zich eigentlgk van onthield op Zuid-Sumatra tegen Java op te 
treden, nl. omdat het behoorde tot de onderhoorigheden van Java. 

„In the year 1373, — zoo leest men er, — the king Tan-ma-sa-na-ho sent en- 
voys to bring tribute, with a separate letter of congratulation for the next new year. 

„At that time there were three kings in this country ^). 

1) In de Notes weea de Heer Oroeneyeldt hier reeds op. 

2) Het Yolgende maakt deze alinea daidelqk. Men bad nl., zooals de Heer Groeneveldt reeds opmerkte, 
op de kust vlak bQ elkander drie vorsten, die van Jambi, die van San-bo-tsai^ en die van uigenlijlk Palembang. 



1f 



Hoofdstuk X. — 142 — AAHmnwo. 

Jn 1374 the king Ma-na-ha-pan-lin-paiig sent enToys to bring tribate, 
which was repeated in the first month of the nezt year. 

„In the ninth month of the year 1375 a king called Saiig-karliel-ytt-liB 
sent envoys to present tribnte ; these envoys came to conrt foUowing au imperial 
envoy who retumed from a mission to another country. 

„In the year 1376 the king Tan-ma-sa-na-ho died and bis son, Marla-«ht 
Wuli sncceeded him ; the nezt year the letter sent a tribnte of rfainoceroa4ioniiy 

The envoys said that the son dared not aseend the tbrone on kis owb 

anthority^ and therefore asked the permission of the Imperial conrt Theempem 
praised his sense of dnty and ordered envoys to bring him a seal and aooBunit- 
sion as king of San-bo-tsai. 

^At that time bowever San-bo-tsai had already been conqnered by JaTS, 
and the king of this country^ hearing that the emperor had appointed a ks^ 
over San-bo-tsai; beeame very angiy and sent men who waylaid and killed flie 
imperial envoys. The emperor did not think it right to pnnish him on dut 
account. 

„After this occnrrence San-bo-tsai beeame gradually poorer^ and no tribtte 
was bronght from this country any more. 

Jn 1397 1). 

„At that time Java had completely conquered San-bo-tsai and cbanged ite 
name to Kukang 

2). 

,The country has cbanged its old capital for Eu-kang (Palembang); ftf- 
merly it was rich country, but since the conquest by Java it has gradnally become 
poorer, and few trading- vessels go there. .......". 

Daar spoedig na den dood van Rajasanagara er onderlinge oneenigbeden 
op Java ontstaan, die wel de voorboden van het latere verval vraren, mag mes 
in verband met die veroveringen vermoedelgk vaststellen, dat met de regeering 
van dezen vorst Majapahit het toppunt van zgn macht en zgn glorie bereikt had, 
en wellicht is het daaraan te w^ten, dat, behalve den naam van den stichter van 
het rijk, in de traditie ook der Javanen van Java, zijn naam, Hayam wnruk, en 
dien van zijn patih, Gajah mada, nog zijn blijven leven. 

In dit hoofdstuk komen verreweg de meeste opgaven van genealogiscben 
aard voor. Het is zaak er ergens in het algemeen de aandacht aan te wgden. 
De meest geschikte plaats schijnt dus wel deze aanteekening. Bg de behande- 

1) Het weggelaten gedeelte handelt orer een schriJTen van den Keizer aan Siam ooi J«fa nn te 
sporen San-bo-tsai tot 7.\jn plichten tegenover China te roepen. In dat gedeelte komt uit 's keiiwn mond ook 
de erkenning Toor Tan Java's recht op Palembang, „I understand that this San-bo-taai wasoriginaUyaeoiiBtiy 
belonging to Java". Dit ziet op een vroegere verovering van Palembang door een vont van Java, in 992 
A. D. (= 914 Qaka), waarover men licht vindt io deselfde Notes bl. 18 (144) en 65 (189). 

2] Overgeslagen als hier ter zake van geen beteekenis. 






Hoofdstuk X. — 143 — Aantebkekikg. 

liDg dient er evenwel iets terug te worden gegaan, evenzeer als er straks ook 
gegrepen zal moeten worden naar geg yens eerst voorkomende in de volgende 
hoofdstukken^ bepaaldelijk tot en met Hoofdstuk XIV, waarbij intusschen nu reeds 
dient te worden opgemerkt; dat men te beginnen met Hoofdstuk XIII de draad 
geheel verliest, met dien verstande, dat nog enkele gegevens in Hoofdstuk XIII 
en XIV kunnen dienen tot afspinning van het opgezette getouw, in casu den ge- 
slachtsboom van het vorstenhuis van Majapahit, dien men met Hoofdstuk XII, on- 
gelukkig genoeg, moet afbreken. 

Heel hoog op terug te gaan is niet noodig. Tot en met Hoofdstuk VIII, de 
regeering van Jayanagara, is alles duidelijk. Eerst met zijne beide halve zusters 
begint er eenige moeielgkheid, die intusschen reeds, in de aanteekening bij het 
vorige hoofdstuk; uit den weg kon worden geruimd Daarom kan het geslacht 
van Jayawi^nuwardhant, Bhre Kahuripan II (19), de eerste prabhu islri, het punt 
van uitgang zgn i). 

Leerde nu Hoofdstuk VIII, dat hare halve broeder Jayanagara (18) kinder- 
loos stierf, er wordt namelgk van geen kroost gewaagd, dat zelfde hoofdstuk ver- 
haalde aan het einde, dat de twee prinsessen, Bhre Kahuripan (de prabhu islri) 
(19) en Bhre Daha (20), beiden huwden, de eerste met een gemaal, die haar 
vroeger of later een stiefzoon schonk, terwgl het begin van Hoofdstuk IX deed 
weteu; dat zg zelf drie kinderen kreeg, een zoon en twee dochters, bl. 27, reg. 16 
en 19 en volgg. Voorts bleek het, dat de beide laatsten huwden, hetgeen in di 
hoofdstuk; bl. 29, reg. 18, ook met haren zoon het geval was. In het geheel 
dus heeft men om te beginnen rekening te houaen met elf personen, van wel- 
ken er vier haar eigen geslacht uitmaken, en de zeven jongeren een jonger ge- 
slacht vertegenwoordigen ^). 

Deïe elf personen waren: 

Bhreng Kahuripan II (de prabhu islri I), Jayawisnuwardhani, dochter van 
Kërtaiajasa (19); 

Baden Cakradhara, hare gemaal (A); 

Bhreng Daha II, hare zuster (20); en 

Baden Kuda mërta, (Bhre) Wëngkër I, Pramecwara I van Pamotan, Wga- 
yanyasa; de gemaal van deze (B); 

Bhreng Kahuripan's zoon, Hayam Wuruk, Bhatara prabhu, Rajasanagara, 
Hyang Wëkasing suka I (21); 

Paduka fori, diens gemalin (25), die bl. 29 reg. 18 de dochter blgkt te zijn 
van Pramecwara I, d. i. den gemaal van Bhreng Daha II, zie boven; 

1) DaideljUieidBhalTe zullen van hier te beginnen ter onderscheiding ran de gemkiutmige personen 
Romónache Tolgefifdrs worden gehmikt, terw^l tevens tosschen haalqes het Arabische qjfier of de hoofdletter 
xaï worden «angegereDf waarmede de te noemen personen in den hier elders te Tinden geslachtsboom, ten 
gtrieve Tan den leier, voonien z\jn. 

2) Zooals straks zal moeten worden gereleveerd, had de stiefzoon van Bhre Kahuripan, HitpraóhH Utri 
\ mA nskiMidiiigeii, nair de naam van z^n gide wordt niet vemseld. 



Hoofdstuk X. — 144 — AAMTEEKnmio. 

een dochter van haar, wier naam niet genoemd is (22); en 

Raden Larang, Bhreng Matahnn I, de man van deze (C); 

Bhreng Pajang I, hare tweede en jongste dochter (23); 

Raden Sumana, Breng Paguhan I, de gemaal van deze (D), en 

Kërtawardhana, Bhreng Tnmapël I, haar stiefzoon (24) i). 

Moest nu in de aanteekening bij het vorige hooldstnk reeds stil worden 
gestaan bij het overlijden van Bhreng Kahuripan II en Bhreng Daha 11^ in dit 
hoofdstak vermeld bl. 29, reg. 31 en volgg., hier moet reeds dadelyk worden 
geconstateerd, dat de dood van den gemaal van de prabhu istri I (A), en die 
van hare eerste niet met name genoemde dochter (22) nergens gemeld wordt, 
zoodat hier nog slechts resten Parame<;wara I van Pamotan (B), Hyang WÖkasing 
suka I (21), Paduka ?ori (25), Bhreng Matahun I (C), Bhreng Pajang I (23), 
Bhreng Paguhan I (D) en Bhreng Tumapél I (24), waar er quaestie van zgn kan 
ook de dood dezer personen vast te stellen. Volgt men nu daarbg een regel, 
die voor de hand ligt, en ook hier tot naar het schgnt niet te verwerpen uit- 
komsten leidt, nl. dat iemand van een voorafgaand geslacht eerder van het tooneel 
verdwynt dan die behooren tot een volgend, dan vindt men den dood van deze 
personen aangegeven, 

Prame^wara I van Pamotan (B), f 1310, bl. 30, reg. 19: 

Hyang Wëkasing suka I (20), t 1311, bl. 30, reg. 24; 

Paduka Cori (25), f 1311, bl. 30, reg. 22; 

Bhreng Matahun I (C), t 1311, bl. 30, reg. 21; 

Bhreng Pajang I (23), f 1311, bl. 30, reg. 22; 

Bhreng Paguhan I (D), t 1311, bl. 30, reg. 22; en 

Bhreng Tumapël I (24), t 1308, bl. 30, reg. 1; 
waarmede men reeds dit resultaat heeft bereikt, dat er tot een volgend geslacht 
zou kunnen worden overgegaan. 

In de opsomming van zooeven werd evenwel niet vermeld de Bhre Oondal, 
genoemd op bl. 27, reg 26. Dit geschiedde daarom niet, omdat het verband t. 
a. p. alleszins onduidelgk is. In de vertaling werd aangenomen, dat er een man 
bedoeld is, en daarmede tevens dat er van een nog niet genoemde Bhreng Kahu- 
ripan wordt gesproken. Dit laatste is echter geenszins aannemelgk, doch het was 
ondoeniyk de voorkomende woorden zoo te vertalen, dat zg in 'tHollandsch even 
onduidelijk zouden zijn als in den tekst, welke mogelijk een fout bevat, of een 
leemte heeft, die niet te verbeteren of aan te vullen is, terwgl het onmogelgk is 
uit te wyzen of hier werkelijk van een man, dan wel van een dame wordt gewordt 
gewaagd. In het wilde gissende, zou men er de ongenoemde zuster van Hayam 
Wumk in kunnen zoeken, wier dood dan wel vermeld zou zgn. Veiliger is het 
evenwel de zaak in het midden te laten, te meer daar zulks niet direct schade 
schgnt te doen, en daarom dan ook bleef deze persoon onvermeld. 

\) Sr wordt bl. 27 reg. 26 nog gesprokea van een Bhre GaQ^^l* Over deien persoon zie men beneden. 



Hoofdstuk X. — 145 — Aantbbkshiko. 

Uit het laatste geslacht^ dat behandeld werd, sproot slechts eeu zestal 
kinderen. 

Rajasanagara (Hayam wnruk) had een dochter en een zoon : de ,,schoone 
Bhre Lasëm I (d.) (26), en 
Bhre Wirabhumi (27), bl. 29, reg. 18 en 19 ; 

Bhre Pajang I (en Bhre Paguhan I) hadden drie kinderen: 
Hyang wi^esa (28), de , dikke" 
Bhre Lasém II (d.) (29), en 
Bhre Kahuripan III (d.) (30); 

en Bhre Tumapél I een zoon, 
Raden Sotor (31). 

Van dezen huwden de vier eersten over en weer met elkander, zoodat Bhre 
Lasém I, de schoone (26), de vroaw werd van Hyang wi^e^a (28) en Bhre Wira- 
bhnmi (27) Bhre Lasëm II, de dikke (29), tot vrouw kreeg, zie bl. 29 reg. 21 en 
23, terwijl Bhre Kahuripan (30) in het huwelijk trad met Raden Sumirat, Bhre Pandan 
Salas I (40); bl. 29, reg. 26, den zoon van Raden Sotor, die hier reeds dadelijk 
te noemen is, om geregeld voor te kunnen gaan, en uit deze drie huwelijken werden 
weer verscheidene kinderen geboren. 

Uit dat van Hyang wi<;e^, (28), het is voldoende alleen den man te 
noemen, ontsproten: 

Hyang Wëkasing suka II (36), bl. 29 reg. 22; 
Bhre Tumapël II {a) (37), bl. 30, reg. 3; 
Dewi Suhita, fwahhu üiri II (d.) (38), bl. 30 reg. 4, en 
Bhre Tumapël III {b) (39), bl. 30 reg. 5 ; — 

Bhre Wirabhumi's (27) kroost was: 
Bhre Pakëmbangan (32), bl. reg. 9; 
Bhre Mataram I (d.) (33), bl. 30 reg. 10; 
Bhre Lasëm III (d.) (34), bl. 30 reg. 11 ; en 
Bhre Matahun II (d.) (35), bl. 30 reg. 11 ; — 

dat van Bhre Pandan salas I (40) was: 
Bhre Eoripan IV, Bhre Hyang Paramegwara II (47), bl. 30, reg. 5, 
Bhre Lasëm IV (d.) (48), bl. 30 reg. 7 ; en 
Bhre Daha III (d.) (49), bl. 30 reg. 8. 

Terwijl dit jongere geslacht weer grootendeels met elkander in het huwelijk 
treedty en daaruit weer een nieuwe generatie voortspruit, blijkt het dat deze laatste 
zoo goed als kinderloos is, want er worden ten minste slechts een paar kindereu 
genoemd, en men mag dus zeggen, dat in het vijfde geslacht na Kërtarajasa (Raden 
Wgaya) het machtige stamhuis van Majapahit reeds aan het uitsterven is, vooral, 
omdat er van een huwelijk door spruiten van dat geslacht, en van door dezen 
verwekte kinderen niet meer wordt gewaagd. 

Nu kan ten deze wel worden aangenomen, dat de Pararaton in dit opzicht 

Ve^ Bst Oen., deel XLIX. 10. 



Hoofdstuk X. — 146 — Aanteekeniko. 

gebrekkig is^ en dat het geslacht zich wel verder heeft voortgezet, maar men dient 
daarbij dan toch in het oog te houden, dat de mededeelingen in het boek gedaan, 
zich in den tijd verder uitstrekken dan het leven gereikt heeft der reeds vermelde 
nakomelingen van Raden Wijaya, van welken hier straks ook de anderen nog zullen 
worden genoemd, en dat zich daarbij het eigenaardige verschijnsel voordoet, dat 
het sterQaar, althans de dood, van haast allen wèl wordt gemeld, zooals hier reeds 
dadelgk, alvorens verder te gaan, in het licht gesteld zal worden voor die per- 
sonen, welke hier met name al genoemd werden. 

Onder dezen is Raden Sotor (31), de zoon van Bhre Tumapël I (29) en 
de vader van Raden Sumana, Bhre Pandan salas I (40), voorbijgegaan. Van zgnen 
dood vindt men geen melding gemaakt, ook niet onder een anderen naam, doch 
die der overigen wordt, behoudens van één persoon, Bhre Lasëm (IV) (48). gecon- 
stateerd. In de volgorde waarin zij hier achter elkander werden genoemd, vindt 
dat aangegeven van 

Bhre Lasëm I, „de schoone*' (26), f 1323, bl. 30, reg. 36; wel is waar, 
wordt daar ter plaatse hare bijnaam niet vermeld, doch als men ziet wie ongeveer 
gelijktydig met de daargenoemde persoon overlijden, en in aanmerking neemt, dat 
zg elders niet genoemd wordt, dan ligt het voor de hand te veronderstellen, dat 
zg en geen ander bedoeld is; 

Bhre Wirabumi (27), f 1328, bl. 31, reg. 13; 

Hyang wi?esa (28), f 1351, bl. 31, reg. 26; 

Bhre Lasëm II (29), f 1323, bl. 30, reg. 37 ; 

Bhre Kahuripan lU (30), f 1323, bl. 30, reg. 37 ; 

Bhre Pandan salas I (40), f 1323, bl. 31, reg. 1. Vervolgens is vermeld 
het overlijden van 

Hyang wëkasing suka II (46), f 1321, bl. 30, reg. 31; 

Bhre Tumapël II (a) (37), en wel jong, immers een jongere broeder van 
hem, Bhre Tumapël III (6) (39), draagt denzelfden naam als hij, bl. 30, reg. 3 en 4 ; 

Dewi Suhita, prahhu istri II, (38), f 1351, bl. 31, reg. 28; 

Bhre Tumapël III (h) i) (39), f 1349, bl. 31, reg. 24; 

Bhre Pakëmbangan (32), bl. 30, reg. 9, hij sterft op de jacht; 

Bhre Mataram I (33), f 1338, bl. 31, reg. 21 ; 

Bhre Lasëm III (34), f 1355, bl. 31, reg. 31 ; 

Bhre Matahunll (35), f 1338, bl. 31, reg. 21; 

Bhre Koripan IV, Hyang Parame^wara II (47), f 1368, bL 31, reg. 35; 

Bhre Lasëm IV (48), nergens; en dat van 

Bhre Daha III, (49), f 1338, bl. 31, reg. 21. 

Bij het nagaan der huwelijken der laatste personen, te beginnen met Hyang 
Wëkasing II (36), kan de na dezen genoemde Bhre Tumapël II (a) (37), hoe- 

1) Deze ö werd aan zjn naam nog toegevoegd om hem dadelgk te kannen ondenclieiden van zr^u 
mtA i tn a broeder, die met a i» aangeduid. 



Hoofdstuk X. — 147 — AANTESKBinNo. 

wel het niet zeker is, dat het ten rechte geschiedt, zie beneden bij Hoofdstuk XI V, 
buiten beschouwing worden gelaten, omdat hij jong stierf, en er verder slechts kin- 
deren van één Bhre Tumapél worden opgegeven, bl. 30, reg. 12 — 16. Wat de 
anderen betreft, van dezen bleef 

Hyang Wëkasing suka 11 (36) ongehuwd; huwde 

Dewi suhita, prahhu isiri 11 (38) met Bhre Koripan IV, Hyang Parame^wara 
II (47), bl. 30, reg. 6 D; 

Bhre Tumapöl lil {h) (39), zooals verondersteld mag worden met Bhre 
Lasëm III (34), bl 30, reg. 11: Bhre Lasém IV (48), bl. 30 reg. 7, en, wat 
zeker is, met Bhre Daha 111 (41)), satna pamungsuj bl. 30, reg. 8; bleef 
Bhre Pakémbangan (32) ongehuwd; doch huwde 

Bhre Mataram 1 (33) weer met Hyang Wi^esa (28), bl. 30, reg. 10; werd 
Bhre Lasém III (34) zooeven reeds genoemd als een der vrouwen van 
Bhre Tumapél III (h) (39); huwde 

Bhre Matahun II (35) met een Bhre Wéngkér II (41), die nog niet genoemd 
werd, maar straks te noemen is; en werden de drie laatsten mede reeds vermeld, 
Bhre Kahuripan IV, Hyang ParamcQwara II (47), als de gemaal van Dewi 
Suhita, prabhu uftri 11 (38), en 
Bhre Lasém IV (48) en 

Bhre Daha lil (49), als vrouwen van Bhre Tumapél III (ft) (39). 
Slechts het huwelijk van Bhre Tumapél III (ft) (39) werd met kinderen 
gezegend, bl. 30, reg. 12—16. Achtereenvolgens verwekt hij Bhre Wéngkér II (41) 
en Bhre Paguhan II (42), en bij een rabi anotn Bhre Jagaraga I (d.) (43), Bhre 
Tailjung pura (d.) (44), Bhre Pajang II (d.) (45), en Bhre Kéling (46), die allen in 
het hnwelgk treden, en wel, zooals reeds van den eersten verteld moest worden, 
Bhre Wéngkér II (41 ) met Bhre Matahun II (35), de dochter van Bhre Wi- 
rabhumi 9 bl. 30, reg. 12 ; 

Bhre Paguhan II (42) met twee zijner halfzusters, Bhre Taüjung pura (44) 
en Bhre Piyang II (45), bl. 30, reg. 14 en 15: 

Bhre Jagaraga I (43) met den boven reeds genoemden Bhre Kahuripan IV, 
Hyang ParameQwara II (47), bl. 30, reg. 13: 
Bhre Taüjungpura (44), en 

Bhre Pajang II (45), met hunnen haltbroeder, zooals reeds werd gezegd: en 
Bhre Kéling (46 ) met een zekere, hier voor het eerst en het laatst genoem- 
de Bhre Kémbang jénar (E), bl. 30, reg. 16; alle welke huwelijken evenwel 
behoudens het eerste, dat van Bhre Wéngkér II (41) met Bhre Matahun II (35) 
kinderloos bleven, want uit dit huwelijk alleen sproot nog voort 

Bhre Kabalan (d.?) (50), bl. 30, reg. 17, terwijl Bhre Paguhan II (42), 
zooals er bericht wordt, nog een dochter had bij een /rfa/r»ya-vrouw. 



1) Ovflr dit liaweljk zie men ook de aanteekening b^ Hoofditak XIIL 



Hoofdstuk X. — 148 — AANTEEKEinKo. 

Bhre Singapura (d.) (51), bl. 30, reg. 17. 

Is hiermede de opsomming voltooid, er is nog iets op te merken voormen 
in staat is er gevolgtrekkingen tegenover het eind van het boek uit af te leiden, 
en ook nog eene bijzonderheid, die voorbij werd gegaan, onder een behoorlijk 
lieht te plaatsen. Er dient nl. ook nog aangegeven te worden of en waar nu ook 
van deze laatste personen in het geschrift de dood vermeld wordt. Zulks is 
noodig om aan te toonen, dat met het XII, XIII en XI V^ Hoofdstuk de geslachts- 
boom inderdaad ten einde loopt, en dat de verder genoemde personen daarmede 
geen verband houden, dit althans op geenerlei wijze blijkt. Door zulk een opgave 
slechts zal men in staat zijn het reeds gezegde te controleeren. Zij moet als volgt 
uitvallen. 

De dood van Bhre Wëngkër II (41), f 1351, wordt geconstateerd, bl. 31, 
reg. 25, en zoo vervolgens die van 

Bhre Paguhan II (42), f 1373, bl. 32, reg. 4 ; 

Bhre Jagaraga I (43), f 1373, bl. 32, reg. 4; 

Bhre Taïïjungpura (44), nergens; 

Bhre Pajang, II (45), f 1372, bl. 32, reg. 6; 

Bhre Këling (46), f 1369, bl. 31 reg. 36; 

Bhre Eémbang jénar (E), nergens; 

Bhre Kabalan (50), f 1373, bl. 32, reg. 5, en van 

Bhre Singapura (51), nergens. 

Wie zich met behulp van deze uiteenzetting de moeite geven wil den tekst 
geregeld na te gaan, zal zien dat alle meer op den voorgrond tredende personen i) 
in Hoofdstuk X — XII, behalve een zekere Raden Gajah, bl. 31, reg. 12 en 32, 
die van vorstelijken bloede moet zijn geweest, raileny terecht konden worden 
gebracht ^), en verder dat Hoofdstuk XIII en XIV nieuwe personen leveren, die 
wel namen dragen als anderen in het voorafgaande droegen, maar die toch niet 
dezelfden kunnen zijn, daar zij, die die namen voerden, reeds overleden waren: 
Bhre Pandan salas, bl. 31, reg. 31 s); Bhre Daha, bl. 31, reg. 34; Bhre Tu- 
mapél, bl. 32, reg. 1, en Bhra Hyang, bl. 32, reg. 5. 

Nu is het mogelijk, dat wat hier als richtsnoer bij de beoordeeling^ welke 
personen er telkens bedoeld werden, aangenomen is, instede van op den rechten 
weg te voeren, juist geleid heeft tot verkeerde gevolgtrekkingen, en dat juist de 
later genoemden van denzelfden naam de bedoelden zijn en niet de daarvoor ge- 
kozenen. Men heeft intusschen gezien tot welk een resultaat de methode heeft 
geleid, en het blijft een ieder vrij, ten minste wat het laatste gedeelte der voor- 



1) Hiertoe behoores, ia het Terband hier» niet Këmbar, Tuhan Woroju, en anderen, die op bladsgde 
28 en 29 voorkomen. 

2) Over de poHk's vindt men iets hij Hoofdstuk XIII. 

8) Raden Jag^uln is hier overgeslagen, omdat hq dezelfde persoon son kannen zqn als Pan4<ui Salas 
U t. p. 



Hoofdstuk X en XI. — 149 — Aabt. en Vkrt. 

afgaande uiteenzetting betreft, van een andere meening te zijn, dan nit het toe- 
passen dier methode moest voortvloeien. Toch mag er hierbg wel op gewezen 
worden, dat in het laatste gedeelte alle nadere aanduidingen omtrent de eigentlijke 
persoonlijkheid van de genoemden ontbreken, en dat men zonder zich op de een 
of andere wijze, te recht of ten onrechte, een norm te stellen, uit den doolhof niet 
geraken kan. Voorshands althans schgnt er geen literatuur voorhanden te zgn, die, 
waar het hier op aankomen zou, eenig licht zou kunnen verspreiden over het laatste 
gedeelte van de Pararaten, en men neme de uiteenzetting dan ook voor niet meer 
dan waarvoor zij gegeven wordt, een poging om den weg te vinden of te wijzen, 
waar men het voetspoor zoo gemakkelijk bijster worden kan. 

De bgzonderheid in dit hoofdstuk, waarop nog de aandacht moet worden 
gevestigd, en tot nog toe voorbij werd gegaan, is deze dat Bhre Wirabhumi, Riya- 
sanagara's (Hayam wuruk's) zoon uit een rabi haji, als kind werd aangenomen door 
een Bhre Daha. Het zou voor het inzicht in Hoofdstuk XII van zeer veel belang 
zijn te weten, wie daarmede bedoeld is. Zooals uit de uiteenzetting boven blijkt, 
waren er tot in 1338 i^aka drie Bhre Daha's, die althans genoemd werden: 

Bhre Daha I, de gemalin van Eértarajasa, 

Bhre Daha II, diens dochter, de zuster van de eerste prabhu islri, en 

Bhre Daha III, de achterkleindochter van den stiefzoon van deze vorstin. 

Dat het de laatste wezen zou, die Bhre Wirabhumi tot zoon had aangeno- 
men, is volslagen ondenkbaar, daar zij, hoewel van moederszijde gelijkgradig met 
een dochter van hem, van vaderszijde als een zijner kleinkinderen te beschouwen is. 
Evenmin is het te denken, dat het Bhre Daha I zijne overgrootmoeder was, en 
zoo rest er dus, wat ook de gedachte is, die zich het eerste opdringt, slechts 
Bhre Daha IL Dit laatste zou ook in overeenstemming zijn met het feit, dat hare 
dood, zie boven, eerst later wordt vermeld, tusschen 1293 en 1298, en de om- 
standigheid, dat zij zijn jongere grootmoeder zou kunnen heeten, is, hoewel er in 
zulk eene adoptatie iets vreemds zou liggen, vooral bij de Javanen, die de geslach- 
ten zoo sterk uiteen plegen te houden, toch niet voldoende om de mogelykheid er 
van geheel te ontkennen. Hoe dit intusschen ook zij, zooals men l^ij Hoofdstuk 
XII en XIII zien zal, waar op deze zaak terug zal dienen te worden gekomen, 
ook zoo zijn de bezwaren nog geenszins uit den weg geruimd. 



HOOFDSTUK XI. 



Bhra Hyang wu^esa, als koning Aji Wikrama. Caka 1311 — 1322. 

Bhra Hyang wigesa wordt koning (prabhu). 

Daarop heeft er een bergstorting plaats in de wuku Prang bakat, in i^aka 1317. 

Vervolgens sterft Gajah önggon, in Qaka 1320, na ze venentwintig jaar a/MiAA 



Hoofdstuk XI. _ 150 — Vert. en Aaot, 

te zijn geweest. Bhra Hyang Wëkasing suka zegt dat Gajah mangnri apalih 
moet worden. 

Bhra Hyang Wëkasing suka, nl. die welke stierf te Indrabhawana, en 
bijgezet werd te Tajung, dat ook de dharma te Paramasakapura heet, stierf in 
Qaka 1321. 

Bhra Hyang wi^e^ wordt kluizenaar (onttrekt zich aan de staatszaken), 
in gaka 1322. 

AANTEEKENIN6. 

Na den dood van den vorst, die bij ons het meeste, of al, bekend was als 
Hayam wuruk, en onder wiens bewind Majapahit zijn hoogsten luister schijnt be- 
reikt te hebben, werd Bhra Hyang wigei^ vorst, onder den naam Aji Wikrama, 
zooals men in het vorige hoofdstuk reeds vermeld vond. 

Zijn recht op den troon schijnt hij, die geen zoon van Hayam wuruk was, 
maar slechts de oudste spruit van diens jongere zuster, voornamelijk ontleend te 
hebben aan zgn huwel^k met Bhre Lasëm I, de schoone (26), die, geboortig uit 
Paduka Qori, ons als de aangewezen troonsopvolgster moet toeschgnen, waar Bhre 
Wirabhumi zijn vader na diens dood niet vervangt, zooals Jayanagara, die toch 
ook uit een hini haji(= rahi hajï) geboren was, Kërtarajasa (Kaden Wijaya)had 
opgevolgd 1). Toch schijnt hij ^en heer te zijn geworden over het geheele rijk. 
Zooals het volgende hoofdstuk kan doen zien, was er een oostelijk rijk ontstaan 
naast een westelijk, en was over dit eerste Bhre Wirabhumi, Hayam wumk's 
zoon, koning geworden. Men moet dus aannemen, dat na den dood van den 
grootsten vorst van Majapahit, en misschien wel door zijne beschikkingen, waarbij 
hij, zonder zijne dochter geheel achteraf te zetten, toch ook aan zijn zoon een deel 
van het door hem bestuurde groote complex wilde nalaten, een gedeelte van het 
rijk aan Bhre Wirabhumi gekomen was, die daardoor, naast Hyang wi^e^a, den 
vorst over het westelijke gedeelte van Hayam wuruk's nalatenschap, het bestuur 
was gaan voeren over een oostelijker gedeelte van Java, oost- Java, Balambangan, 
doch hiervoor zie men bij het volgende hoofdstuk. 

Hyang wi^e^a had spoedig na het aanvaarden der regeering den dood van 
zgn zoon te betreuren, dien hij verwekt had bij de „schoone" Bhre Lasëm, de 
dochter van Hayam wuruk, nl. Bhra Hyang Wëkasing suka II, die dus juist 
heette als ook een der namen van den vorigen vorst, zijn grootvader van moeder- 
szijde, was. Blijkbaar had het jonge mensch reeds een aandeel gekregen in de 
regeering, daar hij, en niet zijn vader, den nieuwen juilih schijnt te benoemen. 

In het jaar na zijns zoons dood trekt Bhra Hyang wi^efia zich uit de regee- 

1) l)e YerhondinfT Ach^nt evenwel niet dexelfde te x^n geweest. Bhre Kahoripan II en Bhre Dahall 
waren de jongere snuters van Jayanagara, f ie bl. 27 reg. 3; Bhre Lasém I daarentegen was Termoedel^k de 
oudere initer ▼au Bhre Wirahhnmi, want s^ wordt eerdqr genoemd, xie bl. 29 reg. 19. 



Hoofdstuk XI en Xn. — 151 — Aaitt. en Vebt. 

ring terng, haar, zooals zoo dadelijk blijken zal, overlatende iian zijne dochter Dewi 
Snhita^ doch naar het schgnt niet voor goed, men zie het volgende hoofdstak. 



HOOFDSTUK XII. 



Dewi Sukitüy als koningin Bhalara istri. Caka 1322 — 1351. 

Bhatdra istri 1) wordt koning (prabhu), 

Bhre Lasém sterft in de Kawidyadharen, wordt bijgezet te Pabangan, dat 
als dharma Lak^mipura heet. 

Bhre Kahuripan sterft. 

Bhre Lasëm, de dikke, [31] sterft. 

Bhre Pandan salas sterft, en wordt bggezet te Jinggan, als dharma Qit 
WLpnupnra geheeten. 

Bhra Hyang wi^e^ had onaangenaamheden met Bhra Wirabhümi, . . 

...... (?) 2). 

Drie jaar daarna had er weder een krijg ^) plaats. 

Beiden maakten zij zich tot den strijd gereed; aan Bhre Tumapël en Bhra 
Hyang Paramen wara zonden zij beiden bericht: „Wien zal ik helpen?" (zeiden 
dezen). Toen het tot den strijd kwam, verloor het westelijke rijk het, (en had dus) 
Bhra Hyang wi^e^a tegenspoed. Hg trok zich dat aan en wilde zich terugtrekken. 
Dit werd aan Bhre Tumapël en Bhra Paramegwara bericht. (Dezen zeiden toen) : 
^Laat hy niet te spoedig zich terugtrekken, ik zal hem (zijn vijand) weerstaan*'. 
Dit gaf Bhra Hyang wi^e^a weer moed. Hg trok weer op, en herstelde het ver- 
lorene weer met de hulp van Bhre Tumapël en Bhra Parame^wara. Het oostelgke 
rgk verloor het. Bhre Daha werd door Bhra Hyang wi^e^a geschaakt, en naar het 
westen gevoerd. Bhre Wirabhumi toog in den nacht weg, besteeg ^) een schip, 
maar werd gevolgd door Raden Gajah, die tot ralu angabhaya, onder den naam 
Bhra Narapati gezalfd was (of werd). Hij werd aan boord achterhaald, gedood ^) 
en onthoofd ^) en (zijn hoofd) naar Majhapahit gebracht. Hij werd bijgezet te 
Lung, dat als dharma Gorigapura heette, in i^aka 1328; (in hetzelfde jaar) had 
deze groote krgg plaats. 



1) Dewi Sohita, zie boven. 

2) Td 't Jav. dadi deniradampul, aèëlak mati stradampul i faka 182S. In de gewoone betee- 
kenis geeft dampml hier geen zin. 

8) In 't JaT. parigrig, 

4) In 't Jat. htmulumpoJt. 

5) In 't Jay. wUnoktan» 

6) In 't Jay. pMk. 



Hoofdstuk XII. — 152 — Vert. en Aaht. 

Vier jaren daarna overleed i) Gajah Manguri, in Qaka 1332. 12 Jaar was 
hij patik, Gajah lëmbana volgt hem palih op ^). 

Daarop had in de wuku Jalung-pnjnt een bergstorting plaats, in Qaka 
1333 3). 

Gajah lëmbana stierf ^) in Qaka 1335. Drie jaar was hij patih. Tnhan 
Kanaka volgt hem als apatih op ^). 

Bhre Daha sterft, Bhre Matahun sterft, Bhre Mataram sterft. 

Daarop had de groote lontaran (?) plaats, in (Jaka 1338. 

En de groote hongersnood in Qaka 1348. 

Bhre Tnmapël sterft in Qaka 1349, hij wordt bijgezet in Lo-kérép, dat als 
dharma Amarasabha heette. 

Bhre Wéngkër sterft, en wordt bijgezet in Sumëngka. 

Bhra Hyang wi^esa sterft en wordt bijgezet te Lalangon, dat als dharma 
Paramawi^e^apnra heette. 

De prahhu xslri stertt in 1351. 

AANTEEKENIN6. 

In de aanteekening bij het XI<» hoofdstuk, dat de regeering van Bhra Hyang 
wi^efa omvat, moest reeds opgemerkt worden, dat deze vorst, wel is waar op een 
gegeven oogenblik van de regeering afstand doet, en door zijne dochter wordt 
opgevolgd, maar dat dit, naar het zich laat aanzien, niet voor goed was. In dit 
hoofdstak nl. treedt hij weder op het tooneel, en wel op zulk eene wijze, dat men 
baast zeggen zou, dat hij de regeering maar weer op nieuw had opgenomen, doch 
men zie hierover wat straks volgt. 

Wie de bhatdra islri (prabhu) was, die na zijn hhagawan worden den troon 
besteeg, leerde het X^ hoofdstuk reeds, waar bericht werd, dat Bhra Hyang wi^esa 
ook een dochter kreeg, de bhre prab'm stri, die Dewi Suhita heette. Het is deze, 
die bedoeld moet zijn. 

Maar al volgde zij haren vader toenmaals, in 1322, op, reeds is bet volgen- 
de jaar, zoo wordt er bericht, heeft Bhra Hyang wi^e^a ongenoegen met Bhre Wira- 
bhumi, en een drie jaren daarna, zegge een viertal jaren (hetél tigang kihun), dus 
in 1326 of 1327, heeft er een groote krijg plaats, tusschen een oostelijk en een 
westelijk rijk. Er wordt bepaaldelijk gesproken van een kadalon wetan en een 
ka^aton kidoriy terwijl, waar het het laatste rijk is dat bij den met afwisselend succes 
gevoerden oorlog het onderspit delft, Bhra Hyang wi^esa in druk geraakt, en omge- 
keerd, zoodra het oostelyke rijk het verliest, Bhre Wirabhumi de vlucht moet nemen. 

1) In 't Jav. atèlaaan, 

2) LeeS: ro wiliu tahuH apatih, gumanti üra Oajah lêmbaua apatih. 

3) Zoo te lexen in plaats van 1348. 

4) In 't Jav. atiUuan, 

5) Leei: Hgtmg tahun apaüh, guituMH Tuha» Kanaka apatih. 



Hoofdstuk Xn. — 153 — Aa^teekeniko. 

Wie Bhre Wirabhumi was, bleek almede reeds uit bet X« boofdstnk; 

lo. wordt daar van bem verteld, dat bij een zoon was van Hayam wuruk 
bij een sélir, bl. 29 reg. 18, dus een balve broeder van de „schoone" Bhre Lasöm, 
de vrouw van Bbra Hyang wi^esa; 

2o. dat bij buwde met de „dikke'' Bbre Lasëm, een zuster van Bbra Hyang 
wigesa, bl. 29 reg. 23, zoodat bij dus met dezen vorst op dubbele wijze verzwagerd 
was, eensdeels omdat bij een broeder was van diens vrouw, anderdeels omdat 
hij een zijner zusters tot vrouw had; en 

3o. dat hij door Bhre Daba tot zoon was aangenomen, bl. 29 reg. 19. 

Na hetgeen in de aanteekeing bij Hoofdstuk XI reeds opgemerkt werd 
over een vermoedelijke splitsing van bet rijk van Hayam wuruk, misschien wel door 
deze zelf, is vooral dit laatste bier, behalve nog andere zaken, waarover da- 
delgk, daar het bovenal te doen moet zijn om de geloofwaardigheid van de Pa- 
raraten in het licht te stellen, van belang; immers uit dit laatste volgt direct dat 
Bhre Wirabhumi ook putra ing Daha, pulrettg Dahu, zou kunnen heeten, of dat 
er, op een andere wijze bet uitdrukkende, over bet oostelijke rijk toen ter tijde 
een Pntreng Daba stond. 

Welken de beide rijken waren, behoeft eigentlijk geen toelichting. Bbra 
Hyang wi^jesa was in 1311 Qaka prahhu geworden, en daarmede wordt hier, in 't 
latere gedeelte van den tekst van de Pararaten, de vorst van Majapahit bedoeld. 
Het andere rgk moet oostelijker hebben gelegen, en bet kan dus kwalijk iets an- 
ders zgn geweest dan wat reeds oudtijds het rijk van Balambangan >) werd ge- 
noemd. Dat komt zelfs nog nader uit. 

Graat men het bericht over dezen krijg nog verder in bijzonderheden na, 
dan ziet men hoe er ook een 'vorst (of regent) van 'fumapél een belangrijke rol 
in heeft gespeeld. Van weerszijden aangezocht door de beide tegenover elkander 
staande rgken, om zich bij hen aan te sluiten, aarzelt hij eerst, evenals de nevens 
hem genoemde Bbra Parame^wara, bij wien men evenzeer hulp zocht, maar be- 
sluit bjl toch iets later om aan het westelijke rijk de hand te reiken, als hij ziet, 
dat dit het aflegt ^). Daardoor wordt bij van dit rijk de bondgenoot, en zóó, 
men zou zoo kunnen zeggen, als 't ware één met Majapahit. 

Maar hier blijkt tevens, dat met die knflaton ivelan naast Majapahit (waar- 
van de residentie Snrabaya de hoofdzetel was) ook Tumapél (= Singasari = Pa- 
sumhan) niet bedoeld kan zijn, en dat men dat oostelijke rijk verder, oostelijker, 
moet zoeken. 



1) In de Pmiaraton komt dese naam niet vuor. 

2) M«n hoodt in 't oog dat drze Bhre Tumapél, volgens de berekening bq Hoofdstak X, slechts ge- 
weeat kan z^n Bhre Tnmapèl (è* (39), de xoon van Hyang wi^eya, tevens de schoonxoon Tan Bhre Wirabhumi. 
Bhim Puamefwum waa Hjang Parame^wara II (47), de zoon yan Bhre Paudan salas I (40), de gemaal van 
Dewi Snhitn (de frmikm ütri); dan terens de schoonzoon Tan H jang wi^eya, wat ook Bhre Tnmapèl {k) (39) 
waa, sie ikUL, en bat slot raa de aanteekening b\j Hoofdstuk VlII. 



Hoofdstuk XII. — 154 — AANTESKENnro. 

Door zich bij Bhra Hyang wi^csa aan te sluiten wordt Tumapél, zoo werd 
er zoo even gezegd^ als 't ware één met Majapahit. 

Men zon dit ook op een andere wijze kunnen aitdrakken. Men zon zich 
byv. eens kannen afvragen welken indruk deze oorlog wel moet hebben gemaakt 
op een vreemdeling^ die, met de plaatselijke omstandigheden nu eens niet bijzonder 
nauwkeurig bekend, hem beleven, hem bijwonen kon. Zou het den schgn niet 
hebben kunnen gehad, alsof hier in dezen krijg in werkelijkheid het rijk van Tn- 
mapél (Pasuruhan) als een westelijk rijk in oorlog was met een oostelijk (Praba- 
lingga, Bësuki, Balambangan\ alsof het de vorst van Tumapél was die oorlog 
voerde met een piUreng Daha? Doch het is niet noodig zulks te vragen. Zonder 
meer kan hier^ na de korte zooeven hier gegeven uiteenzetting, nogmaals een stuk 
worden afgeschreven uit de Notes on the Malay Archipelago and Malacca, door 
den Heer W. P. Groeneveldt uit verschillende Chinecsche teksten saamgelezen. 
Men oordeele zelf of er sprake is van denzelfden krijg, in dezelfde streek, in den 
zelfden tijd, en met denzelfden afloop. 

„When the emperor Ch'êngtsu ascended the throne, — zoo leest men er, 
Verh. Bat. Gen., XXXIX, bl. 36 (162), — he sent Information of it to this country 
(het oostelijk gedeelte van Java), and the next year, 1403 == 1325 (^aka), he sent 
a vice-envoy and a messenger to present the king with silks and gauzes embroi- 
dered with gold. When the envoys had left, the western king, Tumapan, 
sent envoys to congratulate the emperor, who again sent an eunuch and others to 
bestow upon the king a silver seal inlaid with gold. The king sent envoys to 
present his thanks for this seal, and offercd products of his country as tribute. 

„The eastern king, Putling tahah i), also sent envoys tocourtfor 
the purpose of bringing tribute and asking for a seal, and the emperor sent an 
ofScer to bring it to him. From this time the two kings brought tribute. 

„In the year 1405 (= 1327 Qaka) the eunuch Chêng Ho was sent as a 
messenger to this countr}% and in the next year the two kings made 
war upon each other; the eastern king was dcfeated and his 
kingdom destroyed.'' 

„At that time the imperial envoys were just in the country of the eastern 
king, and when the Holdiers of the western king entered the market place 170 
of their followers, were killed by these: on this the western king became af raid 2)^ 
and sent envoys to ask pardon. The emperor gave them an edict, reproving him 
severely and ordered him to pay sixty thousand thails of gold as a fine." Enz. ^). 

1) Volgens eene aaDteekesiBg souden de Chineesclie karakters, waarvan Putling taluüi de iranseriptie 
is ook Piling daha kunnen worden uitgesproken. Dit zon knnnen beantwoorden aan Bhreng Daha; desaak ton 't 
zelfde blgveo, maar ook hier, als in 't westelgke rqk, de fautor Tan den vorst meer op den voorgrond sgn 
gedrongen. Wat Tumapél betreft behoeft men zelfs niet eens zoover te gaan, daar deze naam bg de Chi- 
neezen, zooals uit die berichten blgkt, zoo goed als sjnotiiem is met Java (oost-Java). 

2) NI. voor de Chineezen. Men ziet het, het verhaal is zoo goed als van ooggetuigen. 

S) Het vervolg doet hier minder ter JS^ke. De westen king betaalt slechts een gedeelte, doch krjgt 
de geheele boete daarop kw^t gescholden, 



Hoofdstuk XII. — 155 — Aaxteekening. 

Behalve het voorafgaande^ waarmede gelukkiger en merkwaardiger wgze 
het historisch gehalte van de Pararaton ook wat een ander gedeelte van dit ge- 
schrift betreft, in het licht kon worden gesteld, moet er over de pericope, waarin 
men de mededeelingen aantreft over een krijg tnsschen dat westel^ke en dat ooste- 
Igke rgk^ tnsschen Majapahit en Balambangan nog eene vraag gedaan worden^ 
en wel deze: of het niet waarschijnlijk is, dat men daarin een schildering vindt 
van den krgg en het wapenfeit, die, gecombineerd met allerlei andere zaken (uit 
de folklore) het leven gaven aan den bij den Javanen zoo bekenden Damar Wnlan 
roman, welke nu op deze wijze feitelijk op een historischeu achtergrond zou blij- 
ken te berusten? De aanknoopingspunteu zijn niet velen; doch is zulks wel noo- 
dig? In hoofdzaak, — het volgende toch wordt immers ook hier verteld, — dat er 
onder een vorstin van Majapahit, een groote oorlog gevoerd werd tusschen dat 
rgk en Balambangan, waarbij dit laatste het eerst won, maar later door onver- 
wachte hulp de krijgskansen keerden, zoodat Balambangan te niet kon worden 
gedaan, en dat de vorst van dat rijk door een persoon, die hem opzocht, geveld 
werd en onthoofd, waarna deze zijn hoofd naar Majapahit bracht, is het raam van 
den roman en het beloop van dezen paregrég het zelfde. De held, die hier Bhre 
Wirabhumi (= Menak Jingga) ombrengt, heet hier wel anders : Kaden Gajah, 
Ratu angabhaya, Bhra Narapati, en niet Damar Wulan, de vorstin geen Këücana 
wungUy enz. enz., en men vindt in den roman allerlei verhaald, waarvan hier geen 
spoor te vinden is i), evenals omgekeerd ook de verdere bijzonderheden van den 
oorlog hier anderen zgn, ja, het zelfs met Raden Gajah, die Bhre Wirabhumi versloeg 
en onthoofde^ anders afloopt, daar hij, zooals het volgende hoofdstuk leert, wegens 
dien moord later van kant gemaakt wordt, doch dit alles kan de overeenkomst 
in die enkele, en zeer belangrijke hoofdlijnen niet te niet doen. Is het juist ge- 
zien, dat de Damar wulan roman in zijn opzet inderdaad berust op hetgeen er 
in die jaren is voorgevallen, dan is men, en zulks kan in zekeren zin een winst 
worden geacht, thans ook in staat om eenigszins de waarde van dat verhaal te 
schatten; en wellicht zal het ons straks gegeven zijn na te gaan hoe het lang- 
zamerhand den vorm heeft gekregen, waarin wij het hebben leeren kennen. Dat 
men daarbij vooral het oog zal hebben te richten op de oudste der redactie's, 
welke er van bestaan, dus die, welke Roorda van Eysinga kende, en de dadelijke 
variatie's daarvan, behoeft hier wel niet in herinnering te worden gebracht, waar 



l) De Rangga Uwe van den Damar wulan roman i» natuarl\jk dexelfde aU die welke hier boren in 
Hoofditok V, VI en VIII Toorkomt, ook al zjjn hier z\jne latere gedragingen l^nrecht tegenover g«tteld aan 
wat h\j in de Damar wulan doet. Op den bmid van Lumbang, Mpn Gandring van Lnmbang, in de Damar 
wnlan (ondtte redactie) Mpn Lumbang» werd reeds gewezen in de aanteekening b\j Hoofdstuk ). Verder dient 
er hier nog gelet te worden, in verband met eene opmerking, die strakB in den teint iete lager voorkomt, 
dat Menak Jingga geschaakte prinsessen, Dewi Wahita en Dewi Puyéngan, h|j zich aan zyn hof had, en ook 
de vraag te woiden gefteld of Wahita soms nog een reminiscens aan het Dewi Suhita van dit hoofdstuk soa 
Iraimeii syn. Id Mei^ kon^ar xou 3hre Tumapël )(am)en schuilen* 



Hoofdstuk XII. — 156 — Anmonniniro. 

het daarentegen weer wel van belang kan zijn er op te wijzen, dat Raden Gkijali 
hier, behalve Bhra Narapati, oor ratu auffaffhaifn wordt genoemd. 

Wat de waarde van dezen titel is, werd boven bij Hoofdstak IV reeds 
gezegd, is niet met zekerheid uit te maken, doch zoowel hier als daar moet mes 
vermoeden, dat de rang een vrij hooge was, èn om het gebruikte ratu èn vooral 
om de verhouding, waarin Rangga wuni (Wi^nuwardhana) en Mahisa eampaka 
(Narasinga) tot elkander stonden ^). 

Wie nu die Blire Daha was, die door Bhra Hyang wi^e^a naar het westen 
werd medegevoerd, en of zij de persoon was, welke Bhre Wirabhumi tot zoon had 
aangenomen, is eene zaak die moeielijk is uit te wijzen. De gebezigde uitdrukking, 
in^ètnban, wijst zonder twijfel op een dame, en in de aanteekening bij Hoofdstuk 
X werd het reeds beredeneerd, dat moeielijk iemand anders dan Bhre Daha H 
Bhre Wirabhumi kan hebben aangenomen. Nu kan men gissen, dat de Bhre Daha, 
welke bij Bhre Wirabhumi werd aangetroffen, de dochter was van Pandan Salas I (40), 
Bhre Daha III (49), de echtgenote van Bhre Tumapël (h) (39), of de latere echt- 
genote van deze, door Bhre Wirabhumi bijv. geschaakt, te meer daar Bhre Daha II 
(20), volgens de berekening boven, reeds tusschen 1293 en 1298 overleden was. Maar 
terwijl dit op zich zelf reeds slechts een gissing is, zijn daarmede de moeielijkheden 



1) Van het Dam&r wulan verhaal bestaan er veracheidene redacties, onder welken de tekst die tan 
Roorda Tan Eysinga bekend was, en die een andere is dan de door Winter gebruikte, zeker de ondste is, looals 
reeds bekend werd gesteld in Nog eenige Javaansche pisgëm's uit het Mohammedaansche tjjdvak afkomstig 
Tan Mataram, Bantën en Falembang, T^dschr. Ind. T. L. en Vk., XXXII, bl. 594. Van het begin Tin dese 
redactie bezit het Bat. Gen. een exemplaar op palmblad, met oud-JaTaansch schrift geschreTen. De tënf- 
kala er in is mantri-kuda-obah-ringrat^ 1673^ A. D. 1748. Wat Roorda Tan Eysinga van het boek leide, 
in zgn Handboek, III, 2, bl. 30, „in het laatst der vorige eeuw is zjj uit een JaTaanseh handschrift, dat in 
eene oudere JaTaansche taal geschreTen was, in een JaTaanseh dat aan het tegenwoordige geljk staal OTer- 
gebragt", is dus geenszins zoo onjuist als men wel gemeend heeft, tenzg men hier bepaald wil Tallen oTer taal in 
plaats Tan schrift, die beiden, ook nu nog, zoo menigwerf met elkander Terward worden. De Hollander was 
onnauwkeurig, toen h\j in zjjn Handleiding bij de beoefening der JaTaansche taal- en letterkunde (1848), bl. 288 
(A, no. 47) «oud-JaTaansch" in de plaats stelde Tan wat men b^ Roorda Tan Eysinga Ti ndt. Van desen tekil 
bestaan Terscheidene Tariaties, welke Tooral in het naspel, de lotgeTallen van Damar wulan als h^ koning ge- 
worden is, onderling sterk afweken. In de verzameling te Leiden wordt deze redactie Tertegenwoordigd door 
no. CXIX (Cod. 1845) en CXX (Cot. 1838) Tan den Catalogus van Prof. Vreede. Een tweede is die welke 
"Winter in proza overbracht, zie Tqdschr. Ind. T. L. en Vk., IV, 199, en Verh. BatOen. XXX, en waarrande 
Hollander, in zgn Handleiding van 1848, op bl. 1 58 en volgg., het begin uitgaf. Hier luidt de sëngkala tM7'0é«i- 
nimggang-jalma, 1765; te Leiden CXIV (Cot. 1797), CXVII (Cot. 2117)?, en CXV (Cod. 2152), deproiabe- 
werking. Ten derde Tindt men de redactie, welke door de firma Tan Dorp te Samarang onder toezicht yan Raden 
Paflji Jayasubrata werd uitgegeTen, en zeker nog jonger is. Deze werd, Tolgens eene aanteekening Tan Raden 
Mas Ismangun Dannwinata, TerTaardigd door Raden Rangga Prawiradiija, weleer wëdana mancanigara te Maaapa- 
ti; te Leiden in CXVI (Cot. 1866(2)) en CXVIII (Cod. 219?)?. BehalTc dezen bestaan er nog andere re- 
daetie's, althans fragmenten daarvan, die Tan minder beteekenis schijnen te zijn. Van Teel belang daaren- 
tegen zou wel eens kunnen bljjken te z^jn, wat men aantreft in een Sérat kauda, en hier beneden achter 
Hoofdstuk XVIII, in een extract uit dat boek, dient medegedeeld te worden. Een Damar wulan in ^«^0n Torm 
Tindt men in Tqdschr. Ind. T, L. en Vk., XXXVIII, 457; op het einde Tan deze wordt hier, in verband 
met wat de Pararaton omtrent de latere lotgcTallen Tan Raden Gi^ah Terhaalt, nog eens de aandacht gcTestigd. 



HoovDSTüK Xn. — 157 — Aaütteekekiho. 

omtrent deze persoon toch nog niet uit den weg gemimd, daar, terwgl volgens 
dezelfde berekeningen ook de dood van deze Bhre Daha, Bhre Daha III (49), ons 
straks in ditzelfde hoofdstuk, bl. 31 reg. 21 wordt bericht, f 1338, er in 't vol- 
gende hoofdstuk weder een Bhre Daha ten tooneele treedt, in wier persoon, want 
ook daar moet een vrouw bedoeld zijn. men onwillekeurig weder iemand ziet, die 
tot Bhre Wirabhumi in een nauwere betrekking stond, en dus of de persoon was die 
door Hyang wi^e^ uit het oostelijke rijk gehaald werd, 6f wel die welke hem 
als kind aannam. Doch hierover zie men wederom verder bij het volgende hoofdstuk. 

Zooals men gezien heeft, werd hier, omdat de Pararaton het niet uitdruk- 
kelgk zegt, voorzichtigheidshalve geregeld slechts vermoedender wijze gesproken 
van een op nieuw aan het bewind treden van Hyang wife^a, nadat hy in 1322 
Qaka bhagawan geworden was, maar het bleek ondertusschen uit het uit de Notes 
van den Heer Groeneveldt aangehaalde, dat wat er over de parëgrèg i) in de 
Pararaton voorkomt, ons feitelijk ook door de Chineezen wordt bericht. In het 
aangehaalde wordt de naam van Hyang wifesa, die er slechts wordt aangeduid 
met ^the western king, Tumapan'', niet genoemd. Daarom is het van belang bij 
dit hoofdstuk nogmaals naar die Notes te verwijzen, omdat men daar iets lager 
nog deze mededeeling aantreft: „In the year 1415 ( = Qaka 1337) the king 
adopted the name Yang Wi-si-sa, and sent envoys to thank the emperor for his 
kindness, and to bring as tribute products of the land". In dit gedeelte toch 
vindt men èn den naam van den vorst zelf, èn schijnt het al evenzeer, dat Hyang 
wife^a ook in een lateren tgd nog de teugels van het bewind in handen had. 
Het jaar 1415 (:=Qaka 1337) valt lang vóór zyn dood, want Hyang wife^a, die 
dus inderdaad op nieuw de regeering in handen schijnt te hebben genomen, sterft, 
volgens de opgave, bl. 31, reg. 26, eerst ruim twintig jaren na de paregreg, in 
1350 of 1351 Qaka, terwijl zgne dochter, de prabhu istri II, hem slechts kort over- 
leeft, daar hare dood onmiddelgk na den zijne wordt bericht. 

Hoewel in deze aanteekeningen overigens het doel slechts is den tekst van 
de Pararaton zooveel mogelyk toe te lichten, ook om hare zeker niet geringe geloof- 
waardigheid in het licht te stellen, schgnt het hier echter niet ongepast nog iets 
verder te gaan, en op nog een paar bgzonderheden te wijzen, die onder de periode 
1311 — 1351 Qaka vallen, maar in de Pararaton niet vermeld zijn, en slechts in 
de Notes worden aangetroffen. 

Uit die Notes blijkt nl. op bl. 110 (231) en 112 (233) dat een zeker ge- 
deelte van Bomeo's westkust, dat met den naam Puni wordt aangeduid en niet 
geïdentificeerd kon worden, aan Java tijdens Hayam wuruk tribuutplichtig is 
geweest en dat nog in dezen tgd was. 

Naar dat Puni zond de Chineesche keizer in 1370 (=Caka 1299) een 
gezantschap. Er heerschte daar een hooghartige koning, maar deze werd terecht 



1> B!tgrt§ «s rhltg =• rwmg - luntg N. Jat. en ook wtg in 't BaL 



Hoofdstuk XII. — 158 — Aajtteekening. 

gewezen. Het land was toen juist geplunderd door lieden van Sulu; en de koning 
vroeg daarom vrijstelling van belasting voor drie jaar, doch men deed hem weten, 
dat dat niet ging. „Now, — zoo staat er verder, — this country had hitherto belonged 
to Java, and the people of the latter country tried to prevent him (in de betaling 
van het tribuut aan China^ ; the king was wavering in his decision, but the envoy 
remonstrated with him, saying: „Java has already a long time acknowledged 
itself a subject and brought tribute; why do you only fear Java, and not the 
celestial court? The king then appointed envoys to bring a letter*', enz. 

In 1405 en 1408 (= Qaka 1330) was daar een koning, die met denChi- 
neeschen keizer zeer bevriend, en bij hem zeer in gratie was, doch in 't laatst- 
genoemde jaar reeds overleed. 

„The emperor issued an edict to console his son, Hia-wang, who was 
ordered to succeed his father, and appointed king of the country. Hia-wang and 
his uncle reported that their country had to give Java forty caties camphor baros 
every year, and begged an imperial order to Java that this annual tribute should 
be stopped, in order that it might be send to the imperial court instead; they 
further said that, as they were going home now ^), they asked for the emperor'» 
orders, and for permission to remain at home a year, in order to satisfy the 
wishes of the people; at last they requested that the time for bring^ng tribute, 
and the number of persons who were to accompany it, might be fixed. The em- 
peror acceded to all these wishes; he ordered that tribute should be sent onceiu 
three years, and that the number of persons coming with it should depend on the 
king's pleasure. He also gave an order te Java, telling them not to ask any more 
the annual tribute of this country", zonder dat er evenwel bij opgegeven wordt, 
of Java in overeenstemming met dat bevel ook heeft gehandeld. 

Doch al blijkt hieromtrent niets, en al weten wg nu nog niet waar dat 
Puni eigentlijk lag, zelfs als het van Hiawang voor een gedeelte overgroote be- 
leefdheid tegenover den Chineeschen keizer is geweekt, die hem dat verzoek tot 
hem deed richten, waar zyn vader en hg zelf zulk eene goede ontvangst in China 
hadden ondervonden, er werd toch tegelgkertijd een grootere onafhankelgkheid 
en een zich afscheiden van Java mede beoogd, en, op zich zelf van weinig belang, 
is dit toch in verband met andere feiten van een zekere beteekenis. Want er zgn 
ook nog andere berichten, die er op wgzen, dat het rijk van Majapahit, dat, zooals 
uit dit hoofdstuk bleek, 6f onderling verdeeld was 6f zelfs op Java met vganden 
te kampen had, toenmaals gedurende de regeering van Hyang wife^a en zijne 
dochter, reeds niet meer het machtige Majapahit genoemd kon worden, wat het 
onder de prabhu istri I en Hayam wuruk, laat ons zeggen onder het beheer van 
Gajah mada, geworden en geweest was. Ook elders worden er pogingen gedaan 



1) Het sterfgeval had in Chiaa plaata, waarlieea de koniag xich mrt aqn familie penoonlqk had 
begBven. 



Hoofdstuk XII. — 169 — Aanteekenino. 

het uitgestrekte gebied van het rijk te verkleinen, en goedschiks of kwaadschiks 
schgnt dit gedeeltelijk ook gelukt te zijn. 

Van belang is hier van dit opzicht zeker dat gedeelte van het Chineesche 
bericht over Java tijdens de Ming-dynastie, uit de jaren, die hier in aanmerking 
komen, dat boven werd overgeslagen. Als voorgevallen tasschen 1408 en 1415 
(gaka 1330 en 1337) vindt men //., bl. 37 (163) bericht: ^At that time Pa- 
lembang was onder the domination of Java, and the king of Malacca falsely 
pretended that he had an order from the emperor to claim this possession. 
When the emperor heard this, he gave an edict, saying: When lately the 
eonitch Wu Pin came back, he reported that yon (king of Java) had treated 
the imperial envoys in the most respectful way; no I have heard lately that 
the king of Malacca has claimed the country of Palembang from you, and that 
you have been very much astonished, fearing that this was my will; but I treat 
people in the most upright way, and if I had allowed him to do so, I certainly 
would have sent an open order, therefore you have no reason to be afraid, 
and if bad men make use of false pretences, you must not lightly believe them'', 
een positieve mededeeling van een poging door den koning van Malaka gedaan 
om aan Majapahit een gedeelte zijner onderhoorigheden afhandig te maken. Houdt 
men daarbg in het oog, dat in de genoemde jaren die vorst van Malaka niemand 
anders was dan Mansnr sjah, die van 1374 — 1447 A. D. regeerde, dan valt er 
door een gedeelte van de Sajarah Malayu op dit bericht een eigenaardig licht, 
evenals het op zgn beurt dat gedeelte van die kroniek van bijzonder belang maakt. 

Behalve het boven reeds genoemde bevat de Salalatassalatin (Siyarah Mé- 
layu) nl. nog een ander verhaal over Majapahit, dat, een geheel hoofdstuk be- 
slaande, het XI V«, in 't kort navolgende is 

Toen de vorst ^) van Majapahit overleed, liet hij slechts eene dochter na, 
Raden Oaluh wi ^) kusuma. Deze prinses werd nu, bij ontstentenis van een 
mannelgken troonsopvolger, door Patih Gajah mada tot koningin gehuldigd. Zg 
was en bleef ongehuwd, tot men in de wandeling Gajah mada g^ng beschuldigen 
van de vorstin voor zich zelf bestemd te hebben, en hem dit door het toevallig afluiste- 
ren van een gesprek tusschen matrozen bekend was geworden. Zoo bespeurd 
hebbende dat men zelfs aan zijne integriteit is gaan twijfelen, begeeft hg zich tot 
haar om er haar op te wijzen, dat de tijd voor haar gekomen is om zich in het 
huwelgk te begeven. Zij vraagt hem een sayembara (swayamwara) uit te schrg^en, 
wat hg dadelgk doet. Een ieder, zelfs ouden van dagen, gering volk, mismaakten 
en gebrekkigen, komen op, om voor haar te defileeren, opdat zg hare keuze zal 
kunnen doen, en daaronder ook, en wel in de allerlaatste plaats, een zekere Ei 
Mas jiwa, de aangenomen zoon van een /uti;a/;-handelaar (panadap, Jav. panderes). 

1) Deze wordt hier in dit hoofdstak, evenals elders in de Sigarah Mèlayn, haast geregeld ^a^ora genoemd. 

2) Hier zonder twqfel een verkorting van dewi. Raden galah is bqv. in de Pafiji verhalen gewoonlqk 
4a ondflke dochter uit het hnwelqk van den vorst met de voornaamste gemalin. 



Hoofdstuk XII. — 160 — AANTEEKFNiKa. 

Op dezen viel de kenze^ zoodat hij ralu van Majapahit werd; in welke hoedanig- 
heid hij den naam en titel sang aji Jayaningrat voerde. Nu was dit jonge menach, 
zooals in het voorafgaande reeds was medegedeeld^ in werkelijkheid iemand van 
hooge afkomst; en had hij met zijn pleegvader een afspraak gemaakt deze in 
Gajah mada's plaats patik te maken, als hij soms eens koning van Majapahit wor- 
den mocht. Hij was nl. de zoon van een vorst van Tafijung para ^)j door 
een storm, tijdens een spelevaart, van zijn familie afgescheiden, bg Majapahit 
door dien tuvoak-mdLii opgevischt, en sedert bij hem gebleven, terwijl zijn eigent- 
lijke naam Kirana langu, .c) ^)ïy was. Zijn pleegvader komt hem na zijn troons- 
bestijging aan zijn belofte herinneren, en hij stelt er, zich tevens bekend makende, 
Gajah mada van op de hoogte, die de moeielijkheid weet op te lossen door den 
tuwak man tot hoofd aan te stellen over allen, die dat vak nog verder beoefenden. 
Daarop verneemt men nu in Tafijung pura wie eigen tlijk de nieuwe vorst van Ma- 
japahit is. Zijn vader laat dejuistheid van hetgeen hij verneemt onderzoeken, en als 
het nu ook van die zijde erkend is geworden, schikken zich alle vorsten van Java 
onder zijn bewind. Uit het huwelijk wordt een dochter geboren, die den naam 
krggt van Raden Galuh Candrakirana, en wier schoonheid overal geroemd wordt. 
Dit komt ook ter oore 9an den toenmaligen vorst van Malaka, Sultan Mansur 
shah ^), die besluit haar ten huwelijk te gaan vragen. Hg laat te Singapura en 
te Singaraya een groote vloot gereed brengen van 200 driemasters, stelt zgn ryk 
onder Paduka raja den bandaliara, Sri Naradiraja en Sri Wgadiraja, kiest 40 
edelknapen en 40 freules uit, wier chef Tun Bijasura wordt, en begeeft zich met 
dezen op weg naar Majapahit, ook vergezeld van den vorst van Indragiri, dien 
van Jambi, dien van Lingga en dien van Tungkal ( JjCaJ ) ^), die hij daartoe uit- 
genoodigd had. Als hij Majapahit bereikt, zijn daar ook de vorsten van Daha en 



1) Het citaat boven, uit de Sajarah Mëlayn, Hoofdstuk II, gewaagt Tan een rroeger contact van Ma- 
japahit met dit rjk. De vorst van Majapahit huwt bjj die gelegenheid met Candradewi, een dochter ran Sang 
Saporba (Supraba), terwgl een zoon van deze, sang Maniyaka (verknoeiing van den naam eener andere widadari, 
nl, Menaka, van der Tuuk, Bataksche leesboek, IV, 115), huwt met de dochter van den vorst van Tafijung pan. 
en door zgn vader in dat qjk tot koning wordt aangesteld. In dit hoofdstuk (XIV) wordt deze prioi van 
Ta^jung para de piyut (achter-achter-kleinzoon) van die Maniyaka genoemd. 

2) Na Sèkandar sjah, zie boven, volgden 
Magat, 1274—1276, 
Mohammad sjah, 1276—1838, 

Aba qaid, 1838—1834, 

Modhafar qah, 1834—1874, 

Mansar sjah, 1874—1447, 

Deze laatste vorst vertegenwoordigt het 9e geslacht gerekend van Tribnwana (Nila nttama), die e«n 
broeder was van Maniyaka, uit wien de prins van Ta^jang para was gesproten. Daar deze ran dien Torst een 
afttammeling is in 't 5e geslacht, zie de vorige aanteekening, was de prinses van Miqapahit dos iemand 
ait 't 6e, wat een verschil van drie geslachten geeu. Bij de beoordeeling van het verhaal is het wellicht 
niet ongewenscht hier even op te petten. Candrakirana is het meest bekend als de naam van de prinaei Tan 
Daha, Raden Pafiji Ino Kèrtapati's verloofde. 

3) In Palembang. 



Hoofdstuk XII. — 161 — Aaiïteekeniko. 

van TaSijnng para. Hij wordt luisterrijk ontvangen^ en ziet zich zelfs de hoogste 
plaats onder allen toegewezen. Ook hem stelt nu de hatara van Majapahit 
op de proef^ op een zelfde wijze als hij dat die twee andere vorsten had gedaan, 
door hem, behalve een static-kriS; nog 40 andere krissen ten geschenke te geven, 
van welken de scheeden gebroken waren^ met het verzoek dezen in orde te laten 
brengen. Had hg ze bij de beide anderen weer kunnen laten wegstelen, dit maal 
gelukt het niet; de freules zijn den Javaanschen dieven te slim af. Zoo doen ook 
de jonkers dingen, die de verbazing wekken. Tun Bijasura jaagt een hond, die 
aan een gouden ketting lag, zulk een schrik aan, dat deze losbreekt, en wegloopt, 
en Hang Jébat en Hang KaBturi veroorloven zich de vrijheid in een anders slechts 
door den vorst alleen persoonlijk gebruikte balay te gaan zitten, zonder er zich van 
daan te laten jagen, hoeveel moeite men er zich ook voor geeft, met dat gevolg 
dat de vorst van Msgapahit hun dat nu verder dan ook maar toestaat. Maar 
onder al die jonkers, van wie met name ook nog genoemd worden Hang Lakir, 
Hang Lakiyu, Hang Ali, Hang Sékandar, Hang Hasan, Hang Husen ^i en Hang 
Tnwah, was deze laatste de meest in het oog loopende persoon, bij de mannen 
gerespecteerd, door de vrouwen bewonderd en door de meisjes bemind ; er werden zelfs 
liedjes op hem gemaakt, evenals dat ook geschiedde op een der krijgers van Daha, 
Sangkaningrat 2). De vorst van Majapahit geeft dan ook straks zijne toestemming 
tot het huwelijk. Na groote feesten, gedurende welken Tun Bijasura nog een 
paar stukjes uithaalt ^), heeft het plaats, en eeuigen tijd daarna vraagt Sultan 
Mansur sjah aan zijn schoonvader verlof om met zijne vrouw, de prinses van Maja- 
pahit; Raden Galnh Candrakirana, naar Malaka terug te gaan. Als dit hem is 
toegestaan en hij gereed is om te vertrekken, zendt hij Tun Bijasura tot den 
hatara om Indragiri voor hem te vragen. Het wordt hem geschonken. Dan zendt 
hg nog Hang Tuwah om ook Siantan te verkrijgen ^), wat evenmin geweigerd 
wordt, want zelfs Palembang zou er nog bij gegeven worden, zoo er om gevraagd 
werd. Mansur sjah schijnt echter reeds tevreden te zijn geweest, want hij ver- 
trekt daarop naar Malaka, waar de Majapahit^che prinses later van een zoon. Ra- 
den Këling (^), bevalt 5). 



1) De laatste vier nameu zjn ecu aitbreidiug. Als de gezellen van Hang Tnwah wonlen gewoonlijk 
slechts Hang Jëbat, Hang Kasturi, Hang Lakir en Hang Lakiyu genoemd. 

2) De püntim*% worden medegedeeld, doch zjj zjjn niet terecht te brengen. Van Hang Tnw^ah'n 
heldendaden wordt slechts iets te voren iets medegedeeld^ nl. het geval met den Javaanschen amnk-Xoo^r^ dien 
hj OTerhoop steekt lang voordat men van Malaka vertrok; ook wordt zijn krjjgskrcet «geef mg een 
Laksamana (admiraal) om mede te vechten", vermeld, die hem den b\jnaam van den Laksaniana bezorgde. 

8) Bq aUes wat de Maleiers aan het hof van Majapahit doen z|jn zg, bestudeerd, zoo oiiwelltvend mogelgk. 

4) Ook de vorm der vragen hier is znlk*» in hooge niate; jak'iftfr d'mnvgrahnkfin xnhnikhnikna, 
jakalmo Hj^adapoH diambil juga. 

5) Het OTerige van dit hoofdstnk, dat over Hang Tnwali han IcU, heeft met het oog up Majapahit geen 
beteekenis. Slechts dient er nog uit vermeld te worden, dat Mansur sjah den vorst van Indragiri, dien hg tot 
i^n ichjoonioon maakt, niet naar ggn rqk terug laat gaan, big kbaaromiat hg zich nu als zgn sonverein beschouwt. 

Yerii. Bat. Oen., doel XLTX. U. 



Hoofdstuk XII en XIII. — 162 — Aant. en Vkrt. 

Al is hier de voorstelling een geheel andere, en ook de uitslag niet dezelfde, 
beide mededeelingen, èn de Chineesche èn de Maleische, doen ons weten, dat er 
tijdens het bewind van Mansur sjah door Malaka pogingen, met meer of minder 
gunstigen uitslag, zijn aangewend om zich met een in de buurt van dat rijk te 
vinden gedeelte van Majapahit's onderhoorigheden te verrijken, terwijl uit beiden 
tevens blijkt, dat ook Falembang ondertusschen, na den dood van Gajah mada 
tot die onderhoorigheden is gaan behooren. 

Wat er in werkelijkheid aan historische waarheid in het XIV® hoofdstuk 
van de Sajarah Mélayu schuilt, is zeer moeielijk te bepalen. Hoewel hetkwalgk 
aangaat aan te nemen, dat het geheel zonder historischen achtergrond zou zijn, 
is men bij gebrek aan gegevens van de Javaansche zijde, over hetgeen er in ver- 
haald wordt, toch ook niet in staat er uit te schiften wat meer en wat minder 
vertrouwen verdienen zou, zelfs niet al zou men daarby het eenvoudiger, maar 
zooveel breedsprakiger referaat over de verhouding van Malaka tot Majapahit in 
den Hang Tuwah roman in de beschouwing opnemen. Hier laten wij dat dan daar- 
om ook rusten, te eer nog omdat het hier de plaats niet is een uitvoerige en 
geregelde inhoudsopgave van dat geschrift, of een der redacties er van, te leveren i). 



HOOFDSTUK XIII. 

Bhre Daha (istri), Caka 1359 — 1369 «). 

Tuhan Kanaka overlijdt 8j in Qaka 1352 *j. Hij was 17 jaar apaiih, 
Bhre Lasém sterft te Jinggan. 
Bhre Pandan salas sterft. 
Raden Jagulu. 



1) Over den Himg Tuwah-roinan leze men vooral wat Prof. Dr. 6. K. Niemann mededeelde in t\jne 
Bloemleiing nit Maleische gedchriften, Ie stuk, groote uittreksels grgevende. Het eerste nittrrksel vindt meo 
in transcriptie ook iu de Hikajat Hang Tuwah tersalin sueratannja oleh R. Brons Middel, Leiden 1898. Met 
liet oog op Gsgali madu's plannen met Palembang, zie boven bg Hoofdstuk IX, leest men b\j Niemann, 1870, 
I, bl 8, — er zjjii dour Hang Tuwah, als jongen, krijgsgevangen gcmaakten aan het woord, — adapon kamt 
sëiaiiyaH ini mutuh dari Siantau, tPpuIuh buwah pi^rahufia, dan nama phighulukami itu Arya Nigara, dan 
dart Jëmajapon sëpu/vA bntcah juga kèndak m<trompak ka tanak Palembang, Adapon akan. éèkarang êëgaia 
kèlangkapan saiêngahna sudak lalu, kami di bëfakang ini karëna patik Gajah mada^ mantèri ratu Jf^«- 
pakity ménurukkan êèga/a pënghulu anak êungag gang taalok ka MeBjapakit itu mërompak ka Palembang 
lalu naik ka darat ka bukit Siguntang, diêuruhna rampat oleh patik Gajah mada itu^ karëna kami tëka- 
ligan ini taalok ka Mënjapahit, 

2) Men lette er op, dat de vorige prabhu istri reeds in 1351 overleed. Wie deze Bhre Doha, een 
prabhu istri, was, is niet duideljjk, doch men zie de aanteekening beneden. 

Z) In 't Jav. atëiasan. 

4j Zoo te kscu in plaats van. 18d3. 



Hoofdstuk XIII. — 163 — Vert. en Aurr. 

Raden Gajah wordt uit den weg geruimd^ omdat bij Bhre Wirabhumi ont- 
hoofd had, in Qaka 1355. 

Bhre Daha werd koningin (ratu) in Qaka 1359. 

Bhre Paramen wara, nl. die te Wisnabbawana stierf, sterft in Qaka 1368, 
en wordt bijgezet te Singhajaya. 

Bhre Këling sterft, en wordt bijgezet te Apaapa. 

Bhre Prabhu istri sterft in Qaka 1369, en wordt mede te Singhajaya bijgezet. 

AANTEEKENIN6. 

In het vorige hoofdstuk werd zoowel de dood vermeld van Bhra Hyang 
wige^a, wiens regeering wat de verdeeling in hoofdstukken hier betreft, reeds 
geëindigd werd beschouwd in Qaka 1322, als van de hem opvolgende Bhatara istri, 
die in 1351 Qaka plaats had.- De vermelding van haren dood moest volgens den 
bg de verdeeling in hoofdstukken hier gevolgden regel wederom een hoofdstak 
besluiten. Er schijnt daarop eene periode gevolgd te zijn van koningloosheid, 
althans er volgt daarop niet dadelijk, dat er weder een ander jïrabhu zou zijn 
geworden. Dit vindt men eerst weder naast het jaartal 1359 Qaka vermeld, ter- 
wgl opmerkelijkerwijze daarbij het woord ratu gebezigd wordt, dat, zooals boven 
reeds gezegd is, in dien zin alleen in 't begin van dit geschrift voorkomt i), tot 
prabhu er de plaats van gaat innemen. Toch moet ook hier dat er debeteekenis 
van zgn, aangezien spoedig daarop weer sprake is van het overlijden van een 
prabhi in 1369 Qaka, en wel wederom van een prabhu isfri. 

Het ware dus wellicht beter geweest dit hoofdstuk nog eens in tweeën 
te verdeelen ; dat geschiedde hier niet, omdat het niet duidelijk blijkt, zooals het 
geval was in Hoofdstuk VI, wie in dien tijd wel het bewind voerde, en het even- 
min duidelijk wordt aangegeven, dat er gedurende eenigen tijd geen wettig hoofd 
van bestuur was, zooals dit bijv. straks wel geschiedt in Hoofdstuk XVI. 

De prabhu üln III, die in 1359 Qaka koningin werd, heet Bhre Daha, 
bL 31 reg. 34, en moet, als men ook haar met een volgcijfer wil aanduiden, Bhre 
Daha IV worden, want de in 't voorafgaande voorkomende Bhre Daha I (Kërta- 
r^jasa's gemalin), Bhre Daha II (Kërtarajasa's dochter), en Bhre Daha III, de 
dochter van Bhre Pandan Salas II, waren allen, zooals aangenomen worden moest, 
reeds overleden, zie voor de laatste bl. 31 reg. 21. 

Is dit intusscben, zoo goed en zoo kwaad als dat ging, vrijwel uitgemaakt, 
er doet zich hier een andere vraag voor, en wel deze, of deze Bhre Daha IV niet 
in een nader verband stond tot Bhre Wirabhumi. Dit moet zouder twijfel worden 
aangenomen. 

Zooals men gezien heeft, wordt in dit hoofdstuk, dus na den dood van 
Hyang wi^e^a en de prabhu istri II, in Qaka 1351, Raden Gigah, die in 1328 



1) Hoofliitnk T tot en mot IV. 



HooKDSTUK Xm. — 164 — Aanteekenikö. 

Bhre Wirabhumi versloeg en onthoofde, juist om deze daad, in Qaka 1355, zelf 
van kant gemaakt, ingilangaken pivndom ameki Bhre Wirahhumi, Moet hij om die 
heldendaad tijdens de vorige regeering, van Hyang wi^esa en de prahhu istri II, in 
tel en in eere zijn geweest, er moet daarna een andere factie aan de bovenhand zijn 
gekomen, en wel juist eene, die den aan Bhre Wirabhumi aangedanen dood, nu blgk- 
baar moord genoemd, niet billijkte, dus een partij, die het weer voor Bhre Wirabhumi 
opnam, ook al was zijn ondergang reeds iets van meer dan twintig jaren her. Het 
ligt dus inderdaad voor de hand te veronderstellen, dat de daarop in 1359 Qaka aan 
het bewind komende Bhre Daha IV iemand was, die tot Bhre Wirabhumi in relatie 
stond. Het zou toch zeer begrijpelijk zijn, dat zij het tot den troon had gebracht, 
juist gesteund door, misschien ook als hoofd van de partij, die, toen da^oe de 
gelegenheid zich ten laatste voordeed, gemeend heeft den dood van Bhre Wira- 
bhumi te moeten wreken, door op hare beurt zijnen moordenaar geweldadig te 
dooden, en dit dwingt dan wederom om te vragen of in deze Bhre Daha IV wel- 
licht niet tevens teruggevonden wordt de Bhre Daha, van wie sprake is in het 
gedeelte, dat over de paregreg handelt, en door Bhra Hyang wigesa uit Bhre Wi- 
rabhumi's oostelijk rijk werd weggevoerd, of misschien ook die, welke hem tot 
kind aannam, welke beiden ook wederom dezelfde persoon zouden kunnen zijn. 

Zooals boven beredeneerd werd, werd Bhre Wirabhumi tSt zoon erkend 
door Bhre Daha II, de dochter van Kërtarajasa, zie bij Hoofdstuk X. Het werd 
daar reeds toegegeven, dat er eenige bezwaren zijn, maar het bleek nog duide- 
Igker dat Bhre Daha I en Bhre Daha III buiten rekening moesten worden gelaten. 
Eene mogelijkheid rest er nog, misschien was de pleegmoeder van Bhre Wira- 
bhumi ook Bhre Daha II niet, doch een ander, over wie de Pararaten in het voor- 
afgaande geen verder licht geeft. 

Bij Hoofdstuk XII werd er verder stil gestaan bij de vraag wie of wat de 
Bhre Daha, welke in de paregreg genoemd wordt, wel wezen kon. Het werd 
daar reeds uitgemaakt dat zij niet was Bhre Daha II, terwijl de mogelykheid 
verondersteld werd, dat men in haar Bhre Daha III te zien had, en tevens werd 
er een enkel woord gewijd aan de redenen, die Bhre Tumapöl 6 (39) en Bhre 
ParameQwara II (47) konden doen weifelen bij het partijkiezen of voor Hyang 
wif e^a óf voor Bhre Wirabhumi, zie de noot waarin de familierelatien van deze bei- 
de personen tot de beide tegenover elkander staande vorsten nog eens uiteengezet 
werd, en het bleek daar niet, dat Hyang Paramegwara, tenzy hij als schoonzoon 
van Bhre Tumapël b (39) zich geheel bij zijnen schoonvader aansloot^ eenige 
reden gehad zou hebben de partij voor Bhre Wirabhumi te kiezen, iets wat met Bhre 
Tumapël wel het geval scheen, in zoo verre als deze, hoewel een zoon van Hyang 
wigesa, doch geenszins zijn aangewezen troonsopvolger, daar Dewi Suhita daar- 
voor in aanmerking kwam, ook de schoonzoon was van Bhre Wirabhumi. 

In dit hoofdstuk ontmoet men aan het slot een in een zeker opzicht 



Hoofdstuk XIIT. — 165 — Aanteekenusg. 

merkwaardige mededeeling. Wellicht dat deze iets verder kan brengen. Er dient 
toeh op gewezen te worden. Dit geschiede in verband met het voorafgaande. 

Er wordt daar medegedeeld dat de prahhu tslri III, een ander dan deze 
kan niet bedoeld zijn, men zie slechts bl. 31 reg. 28, waar de dood van de 
prahhu istri II (Dewi Suhita) reeds geconstateerd is, begraven wordt in een heilig- 
dom Singhajaya, waarin reeds iemand bijgezet was, funggal dhtnarma, bl.31 reg, 37, 
terwijl het verder blijkt, dat in datzelfde heiligdom een jaar te voren in 1368 Qaka 
de asch van Bhra Paramegwara II was geplaatst, over wiens persoonlijkheid met de 
door de Pararaten verstrekte gegevens ook al niet getwijfeld worden kan. De vraag 
doet zich voor in welke relatie stonden deze beide personen tot elkander, dat 
men hun asch na hun dood op zulk eene wijze, op éón en dezelfde plaats, ter ruste 
bracht. 

Toevalligerwijze geeft de Pararaten van zulk een plaatsen van de asch van 
twee personen in één heiligdom nog een paar voorbeelden. Men vindt het o. a. 
op bl. 32 reg. 4 en 0. Zoowel Bhre Paguhan als Bhre Pajang, wie deze per- 
sonen waren bleek boven bij de uiteenzetting in de aanteekening op Hoofdstuk 
X, nl. Bhre Paguhan II (42) en Bhre Pajang II (45), worden begraven te Sabyan- 
tara, welk feit ook daar, waar het de laatste dezer beide personen betreft, uit- 
drukkelijk wordt aangeduid met dezelfde uitdrukking, tunggal dhinarma. Kon 
het nu worden uitgemaakt wie deze personen waren, het bleek tevens dat zij, 
hoewel halfbroeder en halfzuster, met elkander in het huwelijk waren getreden, 
en Sabyantara omsloot dus na hun dood de asch van man en vrouw. 

Zou ditzelfde nu ook het geval hebben kunnen zijn in het heiligdom Singha- 
jaya? Zulk eene veronderstelling ligt voor de hand en leidt ook tot eenige 
onverwachte uitkomsten. Aangenomen dat dit het geval was, dan volgt er uit 
dat Bhra Parame^wara II (47) de gemaal was van de pral)hu istri III, en wel- 
licht niet die van pmb/iu isfri II (Dewi Suhita), en er werd dan ook reeds boven 
in de aanteekening bij Hoofdstuk X en in den geslachtsboom, waar aangeno- 
men werd, dat deze laatste, de prahhu islri II, met Bhre ParamcQwara II 
in het huwelijk trad, een vraagteeken bij die echt geplaatst, aangezien de be- 
woordingen van bl. 30 reg. 3 en 7 er wel aanleiding toe geven te veronder- 
stellen, dat zij beiden in het huwelijk traden, doch dezen zelf daartoe niet recht- 
streeks dwingen. Men vindt daar toch niet anders dan putrestri mijil hhre prahhu 
siri, hhuieka dewi Suhila en apnfra mijil hhre Koripan, hhra Ihjaiig Paramecwara si- 
raji Ratnapangkaja hhiselcaftira, atigakp hhra prahhu istri^ tan apuputra sira. Er wordt 
wel gezegd dat hij huwde met een prahhu istri, doch niet met die, welke Dewi 
Suhita heette, en van Dewi Suhita wordt wel is waar niet aangeduid, dat zij 
ongehuwd bleef, doch ook weder evenmin geconstateerd, dat zij wel in het 
huwelijk trad. Doch zou het uu, na hetgeen er nog verder aan het licht kwam, 
hoe weinig zeggingskracht er ook in schuilen moge, niet aannemelijker zijn te 
veronderstellen, dat men met Bhra Paramecwara zijne gade in één heiligdom heeft 



Hoofdstuk XIIT. — 166 — Aahteekenino. 

laten msteD, en dat ook \u de prabliu hfri van bl. 30 reg. 6 zijne gemalin te 
zoeken is, de vorstin die in 13C9 (^aka overleed, d. i. dns de Bhre Daba, welke 
in 1259 Caka rala werd? i) 

Kon op deze wijze bier als van zelf eenige kritiek gegeven worden op den 
ontworpen geslacbti^boon). daar bet aan den dag kwam^ dat deze niet in alle on- 
derdeelen een onvoorwaardelijk vertrouwen verdient, wat op zich zelf reeds van 
groot nut is, omdat men er door weerbouden worden zal er te absoluut op te 
bouwen, bet bleek tevens dat er van verscbillende gedeelten van den tekst ook 
verscbillende opvattingen mogelijk zijn, en dat boe correct de redeneeringen over 
de persoon van de Bbre Daba van bl. 81 reg. 10, die der paregreg, op zicb zelf 
ook mochten zijn, wat aan den lezer ter beoordeeling wordt overgelaten, het toch 
zeer wel mogelijk is, dat zij juist niet Bhre Daba III was. en dat in haar juist 
gezocht moet worden de latere prahhu islri III, wellicht zelfs de Bhre Daba 
die Wirabbumi's pleegmoeder was, en op wie Bbra Parame^wara reeds toenmaals 
zijne oogen geslagen bad. Hier verdiepen wij er ons niet verder in, doch achten 
het daarbij veroorloofd om er nog verder op te wijzen, dat de prahhu istri TT, 
die tijdens de paregthj vorstin was, toenmaals dan nog ongehuwd was geble- 
ven, en er in den titel ralu angabhatja, voor lieden van latere dagen, wel eens, 
ten onrechte, schijnbaar iets gescholen kan hebben, dat hen heeft doen vermoe- 
den, dat Raden Gajab met Dewi Subita, d. i. de prahhv istri II, in 't buwelgk 
is getreden 2). 

In dit hoofdstuk wordt bet laatst een patih vermeld, Tuban Eanaka, die 
in 1352 Caka, zoo moet er in plaats van 1363 gelezen worden, overleed, nadat hg 
17 jaar de functie had bekleed. Boven werd zoo goed als niet bg die palih's 
stilgestaan. Dit geschiedde om daar meer uitsluitend de geloofwaardigheid van 
de Pararaton in het licht te stellen en zich te blijven bepalen bij de genealogie 
der voorkomende personen van vorstelijk geslacht. Ook is bet beter alles wat er 
van hen gezegd wordt, die als hoogste rgksdienaren zeer op den voorgrond 
tredende personen waren, op een enkele plaats te vergaren en te bespreken, 
waarvoor dit hoofdstuk juist de plaats schijnt. 

Met dit hoofdstuk toch begint de Pararaton, die in bet laatste gedeelte van 
het voorafgaande al veel abrupter was dan in het begin, zoo kort en onduidelijk 
te worden, dat men zelfs niet meer kan ontdekken in welke verhouding de per- 
sonen, die nog verder genoemd worden, in verband stonden tot die welke in het 



1) Hoe twjfelaelitig het intas^clien is, bl^kt nit een derde voorbeeld vau het begraTen in cén heilig- 
dom. Volgen» bl. 81 reg. 25 en 82 reg. 6, ook hier tunggal dhinarma, werden Bhre Wëngkër II (41) en 
Bhre Kabalan (50) beiden te Snméngks bggeiet; deze personen waren vader en dochter. 

2) Zooali reedi werd opgemerkt is de waarde van den titel raiu angabhaga onzeker, zie de aan- 
teekening bj het vorige hoofdstuk. In de lakon Damar wnlan huwt de held van het verhaal niet met de 
vorstin, maar vindt hfl het goed maar tenapaü (veldovcrste) te worden, en vereenigd te blgveu met Anja- 

smara {wondening raden Damar %ntlan tamjnm trima dadot senapati kimawon, lulus iëpanggiA kalih ni 
JVtfWtfra), T^dflchr. Iiid. T. L. en Vk., XXXYIII, bL 466. 



Hoofdstuk Xm. — 167 — Aanteekendtg. 

voorafgaande voorkwamen. Moest dit reeds opgemerkt worden omtrent de vorstin^ 
die juist aan het bewind was gekomen, het geldt^ zooals men zien zal^ niet minder 
van de nog verder voorkomenden, behalve dan van die enkelen, wier afsterven 
hier of later nog vermeld wordt (Bhre Lasëm, Bhra ParamcQwara, Bhre Këling, 
Bhre Jagaraga, Bhre Kabalan en Bhre Pajang), en boven bij Hoofdstuk X reeds 
behandeld werd. Behoudens dezen, en dan nog Raden Gajah, van wien reeds 
gesproken werd, Bhre Daha, de regeerende vorstiu, en deze nog slechts gissender 
wijze, en Tuhan Eanaka, vinden wij hier en in het vervolg, behoudens een twijfel- 
achtige uitzondering, zie het volgende hoofdstuk, niemand meer terug, die reeds 
bekend was. 

De eerste pafih, die genoemd wordt is Pranaraja, tijdens Tohjaya, zie 
Hoofdstuk III. Op het feit dat er blijkens de inscriptie van 1216 Qaka, aan het 
hof van Kértarajasa (Raden Wijaya) een zeer hooge ambtenaar was van dezen 
naam, werd reeds gewezen bij Hoofdstuk YII. 

Tijdens Eértanagara vindt eerst Raganatha, die zich terugtrekt, en daarna 
Kébo tëngah = PaTlji Aragani, zie hoofdstuk V. 

Wie palih was onder Kértarajasa, wordt in de Pararaten niet vermeld. 

Daarna vindt men onder Jayanëgara Mahapati in deze functie. Hierover kan 
niet getwijfeld worden, al ziet men daarnaast bericht, dat Nambi, Wiraraja's 
zoon, zie Hoofdstuk YIII, bl. 25 reg. 18, als zijn vader heengaat, als ^/>a/iA achter- 
biyft. Uit het vervolg toch blijkt het, dat die titel zelf, althans voor een tijd, een 
eenigszins mindere waarde heeft gehad, en dat wat vroeger en later uitsluitend 
apaiih (of palih) heette, amangkuhumi of amancanagara werd genoemd. Dit laatste 
moet Mahapati zijn geweest, en deze bleef dit tot aan zijnen dood, bl. 26 reg. 14, 
in 1241 Qaka, het jaar waarin de pa/sufi plaats had, die negen jaar voor de pa- 
ianca (in 1250 Qaka, zie bl. 27 reg. 10) voorviel. 

Na hem bekleedde Arya Tadah die functie. Dit blijkt bl. 26 reg. 36, 
waar zijn naam genoemd wordt, nadat er eerst van den amaYicanagara gesproken 
is, die niemand anders was dan de ammigkubumi van dien naam, terwijl het tevens 
aan het licht komt, waardoor de titel apalih en decadence was geraakt, nl. omdat deze 
ook in gebruik was in wat men de regentschappen, de vasalstaten van Majapahit 
zou kunnen noemen, van welken daar Daha wordt genoemd. Deze Arya Tadah 
was de fautor van Gajah mada, die inmiddels palih van Daha was geworden. Als 
hij oud is geworden, verlangt hij, dat deze in zijne plaats treden zal, apaliharing 
Majapahily bl. 27 reg. 32, waartoe Gajah mada echter nog niet durft over te gaan. 

Toch volgt deze hem op. Wanneer dat geschied is, is niet zeker. Bl. 28 
reg. 20 wordt hij apalih amangkubhümi genoemd, terwijl hij bl. 28 reg. 7 daar- 
mede nog niet bedoeld is, daar hij bl. 28 reg. 17 eerst nog an/zaft^Aï wordt, welke 
uitdrukking in 't verband evenwel niet duidelijk is; ook schijnt intusschen Arya 
Tadah, zie bl. 28 reg. 27, nog niet geheel uitgediend te hebben. De palih ing 
Uajapahil genoemd op bl. 28 reg. 32, is zoader twijfel weer Gaja mada, en ook 



Hoofdstuk XIII. — 1G8 — AANTEEKENiKe. 

dit wijst er op, dat er voor het fumuli pmnindabubal, bl. 28 reg. 29, een lacune 
moet zijn, want feitelijk wordt noch van zijn aanvaarden van die betrekking, noch 
van het werkelijk aftreden of hel overlijden van Arj-a Tadah iets vermeld. Slechts 
vindt men op bl. 29 reg. 10, opgegeven, dat Gajah mada in 1279 Qaka sintsll 
jaren (unnnijkvbhumi was. Hij moet het dus geworden zijn in 1268. In 1290 Qaka 
overlijdt hij, bl. 29 reg. 28. 

Gedurende een drietal jaren wordt er geen nieuwe /fotth benoemd, alsof 
Gajah mada niet te vervangen is geweest. 

Zonder twijfel was het een bijzonder man, en waren zijn verdiensten niet 
gering. In de Pararaton wordt er van zijne verdiensten als rechtskundige of als 
rechter niet gewaagd. Als zoodanig is hij bij de Javanen van Java nog be- 
kend ^). Hier vindt men hem uitblinkende in andere hoedanigheden. Hij redt 
Jayanagara van den rand van den afgrond, weet, of weet dat niet, zulks is niet 
duidelijk, de rust te herstellen onder het bewind van de eerste /ïrabhu istri van 
Majapahit, is de held van vele veroveringen door Majapahit gemaakt en waar- 
door het zich koloniën verschafte, en speelt ook eene groote rol tijdens de regee- 
ring van Hayam wuruk, daar hij zich blijkbaar verzet tegen het door den vorst 
gewenschte huwelijk met de Sundasche prinses, dat hem daarentegen, uit een 
politiek opzicht, juist niet gewenscht voorkwam. 

Eerst in 1293 volgt hem Gajah énggon als /jalilt op, bl. 29 reg. 29. Deze 
bleef dit 27 jaar. Hij stierf in 1320 Qaka, zie bl. 30 reg. 28. 

Daarop bekleedt Gajah Manguri die functie van 1320—1332, zie bl. 30 
reg. 29 en bl. 31 reg. 10, en hij was het dus 12 jaar. Duidelgk is het, dat in 
overeenstemming daarmede de tekst, bl. 31 reg. 17, verbeterd moet worden, zy 
dit nu al met, dan wel zonder invoeging van gumanlL men zie de aanteekening bij 
de vertaling. 

Een zelfde fout vindt men op bl. 31, reg. 20, waar men vermeld vindt, 
dat Gajah lémbana, die, ibid. reg. 17, genoemd wordt als de opvolger van den 
in 1332 gestorven patih, in 1335 overlijdt. Hij had dus drie jaren die functie 
bekleed, en daarom is ook daar het volgende tigami tahun, tot verbetering van 
den tekst, by het voorafgaande te trekken. 

Dit blijkt ook uit het vervolg, daar zijne opvolger. Tuhan Kanaka, en daar- 
mede zijn wij hier aan het eind der opsomming gekomen, na in 1335 patik 
te zijn geworden, bij zijn overlijden in 1352 (zóó te lezen voor 1363), gezegd 
wordt 17 jaar die betrekking bekleed te hebben, zie bl. 31, reg. 20 en 29. Dezen 



1) Zooals men b^ Raffles, History of Java, II, -.bl. 441 vindt opgegeven, bestaat er een wetboek, dat 
zijnen naam draagt, „Giga Muda, a simular work, eupposed to have been writteu by Gaja ^f uda, the Pateh of 
the Great Brow^aya of Majapahit". Vermoedeijk vindt men het in no. 25 van zjne in de Royal Asiatic 
Society te Londen opgeborgen verzameling Javaanscbe handschriften, Bjdr. T. L. en Vk., II, bl. 343. Ook 
het Ned. Bjjbelgenootechap te Amiterdam bent er een exemplaar van, dat schnilt in no. 56 van Engelmann'i 
Catalogus, Tjdschr. van Ned. Ind. 1870, II, bl. 176. Het is maakwerk van een betrekkelgk zeer nieuwen tgd. 



Hoofdstuk XIII en XIV. — 169 — Aant., Vbrt. en AaKt. 

Tnhan Kanaka vindt men terug in het wetboek Adigama, geplaatst intos- 
schen in zulk een omgeving (Bhra Qiwa en Dangdang géndis); dat men vennoe- 
den moet dat dat wetboek eerst vrij lang na zijn dood ontstond of den ons be- 
kenden vorm kreeg i). 

Omtrent de opvolgers van Gajah mada wordt^ behoudens de jaren van hun 
aantreden en hun overlijden, niets medegedeeld en palih Madu wordt alleen slechts 
even genoemd op bl. 28 reg. 30. 



HOOFDSTUK XIV. 

Bhre Tumapel, (als vorst KertawijayaO- Caka 1369—1373. 

[32] Daarop wordt in haar plaats Bhre Tumapël koning (prabhu), 

Bhre Paguhan ruimt de lieden van Tidunggalating uit den weg; dit wordt 
naar Majhapahit bericht. 

Daarop een aardbeving in 1372 2). 

Bhre Paguhan, nl. die te Canggu sterft, wordt bijgezet te Sabyantara. 

[Bhra Hyang sterft, en wordt bijgezet in de Puri.] 

Bhre Jagaraga sterft. 

Bhre Eabalan sterft^ en wordt bijgezet te Sumëngka, waar reeds iemand 
bggezet was. 

Bhre Pajang sterft en wordt (als Bhre Paguhan) ook te Sabyantara bijgezet. 

Daarop had er een bergstorting plaats in de wuku Kuningan, in 1373 3). 

Bhra prabhu (de koning) sterft in Qaka 1373, (de plaats waar hij bggezet 
werd) heette als dharma Kértawijayapura. 

AANTEEKENIN6. 

Wie deze Bhre Tumapël was blijkt niet, evenmin als het van de verdere 
hier nog ten tooneele tredende in het voorafgaande niet genoemde personen uit te 
maken is, wat niet verder behoeft te worden herhaald. Zij werden reeds opgesomd 
in de aanteekening bij Hoofdstuk X. 

Wie de wang Tidunggalating, var. Tidung Kalati, waren, kon niet opge- 
spoord worden. 

1) In het begin ran dit wetboek, dat in den kolophon KutAram&naw&di of Knt&ram&naws pleegt te 
heeten, docb de irerkel^ke Knt&ramftnawa niet is, daar dit het wetboek is dat door Dr. Jonker in z^n Een 
oud-JaTaamch wetboek vergeleken met Indische rechtsbronnen werd nitgegeven, komt een jaartal voor, 

rt jn 53,^» ^* misschien met opzet in 't ceuwcijfer verknoeid is; 1823 (Jaka toch, waaraan men het eerst 

denken ion, omdat men naar Migapahit vei'plaatftt wordt, valt vóór 1336—1352 Qaka, de jaren van Tnhan 
Kanaka's bewind. 

2) Zoo te lezen in plaats van 1862. 

3) Zoo te lezen in plaats van 187 . , waarin de eenheid niet is nitgedrakt. 



Hoofdstuk XIV. — 170 — AAimnsKEinNa. 

Over Canggu werd reeds gehandeld bij het VI^ hoofdstuk. 

Bhra Hyatig mokia dhinarme Puriy Bhra Hyang sterft, en wordt bygezet in 
de Puri; vermoed ik dat bij toeval in den tekst is ingelascht, en zijn ontstaan te 
danken heeft aan het Bhra Ilyang piirwawiccsa moicta, dhinarma ring Puri, dat 
men hieronder in Hoofdstuk XVII, bl. 32 reg. 18 ontmoet. Daardoor zou een 
der onbekende personen, Bhra Hyang, wegvallen. Men vindt het echter zoowel 
in C als in B. 

Op het bijgezet worden van Bhre Paguhan II (42) en Bhre Pajang II (45) 
in één heiligdom, evenals op dat van Bhre Eabalan (50) te Sumëngka, waar Bhre 
Wöngkër II (41) reeds geplaatst was, werd reeds gewezen in de aanteekening bij 
het vorige hoofdstuk. 

De naam van het heiligdom Sabyantara doet denken aan Bintara, waar 
volgens de Javaansche babad Raden Patah zich vestigde en later Démak verrees. 
Sabyantara toch moet tot Sabentara verloopen, en uit dit kan weder, met weg- 
vallen van sQy een Bintara ontstaan. 

Uit den naam van het heiligdom, Kërtawijayapura, waar Bhre Tumapél, 
Bhra prabhu, begraven werd, werd opgemaakt, dat deze als vorst KÖrtawijaya 
zou hebben geheeten. Of het juist is, is moeielijk uit te maken. & wordt hier 
opzettelijk nog eens op gewezen, omdat het, zoo het dat is, wel eens mogelijk wezen 
kon, dat het jongere gedeelte van den ontworpen geslachtsboom op enkele punten 
er anders zou hebben moeten uitzien. 

Aangenomen toch dat de Bhre Tumapël, welke regeerde van Qaka 1369 — 

« 

1373, dien naam droeg, dan vraagt men toch of hij niet een en dezelfde persoon 
moet zijn geweest met de Bhre Tumapël III (ft) (39), het jongste kind van Bhra 
Hyang wi^eipa, dat dien naam ook droeg, manih pulra pamungsu jalu Bhre Tumapël 
qrl Kértatvijaya, en is dit juist, dan kan diens dood weer moeielijk op bl. 31 reg. 
24 zijn aangeduid, maar moet daar bedoeld zijn zijn oudere broeder, Bhre Tumapël 
II (a) (37), van wien aangenomen werd, dat hij jong gestorven is, dat zijn dood 
niet opzettelijk is vermeld, en dat hij ook met het oog op de gesloten huwelijken 
buiten beschouwing kon worden gelaten, zie de aanteekening bij Hoofdstuk X. 

De wijzigingen, die alsdan noodzakelijk zouden wezen, zouden hierop neer- 
komen, dat onder 37 en 39 van den geslachtsboom in plaats van hetgeen er thans 
wordt aangetroffen, zou moeten staan: 

37. Bhre Tumapèl II (a) (bl. 30 reg. 3), 
t 1349 (bl. 31 reg. 24), 
begr. te Lokërëp =r Amarasabha (bl. 31 reg. 25); en 

39. Bhre Tumapël m (h) (bl. 30 reg. 4), 

prabhu van Ma japahity 

gehuwd met Bhre Lasëm III (34) ? ; id. IV (48) ? ; en Bhre Daha UI (49), 

1369 (bl. 32 reg. 1) — 1373 (bl. 32 reg. 11), 

begr. te Kërtawijayapura, 



Hoofdstuk XIV tot XVII, — 171 — Aant., Vert. en Aaxt. 

waarbij in het oog gebonden moet worden, dat bet onverscbillig is met wien der 
beide broeders Bbre Lasëm III (34) en Bbre Lasëm IV (48) in bet huwelijk tra- 
den, daar deze beiden aan geen kinderen het levenslicht schonken. 



HOOFDSTUK XV 



Bhre Pamotan, als koning Rajasawardhana, Caka 1373 — 1375. 

Bbre Pamotan wordt koning (prabhu) te Këling, Eaharipan, onder den naam 
Qrt Riyasawarddhana. Sinagara sterft en wordt bijgezet te Sëpang, in Qaka 1375. 

AANTEEKENIN6. 

Uit de enkele woorden, waaruit het volgende hoofdstuk bestaat, is het 
duidelijk^ dat ook Sinagara een andere naam is voor Rajasawardhana (Bhre Pa- 
motan), die bier koning is geworden. In Hoofdstuk XVIII worden de namen 
genoemd van vier kinderen van hem. 



HOOFDSTUK XVÏ. 



Inlenegnum. Caka 1375 — 1378. 



Drie jaren lang was er geen koning (prabhu). 



HOOFDSTUK XVII. 

Bhre Wéngker, atv vorsf Bhra llyang ]mrwaxvi{etta, Caka 1378 — 1388. 

Daarop wordt Bhre Wëugkër koning yprabhu), onder den naam Bhra Hyang 
purwawife^a, in Qaka 1378. 

Daarop bad er een bergstorting plaats in Qaka 1384. 

Bhre Daha sterft in Qaka 1386. 

Bhra Hyang purwawiQcsa sterft, en wordt bijgezet in de Puri, in Qaka 1 388. 

Daarop sterft Bhre Jagaraga. 

AANTEEKENIN6. 

Bg Hoofdstuk XIV werd reeds opgemerkt, dat het Bhra Hyany /mrwawigefa 



Hoofdstuk XVII en XVIII. — 172 — Aant., Vert., Aant. en Titel. 

nwkla, dhinarnie ring Puri van dit hoofdstuk vermoedelijk de geboorte heeft gege- 
ven aan het Bhra Hyang mokla dhinarme (of als in C dhinarma ring) Puri in dat 
voorafgaande. 



HOOFDSTUK XVIII. 

Bhre Pandan salas. Cakn 1388 — 1390 of 1400 (?). 

Bhre Pandan salas^ te Tnmapël^ wordt daarop koning (prabhu), in Qaka 
1388. Hij was twee i) jaren koning. Daarop verliet hij de kraim. 

De kinderen van Sinagara waren Bhre Koripan^ Bhre Mataram^ Bhre 
Pamotan en Bhra Kërtabhumi^ die een oom was van den koning^ die gestorven is 
in de kraton in Qaka 1400. 

Daarop had er een uitbarsting plaats in Qaka 1403. 

AANTEEKENIN6. 

De Sinagara van dit Hoofdstuk is zonder twijfel dezelfde als die van 
Hoofdstuk XV. 

Wie de prabhu sang mokla ring /cadaton was, is onduidelgk. Mag men 
in plaats van rang lahun lezen rola^ iahun, dan zou het Bbrc Pandan salas III, 
de in dit hoofdstuk regeerende vorst, toch nog niet kunnen zijn, daar van dezen 
wordt gezegd, dat hg zijne kralon verlaat, sah saking kadaton. Ook is de verhou- 
ding, wie paman was en wie neef, niet uit te wijzen. In de vertaling moest 6f het 
een öf het ander worden aangenomen ; hierin te beslissen was geenszins de bedoeling. 

Daar alle verdere aanwijzingen ontbreken , en er, te beginnen met het XIII« 
hoofdstuk, van de voorkomende nieuwe personen niets hoegenaamd verteld wordt 
dan van enkelen, dat zij koning werden en overleden, is het ook niet geredelgk 
na te gaan in hoeverre het einde van het rgk van Majapabit, zoo als het ons 
hier wordt geschetst, als dood te loopen, als men ten minste deze opvatting hebben 
mag, verband houdt met de voorstelling van den val van dat rijk gegeven in de 
Javaansche babad, doch men zie nog beneden. 



TITEL. 



Zoo luidt het Boek der koningen. 

Geschreven te Iccasada, te Qela pénëk, in Qaka 1535. Toen kwam het 
schrgven gereed op Pahing Sane^cara (Zaterdag), Warigadyan, op den 2«» van 



l) Lees: twulf? 



Titel. — 173 — AAKTEEKSinva. 

de donkere helft van de maand Earo. Dat de lezer niet nalate te verbeteren 
hetgeen er te weinig of te veel ') is aan slechte letters, zonder dat men zich 
keere aan het aantal^ want het is van iemand die zeer dom is en pas begint te 
leeren. Om, lang leven zg er, zoo zij er, zij er, heil zij er, ook voor den afschrijver. 

AANTEEKENIN6. 

Pararaton of het Boek der koningen is de eigentlijke titel van het geschrift, 
die, zooals als bekend mag verondersteld worden, oudtijds, of na nog, in ouden 
trant, op Hindu-wijze, geregeld aan het slot van een boek of een hoofdstuk werd 
geplaatst, evenals men ook den naam van den versmaat in het einde van den 
zang, waarin hij gebezigd was, pleegde te noemen ^). In de wandeling is in- 
tnsschen Arok of Angrok, Ken Arok of Ken Angrok meer gewoon, waarvoor het 
begin van het boek, zelfs reeds de eerste woorden: nihan kaluluranira ken Angrok 
„Als volgt luidt de overlevering omtrent Ken Angrok'', de verklaring geven. 

Iccasada is gelijk aan Sukasada, de naam van een plaats iets ten zuidoosten 
van Singaradja, de hoofdplaats van Buleleng. 

De datum: Zaterdag-Pahing van de wuku Warigadyan (bij de Javanen 
Warigagung), de 2« panglong van de maand Karo, Qaka 1535, beantwoordt aan 
3 Augustus 1613 A. D. 

Na dezen kolophon vindt men in B nog de navolgende historische aan- 
teekeningen : 

Sumilih Tjineng Bandaring Bali, i caka, rupa-wuku-rehi-janma, (1671), ma^d 
wegakd en Gusli Bdnwd amangun pasowan ring kali Bunlil, i caka, uti^resi-rasa' 
bumi, 1673. 

Zij worden hier nog even medegedeeld, omdat er uit blijven kan, dat het 
handschrift, waarnaar B, het afschrift voor het Bataviaasch Genootschap, gereed 
gemaakt werd, minstens ongeveer 150 jaar jonger is dan de kolophon, dien men 
er in aantreft, zou doen vermoeden. 



Werd boven bij Hoofdstuk VI de aandacht van den lezer reeds eenmaal 
gevestigd juist op punten van overeenkomst te ontdekken tusschen de oostelijke 
overlevering omtrent Majapahit, die van Bali, en die der Javanen van Java, na 



1) Te lezen de aang frddhdmaca iunalhoihing ; en voor krsnapasa krsnapaksa. 

2) Bj liet bezigen van de zoogenaamde groote maten plegen de Javanen van Java ook in de jongste 
tyden deze gewoonte nog te volgen, daarvoor zie men bgv. den Aijnna Sasrabahu-tektt van Yasadipnra I, 
waarin men aan het einde van iederen zang geregeld den naam van den maat aangegeven vindt, zie het hda. 
der Leidsche Rjksnniversiteitsbibliotheek 1855 (I); waar de zang overgaat, en dus de maat verandert, ver- 
melden diezelfde Javanen ook veelvuldig in de groote pada, die het scheidteeken is, in cjfers, het aantal sylla- 
hen» waaruit iedere vierel der strophen van den daarop volgenden zang bestaan zal, het cjjfer van de iatnpak, 
looalB dat heet. 



— 174 — 

met de behandeling van hetgeen de Pararaton ons bericht^ zoover gevorderd te zgn 
als thans het geval is, is het niet onaardig nog eens even een blik te virerpen op de tra- 
ditie der Javanen omtrent het machtigste rijk; dat zij zich uit han voortijd herinneren. 

Een korte recapitulatie van hetgeen de Pararaton van dat rgk, sedert zyn 
stichting, vertelt; kan daarbij van groot nut zijn. 

Miyapahit werd; zoo verhaalt het boek; door Raden Wijaya gesticht; en hy 
was er de eerste vorst van. Na zgnen dood; die zeer spoedig volgt; wordt hg opge- 
volgd door zijn nog zeer jeugdigen zoon, die een geweldadigen dood sterft. Na 
deze komt diens zuster aan de regeering; wier opvolger is hare zooU; Hayam wumk; 
ook Hyang Wëkasing suka geheeteu; en in diens plaats treedt dan daarna weder 
Hyang wife^a, zijn neef en schoonzoon. Hyang wige^ laat de regeering over aan zgne 
dochter Dewi Suhita; onder wier bewind de groote strijd met oost Java plaats 
heeft; met Bhre Wirabhumi; die door Raden Gajah verslagen wordt. Daarna volgt er 
wederom een vorstiU; straks na haren dood door een Kërtawijaya (?) vervangen, van 
wien al even weinig wordt verteld als van zijn opvolgerS; van welken de laatste 
in Qaka 1390 (?) de kraim van Majapahit verlaat; sah saking kadaton. 

Nu is het bekend; dat de Javanen hoe eenvormig zy over het algemeen 
Majapahit's geschiedenis ook mogen verhalen; dit toch niet altijd op volmaakt de- 
zelfde wijze doen. Het is reeds voldoende hier daarvoor te verwijzen naar hetgeen 
men bij RafSeS; in zgn History of Java; vol. II; aantreft. 

Behoudens de naar waarschijnlijkheid buiten RafSes's schuld zeer mishan* 
delde traditie omtrent de stichting van Miyapahit volgens een bron van Bali, vindt 
men bij hem over Majapahit's geschiedenis verschillende mededeelingen; die zeker 
niet aan één bron zijn ontleend; en het is te betreuren, dat RafSes daarbij niet 
geregeld heeft aangegeven aan wat hij ontleende wat hij mededeelde of van wien hij bet 
vernam; zelfs al moet men daarnevens erkennen; dat hij ook op dit punt weder een 
voor zijnen tijd althans bewonderingswaardige volledigheid heeft weten te bereiken. 

Terwijl het; op bladz. 85; als aan een (pralamhang van) Aji Jayabaya ont- 
leende; behoudens de jaartallen; in wezen overeenkomt met hetgeen men op gezag 
van Eyai Adipati Adimanggala, gewezen regent van Démak, vindt op bladz. 87 : 

(Majapahit) Majapahit 

1301 (16) Jaka sura 1) or Browijaya Ist. 1221 (12) Tanduran. 

(17) Browyaya 2d. (13) Brokumara. 

(18) Browijaya 3d. (14) Ardiwijaya. 

(19) Browyaya 4th. (15) Mertawijaya 2). 
1381 (20) Browijaya 5th. (16) Anakawijaya »). 

wykt daarvan af het op bladz. 86 voorkomende; according to the mannscripts of 



1) Lees Surah. 

2) Elden K&rUwgajra. 
S) Lees Angbiwjaja. 



— 175 — 

the eastern parts of Java, Saménap and Bali ^), as coUected by Natakosama, the 
present Panamhadan of Sumenap : 

Majapahit 
1158 (32) Jaka Sosorah or Bra Wijaya. 

(33) Prabn anom. 

(34) Udaningknng ^). 

(35) Prabu kénya, a prinees married to Damar walan. 

(36) Lëmbu Amisani. 

(37) Bra matonggnng 3). 

(38) Raden alit or Browijaya. 

en daarvan vireder het op bl. 105 en volgg. en 117 en volgg. medegedeelde. 

Dit laatste komt in 't kort hier op neer. 

In 1221 wordt Majapahit gesticht door Raden Tanduran, die door Bra 
Kamara of Browyaya (lees Browijaya) wordt opgevolgd. Daarop komt een niet 
met name genoemde vorst aan 't bewind; zie bl. 119 en 120^ die slechts kort 
regeert. Alsdan volgt Ardi wijaya, wiens dood een billijke wraak is van den 
zoon van zgn patih, dien hij had laten ombrengen. De vijfde vorst heet Mérta- 
wgaya, en de zesde öf Raden Alit (Alitwijaya), die een broeder van Mërtawijaya 
zon zgn geweest, öf Angkawijaya, van wien zoowel wordt ve/haald, dat hij een 
zoon is van dezen laatste, nl. Mërtawgaya, als dat hij dat zijn zou van Raden Alit, 
met dien verstande, dat hij in het eerste geval met Raden Alit een en dezelfde 
persoon zon zijn geweest ^). 

Een ieder zal moeten toegeven, dat by alle overeenkomst hier toch verschil 
bestaat, en dat het moeielijk is in den doolhof een weg te vinden. Nog be- 
zwaariyker wordt het, als men daarbij ook nog gaat letten op de berichten bij 
anderen voorkomende, als Roorda van Eysinga en Hageman s), welke, althans 



1) Bali had Mer wel yeilig geschrapt kannen worden, maar er blgkt uit» en datiaineensekeropticht 
Tmn belang^ dat Natakninma voor Rafflea de legsman moet geweest zgn bg de Balische saken, die in ijn 
boek ▼oorkomen, en dns ook voor de traditie omtrent de stichting van Migapahit, looals men die op bl. 110 
CB Tolgg. verhaald vindt. 

2) Lees Adaningknng. 

3) Te lesen Bra Tafijung? 

4) Be Teroveringen van Mijapahit hebben plaats in de eerste plaats en vooral onder Ardiwgajra, nL 
die van Singapnra, waar Sri Sin I>^rga zon geheerscht hebben en vele anderen, die niet nader worden aange- 
duid, bL 120; onder Mértaw\jajra, wiens patik G^ah mada was, van Indragiri, ibid.; en onder diens op- 
volger of opvolgers van Palembang, en de saidelgke staten van Bomeo, iöid. en 121, Balambangan en Bali 
(op nienw), 121 en 125, van Makasar, Goa, Banda, Snmbawa, Ende, Timor, Temate, Snln, Seram, Manila en 
Bami, bl. 182, terwjl de Prabn kanya, KaQcana wnnga, gezegd wordt een znster te zgn geweest van Ang- 
kiwgaya, bl. 121. 

5) B$ Crawfnrd, History of the fndian Archipelago (1820), vindt men over Migapahit, voorzichtigheids- 
halve, zoo goed als niets, bl., II, 801; Roorda van Eysinga, Handboek der land- en volkenkunde, gesehied-, 
tMÜr» aardrqki- en staatkunde van Neerlandsch-Indië (ook onder den titel Indie ter bevordering der kennis 
vaa NedeHanda Ooei-indiMthe bezittingen), 18i8, Boek lil, deel I, bl. 501 en 298 en volgg. ('t eerste als 



— 176 — 

die van Hagemaii; daarenboven ook al niet als zuivere referaten mogen worden 
beschonwd; aangezien men er berichten van verschillende zyden ontvangen, door- 
een verwerkt in vindt i). Zoo doende is men aangewezen zich zelf een weg 
te banen door zelfstandig inlandsche bronnen te raadplegen en dat zon hier dan 
ook reeds dadelijk zijn geschied ware het niet; dat men bij RaflSes ook op dit 
punt verschillende bijzonderheden aantreft, die tot nog toe in geen Javaanschen 
tekst konden worden teruggevonden; en toch door hem niet verzonnen kunnen 
zijn. Daarop mag de aandacht wel gevestigd worden, of ten minste verdienen zg 
in de herinnering levendig te worden gehouden, tot bij tijd en wijle iemand de 
gelegenheid zal hebben gehad Raffles's verzameling van handschriften, te landen, 
eens behoorlijk na te zien 2). 

Daar nu voorshands ook Kaffles*s mededeelingeu nog niet gecontroleerd kon- 
den worden, zij tot dat doel het voorafgaande hier voldoende, waar thans iets zal 
worden gerepeteerd of bekend gemaakt van hetgeen de Javanen van Java ineen 
paar hunner geschriften over Majapahit verhalen. Daaraan dienen echter nog een 
paar opmerkingen vooraf te gaan, waardoor de lezer in staat gesteld zal kunnen 
worden in de waarde der bronnen een wat juister inzicht te krijgen, dan hg reeds 
bezitten kon. 

In de eerste plaats dient er dan op te worden gewezen, dat tot nog toe 
wat eigentlijk de Javaansche geschiedschryving is, nergens behoorlijk is uiteen 
gezet, ja zelfs laat over het algemeen genomen de beschrijving der bronnen nog 
zoo veel te wenschen over, dat slechts iemand die zelf met die bronnen behoorlgk 
kennis maakte, er zich een eenigszins met de waarheid overeenkomend begrip 
van vormen kan. Dit hier in alle uit\'oerigheid aan te toonen, zou te veel plaats 
vereischen. Het zij hier genoeg te vermelden dat een Javaan zijn geschiedboeken 

sooTeel anders in dat boek nit Rafflca ovcrgeDomeD); Ilageman, Handleiding tot de kennis der geseliiedenis, 
aardmkskunde, fabeUeer en tgdrekenkonde van Java, 1852 I, bl. 18 en Tolgg ; men zie ook Hagemin's 
Algemeene geschiedenis van Ja7a« van de Troegste tgden af aan tot op onxe dagen, in Indiscb Archief !• Jg., 
deel II, bl. 186 Tolgg.; Oordgn's vertaling van 't begin van een babad, uitgegeven door van Iperen in Verh. 
Bat. Oen. I, II en III; Monnier in Indisch Magazgn. 

1) Werd in de vorige noot voor Roorda van Eysinga reeds naar Raffles verwezen, ook bj Hageman 
kan dit g^eschieden; maar bj hem dient op nog meer te worden gelet. 

2) De verzamelingen van Raffles, Crawfurd en Maokeniie te Londen z\jn vooral van belang om 
hare ondheid tegenover latere verzamelingen, als die van Oericke, in 't Ned. Bijbelgenootschap te Am- 
sterdam, om hier sleehts de ondste onder de jongeren te noemen. Vuor de geschiedenis van de Javianaelie 
letterknnde, en dus ook van de Javaansche traditie, die beiden sedert zeer aangezwollen en ook gew\jzigd zJD, 
is een onderzoek van die verzamelingen door iemand, die daartoe behoorlgk in staat is, zeer gewenscht. Zonder 
twQfel vindt men er de ondste producten der nienw-Javaansche litteratuur, na de herleving der Javaansche 
letteren in 't einde der vorige en het begin van deze eeuw, in terug. Van hoeveel gewicht dit is, waar mee 
te doen heeft met een middeleeuwsche literatuur als de Javaansche er een in, behoeft voor hem, die eenig 
begrip heeft van de onderzoekingen, die verricht moeten zjn vuur men eenige orde in den chaos lal kannen 
ontdekken, niet uiteengezet te worden. Hoezeer hetgeen er reeds, vooral door Keyzer en Cohen Staart, ver- 
richt werd op prgs te stellen is, is hetgeen ten deze door hen geleverd werd, zie Bgdr. T. L. en Vk. vao N. 
L| Ut S^» ^^ ^ Tolgr., VI, 145, nog geenszins wat tot een goed iniioht in die vereamelingen leiden kaï^ 



• 177 — 

babad, ook wel sadjarah, noemt, maar dat dan met die uitdrukking veel heterogeens 
wordt bedoeld en er allerlei bijgetrokken behoort te worden wat men van een 
ander standpunt beschouwd^ er niet toe rekenen zou^ en voorts dat uitdrukkingen 
als Babad Jënggala, Babad Majapahit, Babad Dëmak, Babad Pajang, Babad Ma- 
taram, Babad Kartasura, Babad Pêcina; enz. niet beschouwd mogen worden als 
titels van geschriften; hoewel zij als zoodanig in gebruik zouden kunnen zijn, 
maar opgevat moeten worden als korte, niet altijd passende inhoudsaanwijzers, waar- 
mede men zeggen wil, dat een zeker boek handelt over de periode van Java's 
geschiedenis, die in zulk eene uitdrukking aangeduid of genoemd is, of wel dat 
er over die periode in dat boek ook iets voorkomt, 't zij dat nu al zy aan het 
begin^ in 't midden of aan het slot. Van Europeesch standpunt althans, want een 
Javaan is het kwalijk te verbieden zijn geschriften te noemen, zooals hij dat verkiest, 
verdient het volstrekte aanbeveling te spreken slechts van één Babad tanah Djawi, in 
verschillende vormen i), tenzij men werkelijk met iets geheel plaatselijks te doen 
heeft, als bg de Babad Bantén, Babad Cërbon, Babad Banumas, Babad Pasir, Babad 
Bèsuki, Babad Bandawasa, Babad Balambangan, Babad Madura 3), of inderdaad in den 
titel ook de periode wordt aangegeven waarover het boek handelt, zooals in de 
verschillende Babad's Surakarta, de Babad's bëdah Ngayogya, de Babad's Dipa- 
négara, en de Babad's Mangkunëgara en Babad's Paku alaman, of dat men zich bg v. 
tot een vasten regel stelle het eerste en het laatste der in een boek vermelde be- 
langrykste, en een periode kenschetsende feiten te noemen. Doch ook zelfs zoo zal 
byv. in het voorlaatste geval de onduidelijkheid en dubbelzinnigheid nog niet zijn 
weggenomen, zooals bijv. daaruit blijken kan, dat de Babad Dipanëgara, welke 



1) Van de Babsd tanah iljawi werden tot nog toe drie redacties bekend gemaakt, doch allen slechti 
gedeeltelgk. Zj sgn : 1* die waaraan een groot gedeelte, afgedeeld of Terdeeld in verschillende btnkken onder 
de titda b. Pigigaran, b. Pijang, b. Mataram en b. Kartasnra, eerst verscheen als feuilleton in de Jurumar- 
tani en de Bra martani, 1870 — 1875, doch tevens onder die titels, als zooveel verschillende boekeu, werd nit- 
gegeven door Jonas Portier te Surakarta, in dezelfde jaren; — 2* de redactie, die in proza werd overgebracht 
en w66, soover als dat geschiedde, is uitgegeven door Meiusma; van het begin van deze redactie gaf Mounier 
een venlag in het Indisch Magazgn, zie Ie Twaalftal, III, 38 en IV, 143 en 2e Twaalftal, III, 186, terwjl 
Meinsma nog ieta mededeelde van het vervolg in zgn op>tellen Het fort te Kartasoera in 1741, Bijdr. T. L. 
en Vkt Se volgr., VI, 866 en Geschiedenis van Kartasoera volgens de Babad in prozn-bewerking van den 
heer C. F. Winter Sr., ibid., 4e volgr., IV 565; tot deze redactie behoort ook wat in 1 874, in ^t^^any, onder 
den Ütel Babad Pëljina bj van Dorp verscheen; — 8% de redactie, welke van Dorp nitgaf onder den dub- 
belen titel Babad Paljadjarran en Babad tanah Jawi, 4 deeltjes, 1835—1890. 

2} De Babad Bafiumat en de Babad Pasir leerde ik kennen door tusscbenkomst van Dr. C. Snouck 
Hniycronje. Over de Babad Bantén zie men boven de aanteekening bg Hoofstuk VIII en de noot daarbj; 
wal de Babad BCsnki en de Babad Bandawasa leveren, werd medegedeeld in Not. Sat. Gen., XXXI (1898), BgL 
VIII, waar men ook de oudere literatuur over de eerste dezer beiden vindt aangegeven ; een Babad Balambangan 
(in pioia) werd behandeld in Tjdschr. Ind. T. L. en Vk. XXXVIT, bl. 825, en XXXVIII, bl. 283, en een 
dito in OmUnff, gedeelteijk, nl. Zang I— XXIII, in Tgdschr. Ind. T. L. en Vk. XXXV, bL 452 en XXXVII, 
f48; en Tm de Babad Madura leverde Dr. Palmer van den Broek een referaat in datzelfde tijdschrift, XX, 
kh 241—801, 471—568; XXII, 1—89, 280—310 en XXIV, 1—167; hg behandelde haar niet geheel, daar 
er over het laatste geleelte nog een verslag geleverd dient te worden» sie Vreede, Catalogus enz., bl. 148. 

Vcrh. Bat. Gen.. Deel XLIX. 12« 



— 178 — 

door den verbannen vorst zelf vervaardigd werd, ook een resumé geeft van Java's 
voorafgaande geschiedenis in haar geheel; dat de Babad palihan nêgari i) begint 
met de stichting van Surakërta en eindigt met het aan Mangknnëgara toewgzen 
van het deel dat hij ontvangt; dat de Babad bédah Ngayogya, in ééne re- 
dactie, aanvangt met het aan het bewind treden van Daendels en de geschiede- 
nis van Yogya er tot ver na de verovering van de kraton door de Engelscheu 
in wordt voortgezet; enz. ^), terwijl men ook in de Babad Bantén (bedoeld is de 
groote) en de Babad's Cérbon een overzicht van de geschiedenis van eigentlijk 
Java in 't algemeen niet mist. 

Waar het hier om te doen is, een gedeelte van Java's oudere geschiedenis, 
daaromtrent leidt die titulatuur nog verder van den rechten weg, en inderdaad, 
wel beschouwd, is er, zooals boven eigentlijk reeds te kennen werd gegeven, maar 
één babad tanah Jawi, in hoevele verschillende vormen deze nu al voorhanden 
zgn mag. Die babad, die haar vasten vorm verkregen heeft in het einde der !?« 
oi het begin der 18» eeuw van onze jaartelling, is eenig en alleen, en naar den 
inhoud mag men zeggen kanoniek, daar met haar verschijnen alle oudere geschied- 
boeken, welken men toch wel mag en moet aannemen, dat de Javanen eens be- 
zaten, zoo goed als spoorloos verdwenen zijn, zoo zelfs dat men te vergeefs ook 
in andere dan geschiedkundige geschriften speurt naar reflexen van die oudere 
geschiedschrijving, dezen althans, ten minste door schrijver dezes, nog niet 
konden worden ontdekt 3). In hoevele vormen (redacties) die babad, die loopt 
tot aan het contract met Verijssel in 1743 A. D., in haargeheelof bij fragmenten, 
ook voorhanden moge zijn, steeds geeft zij, hoewel telkens in andere woorden ^), 

met slechts zeer onbeduidende kleine afwijkingen, zakelijk hetzelfde te lezen, en niet 
anders dan wat men te qualificeeren heeft als een gedecreteerden en gesanctioneer- 
den vorm van Java's geschiedenis volgens de opvattingen van een bepaalden. 



1) Hier wordt bepaaldelgk bedoeld de redactie van Yasadipura; er bestaan er verscheidenen over 
deze periode, ook wel ondf-r den titel Babad Mangkabumcn, iraaronder een onder Mangknnégarasclien invloed 
geachrevene om de geheel andere opvatting of waardeering van verschillende zaken zeer belangwekkend is. 

2) Een Babad Bipanëgara verscheen in 1874 bjj van Dorp te Samarang. Deze baèad ia een anden 
dan die door Pangeran Cakranégara werd vervaardigd. Hg dr. T. L. en Vk., 2e volgr., III, 140, of de van 
Dipauëgara zelf afkomstige, Not Bat. Gen. II (1864) 251; VI (1868), 26, en XV il877), 89. Het begin 
van de Babad palihan nëgari van Yasadipnra werd, onder de titels Babad Giyanti en Babad Snrakaita, I — 
II f, in 1885 — 18S8 uitgegeven, gedeeltelijk te Snrakarta en gedeelteijk te Yogyakarta. 

8) Op een zeer merkwaardig stuk, waarin zich iets van die oudere geschiedschrijving, althans voor 
oost-Java, nog afspiegelt, kon gewezen worden in Iets over een onderen Dipanégara, enz. in Tjdschr. Ind. 
T. L. en Vk., XXXII. 

4) Men lette er intasschen op dat het gedeelte, hetwelk de lotgevallen van Jaka Tingldr, den lateren 
eenigen vorst van Pigang, beschqjft veelvuldig, ook daar waar de veibatie van het overige afw\jkt, toch eenalni- 
dend, of zoo goed als woordclgk hetzelfie is. Dit gedeelte moet dus lo een oud stuk zgn, en 2o reeds vroeg- 
t^dig bgzonder de aandacht hebben getrokken of in den smaak zgn gevallen, dat men het of geregeld heeft 
a%eaèlireTeii hf wat eerder ia veroniersteUen ia nit het hooU kanie, en respecteerde. 



— 179 — 

den boven reeds aangewezen tijd i). £n geldt dit reeds voor het meer historisehe 
gedeelte van het boek, dat hetwelk de geschiedenis van Java behandelt sedert de 
komst der Hollanders, men zegge te beginnen met den tijd van het opperbewind 
van Hataram, ook ten opzichte van het daarin over de voorafgaande perioden ver- 
haalde kan men niet anders z3ggeo, dan dat het altijd een en hetzelfde geeft en 
daarbuiten eigentlijk niets voorhanden is. Met het oog op dit laatste dient er 
echter nog iets te worden opgemerkt. 

By het voorafgaande werd geenszins vergeten of voorbygezien^ dat er 
nevens dat gedeelte van de babah tanah Djawi, hetwelk de oudere geschiedenis 
behandelt, een rijke literatuur voorhanden is aan wat men de bronnen voor dat 
gedeelte zou kunnen noemen, ook al zijn verschillende der hier bedoelde boeken 
jonger dan die bahad in haar eersten opzet zelf ^), en er verder ook nog ge- 
schriften bestaan, die in den trant van een geschiedverhaal den ouderen tijd uit- 
voerig beschrijven. 

Hierby dient men toch vooreerst in het oog te houden, dat eensdeels die 
eerste serie van geschriften juist leverde wat men in een beknopten, zelfs zeer 
beknopten vorm in dat eerste gedeelte der babad terugvindt, en anderdeels dat, 
terwgl de Javanen den intioud dier juist bedoelde boeken zijn gaan beschouwen 
als hun eigen eigendom, en zóó als een deel van hun oudere geschiedenis, zy in 
die uitvoerigere babad'% over den ouderen tijd ook al weer niet anders leveren 
dan men in dezen aantreft, onder voorbehoud alweer dat men den inhoud daar- 
van intusschen niet altijd even correct, vergeleken met die geschriften, er in 
terugvindt. 

Wat daarvan de reden is zij hier in het kort even aangegeven. 

Als men, voor zoover dat nu reeds mogelijk is, de geschiedenis der Javaan- 
sche letteren in 't algemeen de revue laat passeeren, dan blijkt het, dat deze na 
een aanvang genomen te hebben, steeds meer en meer aangroeide, zich oudertusschen 
herhaaldelijk ook repeteerende. Terwijl er van het oudere verloren gaat, blijft 
een gedeelte er van bestaan, wordt er weer een gedeelte in een nieuwen vorm 



1) Hieruit volgt direct, dat men de vele redacties die van de babad tanah Cjawi of gedeelten daarvaa 
bestaan, niet naar den inhoud, waarvan intnsschen wel de omvang aan te geven is, te beschrjjven heeft of te 
Tcrgeljken, maar dat men ze naar hst niterljjk, den vorm dii-nt te kenschetsen. Ditzelfde geldt voorloopig 
ook van van alle aniere hetzelfde verhaal leverende geschriften of redacties, als de Damar wulan's, de Yosnp's, 
de Anbia'a enz. enz. 

2) Evenmin dat men naast het latere gedeelte b\jv. een Babad bèdah kuta Mangir en een Pranacitra 
aantreft Wat dit laatste geschrift aangaat, dat een enkele episode uit den tgd na de verovering van Pati 
door Mataram beschrgft, het is het lezen meer dan waard, daar het een der fraaiste Javaansche boeken van 
Dienweren tjd is, vooral in de van de onlere niet zoo heel veel af\fgkeultt nieuwere redactie, die in 1873 bjj 
Jonas Portier verscheen, en later in 1888 nog eens door van Dorp & Co., Samarang werd uitgegeven. De 
ftbad béjah kuta Mingir of wat daarin verhaald wordt, werd ook in de b\j die zelfde firma verschenen, 
Bnbad tuuh Jawi, Deel I— IV, 1885--1S90, verwerkt, nalat zg afzjnleimk reeds in 1873 ter zelfde plaatse 
Ycnchenen was. 



— 180 — 

gebracht en ziet men ook nieuws verschijnen, waardoor het voorhandene^ dat in 
volamen afnam, aan de andere zijde weder op tweeledige w^ze aangevuld of 
verrijkt werd. Dit proces herhaalt zich, als bij alle middeleeuwsche letterkunde, 
verscheidene malen, niet op alle punten natuurlijk even druk of gelijkmatig, met ze- 
kere schokken slechtS; en nu bij voorkeur in het eene onderdeel en dan weer in 
een ander. Daarbij heeft nu ook de beoefening der letteren bij de Javanen^ wier 
letterkunde inderdaad een volslagen middeleeuwsche is, evenals men dat overal 
elders bij een diergelijke literatuur aantreft, steeds ook als een te beoefenen kunst 
hoog gestaan, een kunst intusschen, die geenszins los was van banden, maar in- 
tegendeel, hoewel zulks niet gereglementeerd was, toch steeds in zekere vormen 
bevangen was en bleef. Van een vrijheid van handelen, een vrije keuze van on- 
derwerp^ een vrge dictie, een eigen gedachte uitgedrukt in het geleverde^ geen 
spoor, want met dit alles is niet te verwarren het verschil in taal door lengte 
van tijd, het verschil in voorstelling uit een zelfde oorzaak geboren, of wat meer 
een onderling verschil in de verschillende overeenkomstige geschriften in het leven 
kan hebben geroepen, doch niet voortkomt uit een vrije, zich zelf bewuste en 
toegepaste, individualiteit van de auteurs. De Javaansche literatuur is, ook daar 
waar zij van leven getuigt, een kunstige, en een kunstmatige, zooals èen ieder 
in het oog moet loopen, als hij slechts letten wil op de uniformiteit van den op- 
zet, het raam van de verhalen, de geijktheid der taal, desnoods ook hier pe- 
rioden onderscheidende, al naarmate zij een korter of langer leven reeds achter 
den rug heeft. Het boeken maken, het schrijven van gedichten is bij de Javanen 
dan ook van oudsher iets van beteekenis geweest, zooals ook uit bepaalde feiten 
blijken kan. 

Onderzoekt men die over den ouderen tijd uitvoeriger hahad^B iets nauw- 
keuriger, bijv. door er zich een kort overzicht van te vervaardigen, een inhouds- 
opgave of een reeks van titels van hoofdstukken, waarin men zulk een boek zou 
kunnen verdeden, dan bespeurt men spoedig, dat zulk geschrift, van eenbepaald 
standpunt, al evenzeer een handboek voor de Javaansche letterkunde zou kunnen 
worden genoemd als een geschiedverhaal; dat zulk een boek evenveel recht zou 
hebben op een titel Sërat kanda, zooals men bij RaflSes (surat kanda) vindt i), of 
pépakêm, in den zin van handboek, voor wat zal zoo dadelijk blijken, als op babad. 
Nog sterker loopt dit in het oog als men in zulk een geschrift, waarin men ook 
steeds tallooze genealogische opgaven aantreft, geen jaartallen vindt genoemd^ die 
den tijd aanwijzen, waarin de gememoreerde gebeurtenissen zouden hebben plaats 
gehad; en wat zeker van nog meer belang is, als men in den tijd teruggaat en 



1) Een dezer aoort telwtcn begint botweg: purwakanda jhOnging jhtg nabi, nabi adam JwmhiHg 
ing mHak; eeo ander na bet jaartal met den datum {woga-guna-aahta-janmi, 1781 of 1739 = A. D. 1804 
of 1SI2) ndan jmncanikang earita, kandanipun ringgit paruwa nhtggih, Paruwa is een nienwe vorm Toor 
parwa, en loa men als een der scbakcls kannen bescbonwen tasseben dit woord en bet er Toor in de f^f f 
gelredeu purwa, waar dit laatute den sin van wagang purwa beeft. 



— 181 ~ 

de verechillende bier in aaDmerking komende geschriften in de vergelyking trekt^ 
dan komt men feitelyk het laatst terecht bij een handboek voor den dichter ^). 

Het is ondoenkeiyk dit hier in bijzonderheden aan te toonen^ te minder daar 
hier ook nog op een wisselwerking dient gewezen te worden, welke er plaats 
moet hebben gehad tassehen de geschreven en de mondelinge traditie, daar naast 
de voortgezette reeks van voortdurende repetitien in een vasten vorm (geschreven 
en hg voorkeur in maat) van de oude, langzamerhand in talrijkheid toenemende 
verhalen, er ook een geregelde mondelinge overdracht, in ongebonden vorm, bestaan 
heeft van die zelfde verhalen, onder het opvoeren daarvan als H'^j/a;i()f-stukken. 
Terwijl de wayang'VQrhsileu voor een deel althans ontleend zijn aan de oudere 
schrifturen, van welken er voor ons nog verscheidenen gespaard zijn, lieten zij op 
hunne beurt weer hunnen invloed gelden bij het vervaardigen van nieuwe bewer- 
kingen dier oude geschriften of gedeeltelijke omwerkingen er van, welke nu op 
hare beurt straks weer het hare in de waijang brachten, en zoo ging het voort, 
gesteund vooral door die geschriften, die dienen moesten het den dichter gemak- 
kelijk te maken hunne producten te vervaardigen, 't zij door het geven van regels 
of voorbeelden voor de metriek, 't zij door het aan de hand doen van synoniemen, 
en straks ook door genealogien in op- en in afgaanden lijn, door biographien van 
bepaalde personen, het teekenen van hunne onderlinge verhouding, het leveren 
▼an korte inhoudsopgaven van gedichten of andere werken, en dit alles natuurlijk 
niet vrij van fouten tegenover de oorspronkelijke, de oudste, straks de oudere 
teksten, en onder den invloed van de mondelinge traditie, of van de wayang in 
den vorm, waarin deze in den tijd van de respectieve schrijvers dier handboeken 
leefde, en die op hunne beurt, zooals van zelf spreekt ook weder te gast waren 
gegaan bij die handboeken, welke het voor de dalaiig's niet minder dan voor de 
dichters, van belang was ze te kennen. 

Het moet op deze w^ze zijn geweest, dat langzamerhand, parallel met het 
overige der Javaansche literatuur, waarvan ook in haar de reflexen teruggevonden 
worden, dus èn de waivacans èn de tvayaw^-verhalen in hun historisch verloop, die 
de oudere geschiedenis van Java uitvoeriger behandelende babad's zijn ontstaan, 

1) NI. de Candakirapa of Candrakirapa, de ons door de opstellen van dun Heer K. F. Holle en Prof. 
Kcm, TjdBcbr. Ind. T. L. en Vk., XVI, 461, en Travaux dn 6«ue CJongrcs des orieutalistcs, II f, 2, bL 1, 
welbekende Ko^a. Uit dit handboek voor den dichter, dat bestaat uit een handleiding voor de spelling van 
•anikrit woorden en de oude (Hindu) metriek, waarin o. a. ook de Aryft beschreven wordt, en een woorden- 
boek van synoniemen, dat op Amarako^a's Amaram&lü gebaseerd moet zijn, zie Tgdschr. Ind. T. L. en Vk., 
XXXII, 180, noot 1, ontstond het Captakaparwa (proza-handboek voor het stellen van fraaie literatuurpro- 
dacten), dat op zjju beurt naar alle waarschgnlgkheid weer het leven heeft gegeven aan de Rftmft9rama's en 
de Sérat kanda's. Be titel van de Candakirapa (een opzetteljjke wijziging van Candrakirana, omdat het over 
Tersmaten, cAanda, handelt, of slechts uit een vergissing geboren) is ontleend aan de beginwoorden van het boek: 
kirmifawfyalicandrdgnL Vooral in lateren tyd heeft dit geschrift, dat zeer oud achgnt te zgn, zie t a. p. in 
Tgdschr. Ind. T. L. en Vk., deel XXXII, een grooU-n invloed gehad. Voor zoover de eigentljjk gezegde 
takawm's betreft stuit men op het eigenaardige verschgnsel, dat dezen, metrisch althans, er als het war« buiten 
om van zgn vervaardigd. 



— 182 — 

b abad*B dnS; die men evenzeer pepakem zou knnnen^ handboeken als zg tevens zgn 
èn voor de latere dahng*8 zoowel als voor de latere dichters. 

Het spreekt van zelf dat in deze soort babad's, die in den ouderen tijd; zoo 
de naam babad een oude was^ zeker zoo niet genoemd zouden zijn geworden^ noch 
dat werden, eerst langzamerhand meer en meer stof werd opgenomen^ en dat de 
iongsten dezer soort geschriften ook het rijkst moeten zijn. Gaandeweg kreeg, 
met het aanzwellen van den tijd, er een grooter tal van onderwerpen, of van ver- 
halen, een plaats, ^velke gemakshalve geordend werden in een chronologische 
volgorde, of in een te veronderstellen opvolging van dien aard, tot ten slotte de 
geschriften van deze soort zich als 't ware van zelf voordeden als geschiedverhalen, 
te eer omdat de regeerende vorsten hun geslacht afleidden uit de helden dier 
oude verhalen, en men door de eene of andere ideosyncratie er toegekomen was in 
Java het terrein te zien, waar dezen leefden, en zij hunne heldendaden verrichtten i). 
Niet minder duidelijk is het verder, dat de makers van deze geschriften steeds k poste- 
riori redeneerden en schreven, zoodat het er in voorkomende er eerst een plaats 
in krijgen kon, zelfs pas een vrij langen tijd na het bij de Javanen bekend 
raken van de verhalen, die men er in aantreft, of het plaats hebben van het feit, 
dat er om zoo te zeggen het laatste onderwerp in is, hetwelk er in behandeld 
wordt, zoo dit een historisch was. 

Van de soort geschriften, die op die wijze hier in aanmerking komen, en 
ten slotte inderdaad een meer geschiedkundig uiterlijk verkregen, dan in den aan- 
vang het geval was, bestaan er verscheidenen. Op den duur heeft men er zich 
blijkbaar meer en meer op toegelegd om ze volledig te maken, en die van den la- 
teren tijd verdienen den naam babad, hoe onhistorisch zij ook naar hun oorsprong zijn, 
niet minder dan bijv. de babad tanah Djawi, waarover boven werd gehandeld, en de 
oudere geschiedenis, zooals gezegd werd, slechts zeer beknopt bespreekt. In die 
producten van jongere dagteekening vindt men den invloed van den Islam voor 
zoover deze zich in de tegenwoordige genealogien der vorsten van Java uit, reeds 
duidelijk voorhanden, is ook het beloop verder vrij wel hetzelfde 2), ook zij, dit 
mag men wel zeggen, kunnen niet ouder zijn dan uit denzelfden tijd als waarin 
men het ontstaan en de kanouiseering van de babad tanah Djawi te plaatsen 
heeft. £r voordeel uit te trekken voor de oude geschiedenis van Java zal dus al 
even bezwaarlijk gaan als bij de babad tanah Djawi zelf. Toch zullen zij de 
aandacht verdienen, en een onderzoek ook met het oog op Majapahit nog wel 
waard zijn, vooral ook omdat men aannemen mag, dat hetgeen men bij RaflSes 

1) Ook dit is een gecompliceerd proces. Eendeels waren, volgens de genealogische opvattingen, de 
vorsten en grooten van Java afstammelingen van sommigen dier oude helden, anderdeels vindt men ook in 
ondere geschriften reeds dat stukken, bepaaldelgk de bergen, van Ëngelseh-Indie na»r Java werden overgebracht, 
een voorstelling, die zonder twijfel gegroeid is uit het overdragen hunner nameo op gebergten op Java te 
vinden. 

2) Eigenaardig is, dat de Rama-legende er steeds in behandeld is volgens hetgeen de Rama Kling 

levert. 



— 183 — 

meer vindt dan de babab tanah Djawi^ ook in hare verschillende redacties, daar* 
over levert; aan een geschrift ontleend moet zijn van een aard als de zoo joits 
beschrevenen i). 

Onder de vele aan schrijver dezes bekende boeken van deze soort is er 
slechts één, dat ver genoeg doorloopt om bij de bespreking van Majapahit's ge- 
schiedenis, volgens de opvatting van Java, in aanmerking te komen. Hier kan, 
en moet das volstaan worden met het mededeelen van hetgeen er in dit geschrift 
voorkomt, terwijl het voldoende wordt geacht zich bij de Babad tanah Jawi tot 
één tekst te bepalen. Het laatste boek ga voor. 

In de Babab tanah Jawi, den prozatekst ed. Meinsma, die hier als type 
wordt gekozen, ook omdat die babad voor een ieder bereikbaar is, vindt men, nadat 
op bl. 21 de stichting van Majapahit is medegedeeld ^), verhaald, dat Arya Bangah's 
rgk door Pajajaran wordt overvallen, hy zelf naar Majapahit vlucht en dat daarop 
Pajajaran door Majapahit wordt veroverd. Van Brawijaya krijgt Arya Bangah daar- 
op den naam Arya Panalar, terwijl Wiro /mdh Wahan wordt gemaakt, en Nambi 
en Bandar matUri. Daarop wordt er verder verteld, dat de vorst van Majapahit een 
zoon krygt, prabhu anoniy evenals ook Wahan er zich een geboren ziet worden, die 
Udara heette en o^i/id/i van Daha werd. Prabhu auom volgt zijn vader op, doch doodt 
Wahan, die bij hem palih bleet, omdat deze hem niet vrij naar hartelust laat jagen. 
Hg neemt daarvoor Ujung sabata in den arm, den lurah kajinenian^ die Wahan 
met de hem geschonken kris Jangkung pacar overhoop steekt, tengevolge waar- 
van de genoemde adipaii van Daha een gelegenheid zoekt en vindt den vorst te 
dooden om den dood zijne vaders te wreken. De opvolger van Prabhu anom is 
Prabhu Adaningkung, wiens zoon was Hayam wuruk, en diens zoon was weder 
Lëmbu Amisani, wiens paiih heette Dëmung s) Wular. Lémbu amisani had ver- 
volgens tot zoon Kaden alit, die als vorst Brawijaya heette en wiens palih Gajah 
mada was. 

Ziedaar in werkelijkheid eigentlij k alles wat de babad van Majapahit ver- 
telt, daar hetgeen er op volgt feitelijk tot niets anders dienen moeten dan om den 
oorsprong van de verkondiging van de Islam op Java, bare overwinning op het 
oude geloof, die samengaat met den val van het rijk, en het genealogisch verband, 
dat er tusschen het Majapahitsche vorstenhuis en de later op Java regeerende 
vorsten bestaat, of verondersteld wordt te bestaan, in het licht te stellen. 

In een eenigszins andere volgorde levert genoemde babad, op bl. 24 — 48, 
nl. aan feiten niet anders dan het volgende, dat hier om de volledigheid èn ter 
vergelijking even in herinnering wordt gebracht. 



1) Het is ook ait zulk een geschrift, dat Hagenian Toor een groot ge'leelte, onder raadpleging fan 
KafSes, f^n Fabelleer, in zijn Handleiding enz. II, bl. 237 en volgg., moet liebben geput. 

2) Het voorafgaande werd boven reed« behandeld. 

3) Da onde vorm, niet déman^. 



— 184 — 

De laatste Brawgaya hnwt achtereenvolgens vier vronwen^ eene prinses uit 
Cémpa^ eene renzin, eene prinses van Cina en eene vronw van Wandan. 

De eerste wordt voor hem door Gajah mada van Cémpa gehaald. Haar 
vader geeft als een huwelijksgeschenk de gong Kyai Sëkar dalima, de garebang 
Kyai Bale Inmur en een wagen, Kyai Jëbat betri. Zij heeft nog een zuster en 
een broeder. Haar zuster is gehuwd met Makdum Brahim Asmara, een moslim, 
die heel Cömpa reeds bekeerde en bij zijne vrouw Raden Rahmat en Raden 
Santri verwekte. Haar broeder volgt zijn vader op. Van kinderen van Brawijaya 
bij de prinses van Cëmpa wordt niet gewaagd. 

Bg de tweede, die in vrouwegedaante, als endang Sasmitapura, tot hem 
was gekomen, en hem weer verlaat als zij rauw gehakt heeft gegeten, krijgt 
Brawijaya een zoon, Ki Dilah. Dit jonge mensch gaat later naar Majapahit, ver- 
plicht zijnen vader door hem in staat te stellen op de atun-alun te jagen als in 
't bosch (hij brengt er alle wilde dieren), krijgt dan den naam Arya damari)^en 
wordt over Palembang gesteld, waarheen hem, zwanger, 

de derde vrouw, de prinses van Cina, wordt medegegeven. Deze schenkt 
straks het leven aan raden Fatah, en daarna aan radefi Usen, een zoon door Arya 
Damar bij haar verwekt. 

De vierde vrouw, die uit Wandan, neemt de vorst om van de rajasinga 
af te komen, zooals hem werd aangeraden. Hij schenkt haar dadelijk weer weg 
aan een Juru sahin, Kyai Buyut Masahar. Haar zoon was Bondan Kajawan, die 
volgens het bevel van Brawijaya, dadelgk moest worden omgebracht. 

Raden Rahmat en Raden Santri, de zonen van Ibrahim, gaan met hunneef^ 
den zoon van den jongen vorst van Cémpa, raden Burereh, naar Java, hun tante 
bezoeken. Rahmat huwt met de dochter van Tuménggung Wilatikta, die nog een 
zoon had, Jaka Said, Hij vestigt zich te Ampel dënta. De beide anderen huwen 
met dochters van Arya Teja en gaan te Garësik wonen. 

Ook Radeti Fatah en raden Usen komen naar Java, na twee roevers, Supala 
en Supali, overmand te hebben. De eerste gaat eerst in den leer te Ampel dënta, 
huwt met de dochter van nyai ageng Maloka, des mnan\s kleindochter, en vestigt 
zich dan op eene plaats met geurige glagah, die den naam Bintara krijgt, terwijl 
de tweede bij Brawijaya in dienst komt en adipati van Tërung wordt. Na door 
zgn vader te zijn ontboden en zijne opwachting gemaakt te hebben, wordt raden 
Fatah adipati van Bintara. 

Nu was ondertusschen uit Juldah een zekere Seh Wali lanang naar Ampel 
dënta gekomen, die straks verder gaat, naar Balambangan, daar huwt met de 
prinses, weggejaagd wordt, omdat hij Balambangan bekeeren wil, en nu zyne 
vrouw, als hijzelf naar Malaka gaat, zwanger achterlaat. Zijn na zijn vertrek gebo- 
ren zoon wordt in zee geworpen, maar opgevischt door een kaptein van Nyai pinatih 



]) Het verdient zeer de aandacht, dat liet jonge menscli, dat alle dieren uit liet wond, eendrachtig, 
op de alun-alwi weet te brengvn (te tooTeren), jnist Jaka Dilah, en Arya Damar heet. 



— 185 — 

van GarCmk, de weduwe van een zekeren uit Balambangan verbannen ki Sam- 
boja 1); tot haar gebracht; door haar als kind aangenomen^ bij raden Rahmat in 
deo leer gedaan^ dan diens schoonzoon, en later Sunan Giri, prabu Satmata, te za- 
men groot geworden met Sunan Bonang, prabu Nakrakusuma. Vóór hun huwe- 
Igk hadden deze beiden getracht naar Mëkah te gaan, maar Seh Wali lanang, 
dien zij te Malaka ontmoetten, had hen teruggezonden en hun die namen gegeven. 

Jaka Said, de zoon van den (urnénggang Wilatikta, wordt straks door dezen 
laatste (Bonang)^ op wonderbare wijze, bekeerd, gaat naar Cérbon, is daar bij de 
rivier Kali Jaga kluizenaar, en verkrijgt zoo den naam Sunan Kali Jaga. 

Ook Bondan Kajawan treedt nog even op 't tooneel. Wel had Brawijaya 
bevel gegeven hem te dooden, doch dit was niet geschied. Met Kyai Masahar 
komt hg te Majapahit, bespeelt daar de Sëkar dalima, en wordt door Brawijaya 
erkend en begiftigd met de krissen Kyai Mahesa nular en Kyai Malela en den 
lans Kyai Plered. Hij wordt naar Tarub gezonden, waar hij met Nawangsib, de 
dochter van een widadari Nawangwulan en den ht/ai gede, huwt, op deze wijze 
geparenteerd rakende aan Kudus, want deze kyai gede was de in de wildernis 
geboren, door ran^a Tarub aangenomen zoon van de dochter van ki ageng K6m- 
bang Lampir en een weggeloopen zoon van Kyai agSng Kudus. Kyai ageng Tsinih 
geeft Bondan kajawan den naam Lëmbu pëtëng 2). 

Het nieuwe geloof had ondertusschen groote vorderingen gemaakt. Op 
verschillende plaatsen zaten sunan^B] zoo was er o. a. ook nog een zekere Seh 
Aripin, die na zijn dood te Pamalang begraven werd. 

Brawgaya zendt daarom Gajah mada tegen Giri. De sunan daar werpt 
zgn schrijfstift {kalam\ onder een gebed, neer; deze wordt een kris, de kalam of 
Kala muiiéng 8)^ en verjaagt den vijand. Na des sunan'^ dood, als zijn kleinzoon 
Snnan Prapen hem is opgevolgd, trekt men op nieuw tegen Giri op. Men breekt 
het graf open, doch wordt door de daaruit te voorschijn komende wespen ^) naar 
Mqapahit tem^edreven. Raden Patah wordt nog eens opgeroepen. Hij weigert 
te komen, komt zelfs in opstand, en nu trekt men, de verhouding is een andere 
geworden, vereenigd met Madura, Tuban, Surabaya en Giri, tegen Majapahit op. 
Brawijaya vaart met al wie hem nog trouw was gebleven, ten hemel. De glans 
(majesteit, grl, voorgesteld door een andarii) van Majapahit gaat over op Bintara. 



1) Op het wellicht zeer belangrijke van dezen naam Samboja, wees Prof. van der Lith in z^n Mer- 
▼eiUes de l'Inde, zie aldaar. 

2) Ook Lëmba pëtëng, mede voorkomende als de stamvader der vorstenliuizen van Madura, is een 
merkwaardige naam, niet minder dan het geheele verhaal van dt-n zwervelinp?, die na eerst door Kyai Sela 
▼enoigd te zgn, in Tamb komt, en dan hawt met Nawang wulan, een der badende widadari*^. 

8) Deze legende berust vermoedelijk op eene woordspel of een eigenaardigde spelling. Kala muilen g is als 
ntftm Tin een kria geheel begqjpelgk; kalammnflëng gespeld, lost men dit weder licht in Kalam muüëng op. 

4) Men herinnere zich hier het pl^landnk verhaal in den door den Heer Klinkert in 1893 oitgegeTen 
Pèlanduk-tekst, no. 7 ^bl. 70— 80\ zie Tjjdschr. Tnd. T. L. en Vk, XXKVII, 382. 



— 186 — 

Gedurende 40 dagen neemt Giri het opperbewiud waar. Dan wordt Raden Patah, 
Senapati Jimbnn^ tot sultan van Dëmak gehuldigd. 

Ook bij de Sërat kanda vangen wij hier het verhaal aan met de stichting 
van Majapahit^ die volgens dezen tekst in 1221 A. J. zou hebben plaats gehad. 
Men vindt hier een geregelde reeks van jaartallen (1221, 1223, 1229, 1234, 1250, 
1267, 1270, 1301, 1308, 1320, 1327, 1328, 1329, 13 . 2, 1398, 1399, 1400), 
waarop intusschen vermoedelijk al zeer weinig te vertrouwen is. Toch verdient 
het verhaal, zooals het hier gedaan wordt, zonder twijfel zeer de aandacht, al 
dient men het wellicht voor het grootste gedeelte historische waarde te ontzeggen. 
Bij de lezing houde men de bovengemaakte opmerkingen vooral in 't oog, en 
zonder twijfel doet het, al is dat niet de reden waarom er hier eene plaats 
aan moest worden toegekend, ons een eigenaardigen blik slaan op de geschie- 
denis van den Damar wulan roman, bepaaldelijk het laatste gedeelte daarvan. 
Was het mogelijk den ouderdom van deze redactie van de Sërat kanda iets 
nauwkeuriger te bepalen, dan ons thans gegeven is, waar slechts gesteld kan 
worden dat zij vermoedelijk uit het laatst der vorige of het begin van deze 
eeuw is, dan zou door vergelijking misschien den gang van den aanwas van dat 
verhaal iets meer in bijzonderheden kunnen worden bepaald, en het zoo gelukken 
iets beter kennis te krijgen van de geschiedenis van een enkel onderdeeltje van de 
Javaansche letterkunde. In ieder geval blijft eene vergelijking van wat deze tekst 
levert over den tijd dat Majapahit bestond, met hetgeen men in de verschillende 
variaties van den oudsten Damar wulan tekst aantreft i), in zoo verre niet onbe- 
loond, omdat men er uit leeren kan hoe op een zekeren tijd een groot gedeelte 
van hetgeen men in beiden vindt, een als 't ware vloeiende massa was, waarvan 
later enkele deelen een meer vasten vorm hebben aangenomen. 

In die Damar wulan variaties vindt men allerlei om den persoon, die de 
held van den roman is, geconcentreerd, wat hier gezegd wordt plaats te hebben 
gehad onder de regeeringen van verschillende elkander opvolgende vorsten, en het 
opmerkelijkste daarbij is wel, dat zelfs de inval van de Wandan en de Inggris, 
volgens de voorstelling hier, niet onder zijne regeering valt, terwijl hij onder al 
het andere zich in den Damar wulan romans, ook in de andere redactie's, een vaste 
plaats veroverd heeft ^j. 

1) Zie boveD de noot b^ Hoofdstuk XII. 

2) Deze bijzonderbeid wettigt de verouderstelling, dat de Sérat ka^du, waaruit hier reuige inededee- 
lintren worden gedaan, betrekkelijk oud is, en ouder dan vermoedclyk al die toevoegsels tot den Damar wulan 
rolkan. Men vindt hier ook nog andere groote afw^kingen. Logënder is niet de broeder van ITdara, inaar 
de zoon van een anderen, vroegeren patik, H|) heeft slechts één zoon, geheeten Layaiig setru kumitir, waarde 
roman een Layang setra en een Layang kumitir geeft, en deze eene zoon wordt na de krooning van Damar 
wnlan, als vorst van Mijapahit, in zijns vaders plaats, terwijl die zich terugtrekt, patik, en is dan niemand 
anders dan Gajah mada. Ook Rangga lawe heeft maar één zoon. Raden Buntar wat«ngan, waar er twee in den 
roman optreden, Raden Buut«rau en Raden Watangan. De prabu kènya is de dochter van den vierden vorst 
vun Majapahit, terwijl ia den roman gesproken wordt van den derden Braw^aya. 



— 187 — 

Onder de regeering van Damar wnlan^ die ook hier koning wordt, en dan 
Mértawijaya heet, heeft er slechts een vriendschappelijke overkomst plaats van 
Andaka sasi, Knda rangeyan (niet Rarangin) en Kada tilarsa, die respective thuis 
bebooren in Kamboja, Baöjar (nl. Baüjarmasin) en Sukadana, welke drie rijken 
onderworpen waren geworden, tijdens de regeering van Adaningkang^ den vader 
van de prabu Icénya, zie Zang 392 en 382, en voorts valt in den tijd van zijn 
bewind ook nog de tocht van Sapa naar Balarabangan om den door den vorst van 
daar gestolen kris terug te halen, Zang 394. 

De inval van Wandan en van Inggris heeft hier plaats onder Angkawijaya, 
zyn zoon, zie Zang 399, die hier regeert van 1301 tot 1399 of 1400, al naar men 
bet nemen wil, zie Zang 414. Daaronder is ook gesteld de strijd met Menak 
Dedali putih, die te zamen met den vorst van Bali in opstand is gekomen, en verslagen 
wordt door den zoon van den krokodillen-vorst, die tot belooning daarvoor Péng- 
ging krygt, huwt met de dochter van Angkawijaya en Andayaningrat wordt. Zang 
401, maar zoo Balambangan dan ook voor de derde maal Majapahit als souverein 
bad doen erkennen. 

De eerste maal toch dat dit was geschied, was reeds onder Ardiwijaya 
geweest, den grootvader van Këncana wungu, de prabu henyüy zie Zang 379; de 
tweede maal had het plaats gehad^ toen Damar wulan, toenmaals nog geen koning, 
Henak Jingga versloeg. Zang 384 en volgg. ; en dit nu was de derde keer, dat 
het geschieden moest en gelukken kon, doch van verdere en groote veroveringen 
bij deze gelegenheid of door dien veroveraar, den lateren adipali van Pëngging, 
gemaakt, is geen sprake, daar zijne heldenfeiten zich slechts bepalen tot het 
weder ten onder brengen van Balambangan en Bali door middel van de krokodillen 
zijns vaders. 

Geheel anders was het geweest bij de eerste verovering van die beide ge- 
noemde latere onderhoorigheden van Majapahit, zie Zang 379. Door Ardiwijaya 
gezonden, vindt Dangdang wëcana van Tuban, de vader van Rangga lawe, ten- 
gevolge van een daar uitgeschreven sayembam, op Bali allerlei vorsten vereenigd 
(Bugis, Mangkasar, Sëmbawa, Banjar, Tarnate, Bandan, Ambon, Bawiyan), en 
verslaat hij ook dezen, na den vorst van Bali overwonnen te hebben, ze daardoor 
dus te zelfder tijd vasallen van zijn heer en meester makende, iets waarop hier 
slechts nog even gewezen wordt, vóór er wordt overgegaan tot het plaatsen van 
het overzicht van het bedoelde gedeelte dier Sërat kanda, omdat men bij Raffles, 
History of Java, II, bl. 132, zie de noot boven, wat hier door Dangdang wëcana 
verricht heet te zijn, als door Andayaningrat, den ralii Pi^ngging, verkregen, is 
voorgesteld, en dat, terwijl men bij Kaflfles op bladz. 120, zonder dat er eigentlijk 
in bijzonderheden wordt gegaan, ook leest, this priiiee (d. i. Ardiwijaya), however, 
is distinguished bij the extents of bis conquests. Dit laatste is nl. in overeen- 
stemming met onzen tekst, en aan groote veroveringen onder Angkawijaya, tijdens 
wiens regeering, die te lang diiurt, Majapahit toch geheel in venal geraakt, viel 



— 188 — 

tocb moeielgk te denken. Zoodat het er den schijn van heeft; dat BaflBes, of 
zijne zegslieden, ook hier het aangetroffene minder juist hebben weergegeven, 
waarop te wijzen zijn nut kan hebben, al wordt er hier niet mede bedoeld eenige 
kritiek te geven op het X« hoofdstuk van de Ilistory of Java, d:iar dit toch eerst 
behoorlijk zal kunnen geschieden na in kennis te zijn gekomen met hetgeen de 
door hem nagelaten verzamelingen opleveren. 

Doch zie hier nu wat de Sérat kanda van Majapahit vertelt. 

Als Majapahit is gesticht en Raden Susuruh daar onder den naam Brawijaya 
in 1221 {scln-mumjal-kalon-tunggal), tot koning over het nieuwe rijk is gekroond 
(Zang 374), onderwerpt zich heel het oosten aan hem. Hij maakt Wixvlh pepalih onder 
den naam Adipati Wirun, en Nambi wordt als tuménggung Uëksapura wedatM jèro. 
Hij haalt zijne garwa^ die hij in Galuh had gelaten, en helpt zijnen broeder Arya 
Bangah in zijnen strijd tegen Ciyung wanara. In dien strijd wordt de eerste 
verslagen, zoodat hij naar Lèbak ciyu moet vluchten, en Galuh verbrand. Hij 
wordt nog verder verjaagd, tot Tugu, waar hem de troepen van Majapahit onder 
Réksapura hulp komen verleenen. Vrouwen en kinderen zendt hij nu onder ge- 
leide van Raden Kumara, den zoon van Raden Susuruh (Brawijaya\ die evenzeer 
te Galuh was achtergelaten, naar zijn broeder, die hem die hulp had gezonden, 
en daarop keert hij zich op nieuw tegen de troepen van Pajajaran, welke onder 
Ciyung wanara tot Pudak satégal wangi waren voortgerukt, en te Tugu een nieuwen 
slag leveren. Dezen worden nu teruggejaagd. De troepen van oost-Java verrichten 
wonderen van dapperheid (angkotbuta) i), en al dringen die van 't westen toch 
weer meer oostelijk door, zij worden bij de rivier, die daarom Pamali heet. weer 
teruggeslagen, terwijl 't vechtterrein den naam van Bröbés krijgt, en Ciyung wanara 
zich naar zijn land terugtrekt. De troepen onder Réksa pura achterlatende, gaat 
Arya Bangah nu naar Majapahit, waar Brawijaya hem wêdana (d. i. hoofd-bupaif) 
maakt, met Tuban als zijne standplaats. (375) Kumara huwt met Arya Bangah's 
dochter Citrawati. Daarna wordt hij op raad van Arya Bangah met diens zoon 
Dangdang wiring en Wirun's zoon Wahas tegen Pajajaran gezonden. Op aanbe- 
veling van Dangdang wiring trekken zij nu in drie kolonnes, na zich met Réksa- 
pura vereenigd te hebben, het land in. Daar trekt men zich terug op Sumëdang 
(376). Men gaat naar Galuh. Dangdang wiring onderwerpt Dérmayu, Wahas 
doet dit Banumas, Magèlen, Prabalingga, Caracap. Ook Sokapura wordt ver- 
meesterd. Ondertusschen heeft Kumara Sumëdang en Banduug genomen. Ciyung 
wanara komt in onderwerping. Eerst stelt hij Dipati Jayasudarga, den schoonvader 
van Brawijaya, in vrijheid. Hem zendt hij tot Kumara met het bericht. (377). 
Ciyung wanara wordt, zooals de eiseli was geweest, naar Majapahit gevoerd. 
Pajajaran viel in 1223 {guna-kaUb'hngal'hiji), Ciyung wanara wordt opper-6ii/>a/« 
over west-Java tot aan de Pamali, maar de smeden moet hij naar Majapahit zenden. 



1) Het oad-Jav. kddbhuia. Uit dit wourd ontstonden de namen der beide patik* t van Mensk Jingga 
Kotbnta en Angkatbnta. 



— 189 — 

Kamara's gemalin bevalt daarop van een zoon^ Raden Ardiwijaya. Onder hnnne 
hoofden, Pënapi, den zoon van SombrO; en Kënang, dien van Kuwnng^ trekken de 
smeden naar Waleri en Kémangi, waar zij nadere bevelen van Brawijaya afwachtten, 
die hen naar Taban zendt, en ze wapens van allerlei aard laat maken. Këlép 
(Eënang?) wordt naar Madura gezonden, als hoofd over de ooster-smeden, wat 
Panéti (Pënapi?) over de westelijken wordt. Inmiddels is Wirun, depalih, gestorven 
en zgn zoon Wahas in zijn plaats getreden. Ook Arya Bangah overleed en deze 
werd door Dangdang wiring opgevolgd. Kéksapura, de dipati Këdiri, stierf kin* 
derloos ; zgn opvolger was Wahas's zoon, Jayasena, die nog zeer jong was. En 
daar nu ook Brawgaya sterft, wordt Braknmara in 1229 (muka-lialih»lingal'nala) 
vorst in zgne plaats. 

Diens groot genoegen is jagen. Dangdang wiring krijgt een zoon, Dang- 
dang wëcana; deze wordt in zijne plaats dipati met den naam van zijn va- 
der. Ujang sabata, een Balinees uit Blambangan, was tuménggung en èmban 
van den vorst. (378) Deze wilde Wahas, den patih van Braknmara, van kant 
helpen. Hij geeft voor, dat deze in opstand komen wil. Braknmara beveelt hem 
hem te dooden. Dit geschiedt, en nu wordt Ujung sabata in zijne plaats paiih. 
Het blgft evenwel aan den dipali van Këdiri, Wahas's zoon, niet onbekend, dat 
de dood zijns vaders van den vorst uitgegaan was. Hij geeft daarvan geen blijk, 
maar grgpt straks de gelegenheid aan om, zonder dat iemand het merkt, dat hij 
't doet, èn den patih èn den vorst, als hij ze op de jacht van hun gevolg geschei- 
den heeft, te dooden, en straks vindt men dan ook hunne lijken, die naar Majapabit 
worden gevoerd. De opengekomen p(7/ï A's-plaats krijgt Jayasena, en Ardiwijaya 
volgt zijn vader op. Dit geschiedt in 1234 {wani-tigatingnl-nata'. 

De nieuwe jonge vorst is nog niet gehuwd ; hij wil dit doen met een dochter van 
Kaja Balilung, den vorst van Bali, die drie kinderen had, Rëtnasari (d.), Këöcanasari (d.) 
een Jaka Antëban (z.), maar zich aan Majapabit nog niet onderwierp. (379) De dipati 
van Tuban neemt op zich Raja Balilung, die belooft had zich te onderwerpen en zijne 
dochters te zullen schenken aan wie hem in kracht overtrof, te verslaan. Hij roept 
Menak Sopal van Blambangan, Menak Sastra van Lumajang, Menak Suruh van Pugër, 
Menak Pralangge van Purbalingga, en Menak Wilung van Bangkalan op, om zich 
te verzamelen in de segara rupak (d. i. de straat van Ba&uwangi), waarheen ook 
hg zich begeeft, hen daar dan aantreffende. Dangdang wëcana begeeft zich echter eerst 
alleen naar Bali. Op Bali waren reeds verscheidene koningen met het zelfde doel bij- 
een gekomen; genoemd worden : Bngis, Mangkas ar, Sëmbawa, Baiijar, Tamate, Ban- 
dan, Ambon, Bawiyan. Het tweegevecht bestaat in 't aan weerskanten trekken aan 
een touw. Het lukt niemand (380), ook den dipali van Tuban niet, den vorst van 
Bali van zijn plaats te trekken, doch hij blijkt toch zoo sterk te zgn, dat hij 't 
touw stuk trekt. Dit geschiedt herhaalde malen. Hij had daarbg echter slechts 
zgn linkerhand gebruikt, maar als men nu een ketting neemt, en het nogmaals 
geprobeerd wordt, wint hij het van den vorst van Bali zeer gemakkelgk. De te 



— 190 — 

Balambangan acIitergebleveD dipatis worden ODtboden, en er heeft (Datanrlijk) een 
strijd plaats met die vreemde koningen. Zij worden allen onderworpen en met 
hen (381) en met de prinsessen keert Dangdang wëcana naar Majapahit terag. 
Ardiwijaya huwt zelf met de oudste; de jongste, Kéficanasari; schenkt hij aan 
den held; den dipati v<an Taban. De gemalin van Ardiwijaya krijgt drie zonen, 
terwijl geen zijner ampeyan kinderen heeft. Die zoons heetten Kaden Udara, Adaning- 
knng en Raden Juru. De kinderen van den patih zijn Nawangsasi (d.) en Legot (z.). 
Nawangsasi huwt met Udara, die na den dood van Jayasena, den patih, in diens plaats 
benoemd wordt. Adauingkung huwt met Uëtnadewi; de dochter van den dipafi 
van Tuban, wien ook nog een zoon Raden Lawe wangsul geboren werd. Vóór 
zijn dood beschikt Ardiwijaya, dat Adaningkung den tweeden zoon, hem zal op- 
volgen, en daarom verzoekt Patih Udara, de oudste zoon van Ardiwijaya, als de 
vorst kort daarna is overleden, aan allen (382) hem, zijnen jongeren broeder, die 
als vorst Brawijaya sang Kalamisani heeten zal, als koning te huldigen. Raden 
Bali anom (d. w. z. Raden Lawe wangsul) volgt zijn vader als regent van Tuban 
op, wordt wedana bupati en krijgt den naam Rangga lawe. Dit geschiedde in 
1 250 {muluk'tala'Ungalc'nevpati), 

Raden Juru, de jongere broeder van den vorst, is gehuwd met Citrawulan, de 
dochter van den regent van Prabalingga. Nu komen er vijanden van Siyém, Kamboja 
en Sokadana. Zij bevinden zicli te Garësik, en woorden te vergeefs bestreden. Op 
raad van Udara roept Brawijaya de Inpas te hulp, de belofte doende hem, die ze 
verdrijven zal, den rang van dipati te geven en Balambangan te schenken. Een 
ajar van de Ténggèr, Guntur gëni, die vele cantrik's had en in het bezit was 
van het wési kuning, een vergiftigen knuppel, neemt het op zich. Hij gaat met 
40 leerlingen naar Majapahit. Brawijaya beveelt hem den vijand dadelijk te 
verslaan, maar tevens aan Rangga lawe met hem mede te gaan om hem te be- 
spieden. (383.) De ajar gaat, gevolgd door Rangga lawe, naar Garësik. Hij 
verslaat den vijand, daarbij nog geholpen door wespen (lawon éndas). De vijand 
vlucht, vele wapens, waaronder twee groote kanonnen, achterlatende. (384.) De buit 
wordt Brawijaya aangeboden, en de ajar met den naam Paménggër tot dipati ysoï 
Balambangan aangesteld. De beide kanonnen krijgen de namen Guntur gëni en 
Jagur. Nu vraagt Udara zijn ontslag als patih. Hij wil gaan reizen. Als zijn 
plaatsvervanger stelt hij voor Kalot (of Legot, de eene maal luidt de naam 
zus, dan weer zoo) *). Deze wordt benoemd en krijgt den naam Logënder. Voor 
hij op reis gaat, geeft Udara, die den naam Juragan Kamboja aanneemt, zijn 
reeds geboren zoon Damar wulan aan Logënder over. Ook Këntjana wungu (de 
latere prabu kmya) is reeds geboren, en evenzoo had Raden Juru reeds een dochter. 
Deze laatste trekt zich terug om kluizenaar te worden op den gunung Ëdak, 
waarheen hij zijn dochter, wier moeder reeds overleden was, medeneemt. Als 



1) Zie Zang 3S1. 



— 191 — 

Kéntjaua wungn nu volwassen iS; sterft Brawijaya (Kalamisani). Logënder en Rang- 
^ la we stellen de prinses tot koningin aan^ 1267 {wiku^retu-lingaUwani), 

Daarover is PamÖnggër, na zijn terugkeer van de huldiging, verdrietig. Hij 
verlangt naar een zoon. Een rooden hond herschept hij in een mensch, dien hij 
Menak Jingga noemt. Hij baadt hem met water^ dat hij over het wesi kuning 
heeft laten loopen, om hem sterk te maken, maar zijn voorhoofd was dat van een 
hond gebleven, en hij had geen schouders. Het wcsi kuning zou zijn dood zijn, 
en daarom geeft hij het hem zelf ter bewaring. Menak Jingga rooft zich twee 
vrouwen, Waita uit Balega en Puyëngan uit Bangkalan. Daarmede niet tevreden 
wil hij de vorstin van Majapahit ten huwelijk vragen. Pamënggër raadt hem dat 
sterk af, en als Menak Jingga niet naar hem luistert, verlaat deze Balambangan 
om naar den gunung Agung te gaan. (385.) Nu wordt Menak Jingga koning van 
dat gewest. Twee der canlrik'» van Pamënggër stelt hij onder den naam Kotbuta 
en Angkatbuta tot patih aan, en zijn huwelijksaanzoek zendt hij af. Lawe idjo komt 
met een antwoord van Rangga lawe terug. De uitdagende weigering, die dit 
bevat, maakt zgne woede in hooge mate gaande, en hij trekt tegen Majapahit op. 
De omgeving van Prabalingga, waar hij zich legert, onderwerpt zich. Menak 
Koficar, de ptUra Lnmajang, komt dit te Majapahit berichten, en spoedig trekt 
Rangga lawe, die de jongeren ter bescherming van den vorstin achterlaat, met 
snjn Tttbaners naar Prabalingga^ waar hij een gevecht levert, (386) dat hem den 
dood brengt. Démang Gatul, zijn patih, die hem nog geraden had zich terug 
te trekken, vlucht na zijn sneuvelen naar Majapahit, waarheen Menak Jingga 
besluit den volgenden dag door te gaan. 

Logënder had toenmaals ook reeds kinderen, een zoon Setra kumitir ^) en 
eene dochter Afijasmara. De laatste, de oudste, was gehuwd met Damar wulan. 
Logënder had dezen jongeman eerst in Paluh amba geplaatst, maar later tot schoon- 
zoon genomen. Setrakumitir had niet met een evenmensch wil huwen; hij had 
dcb een pari, de dochter van een brahnana van den gunung Sumeru en een peri, 
tot vrouw genomen. Damar wulan, wiens roep door Majapahit ging, werd door 
Afijasmara steeds thuis gehouden, waar Sëbdapalon en Nayageuggong, zijn pamong- 
mongs, hem niet verlieten. 

De prabu kenya verneemt nu van dèmnng Gatul den dood van Rangga lawe. 
Logënder slaat voor Damar wulan te zenden. De vorstin vindt het goed, en de 
patih zendt hem met Setra kumitir tegen Menak Jingga. Zij bereiken Prabalingga 
nog vóór deze van daar vertrokken is. Menak Jingga meent voor hen niet be- 
vreesd te behoeven te zijn. (388.) Er hebben verschillende gevechten plaats, 
waarin Surajaya van Bandung, Rëksayuda van Roban, Sore pajok van Walere, 
Sturaaastra van Tëgal van de volgelingen van Menak Jingga achtereenvolgens 
overwinnen Jakang tulung van Malang, Cocak ijo van Pugër, Cocak pëtak van 

1) Hier één persoon, en niet als ia den Damar wnlan roman een tweetal, Layang setra en Layang 
IniBitir. 



S 



^ 192 — 

Bangkalan en Këtek abang van Balega. Damar wnlan ziet dat bet zoo niet gaat, 
en (lat Mcnak Jingga bet een of ander bijzonders in zijn bezit moet bebben. 
Hij stelt Bantar vvatangan i) als zijn plaatsvervanger aan, en sluipt met zijn ttti/u 
cumim's in het kamp van Menak Jingga. Den volgenden dag wordt er weer 
gevochten. Kidang wulan van Sarëngat strijdt met Jaya lawnng van Luwana, 
Macan putih van Ludaya met Suraprawira van Banumas, Lawe ijo van Japan met 
Sétraprameya van Andalahur. Menak Djingga laat in den nu volgenden naeht Hëlati 
en Mëndang voor de zijnen dansen. Damar wulan dringt op dat oogenblik in het 
vrouwenverblijf. (389.) Daar waren nu Waita en Puyéngan reeds zeer begeerig 
hem te zien, en af keerig van haren gemaal. Zij leggen bem, als hij zieh vertoond 
beeft, Menak Jingga's geheim uit, en Puyëngan baalt voor hem zelfs het wêsi kuning^ 
dat zij bad opgeborgen. (390.) Dronken komt Menak Jingga ter plaatse, bif 
boort praten, en roept Dayun om te onderzoeken wat er aan de hand is. Söbdapalon 
gooit deze eenige malen de deur uit, en Damar wulan neemt de beide prinsessen 
op om met hen wo/g te loopen, Menak Jingga tartende hem te volgen. Deze 
bespeurt, dat het wesi kuning weg is. Den volgenden dag trekt Damar wulan daar- 
mede ter strijde, en slaat hij de Balambanganers op de vlucht. Menak Eoficar 
doodt Kotbuta en Angkatbuta met een ring, die ook van wesi kuning was, en hg 
van Pujadevva, een tapa op den gunung Liman, had ontvangen, en Damar wulan 
velt Menak Jingga. Zijn hoofd word afgeslagen en door Sëbdapalon weggedragen. 
(391.) Met groote buit keert men terug. 

Als Damar wulan bij de vorstin komt, staat deze hem niet toe haar hulde 
te brengen, zij verheft hem tot koning, en laat tevens Aïijasmara ontbieden, wie 
zij bericht wat zij gedaan heeft, haar zeggende, dat zij haar geluk met haar moet 
deelen. Damar wulan werd onder den naam Mërtawijaya koning in 1270 (nir- 
gurnita'Sembahira-prabupati). 

Layang Setra kumitir wordt zijn palih^ Sëbdapalon maakt bij tuménggung 
en Nayagenggong rangga. Hunne namen worden veranderd in dipati G^jah mada, 
luniènggung Sëbdayuda en rangga Sëbdagënggong. Buntar watangan wordt Aiya 
Teja van Tuban ; Menak Koncar wordt over Lumajang gesteld en huwt met Rfitna 
Sëkati. Logënder laat zijn post over aan zijn zoon. (392.) Nu was Udara 
(op zyn zwerftocht) in Kamboja gehuwd met eene dochter van den vorst van dat 
rgk. Hg bad bij baar een zoon verwekt en deze was zijn grootvader, na 
diens dood, onder den naam Andaka sasi, als vorst van Kamboja, opgevolgd. 
In bet geheel had Udara (393) aan den overwal drie zonen; genoemden Mahesa 
sasi in Kamboja, Kuda rangeyan in Baujar, waar deze zijn grootvader evenzoo 
opgevolgd was, en Kuda tilarsa in Snkadana, die ook koning was geworden. 
Zg waren allen op één oogenblik in Kamboja bgeen. Udara beveelt bun naar 



1) Hier al evenzeer één persoon, terwjl de Dammr wnlan romau er twee kent. Raden Bnntann «n 
Raden Watangan. Beie Bnntar watangan moet de loon van Rangga lawe x$n; daarom volgt hy denn dan 
ook later ala Arya Tcja over Tnban op, sie Zang 391 ; 



— 193 — 

Majapahit te gaan. Damar walan is 2&eer verheugd zijnen vader en zijne broeders 
te zien. Na hun aankomst bevalt Kéöcana wungu van Raden mas Alit. Zyn groot- 
vader voorspelt zyne toekomstige grootheid, en zegt dat hg later Angkawyaya 
moet heeten; en dat hij de laatste der heidensche vorsten wezen zal (nniékasiratu 
htida). Ook Afijasmara bevalt, van Raden mas Kaon. Na zeven maanden te 
Majapahit te hebben vertoefd; gaan Këlana Mahesa sasi en zijne broeders huis- 
waarts. Udara en Logénder komen te overlijden. Raden mas Alit wordt Prabu 
Angkawgaya en de tweede zoon, Bétara Katong, komt over Panaraga. 

Als deze gebeurtenissen doorleefd zijn, bespeurt Brawgaya (Damar wulan), 
dat er een kèi*is van Jaka Suruh (den 1«d vorst van Majapahit) is zoek geraakt, 
de kris Sumélang Gandriug, van de dapur jalak. Hij draagt den palih Gajah mada 
(=Setra kumitir) op haar op te sporen. Deze wil het verdwgnen van die keris 
niet ruchtbaar laten worden, (394) omdat dit voor \s vorsten naam niet goed zijn 
zon. Hij ontbiedt de luraKs der empu's (smeden). 

Wie dit waren, blijkt uit het volgende. In Pigajaran had men vroeger 
een smid Këléng en in Majalëngka een andere, Panëti; de eerste was de oudste 
van de twee. Këlëng liet twee kinderen na, Supa en Kapa ; Supa werd kluizenaar 
op den gunung Liman, en huwde met de dochter van Kasa daar; hij werd later 
lurah émpu van de hrang welan. Supa had bij haar twee zonen, Aman en Tiris, 
die hg achterliet, toen hij, wat hij deed, naar Tuban ging. Daar werd hij door 
Panëti tot zoon aangenomen, en huwde hij nog met diens dochter, waardoor 
Suratman en Jati zgne zwagers werden Na den dood van Panëti wilde hg deze 
niet opvolgen, zoodat Suratman luvah empu van de bramf knion werd. Bg de dochter 
van Panëti kreeg hij nog twee zonen, Gudana en Jegja. 

Zoo geschiedde het dan dat Gajah mada Supa, Kasa^ Suratman en Jati 
opriep. Hij verhaalt hun wat er aan de hand is, on beveelt hun geheimhouding. 
Thuis gekomen komen deze vier overeen, dat Supa zal gaan zoeken. Zoo de 
anderen dat deden, zou het de aandacht trekken. Hij was nooit gevestigd smid 
geweest en had altgd gedwaald. Supa gaat nu eerst naar den ajar Këndali. 
Deze zegt hem naar Balambangan te gaan, hij moet zich uitgegeven voor een smid 
uit de sabrang, daar zal hij de këris vinden. Hij gaat naar Madura, laat zich 
daar een vlot maken, neemt den naam van Émpu Rombang aan en steekt met zes 
gezellen, en zijn gereedschap in zee. Overal waar hij langs komt, maakt en ver- 
koopt hij wapenen, die hg van zijn merk voorziet. Als hg Balambangan bereikt 
heeft, begeeft hij zich dadelijk tot den lurah empu Kyai Pitrang daar. Hij zegt, 
dat hg, op weg naar Java, schipbreuk heeft geleden, en vraagt wie lurah is, ver- 
zoekt bg hem te mogen blgven, mag dat, verdient veel geld voor hem, en wordt 
door hem ook al tot schoonzoon aangenomen. 

Op dat oogenblik was Menak Dëdali putih, een zoon van Menak Jingga, 
dipati van Balambangan. Eerst was hg panakawan van Brawgaya geweest, en 
daarna door deze tot d^niti van dat gewest aangesteld; het was deze die vóór 

Vorii. Bat. Oen., Deel XLU. I -^- 



— 194 — 

zgn vertrek de kris Snmëlang GandriDg had gestolen. Hij verlangt van Snpa baar 
na te maken, voorgevende haar van Brawijaya ten geschenke te hebben ontvangen. 
Rombang (Snpa) herkent haar en belooft het te zullen doen. Hij moet dit eebter 
in de tegenwoordigheid van Dëdali putih verrichten, zelfs wordt daartoe in de 
kraton een smidse gemaakt. Nu wil het geval dat de dipali drie dagen ziek 
wordt. Die gelegenheid gebruikt Supa om twee valsche krissen te maken, een 
die wat oud leek en een andere die er nieuw uitzag. Deze beiden biedt hg den 
dipati aan, die aan de tweede ook een oud uiterlijk laat geven. Doch Supa heeft 
zijn doel reeds bereikt. Hij voldoet nog aan het laatste verzoek, maar maakt daarop 
plan te vertrekken,- zijne zwangere vrouw krijgt de opdracht hun kind, als dat een 
zoon is, Sura te noemen, en hem te bevelen zijnen vader in Majapahit te komen 
zoeken. Na zoo twee jaar afwezig te zijn geweest, keert hij over land terug. (395. ) 
Brawijaya laat zich verhalen wie de kris gestolen had, en beloont Supa door hem 
tot diimti van Sidayu en wedana émpu te benoemen. Slechts voor dipati" s zal hij 
voortaan nog krissen mogen maken. 

Angkawijaya had toenmaals nog slechts eene selir, Jaka Snmh (de 
stichter van Majapahit) had indertijd aan een iwlang, ni Rasëksi, belooft dat zijne 
nakomeling Angkawijaya haar ruwal wezen zou. Deze had haar dan ook tot selir 
genomen, en zij neemt, nadat zij, zwanger geworden, rauw gehakt had gegeten, 
hare reuzinnegedaante weer aan. De iwmniswnri verneemt het, en verhaalt het 
aan Brawijaya, (396) hem tevens op de pntri van Cëmpa wijzende als een goede 
gemalin voor Angkawijaya. Daar waren drie koningskinderen, van welken er 
een den koning, hun vader, die reeds gestorven was, was opgevolgd; de oudste 
der twee anderen, dochters, was gehuwd met een Arabier, om de jongste, Darawati, 
moest men aanzoek voor den kroonprins doen. Daar Cémpa onder Kambqja 
stond, waar Kélana Maesa sasi regeerde, schrijft Brawijaya naar Kamboja en 
Gömpa beiden. Ook zendt hij hupatis naar Banjar en Sokadana. In Kamboja 
is Maesa Lajër patih. De vorst daar ontvangt de beide brieven, zendt er een 
van door naar Cémpa, en maakt zich gereed naar Java te gaan. In Cëmpa begrgpt 
de koning, dat als hij zijne zuster niet geeft. Kamboja zich tegen hem zal wenden, 
toch doet hij het niet dan schoorvoetend; hij was namelijk door zijn zwager, den roof/a 
pandiia Mustakim, tot het Mohammedanisme bekeerd, en Darawati wilde slechts 
huwen met iemand van het ware geloof; Angkawijaya was dat niet, daar hij een 
ratu huda was, toch geeft zij om baars broeders wil toe. Hare oudere zuster be- 
looft haar, dat haar neef Rahmat, haar zoon, haar op Java zal komen bezoeken. 
De paiih begeleidt haar. Op Java zijn de vorsten van Kamboja, Bafijar en Soka* 
dana reeds aangeland, en als het huwelijk plaais heeft, verbindt men tegelgker- 
tijd Katong in den echt met de prinses van het eerste ryk, Srawulan. (397) De 
drie broeders keeren daarop weer naar hun land terug. 

Nu had de pi*abu anom, Angkawijaya, een vriend, een Chinees, een koopman, 
Kyai Bantong. Met goedvinden van Darawati draagt hij aan deze op een Chi- 



— 195 — 

neeeche vrouw voor hem te zoeken. Er was namelyk voorspeld dat Darawati 
kinderloos zon blgven, als de prins niet eerst een Ghineesche vrouw gehuwd zou 
hebben. Bantong zegt dat slechts zijn eigen dochter daarvoor in aanmerking kan 
komen, doch vraagt tevens een stnk land om er Chineezen te kunnen laten 
wonen. 

(Als Angkawijaya, om zoo te zeggen, gereed is zijn vader op te volgen), 
wordt Brawgaya (Damar wulan) ziek. Hij raadt zgnen zonen met elkander 
in vrede te blijven, en wijst Angkawijaya aan als zgn opvolger (over M^japahit), 
met deze restrictie, dat Katong over Panaraga zal moeten blijven staan. Dan 
overiydt hy, door zijne beide gemalinnen spoedig in den dood gevolgd, en bestggt 
Angkawijaya den door zijnen dood opengekomen troon, in 1301 (putra-mnmbul' 
pigunanythsribupati) . 

Aan Bantong wordt grond toegewezen in de Kédu. In (^émpa was de 
zoon van Mustakim, Sayit Rahmat. van Mékah weer thuis gekomen, waar hg ge- 
huwd en vader geworden was van Sayit Seh. Hij vindt slechts zijne moeder terug, 
van wie hg verneemt, dat zijne tante Darawati naar .lava is gegaan, en als nu ook 
zijne moeder gestorven is, vormt hij het plan zijne tante te gaan bezoeken. Zgn neet' 
Jenalkabir, de zoon van zijn oom, den vorst van Cémpa, sluit zich bij hem aan, 
begeerig als hij is naar de ngelmi. Zij landen te Jépara. Jenalkabir gaat naar 
Grage om eerst een woonplaats te zoeken. Hij vindt daar Dipati Talorémi, die 
zich bekeert en hem zijn docliter schenkt, met wie hij te Jépara, aan de Rénga- 
réngan, gaat wonen; Sayit Rahmat was ondertnsschen naar Kudus. ilat toen nog 
Tquk heette, gegaan. Daar blijvende, omdat Sayit Seh, zijn zoon, ziek was, huwt hg 
ook met een vrouw van daar. Nyai Lara ngunyun, de dochter van Puraga(ofNu- 
raga), die eigentlijk van Majapahit was. Als Sayit Seh weer hersteld is, laat hij haar 
zwanger achter, met de opdracht om *t kind, zoo hem een zoon geboren worden mocht, 
Raden Undung te noemen. Te Majapahit laat hij zich door Sastra(wi)jaya bij Dara- 
wati brengen. Bij Brawijaya geintroduceerd, schenkt deze hem Ampel en de dochter 
van Tumënggung Wilatikta van Tuban, de kleindochter van Arya Teja. Daar vestigt 
hy zich in 1308 (asta'ilang'gnnane'aji), (398.^ Ni Raséksi is intusscben van 
Jaka Dilah bevallen. Deze wil weten wie zijn vader is. Zijn moeder en zgn 
oom z^n onwillig hem in te lichten. Zij krijgen hunne menschelijke gedaante 
weer terug, als hij verwoed hen bewusteloos heeft geslagen. Nu verneemt hij wat 
hg weten wil, en dan gaat hij naar Majapahit. Hij begeeft zich tot Gs^jah mada 
en deelt deze mede wat hij weet. De patik brengt den van Tayu gekomen jonge- 
man tot den vorst, die belooft hem als zijn zoon te zullen erkennen en hem pulo Palem- 
bang te zullen geven, als hij de dieren uit *t woud op de nlun-uhm zal hebben gebracht. 
Hg doet het, krijgt Palembang, (399) en den naam Arya Damar ^). Om de droefheid 



1) Reeds te toi-en wordt 1i^ Damar genoemd. 



— 196 — 

van Darawati te stilleu, geeft de vorst hem zijne vrouw uit China, die zwanger is, mede , 
hem tevens opdragende Pëkik te Bantën en Jakarta te Jakarta te plaatsen als iaga 
(ampingan. Spoedig daarop wordt ook Darawati zwanger. Wandan en Inggris doen een 
inval met 12 schepen, omdat men hun geen phiats had willen geven om handel te 
drijven ij. Zij landen te Gërsik. Menak Koncar van Luuiajang, Sapu jagat van 
Prabalingga, ïumënggung Wilatikta van Tuban worden hun tegemoet gezonden. Ook 
Menak Dëdali pëtak vecht daarbij dapper mede. De vijand wordt verjaagd en 
een groot kanon vermeesterd. Dit laatste krijgt den naam van den dipati van 
Prabalingga, Sapu jagat, wiens buit het was, terwijl hij zelf voortaan Sapu Iaga 
heeten zal. De islam breidt zich te Ampel uit. Sayit Iskak, een oom van Uahmat, 
die aangewezen was om Ga/age 2) te bekeeren, brengt hem een bezoek; evenzoo 
Maulana Mahribi, ot Sayit Ibrahim, die naar Garage gaan moest. Sayit Ali (Sunan 
Gésang 3) ), bestemd voor Pamalang, en Sayit Seh Akbar, bestemd voor Tuban, 
doen dat al evenzeer. Brawijaya vindt alles goed. Als nu Sayit Iskak in Blam- 
bangan komt, wijkt daar een epidemie {paglrinq) ^), en zoo verkrijgt hij Dëdali 
pötak'fl dochter tot vrouw, maar 't rijk l)ckeercn kan hij niet. Hij gaat weer 
naar Arabie terug. Zijn na zijn vertrek geboren zoon wordt door zijn grootvader 
in een kist in zee geworpen, maar weer opgevischt (400) door een kapt«in van 
de Nyai Gëde pinatih (van Gërsik). Deze keert dadelijk huiswaarts, om haar 
het kind te brengen. Zij neemt het aan, en zoogt het zelf, geen kinderen ooit 
gehad hebbende. Het kind gaat later bij Sunan Ampel in de leer. Deze heeft 
bij zijn vrouw van Tuban reeds twee kinderen, een dochter, .... geheeten, en 
een zoon, Raden Sayit, (en nog andere kinderen) Bara Mëloko (d.), Kaden Bonang 
en Raden Dërajat. Ook Sayit Seh, die Siti jenar moest bekeeren, en zijn zoon 
van Tajuk, Raden Undakan (lees ündungV), komen tot hem. De laatste wordt 
naar Tajuk, dat voortaan Kudus heet, teruggestuurd. Kaden Iskak huwt met Rara 
Méloko, en gaat dan, in oversenstemming met den wil zijns schoonvaders, naar 
Gërsik, maar vestigt zich te Giri. Raden Bonang gaat naar I.>asëm, en Raden Dërajat 
naar Tuban. In Palembang bevalt de Chiueesche prinses van Raden Patah. Uit 
het huwelijk, dat Arya Damar daarna met haar sluit, spruit Raden Kusen. Baden 
Patah wordt kluizenaar op den berg Sumirang. Kusen sluit zich bij hem ^) aan. 
Een Chineesche jongj die daar noch voor- noch achteruit kon, neemt hen aan de 
muwara op, als de junigan, die hen had zien lichten, hen is gaan halen, en voor niets 
naar Java medcneemt. Kusen gaat naar Majapahit en Patah naar Ampel. (401.) 
De eerste wordt door Brawijaya tot Adipati Paücatanda van Tërung verheven. 

1) Op deze plaats verdient de aan dacht in het bijzonder gevestigd te worden. 

2) BUmbangan bedoeld (?). 

3) Oosan (?). 

4) Ben der weinige in het Javaansch nog levende voorbeelden van het voorvoegsel pa met den rin 
van toen dit of dat plaats had. 

5) Hij wordt hier xiju pama» genoemd. Dit wa:» h^ ook, als zijnde een jongere broeder van z\jn 
vader» Arya Damar. 



— 197 — 

Darawati heeft ondertussclien reeds drie kinderen gekregen/ Rëtna ayu adi (d.), 
Lembu pétëng (z.) en Kaden Guntur (lees: Gugur) (z.) Voorde ondste, het meisje, 
wordt een sayemhava uitgeschreven. Dëdali putih van Balambangan nl.^en^^Menak 
Badong, de dipati van Bali, zijn opgestaan ; >iKe hen verslaat, krijgt de prinses en 
Péngging. Nu had Kaden Juiu, de jongste broeder van Udara V\» zijï^e door hem 
medegenomen dochter, als deze, die dikwijls in de Sëmanggi baadde, in stilte met 
den vorst der ftai/a's (hmuna^), Bajul sëugara, is gehuwd, en zich de gevolgen daarvan 
laten zien, verlaten en den dood gevonden, l'r wordt een zoon geboren, die van 
zijn vader een tooverring en den naam Jaka sëngara krijgt, als deze eens te' laat 
blijft en dus des daags in zijn kaaiman-vorm door vrouw en kind gezien is, wat 
hen voorgoed van elkander zou scheiden. 

Ook deze jongeman neemt deel aan die saylnuharn. Hij wordt aan Sapu 
laga van Prabalingga toegevoegd. (402) Voor hij naar Balambangan gaat, 
bezoekt hij zijn vader te Sëmauggi. Met behulp van de onderdanen zijns 
vaders verovert hij Balambangan, alleen daarheen getrokken, als Sapu laga hem 
zegt maar vooruit te gaan. Dédali putih wordt onthoofd. Daarna trekt Jaka 
' Sëngara naar Bali; ook dat onderwerpt hij, en ook dat hoofd wordt hij machtig. 
Met Sapu laga gaat hij nu op een met buit beladen vlot, dat door haya'% geleid 
wordt, naar Majapahit terug. (403). Hij huwt en wordt Dipati Dayaningrat van 
Pëng^ng. Snnan Ampel zendt Ki Bouang om zijn paman te bekeeren, en Patah 
beveelt hij om ergens in 't westen, waar hij ffalaffa natigi vinden zal, een du/cuh te 
stichten, hem ook zijn latere grootheid en verdienste omtrent het geloof voorspel- 
lende. Darawati steri't 1320 (sirna halih-gunane-nerpah) 2). Zij wordt Moham- 
medaansch begraven, hoewel de vorst haar eerst op de oude (heidonsche) wijze 
had willen bijzetten. Haar graf krijgt den naam Citrawulan. De vorst, die erg 
bedroefd is, heeft ook bij een Balische vrouw kinderen. Kaden Kalungkung en 
Raden Katong. Lëmbu pétëng wordt over Madura gesteld, Kaden Gugur (boven: 
Guntur) ^) over Madiyun, Kaden Kalungkung over Bali, en Kaden Katong over 
Pranaraga, in de plaats van zijn schoonvader, Batara Nata (d. i. Katong), den jongeren 
broeder van Brawijaya. Kaden Pa^ah sticht Dëmak; velen vestigen zich daar. Bra, 
wgaya verneemt van Gajah mada, dat daar een hrnmnn zou zijn. De adtpaliyan 
Tërung wordt er heen gezonden, om Patah te ontbieden, omtrent wiens afkomst hij 
Brawijaya inlicht. Daarop wordt Patah met Dëmak begiftigd, dat den naam Bintara 
krijgt. In 1326 (rasa-kalih-lcang ffma-puha) werd Dëmak gesticht, in 1327 {sebdu' 
knlih Ixdumyn-kang sitvi) had de benoeming plaats. Op bevel van Snnan Ampel 
zal hij de groote moskee bouwen, en huwt hij met de dochter van Sunan Giri- 

1) Zie Zang 384. 

2) Op haar graf te Trawulan vindt men in werkelijkheid het jaartal 1370, zie Not. B. G. XXIV 
(1886), W. 42; afbeeldingen van dit jaartal vindt men in Journ. lud. Archipelago, Vol. V, bl. 439, en in 
HoUe's Tabel van Oud-Indische alphabetten, bl. 48. De mislezinjj; of verkeerde interpretatie van dit jaartal 
18 dos reeds vr^ oad en een constante. 

3) Zie Zang 401* 



— 198 — 

Rétna Malya. Brawijaya wil een pusalio kris lateu maken. Dipati Supa wordt 
van iSëdayu ontboden. Hi) krijgt die opdracht, maar weet niet hoe die uit te 
voeren, daarom sluit hij zich op. Nu komt zijn zoon Kyai Sura uit Blambangan 
met een calon ijunwuf te Majapahit. Hij begeett zich tot Kyai Jikja, die in Supa's 
plaats gekomen was. Hij maakt zich bekend en zijn broeder ^) (404) zendt hem 
naar Sëdayu. Onderweg maakt hij zonder vuur. tot verwondering van zijn be- 
diende, Salahita, overal krissen. Een zekere Jébat, de zoon van Modin, de 
schoonzoon van Supa, informeert naar hem, en ontvangt hem evenzeer goed, en 
nu hoorende wat Supa wenl opgedragen, maakt Sura in de smidse van zijn vader een 
mooie hüf, wa*irvoor hij evenwel geen naam weet tt* bedenken. Deze kris vindt 
Supa. Hij is verrukt, en brengt Sura straks tot Brawijaya, die deze kiis Sèngkëlat 
noemt en haar bestemt voor hem, die muier uégnri jawl. Sura wordt tot Tu- 
ménggung Sura euriga verheven : ook met Jigja, nu Jigjasura, geschiedt dat, doch 
zij mogen voor niemand dan den vorst meer werken. Sunan Bonang gaat nu 
Sayit, een zoon van Wilatikta^ bekeeren. Dit jonge mensch was een lichtmis. 
Te Tambak baya houdt hij Sunan Bonang aan, om hem te berooven. Door allerlei 
wonderen ( 405 ) wordt hij bekeerd. Sunan Bonang laat hem zijn staf, die hij achterlaat, 
in het bosch bewaken. Dit doet hij zoo getrouw, dat hij geheel overgroeid raakt. 
Eerst na twaalf jaar zendt Sunan Bonang Saloka^ Kartapati en Kartabangsa. die hem 
tot leermeester {prawiia = puvohila = guru) hadden gekozen, om hem te halen; zij 
brengen hem weer bij. Sayit begeeft zich daarop naar Mëkah, maar wordt reeds te 
Pulo Pinang, door Seh Sayit Maolana Mahribi, weer naar Java teruggezonden om 
aan den bouw der moskee mede te helpen, waarbij negen tvaliH moeten zijn. Bij 
Jnwana wil 't schip niet verder. Op Sayit's gebed beweegt het zich weder, doch 
het komt te Cérbon terecht. Hij betaalt de vracht met getooverde w/ëti, en 
wandelt over 't water naar de wal. De juragan bekeert zich en volgt hem. Sayit 
gaat naar Kali Jaga, en vervolgens naar Kuningau, waar Maolana Ibrahim op do 
gunang Jati als kluizenaar leeft. Hij wordt^diens schoonzoon, gaat dan naar üérboii 
en heet verder Sunan Kali Jaga. Brawijaya heeft bij een vrouw uit Bagëlen nog 
Jaran panolih verwekt, te Sumédang geplaatst V : en bij een dochter van den vorst van 
Pulo Banjar een andere, die met een helm geboren werd (deze kon slechts ven;\ijdenl 
worden door een wmg tapa); deze knaap krijgt den naam Baüjaran sari ; en eindelijk 
bij een vrouw van Sukadana Garang soka. Daarop wordt hij ziek (406) aan de raja- 
sitiga. Het geneesmiddel daartegen is een Wandan'sche vrouw. £en bule van daar, uit 
't vroegere gevolg van Darawati, wordt ontboden, en daaraan aan een juni sabin 
ten huwelijk gegeven. Zij schenkt het leven aan Bondan kajawan. Deze jonge 
man gaat naar Majapahit, pleegt daar majesteitsschenis door de hetide Sëkar dalima 
te bespelen, en is niet te overmeesteren. Hij blgkt, dat hij de zoon is van Bra- 
wgaya. Deze voorspelt zijne grootheid, en beveelt hem aan Kyai Tarub te geven 
om hem op te voeden, hem twee pumka krissen schenkende. Hierop volgt de be- 

1) Zir^agS94. 



— 199 — 

schrijving van den bouw van de moskee te Dëmak, waaraan de negen wali's (Snnan 
Giriy Snnan Gërbou, Sunan Gësang, Snnan Mëjagung, Seh Lémah bang, Sunan 
Undung, Sunan Bonang, Sunan Drajat, en Sunan Kali Jaga) deelnemen. (407). 
Onderwijl sterft Sunan Ampel. Hij wordt te Ampel begraven, 1328 {awak-kalih' 
guna-ikü). Kali Jaga raadt het af tegen Brawijaya geweldadig te ageeren, daar 
hi] zich tegen de Mohammedanen nooit misdragen had; toch besluit men tot een 
opstand. Sunan Kudus (Undung) wordt aan 't hoofd der troepen geplaatst. De 
bouw van de moskee wordt voortgezet. Nog restte een der salcn gum te plaatsen, 
wat Sunan Kali Jaga doen moest. Hij maakt er een uit spaanders, de saka tal. 
De kihlal blijkt niet juist te zijn (408). Ki Pëlerabang wordt tot Ki Nagur ge- 
zonden om deze iali duk te laten maken. Hij vindt verschillende personen, waar- 
onder er een op 't schuim van het water zit, die zeggen diens leerlingen te zijn en 
hem terecht wijzen. Zoo vindt hij hem, die in de lucht schijnt te kunnen zitten, 
en er zich op verstaat voortdurend maar door te eten en dan ook een dik 
buikje heeft. Hij maakt het touw in weinige oogenblikken gereed, staakt zijn 
eten even, en verdwijnt dan met zijn leerlingen, uit gebrek aan zwaarte met hen de 
lacht in vliegende. Ki Palembang keert van Gëbang met 't touw, dat wonder- 
touw blijkt te zijn, dmir men het niet op kan maken, terug. In den nacht daar- 
op plaatst Sunan Kali Jaga, de kihlat in zijn linker en de kahah in zijn rechter- 
hand nemende, de eerste zooals zij staan moet. Hij wordt daarvoor beloond met 
het baadje van Muh<amad. de Antakusuma, dat uit de lucht komt vallen, gewik- 
keld in een schaapsvacht. Dit alles geschiedde in 1329 {imipak-hakal-ngapit^ 
karï) 1). Sunan Undung, die was komen helpen, wordt er weer op uitgezonden. 
Hij vraagt en krijgt de Antakusuma om die in den strijd mede te nemen. De 
diimli van Dëmak moet moeite doen Ltmbu Pëtëng van Madura, Arya Damar, 
Snmënëp en Madiyun, Prabu Katong van Pranaraga, Baiijar en Sukadana over te 
halen zich te bekeeren Iman in de moskee wordt Sunan Giri, de andere acht, 
van wie Sunan Undung zijn zoon, Raden Iman, als xmkH aanstelt, worden er ketilys; 
Raden Iman wordt kahaijan, marhoL modiuy hclaL De adipali van Kalungkung, op 
Bali, en Batara Katong van Pranaraga blijven halstarrig weigeren Mohammedaan 
te worden, doch behalve dezen en Brawijaya zelf zijn de anderen toegetreden. 
De dipati van Bintara heeft bij zijn oudste vrouw (van Giri) Raden Surya (z.) en 
Raden Trënggana (z.) verwekt, en bij een vrouw van Randu sanga Kanduruwan (z.), 
die ouder is dan Trënggana. Surya huwde niet Rëtna Lëmbah, de dochter van 
Raden Gugur 2j. Uit de dochter van den dipali van Jipang, een derde gemalin 

van den Dipati Bintara, worden Raden Kikin (z.) en Ratu mas Nawa (d.) geboren. 
Surya, die sabrang tvetan kali woont, heeft een zoon. Raden Pafiji Pandan, die 



1) Zooals men ziet .een séngicala in een van de gewone afvqjkende Tolgordc. 

2) Zie Zang 403. 



— 200 — 

door Sanan Bonaug aangeuomeu wordt. Trëiiggaua huwt met een dochter van Arya 
Damar van Palembang^ Kaden Kikin's schoonvader is Jaran panolih van Sumënëp^ 
en Ratu nias Nawa treedt in den echt met Raden Sampang, den zoon van Lémbn 
pëtëng van Madiini. Nog steeds had Bintara het seha niet gestaakt. Tegen de 
opstandelingen is de (iipaii Tërung gezonden, maar deze beweert hen niet meester 
te kunnen worden. Gajah mada wordt op inspectie gezonden. (409.) Nu worden 
de opstandelingen bij Tuban verslagen en verjaagd. Ook in Cërbon zal men een 
moskee maken, die van die te Dëmak in 't dak verschillen zal, als ware zij de 
vrouw van haren man daar. De Suuan's stellen iviihTH voor den bouw daarvan aan. 
(410.) Sunan Bonang laat de paso sembeliyan maken door Sura, die toegetreden is, 
en Sunan Giri draagt hem op een pmaka-Yn^ te maken. Sura weigert eerst om 
zgn aan Brawijaya gegeven woord, maar doet het toch. Hij wordt er echter 
ziek vaU; en sterft, als hij aan zijn zoon Suradi heeft opgedragen de kris Parung 
ware aan Sunan Giri te brengen, die de kris Sura dadi noemt. Vele ajar% worden 
Mohammedaan. Blacak ngilo komt met zijn haan bij Sunan Bonang; als het dier 
den kamp verliest, zal ook hij zich bekeeren. Hij verstopt zich daarop nog achter een 
groote hoop steenen, doch Sunan Bonang weet hem toch te vinden. De bekeering 
volgt. (411.) Als de moskee te Cërbon voorbereid {limasan) is, gaan de ivalts er 
heen. Het wordt er een met negen deuren en negen pangimanan's, en zg komt 
in 13.2 (muitgal-niaugil'mun^b'bumya) gereed. Op nieuw trekt men dan tegen 
Majapahit te velde, doch nu gaat van de Sunan's slechts Sunan Undung zelf, daar 
de anderen hunne zonen zenden, nl. Raden Makripat (v. Giri), Madi pandan 
(v. Bonang, eig. de zoon v. Sabrang wetan, d. i. Surya, dus de kleinzoon v. den 
dipati van Bintara), Makdum Sarap (Drajat), Japar sidik (Lëmah bang), Seh 
Maolana Gatana ( Mëjagung), Sunan Panggung (Sunan Ibrahim), Abdullah rakim 
(Sunan Mahribi), Sunan Adiganda (Kali Jaga). Brawijaya zendt Pancatanda (van 
Tërung), Dayaningrat en Gajah mada. (412.) De strijd blijft onbeslist. Raden 
Këbo kënanga, de zoon van Dayaningrat, loopt, uit vrees voor zijn leermeester, 
Seh Lëmah bang, over, doch zijn broeder Këbo kanigara blgft trouw. Het 
sneuvelen van Dayaningrat doet de wonif huda (de aanhangers van 't oude 
geloof) vluchten. Sunan Kudus wordt door Pancatanda van Tërung verslagen. 
Met den avond legert men zich te Wirasaba, waar de patih een pasanggrahanhsid 
laten maken, maar wordt achtervolgd door den vijand. Brawijaya zendt versterking 
onder den dipaii Kalungkung, maar de reeds bekeerde zonen van den vorst trekken 
zich naar hunne rijken terug. Ook de dipati van Bintara is om hulp naar Dëmak 
gegaan. Iman^wordt in zijns vaders plaats legerhoofd, en Sunan Giri geeft zijn kri^ 
voor Makripat, deze zal wespen voortbrengen, die den vijand zullen verjagen, en 
Sunan Cërbon geeft een badong, die men op het slagveld openen moet om er 
regen, wind, en de muizen {durbiksa) uit te laten, die er in zitten. Iman, thans 
Sunan Kudus, (413) vertrekt met 1000 man; aan de wong huda schijnen het er 
100000-en toe. De muizen eten den voorraad op en vernielen alle harnachementen. 



— 201 — 

de wespen zijn niet te keeren, en de stormwinden en <le regenvlagen verrichten 
nog het hanne. Alles dringt tot Majapahit door, maar de pondok van den ndipati van 
Tërung heeft niets te verduren, daar deze kevamal was, omdat hij het ware geloof 
reeds omhelsd had. Brawijaya vlucht met zijn kroost (lees: zijn vrouwen?) en 
zgn palih naar Sënggurnh. Sunan Kndus dringt Majapahit binnen. De dipali van 
Tërung onderwerpt zich. De kris Sëngkëlat brengt Sunan Kudus zelf naar Dëmak. 
Madi pandan moet zich op bevel van Sunan Bonang te Tirang ampel vestigen. 
Pulo Tirang heet dientengevolge, sints 1398 (aaak'terus'cahya'jali), Pandan nara (of 
Pandan arang;. (414.) Brawijaya trok zich in 1399 (rnHha-terus-lena-naia) naar 
Sënggnruh terug. Adipati Bintara wordt Panëmbahan Jimbuu. Dipati Tërung's 
dochter huwt met Sunan Kudus, en haar vader geeft dezen de bende Macan 
tétunggul jurit. De paseban pajeksnn van Majapahit wordt naar Dëmak overgebracht. 
Këbo kënanga volgt zijn vader over Pëngging op. Des paneinhahanA zonen wor- 
den ptingeran, Raden Surya wordt Pangeran Sabrang, Kanduruwan wordt Pangeran 
Panggung (te Randu sanga), Raden Trënggana Pangeran Trenggana, en dan zijn 
er nog Pangeran Saba Kingkis (lees Saba Kingkin) en Pangeran Sampang, zijn 
schoonzoons. Lëmbu pëtèng ^), te Tarub, is ontsticht dat ook hij geen hoogen 
titel kreeg. Zelf verschijnt hij niet meer op audiëntie, maar zendt zijn zoon Gë- 
tas pëndawa. De nieuwe panemhaluui overlegt, ook met zijn patih Wanawala, hoe 
met Brawgaya te doen. Hij beveelt Lëmbu pêtêug en Jaran Panolih naar Sêng- 
garnh te gaan om nog eens te trachten den vorst over te halen zich te bekeeren ; 
de eerste is niet aanwezig. Gëtas pëndawa wordt lurah lamlama. Men trekt naar 
Sëngguruh. Brawijaya wordt voor de laatste maal uitgenoodigd Mohammedaan te 
worden. Hij blijft 't geloof zijner vaderen trouw. Als Kalungkung het gevecht 
verliezen zal, zal hij naar Bali vluchten. (415) De laatste strijd wordt gestreden. 
Terwgl deze nog niet geëindigd is, gaat Brawijaya naar Bali, waarheen Kalungkung 
en G^jah mada hem straks volgen. Sëngguruh wordt geheel vernield, maar Bali kan, 
erkent de Panèmbahan, door hem niet tot den islam worden gebracht. Sëngguruh 
viel in 1400 {sirna-Hang-kérlining-humi) ; de lezer, — zegt de schrijver, — houde 
bet verschil tusschcn den val van Majapahit en dien van dit laatste wel in 't oog {ing- 
kang amacay ing séral dipun-lialiv y, hédahira ing negara majalhigka, lawan segunth 
ikiy ayun hednk-ena). Als de Panèmbahan weer te Dëmak is teruggekeerd, wordt 
overal de Vrijdagsdienst geregeld. 

Tot zoover de Sërat kanda ^). 

In een tabelvorm gebracht in den trant van hetgeen uit Rallies overgenomen 
werd, en tevens vermeldende wie de palih'» waren, leveren deze beide teksten al 
weder iets anders, dan men daar aantrof, doch daarin verdiepe men zich niet verder. 



1) Bonclan Kajuwau moet hier zijn bedoeld, vgl. Zang 402, waar door den üchrjiver is vergeten te 
vennelden, dat hjj dezen naam kreeg, vergl. slechts Babad tanah Jawi, cd. Meinsma, bl. 42. 

2) Ook elders is dit geschrift, althans in deze redactie, zakelgk, /eer belangrijk, zoo bijv. ook de 
gedeelten, die handelen over Pafiji, Pigajaran, en Aji Saka. 



— 202 — 

Bnhad tamih Jmri, 

Brawijaya, palilt Wahan ( = Wiroj. 

Prabu anom^ padli Waliaii (diens zoon heet hier Udara). 

Adaningkung; 

Hayam wuruk, 

Lëmbu Aiiiisani; initih Démung wular. 

Raden Alit. pahh Gajah mada. 

Sérnl Icnntia, 

1221. Brawijaya, palih Wirun. 

1229. Bra kamara, patili Wahas (zoon van Wirun j, dan Ujung sabata. 

1234. Ardiwijaya, pahh Jayasena (de zoon van Wahas, de dipati v. Ködiri), 

dan Udara Teen zoon v. Ardiwijaya). 
1250. Adaningknng, ook Kala Amisani, pnfih Udara, dan Logènder (zoon 

van Jayasena). 
1267. Kêneana wiingu, palih Logènder. 
1270. Mêrtawijaya (Damar walan, gehuwd met Kêneana wunguj, patih 

Gajah mada (Layang Setra kumitir, de zoon van I^gënder). 
1301. Angkawijaya, palih Gajah mada. 
1398. Majapahit verlaten. 
1400. Sëngguruh verwoest. 

Terwijl boven bij Hoofdstuk XII en op bladz. 186 reeds het noodige is opge- 
merkt over den Damar wulan roman in verhouding tot de Pararaton, en daarover 
dus hier verder kan worden gezwegen, dient er hier de aandacht op gevestigd 
te worden, 

lo. dat algemeen in de betrokken literatuur na den eersten vorst volgens 
de overlevering een Bra kumara aan het bewind komt, die af en toe wel eens Prabii 
anom wordt genoemd. Doch al kan Prabu anom als een andere uitdrukking voor Bra 
kumara worden beschouwd, op zich zelf is het een onduidelijke uitdrukking, daar er 
ook onderkoning, tweede koning^ onder verstaan kan worden, en zij dus aan Bra ku- 
mara geenszins in allen deele gelijkstaat. Dit Bra kumara^ de knaap, het jongetje, dat 
Bra, d. i. Qri, d. i. Zijne Majesteit was, herinnert te sterk aan wat wij nu van 
Jayanagara weten, dan dat men niet zou kunnen beslissen, dat èn de westelijke 
èn de oostelijke, èn de Javaansche èn de Balisehe overlevering ons berichten, dat 
er na den eersten Brawijaya een klein kind vorst over Majapahit is geweest. 

2o. dat de vierde vorst van Majapahit, volgens één der voorstellingen, 
Hayam wuruk zou hebben geheeten, wat volgens de Pararaten, prabhu is(ri I 
medetellende, werkeiyk het geval was, doch dan heeft men daarby er op te letten 



— 203 — 

dat zijne voorganger den naam Adaningkung zou hebben gedragen, die herinnert 
aan een anderen naam van Hayam wuruk, nl. Hyang Wêkasing suka. 

30. dat de prabhu islri II, tijdens wier regeering [de paregrég plaats 
had, d, i. de prabhu kenya van den Damar wulan roman, den eersten vorst van 
Majapahit, Raden Wijaya, Kërtarajasa, werkelyk bestond in den zelfden graad, 
als daarvoor door de Sërat kanda wordt opgegeven, aangezien de prabhu islri I 
een zuster was van Jayanëgara, en bij de telling der geslachten deze dus kan 
worden overgeslagen; Kaden Wijaya, de prabhu isfri T, Ilayam wuruk, Hyang 
wi^e^a, de prabhu islri II; of in de Sërat kanda, zonder daarmede de genoemde 
personen geheel te identifieeren : Brawijaya, Braknmara, Ardiwijaya, Adaningkung, 
Këöcana wungu; en zonder dat daarbij vergeten wordt, dat hier Adaningkung 
Hayam wuruk's zoon zou zijn geworden, waar sub 2° er zijn vader uitgroeide. 

4». dat er een Hyang Wëkasing suka, nl. de II« van dien naam, te Tajung 
(Tafijung) werd bijgezet; doch deze was wel een hm, maar besteeg den troon niet. 

r><'. dat ook in de Pararaton het laatste gedeelte van den Majapahitschen 
tijd een raadsel is, evenals in de Javaansche traditie, welke den laatsten Brawijaya. 
Angkawijaya, in de Sërat kanda, van 1301 — 1399 of 1400 laat regeeren; 

60. dat, en men zie al weder (Je Sërat kanda, de laatste vorst, zijn kralon 
verlaat, en dat hij dat reeds doet vóór 14(>), terwijl er tevens opgewezen mag 
worden 

7». dat ook de Sërat kanda den duur van het Majapahitsche rijk op circa 
twee eeuwen stelt, aangevende dat de plaats in 1221 gesticht zou zijn; 

80. dat ook hier de belangrijkste veroveringen, al is de voorstelling eenigs- 
zing vreemd, plaats grijpen onder den derden regent, evenals zij in de Pararaton 
tijdens de prabhu islri I geschieden, en ten laatste 

90. dat men in beide traditien den palih Gajah mada terugvindt. 

Met dit laatste vooral komt men op een zeer zwak punt, daar de tijd 
waarin bij zou geleefd hebben, in de eene overlevering een geheel andere is dan 
in de andere, en hy in beiden geenszins hetzelfde verricht, aangezien in de eene 
traditie andereu reeds lang vóór hij ten tooneele treedt, in zijne plaats hebben 
gedaan wat volgens de anden^ hij tot stand zou hebben gebracht. 

Vooral wanneer men de lijsten der palih'» M, volgens de beide tradities, 
zie hierboven en bij Hoofdstuk XIII, met elkander vergelijkt, blijkt het hoe ver 
de overleveringen uit elkander loopen. 

Men zoeke of trachtte er voorshands niet opzettelijk naar ze met elkander 
in overeenstemming te brengen. Vloeiden de bronnen maar rijkelijker, zeker zou 
er meer aan het licht zijn te brengen. 

Nu dat niet het geval is, moet men zich te vreden stellen met hetgeen 
er reeds gevonden werd. 

1) Orer 'Wthsn sie men wat opgemerkt werd in Net. B. G. XXVI (1888% fi^lage 11, bl. XVII, noot. 



— 204 — 

Ook dit zal bij een verder onderzoek, een langere beschonwing en een 
scherper toezien zonder twijfel straks nog wel meer belangrijks blijken te bevatten 
dan nn reeds kon worden aangewezen; niemand kan meer dan schrijver dezes 
verlangen^ dat er eens meer licht over de nog zoo talrijke duistere punten zal 
gaan schijnen. 



TABELLEN 



EN 



REQISTERS. 



Tot verdere toelichting van het hier uitgegeven geschrift volgen hier: een 
stamboom van de vorsten van Majapahit en die van Tumapél, welke daaraan 
voorafgingen^ met eenige aanvullende tabellen; een kort overzicht van de opvol- 
ging dier vorsten ; een chronologisch overzicht over de jaren 1 144 — 1400 Qaka ; 
een lijst van de namen der vermelde heiligdommen ; en drie registers^ die achter- 
eenvolgens bevatten 1» de plaatsnamen, die in de Pararaton voorkomen, 2^ de 
daarin voorkomende persoonsnamen, en 3<> de eigennamen, plaats- en persoonsna- 
men, die i^n de aanteekeningen worden aangetroffen. 

Op welke wijze de stamboom (Tabel I) werd uitgezet, is boven reeds mede- 
gedeeld in de aanteekening bij Hoofdstuk X. Toch lette men ook op die by de Hootd- 
stnkken XII, XIII en XIV, aangezien daar gewezen werd op eene mogelijke an- 
dere opvatting van een paar plaatsen, die een wijziging van enkele onderdeden 
van het latere gedeelte van den geslachtsboom noodzakelijk zouden kunnen maken. 

De aanvullende tabellen geven eene opsomming van de personen, wier 
namen in den stamboom dienden voor te komen, doch wier afkomst niet bleek 
(Tabel II); van de latere vorsten van Majapahit (Tabel III); en van de nog verder 
genoemde personen van vorstelijken bloede (Tabel IV). 

Het chronologisch overzicht geeft niet alleen de belangrijkste feiten van de 
Pararaton, naast dezen worden er ook in vermeld alle oudheden van Java en 
Sumatra, welke bevonden zijn jaarcijfers te dragen, die in dezelfde periode vallen. 

De splitsing in de registers gemaakt moet ten doel hebben de overzichte- 
lijkheid te bevorderen. Daarom werd wat in den tekst van de Pararaton voor- 
komt en hetgeen de aanteekeningen mochten bevatten, uiteengehouden, en ten 
opzichte van den tekst ook nog een scheiding gemaakt tusschen plaatsnamen en 
en eigennamen van personen. Op deze wijze zal het mogelijk zijn, gemakkelijk 
een overzicht te verkrijgen over hetgeen de Pararaton levert, en werd het tevens 
overbodig telkens te vermelden tot welke soort van namen een gegeven, in dat 
boek voorkomende, naam behoort. 

De verwijzingen in de beide eerste registers zijn naar de bladzijden en 
regels van den Javaanschen tekst. Het mocht overbodig worden geacht ook naar 
de bladzyden der vertaling te verwijzen, aangezien in deze door middel van vette 
cgfers tusschen scherpe haakjes geregeld het begin der bladzijden van den Ja- 
vaanschen tekst is aangegeven. Zoo noodig zal men daardoor ook in de vertol- 
king de bedoelde plaats gemakkelijk terug kunnen vinden, te eer omdat in de 
inhoudsopgave aangewezen is op welke /egels de in de vertaling aangenomen 
hoofdstukken beginnen en eindigen. 

Er werd de voorkeur aangegeven deze beide registers, die uitsluitend Ja- 



— 208 — 

vaansche namen bevatten, te schikken volgens het Javaansehe alphabet, en tevens 
werd het ouuoodig geacht om in de laatste dezer twee lijsten ook onder te brengen 
de voorkomende dag-, week- en maandnamen (Budha hiréng, Wérhaspati, Sa. ^^ 
Sane^eara; Pa. = Pahing, Pon; Galungan (inlandsch awiArti-nieawjaar); Landép, 
Warigadyan, Kuningan, Madasya, Julung pujut, Pahang, Prangbakat, Watu ganang; 
Antawulan = Basantawulan ?, Karo, Kawohi), die daar ook niet op hun pinate 
zouden zijn geweest, evenmin als de beide boektitels Wukir polaman (de door 
Jayakatong in zijn gevangenschap vervaardigde hidung) en Parthavajfia (een 
kakawin). 

Omtrent het derde register valt niets op te merken. Het is een gewone 
klapper, zooals men die wel meer vindt, gerangschikt volgens de volgorde van 
ons alphabet. 



bc 



TABEL II. 

PEUSOM IN DEN GESLACHTSBOOM YERÏELD; DOCH VAN WELEEN 
NIET BLIJKT WELKE BÜNKE AFSTAMG IS. 

(Men zie b|j No. 18, 20, 22, 23 en 46.) 

Il, Raden Cakbadhara (bl. 27 reg. 14), 
gehuwd met Bhre Eaburipan II (19), 
f (niet vermeld), 
begr. te (niet vermeld). 

i. Raden Kudamêrta (bl. 27 reg. 15), 

= (Bhre) Wéngkër I = PrameQwara I (bl. 27 reg. 15), 

= Bbre Pamotan I = Wijayarajasa (bl. 27 reg. 15), 

gehuwd met Bhre Daha II (SO), 

t 1310 (bl. 30 reg. 19), 

begr. te Mafiar = Wii^nubhawanapura (bl. 30 reg 20). 

CJ. Raden Larang (bl. 27 reg. 23), 

= Bhre Matahun I (bl. 27 reg. 23), 

gehuwd met .... (d.) (82), zuster van Hayam Wumk, 

t 1311 (bl. 30 reg. 20), 

begr. te Tigawangi = Kusumapura (bl. 30 reg. 21). 

||. Raden Sumana (bl. 27 reg. 25), 
I = Bhre Paguhan I (bl. 27 reg. 25), 

gehuwd met Bhre Pajang I (23), 

t 1311 (bl. 30 reg. 26), 

begr. te Lo bëiical = Parwatigapura (bl. 30 reg. 23), 

B. Bhre Këmbang jénar (bl. 30 reg. 16), 
huwt met Bhre Keling I (4^), 
f (niel vermeld), 
begr. te (niel vermeld) 



V«db. Btt Gen.» dad XLUL 14. 






TABEL lil. 

DE LATERE VORSTEN VAN MAJAPAfllT. 

Koninglooshcid gedurende 8 jaren, 1351 — 1359 (hl. 31 reg. 28 en 34), 

52. Bhre Daha IV, 

= Frabbu istri III, 

1359 (bl. 31 reg. 34) — f 1369 (bl. 31 reg. 37), 

begr. te Singhajaya (bl. 31 reg. 37). 

53. Bhre Tumapël IV, 

*= Kërtawijaya (?), 

1369 (bl. 32 reg. 1) — f 1373 (bl. 32 reg. 9), 

begr. te Eértawijayapara (bl. 32 leg. 9). 

54. Bhre Pamotan II, 

= Bhre Keling II = Bhre Eahuripan V, 
s Rajasawardhana = Sinagara (bl. 32 reg. 11), 
1373 (bl. 32 reg. 11) — f 1375 (bl. 32 reg. 12), 
begr. te Sépang (bl. 32 reg. 12). 

Van dezen vorst worden vier kinderen vermeld: 

55. Bhre Koripan VI (bl. 32 reg. 23), 

56. Bhre Mataram II (bl. 32 reg. 23), 

57. Bhre Pamotan UI (bl. 32 reg. 23), 

58. Bhre Kërtabhumi (bl. 32 reg. 24). 

Koning loosheid gedurende 3 jaren, 1375 — 1378 (bl. 32 reg. 14). 

59. Bhre Wëngkër III, 

= Hyang Purwawige^ia (bl. 32 reg. 15), 

1378 (bl. 32 reg. 16) — f 1388 (bl. 32 reg. 19), 

60. Bhre Pandan salas III, 

1388 (bl. 32 reg. 21) — verlaat da kraton in 1390 (bl. 32 reg. 22). 



i 



TABEL IV. 

KOG mm cnoEiDE mmn m mmim mm 

De OTeri^y nog verder genoemde personen, van welken aangenomen worden 
moety dat ook zij van vorstelijken bloede waren, worden zonder eenige nadere 
aanduiding alleen maar hier en daar vermald. Evenmin als de familieverhouding 
der vijf (5) laatste vorsten van Majapahit onderling en tot de leden van den 
voorafgaanden geslashtsboom te bepalen is, is dit bij hen mogelijk. Zij zijn: 

61. Bhre Gu?dal (bl. 27 reg. 26), 

62. Raden Gajah, Bhra Narapari (bl. 31 reg. 13 en 32), 

63. BoRE Pa^jtdast salas II (bl. 31 reg. 31). 

64. Radex Jagulu (bl. 31 reg. 31), 

65. Bhra Htasq (bl. 32 reg. 5), 

66. Bhre Daha V (bl. 32 reg. 18), en 

67. Bhre Jaqabaqa II (bL 32 reg. 20). 



TABEL V. 

KORT 0ÏÏR2ICBT VAN DE OPVOLGING DER VORSTEN VAN TOMAPÈL EN MAJAPAHIL 

Tumapél. 

Ken Angrok; als ralu Rajasa^ enz., 1144 — 1169. 

Annsapati, raiUf 1170 — 1171. 

Tohjaya, ratu, 1171—1172. 

Ranggawuni; als ra(u Wisnuwardbana, 1172 — 1194. 

Kértanagara, als prabhu Qiwabuddha, 1194 — 1197. 

Interregnum (Jayakatong), 1197 — 1216. 

Majapahit. 

Raden Wijaya, als prabhu Kërtarajasa (Jayawardhaua) 1216 — 1217. 

Kala Gëmët, als prol) hu Jayanagara, 1217 — 1250. 

Bhre Kahuripan II, als prabhu uflri I (Jayawi^nuwardhant), 1250 — ? 

Hayam Wuruk, als prabhu Rajasanagara, enz., ? — 1311. 

Hyang Wigesa, als prabhu Aji Wikrama, 1311 — 1322. 

Dewi Suhita, prabhu ulri II, 1322—1351. 

Interregnum (koningloosheid), 1351 — 1359. 

Bhre Daha IV, prabhu islri III, 1359—1369. 

Bhre Tumapël IV, als prabhu Kërtawijaya (?), 1369—1373. 

Bhre Pamotan II, als prabhu Rajasawardhana, 1373 — 1375. 

Interregnum (koningloosheid), 1375 — 1378. 

Bhre Wëngkër III, als prabhu Hyang Parwawige^a, 1378 — 1388. 

Bhre Pandan salas III, prabhu, 1388—1390 (?), 



TABEL Tl. 

CHRONÖlöGISCB OÏÏRZICIIT OVER DE JAREN H44-H0Ö (AKA = 1222H4I8 l D. 

Qaka. A. D. 

— — t Tunggul amétnng (1). 

1144 1222 t Dangdang gëndis; val van Daha^ Tumapél (Singasari) het eerste 

rijk op Java; Rajasa (Ken Angrok) (2) opperheerscher. 
114Ö 1223 Watervat met jaartal te Sépande, in Surabaya. 
1148 1226 Steen met jaartal te Parwakérta^ in Kédiri. 

1160 1238 Steen met jaartal te Këdung dawa^ in Këdiri. 

1161 1239 Gane^a-beeld met jaartal te Bara^ in Kédiri (ham ghana hana bumi). 

1169 1247 t Rajasa. 

1170 1248 Anusapati (3) koning {rahi). 

1171 1249 t Anusapati; Tohjaya (8) koning (ratu). 

1172 1250 t Tobjaya; Wi^nuwardhana (12) koning {raiu). 
1189 1267 Jaartal te Jëdung^ in Sarabaya. 

1191 1269 Beschreven steen te Pëtung amba^ in Këdiri. 

1193 1271 Canggu lor gesticht. 

1194 1272 t Wisnuwardhana ; Kërtanagara (Qiwabuddha) (4) koning {pra- 

hhu)', grafschrift van de Mërapi, op Sumatra (Mus. Bat. no. 84). 

1195 1273 ? f Mahisa campaka (13); grafsteen te Tralaya, in Surabaya. 

1197 1275 Famalayu; patumapël; f Kërtanagara; Daha weer het eerste rijk 

op Java. 

1198 1276 Jayakatong (van Daha) opperheerscher; grafsteen te Tralaya^ 

in Surabaya. 
1200 1278 Kërtanagara bijgezet. 
1204 1282 Jaartal te ïralaya, in Surabaya. 

1211 1289 ? Opschrift op den Jaka Dolok; te Surabaya. 

1212 1290 Opschrift te Anjuk^ Madura {yama-daca-paha-wwang). 

1213 1291 Kikvorsch met jaartal te Blitar, in Këdiri. 

1214 1292 ? Majapahit gesticht door Raden Wijaya (15); steen met jaartal 

te Gambar^ in Këdiri. 

1215 1293 Chineesche expeditie op Java; val van Daha^ Majapahit het eerste 

rijk op Java; terugkeer van de Javaansche troepen uit Malayu; 
f Jayakatong. 

1216 1294 Kërtarajasa (Baden Wijaya) koning {prabhu)*^ Jayanagara (Kala 



— 214 — 

Qaka. A. D. 

gfimët) (18) geboren; pracasU van Kërtarajasa voor het hoofd 

van Kndadn. 
1217 1295 t Krrtarajasa; Jayanagara koning rf?ra6/m); opstand van Rangga 

lawe; Wiraraja (Baiiak wide), ract wien Kërtarajasa (Raden 

Wijaya) de afspraak maakte Java te deelen, krijgt Lamajang 

en de Tigang jum. 
1220 1298 Pasora. 

1222 1300 f Sora; ? Nambi verlaat Majapabit, gaat naar Wiraraja (Lamajang), 

en Btaat op. 

1223 1301 Jaartal aan Candi Sapob, in Eëdiri. 
1229 1307 t Wiraraja. 

1231 1':I09 Steen met jaartal te Tëgal sari, in Madiyun. 

1233 1311 Guntnr (bergstorting) Palungge. 

1234 1312 ? Pajurudëmung. 

1235 1313 t Juru dëmung. 

1236 1314 Pagajabbim; beschreven steen te Blitar, in Eëdiri. 

1237 1315 Pamandana; pawagal; steen met jaartal te Blitar, in Eëdiri. 

1238 1316 f Nambi, einde van den opstand van Lamajang. 

1240 1318 Palasëm, f Sémi. 

1241 1319 Pakuti; f Euti; f Mahapati; jaartal te Tralaya, in Snrabaya; 

rijstblok uit Surabaya; rahasa's te Panataran, in Eëdiri. 

1242 1320 Rahasa's te Panataran, in Kêdiri. 

1243 1321 Zodiakbekers van Oost- Java. 

1245 1323 Eoperen platen van Sidatëka, in Snrabaya. 

1248 1326 Jaartal te Ji^dung, in Snrabaya; zodiakbeker van Oosl-Java. 

1250 1328 Patafica; f Jayanagara; Blire Eahuripan II (pra6Au »rn I) (19) 

koningin (prabhu). 
1252 1330 Zodiakbekers van Oost-Java. 
12'33 1331 Pasadeng; zodiakbeker van Oost-Java. 
1256 1334 Pabanupindab; hds. van de Arjunawiwfiba (Mus. Bat. kropak n». 641). 

1260 1338 Grafsteen op den Gunnng Pontang, in Bësuki; zodiakbekers van 

Oost-Java. 

1261 1339 Zodiakbeker van Oost-Java. 

1264 1342 Eris van den Heer Cb. Enaud (gipsafgietsel. Mus. Bat. no. 1606»). 

1265 1343 Opsebrift op het MaTiju^rt-beeld, dat een koningin als regeerend 

vermeldt ; ? pra^asti van Jayawii^nuwardhani {prabhu ishi 1) ? 
(Mus. Bat., no. 38). 

1268 1346 Gajab mada (patih) amangt(ubhumi. 

1269 1347 Raksasa'B te Panataran, in Eëdiri; besebreven steen te Batu bara- 

gang; op Sumatra (dwarc^a^^bhuje^pc.) 



— 215 — 



Caka. 


A. D. 


1271 


1349 


1272 


1350 


1274 


1352 


1275 


1353 


1276 


1354 


1277 


1355 


1278 


1376 


1279 


1357 


1282 


1360 


1283 


1361 


1284 


1362 


1286 


1364 


1290 


1368 


1291 


1369 


1292 


1380 


1293 


1371 


1294 


1372 


1295 


1373 


1296 


1374 


1297 


1375 


1298 


1376 


1299 


1377 


1302 


1380 


1306 


1384 


1307 


1385 


1308 


1386 


1309 


1387 


1310 


1388 



Jaartal van Gandi Kali cilik. in Eëdiri. 

Zodiakbeker van Oost-Java. 

Rajasanagara (Hayam wamk) (21) koning (prabhu). 

Zodiakbeker van Oost-Java. 

Badkuip van Nabo, in KCdiri. 

Jaartallen te Tralaya, in Snrabaya. 

Badkuip van Nabo^ in Kédiri. 

Beschreven steen te Balong masin^ in Snrabaya; besebreven steen 

te Pagar ruyung, op Sumatra (wasttr-muni-bhiijd'Sthalam). 
Pasunda bubat; padompo; Qiwabeeld van Majakérta, in Snrabaya. 
Beeld uit het Surabayasche ; zuil met jaartal van Plumbangan^ 

in Kédiri; dubbelpaard van Bogëm, in Këdiri. 
Lingga van Oost-Java (Mus. Bat. no. 352). 
Pa^raddban agung (het groote doodenoflfer). 
Watervat te Gérsik; in Snrabaya. 
t Gajah mada. 
Kleine tempel te Panataran, in Kédiri; steen met jaartal te Pafijér, 

in Snrabaya; zodiakbeker van Oost-Java. 
Candi Kédaton. in Bésuki. 
Gajah énggon padlr^ f Bhre Kahuripan II (prabhu istri I);tBhre 

Daha II (20); Candi Pari, in Snrabaya (Mus. Bat. no. 49). 
Jaartal te NgluyU; in Rémbang; voetstuk te Panglungan^ in Snrabaya. 
Pracdsli van Rajasanagara (Hayam wuruk); steen te Panataran, is 

' Këdiri. 

* 

Watervat te Sémangka^ in Snrabaya. 

Péndapa te Panataran, in Kédiri. 

Pagunung auar; steen met jaartal te Jédung, in Snrabaya. 

Verovering van Palembang, volgens Notes enz., bl. 36 (162) en 

69 (193); voetstuk van Nabo, in Kédiri. 
Grafsteen te Tralaya, in Snrabaya. 
Watervat te Blitar, in Kédiri. 

Pamadasya; beschreven steen uit het Surabayasche (wAaAa/a /any- 

gala 1307) (Mus. Bat. n». 32). 
t Bhre Tumapël I (24); beeld te Madiyun. 
Wi^nu-beeld in Kédiri. 

t Bhra PramcQwara I Pamotan (Bhre Wéngkér I, de gemaal van 
Bhre Daha II) (B). 

1311 1389 t Pajasanagara; Hyangr wi9efia (23) koning (prabhu'', f Bhre 

Rajang (23); f Paduka «ori (24); f Bhre Matahun I (C); 
t Bhre Pagnhan I (D). 



— 216 — 



Qaka. 


A. D. 


1313 


1391 


1316 


1394 


1317 


1395 


1318 


1396 


1319 


1397 


1320 


1398 


1321 


1399 


1322 


1400 


1323 


1401 


1324 


1402 


1325 


1403 


1326 


1404 


1327 


1405 


1328 


1406 



Beeld van Ngluyn^ in Rëmbang (Mus. Bat. n». 147). 

Pra^sti uit het Surabayascbe (Kaw. Oork. IV). 

Pra^asti uit het Surabayasche (Kaw. Oork. IV); paprangbakat. 

Pra^asti uit het Surabayasche (Kaw. Oork. IVj; steen met jaartal 
te Sëtana, in Madiyun. 

? Beschreven steen van Elaranglo, in Surabaya {lenff-tunggal-murtV^i)- 
ning-wwanfji) ' een steen met jaartal^ in Këdiri. 

t Gajab ënggon; Gajah manguri palih] watervat te Kébondalém; 
in Madiyun. 

f Hyang wëkasing suka II (36). 

Hyang wi^e^a trekt zich uit de regeering terug; Dewi Suhita 
(prabhu islri II) (38) koningin (prabhit). 

Begin der oneenigheden tusschen Hyang wigesa en Bhre Wirabhumi; 
t Bhre Lasëm I (26); f Bhre Lasëm II (29); f Bhre Kahu- 
ripan III (30); f Bhre Pandan salas I (46). 

Beschreven steen te Wangkal; in Prabalingga {sepat-roro-hangan- 
felu'twiggal). 

Begin van den groeten krijg tusschen het westelijke en het ooste- 
lijke rijk (Majapahit en Balambangan, d. i. tusschen Hyang 
wi^esa en Bhre Wirabhumi); ? beeld te Jufijung, in Këdiri. 

Beeld te Ngampel^ in Këdiri. 

Jaartal aan de grot te Jajar^ in Këdiri. 

t Bhre Wirabhumi, die door Raden Gajah (Damar wulan?) ver- 
slagen wordt. 
1332 1410 f Gajah manguri; Gajah lëmbana palih] raksasa van Gambar 

wetan in Këdiri. 

Pajulungpujut. 

Beeld te Grogol, in Surabaya (Mus. Bat. no, 310a). 

t Gajah lëmbana; Tuhan Kanaka palih. 

? Beschreven steen van Selabraja^ in Pasuruhan {rasa-beddhé" 
beddha — ). 

Badkamer te Panataran; zodiakbeker van Oost-Java. 

t Bhre Daha III (49); f Bhre Matahun II (35); f Bhre Mataram 
I (33); palantaran agung; beschreven steen van Sukoh, in 
Surakêrta; beeld van Utëran, in Madiyun; beschreven steen 
van Bërbëk, in Këdiri (Mus. Bat. n©. 61). 

1340 1418 Grafsteen te Gérsik, in Surabaya; id. te Tralaya, in Surabaya. 

1341 1419 Handschrift van de Sang hyang hayU; van Ciburuy; in de Preanger. 

1348 1426 Pahilan agung (groote hongersnood). 

1349 1427 t Bhre Tumapöl (b) UI (39). 



1333 


1411 


1334 


1412 


1335 


1413 


1336 


1414 


1337 


1415 


1338 


1416 



— 217 — 



Qaka. 


A. D. 


1351 


1429 


1352 


1430 


1353 


1431 


1354 


1432 


1355 


1433 


1356 


1434 


1357 


1435 


1358 


1436 


1359 


1437 


1360 


1438 


1361 


1439 


1362 


1440 



t Hyaog wife^a; f Bhre Wëngkér II (41); f Dewi guhita (prafcAw 
islri n). 

G^en koning. 

t Tuban Kanaka; voetstuk te Sela mangleng, in Këdiri; geen koning. 

Oeen koning. 

t Bhre Lasëm III (34), f Bhre Pandnn salas II (62); f Raden 
Gajah; geen koning. 

Geen koning. 

Handschrift van de Sang hyang hayn, van Cilégon, in de Preanger, 
(Mus. Bat. kropak n^ 638); geen koning. 

Jaartal van de Candi Bocok, in Pasuruhan (Mus. Bat. n». 47); 
geen koning. 

Bhre Daha IV (prabhu istri III) (52) koningin (ra/ii); grafsteen 
te Tralaya, in Surabaya. 

Beeld uit het Surabayascbe ; steen met jaartal van Pëtung amba, 
in Pasuruhan; beschreven steen te Aüjuk, op Madura; be- 
schreven steen van Tajuk, in Samarang (Mus. Bat. n». 71). 

Varken en beschreven steen te Snkoh, in Surakêrta. 

Steen met jaartal te Pëtung amba, in Pasuruhan; beeld en be- 
schreven steen te Snkoh, in Surakêrta. 
1363 1441 Beschreven steen te Tajuk, in Samarang; steen met jaartal en 

beschreven steen te Sukoh, in Surakêrta. 

? Beeld te Sukoh, in Surakêrta. 

Beeld te Blitar, in Këdiri. 

Beschreven phallus van Sukoh; in Surakêrta (Mus. Bat. n». ö). 

t Bhra ParameQwara II (47); steen met jaartal van Suklit, in 
Bêsuki. 

1369 1447 t Bhre Këling (46); f Bhre Daha IV (prabhu isiri III); Bhre 

Tumapël IV ? (Kërtawijaya ?) (53) koning (prahlm)', beeld 
van Oost-Java (te Leiden). 

1370 1448 Olifant te Cëta, in Surakêrta; grafsteen te Trawulan, in Surabaya^ 

(Putri Gémpa). 

1371 1449 Beschreven steen van Adoman, in Samarang. 

1372 1450 Palindu (aardbeving). 

1373 1451 t Bhre Paguhan II (42); f Bhra Hyang (?); f Bhre Jagaraga I 

(43); t Bhre Kabalan (50); f Bhre Pajang II (45); guntur 
(bergstorting) pakuningan; steen met jaartal van Patirana^ 
in Bësuki; f Bhre Tumapël IV; Rajajsawardhana (Bhre 
Pamotan II) (54) wordt koning (prabhu). 
1375 1453 t Bajasawardhana ; geen koning. 



1364 


1442 


1365 


1443 


1367 


1445 


1368 


1446 



^ 



— 218 — 

Qaka. A. D. 

1376 1454 Steen met jaartal te Panataran, in Këtjiri; geen koning. 

1377 1455 Steen met jaartal van Widara pasar, in Bësuki; houten stijl van 

Majapabit (?); geen koning. 

1378 1456 Hyang purwawi9efta (Bhrc Wëngkör III) (59) wordt koning 

iprablm); beschreven steen van Céta, in Surakërta ; losse steen 
te Jédung, in Surabaya (naga-maharci-hutiku F). 

Grafsteen te Tralaya, in Surabaya. 

Beschreven steen te Sine, in Madiyun (Mus. Bat. n®. 3). 

Beschreven steen te PënampihaU; in Këdiri. 

Guntur (bergstorting) palandëp. 

t Bhre Daha V (65). 

t Hyang purwawi^esa ; f Bhre Jagaraga II (66); BhrePandan 
salas III (56) koning (prabhu). 

Grafsteen te Tralaya, in Surabaya. 

Bhre Pandan Salas III verbat de kraton. 

Zuiltje van Madiyun (Mus. Bat. no. 60). 

? Zuiltje te Diipak, Madiyun. 

Beschreven steenen te Agël, in Bërjuki. 

Grafsteen te Tralaya, in Surabaya. 
1400 1478 Dood van een vorst in de kraton (?). 



1379 


1457 


1381 


1459 


1383 


1461 


1384 


1462 


1386 


1464 


1388 


1466 


1389 


1467 


1390 


1468 


1391 


1469 


1392 


1470 


1395 


1473 


1397 


1475 



1403 1481 Guntur (bergstorting) pawatugunung. 

1408 1486 Beschreven steenan van Dakuhan duku, Jiyu, en Majajejer, in 

Surabaya. 



TABEL VII. 

LIJST VAN DE MM DER IN DE PARARATÖN GEKOEMDE eEIllGDöUlN. 

Adilangu, als dharma Adripurwawigesa. 

Adripurwawi^esa = Adilangu. 

Antapani; dharma. 

Apaapa, dharma. 

Badandër (kabnyutan). 

Bajrajinapariinitapura »= Sajabung. 

Bapa (mandalcng — ) = Turyantapada. 

Bulalak (nxandalcng — ). 

QiSrDggnpura = Eapopongan. 

gëroggarapura, var. van Céraggapura. 

QuDyalaya [dharma F). 

Èmbul, als dharma Girindrapara. 

Girindrapura = Ëmbul. 

Giripantarapnrwa = Panggih. 

Gori§apura = Lung. 

Indrabbawana. 

Indrapnra (giri — ), d.i. Girindrapara. 

Jajagn/ dharma. 

Japan^ als dharma Sarwajüapura. 

Jinggan^ als dharma Wi^nupura. 

Eabalon (kabuyulan). 

E^gënëngan^ dharma. 

Eapopongan^ als dharma ^ërnggapura. 

Eapundungan (mandalcng — ). 

Eatang lumbang^ dharma. 

Eêrtawijayapura, dharma. 

Eidal dharma. 

Enmëpër; dharma. 

Ensumapnra =- Tigawangi. 

Lak^mipura = Pabangan. 

Lalangon^ als dharma Paramawife^apura. 

Lëbak {mandalcng — ). 

Limbeban (kabuyulan). 

Lobëücal, als dharma Parwatigapora. 



— 220 — 

Lokërép; als dharma Amarasabha. 

Lukih (mandaleng — ). 

Lang^ als dharma Gori^apara. 

Mafiar; als dharma Wii^nubhawanapara. 

Nangka (kabuyutan). 

Oran (tnawlaleng — ). 

PabangaD; als dharma Laksmipara. 

Pandakan (kabuyutan). 

Panggih, als dharma Giripantaraparwa. 

Pantarapurwa (Giri — \ d.i Giripantaraparwa. 

Paramasukapura = Tajnng. 

Paramawigei^para = Lalangon. 

Parwatigapura = Lobëfical. 

Pari, dharma (?). 

Parwapatapan = Tamapél. 

Parwawi^esa (Adri — ), d.i. Adriparwawi^efut. 

Rabat Bahayabang. 

Babat Gorontol. 

Babat Ganang Lëjar. 

Babat Jala. 

Babat Eata. 

Babat Këdang Panitikan. 

Sabyantara, dharma. 

iSajabang, als dharma Bajrajinaparimitapara. 

Sarwajöapura =■ Japan. 

Sëpang, dharma. 

Siddhabbawana. 

Singhajaya, dharma. 

Saméngka, dharma. 

Tajang, als dharma Paramasakapara. 

Tigawangi, als dharma Kasamapara. 

Tagaran (kabuyutan). 

Tamapël, als dharma Parwapatapan. 

Taryantapada (mandaleng — ). 

Wi^nabhawana. 

Wii^nabhawanapara = Maöar. 

Wi^napara -= Jinggan. 

Wong sampflma (mamlaleng — ). 

Wadi kaficir (patnêlésatan). 



REGISTER 

DER IN DE PARARATON VOORKOMENDE PLAATSNAMEN, 

gerangschikt volgens het Javaansche alphabet. 



Ano, 6; 7. 

Indrapora^ zie Girindrapnra. 

Indrabhawana; 30^ si. 

Antapura^ naam van een heiligdom, of 

een deel van de kroton, 25, 2. 
lecasada; 32; 28 (in den kolophon). 
Harn, 28, 22. 

Oran (man^aleng — ), 5, 26. 
Akaa, 19, 15, lees Baksa. 
Adri purwawifesa, naam van Adilangu 

als heiligdom, 29, si. 
Adilangu, heet als heiligdom Adri (gu- 

nang) Purwawi^e^, 29, so. 
Adiyuga, naam van een bosch, 5, 8. 
Apaapa, 31, 87. 
Ayuga, naam van de sawah van Gajah 

para, 2, 1. 
Amarasabha, naam van Lokërëp als hei- 
ligdom, 31, 25. 
Èmbnl, heet als heiligdom Girindrapura 

of Giri Indrapnra, 30, 22. 
Nusantara, geen plaatsnaam, 16, 23; 

28, 21. 
Nagamasa, of Bagama^a, 5, 26. 
Nangka, 18, 17. 
Campara, verblijfplaats van Gajah para, 

2, 19; 3^ n (waar het foat gebruikt 

schijnt te zyn). 
Canggn, 32, 4; Canggn lor, 18, 9; so- 

haning Canggn, 24, 26. 
Baksa^ tegenwoordig Léks% ontstaan nit 



pinggir raksa, de verdedigde grens, 

19, 16. 

Rajasa {wong — ), 17, 17 en volgg., 

misschien geen plaatsnaam. 
Ragama^a, of Nagamasa, 5, 26. 
Rabat Eatu, 6, 12. 
Rabat Eëdang (var. Grédang) Panitikan, 

8, 6 ; misschien te lezen Rabat ganong 

Panitikan. 
Rabat Jala, 3, 15 en 17. 
Rabat gannng Léjar 8, 7 en volgg. 
Rabat Gorontol, .5, 7 en 10. 
Rabat Gédang Panitikan, var. van Rabat 

Kédung Panitikan. 
Rabat Bahayabang, 26, 8. 
Kahuripan, komt in de Pararaten alleen 

voor in de titels bhreng Eaharipan, 

anjéfiéng ring Kuharipan, patih ring 

Eaharipan. 
Eantër, var. van Gantër. 
Eocapet (Baöjar — ), zie Banjar Eocapet. 
Eërtawijayapara, naam van een heilig- 
dom, 32, 10. 
Eèrtabhami, alleen in den naam (titel) 

bhre Eërtabhami. 
Eoripan, zie Eaharipan. 
Earaman, 3, 13 en volgg.; 10, 28; se 

en 28; 11, i6 en 24. 
Eatang lambang, 17, 38; 18, 3, zie ook 

Lambang katang. 
Easamapara, naam van Tigawangi als 



— 222 — 



heiligdom, 30, 21. 

Kam {gunufifi --), 1, 17; 7, 27; 8, 27; 
9, 28; 13, 12. 

Eawidyadharen, een gedeelte van de 
kralon (?), 30, 86. 

Eëling, komt alleen voor in den titel 
bhreng Kéling. 

Kapundungan, 3, 12 en 29; 5, 1 (var. 
Mundung); 5, ie en volgg. 

Kapopongan, heet als heiligdom Qragga- 
pura of Qrnggapnra, 27, n. 

Eadiri, synoniem van Daha, 13, is. 

Eidal, 16, 16. 

Eumëpêr, 18, 12. 

E6mbang jénar, komt alleen voor in den 
titel bhreng Eëmbang jënar. 

Eagëncngan, 15, 26. 

Eabalan, komt alleen voor in den titel 
bhreng Eabalan. 

Eabalon, O, 27 en volgg., 7, 8 en volgg. 

Daha (nagareng — ) 5, 6; 8, 2 en volgg.; 
13, 15 en volgg.; 14, 9 en volgg; 18, 
28; enz., zie ook Eadiri; komt ver- 
der voor in titels als bhreng Daha, 
anjeneng ring Daha, patih ring Daha. 

Trinipanti, 23, 86. 

Trik {alasing voonq — ), de woeste gron- 
den van de lieden van Trik, naam 
van de plaats waar Majapahit verrees, 
in Qaka 1214, 22, 5 en 11; 23, s. 

Tënvag {alas — ), 6, s. 

Taryantapada ('t tegenwoordige Tu- 
ren?, 6, 27 en 82; 7, 8, 7, s, 9, ii; 

8, 2; heet ook Mandaleng bapa. 
Tërung, 22, 25. 

Tidang galating, var. Ti(]ung kalati, 32, 2* 
Tatar, d. z. de Tataren of Chineezen, 

23, 19 en volgg., 24, 1 en volgg. 
Taloka, var. Talokah, 8, 62 en volgg., 

9, 8. 

Talokah, zie Taloka. 



Talaga pagër, 20, 15 en 20. 

Tidung kalati, zie Tidung-galating. 

Tajung, heet als heiligdom Paramasaka- 
pura, 30, 82. 

Tojongrang, zie Tobong barang. 

Tanjung pura, 28, 22; voorts in den titel 
bhrc Tanjung pura. 

Tumasik, 28, 2:j. 

Tumapël, andere naam van Singasari, 5, 
ö; 9, 8 en volgg.; 10, 2 en volgg., 
11, 22 en volgg., 12, 9 en volgg.; 13, 
26 en volgg ; 14 15; enz.; ook in 
den titel bhreng Tumapël; heet als 
heiligdom Purwapatapan, 25, 4. 

Tugaran, 7, 30 en volgg. 

Tigawangi, heet als heiligdom Kusuma- 
pura, 30, 21. 

Tëgal ing Saöja, zie Sauja. 

Tëgal ing Sukamanggala, zie Sukamang- 
gala. 

Tëgal ing Lalatëng, zie Lalatëng. 

Tuban, 18, 26; 25, 6 en 7. 

Tiibong barang, var. Tojongrang, 29, i. 

Sinëlir {ivong — ), 17, 19 en volgg., mis- 
schien geen plaatsnaam. 

Sunda, 28, 17, 29 en volgg. 

Qunyalaya, een gedeelte van de kratm 
(?), 30, 1. 

Seran, 28, 22. 

Sarwajuapura, naam van Japan als hei- 
ligdom, 30, 2. 

Siring, 29, 5, misschen geen plaatsnaam. 

Qrnggarapura, var. van Qrn^gapura. 

Qrnggapura, var. Qrnggarapura, naam 
van Eapopongan als heiligdom, 27, 11. 

Sakëmbangan, var. van Pakëmbangan. 

Sukamanggala {légal ing — ) 5, 11. 

Siddhabhawana, 19, 16. 

Qala pënëk, 32, 28 (in den kolophon). 

Sëpang, 32, 12. 

Sa^eng, 27, 28 en volgg.; 28, 1 en volgg. 



— 223 — 



S^jabnng; heet als heiligdom Bajrajina- 

parimitapura^ 21, 26. 
Saya, 29^ 6, misschien geen plaatsnaam. 
Saüja (têgal ing — ), 4, 83. 
Samëngka, 31, 25; 32, e. 
Sagënggëng, 3, so en volgg.; 5, e. 
Sabyantara (= Bintara?), 32, 4 en 7. 
Singhasari, andere naam van Tamapël, 

13, 28; 14, 6; 19, i6. 
Singhapura, alleen in den titel bhretig 

Singapnra. 
Singhajaya, 31, 36 en as. 
Sungönëb ( = Sumënëp), 18, is; 21, 9 

en 11; 22, 1. 
Wirabhumi, alleen in den titel bhre 

Wirabhnmi. 
Wudi kuficir, 18, 13. 
Wi^nnpora, naam van Jinggan als hei- 
ligdom, 31, ]• 
Wi^nabhawana, 31, 35; vermoedelijk ge- 
lijk Wii^nubhawanapara. 
Wii^nubhuwana, 1, 11 en 15, de hemel 

waarin Wi^nu verblijf houdt. 
Wi^nubhawanapura, naam van Manar als 

heiligdom, 30, 20. 
Wayang, 5, 10. 

Wagal, plaatsnaam? in Pawagal, 2G, 9. 
Wëngkër, alleen in den titel bhreng 

Wëngkër, anjeneng ring Wéngkër. 
Wong sampflrna (mmidaleng — ), zie Jun 

watn. 
Lantaran, 31, 22; missehen een plaats- 
naam in Palantaran. 
Luki, var. Lnkih, 6, s. 
Lnkih, zie Luki. 
Lokërëp, heet als heiligdom Amarasabha, 

31, 26. 
Laki^mipura, naam van Pabangan als 

heiligdom, 30, 37* 
Lasëm, 26, 10; voorts in den titel 6Arei?^ 
Ifftftffm 



Lawor, 19, 15. 

Lawwang, var. van Lawang. 

Lawang, 1, e, misschien de plaats- 
naam. 

Lalatöng (tégal itig—), 2, 3 en 9. 

Lulumbang, 5, u en volgg., 6, 27 en 
volgg., 11, 11 en volgg. 

Lalangon, heet als heiligdom Parama- 
wigesapui-a, 31, 26. 

Lëjar, zie Rabut gunung Lëjar. 

Lamajang (lor, kidul lawan tigang juru), 
25, 16 en volgg., 26, 9. 

Lëmbah, 25, 26. 

Limbehan, 8, 5 en volgg. 

Lumbang katang, 18, 3; vermoedelijk 
hetzelfde als Katang lumbang. 

Lobëöcal, heet als heiligdom Parivati- 
gapura, 30, 23. 

Lêbak, 3, e en 9. 

Lung, heet als heiligdom Gori^apara, 

31, 14. 

Lungge, plaatsnaam ? in palungge, 25, 27. 
Pabang, 28, 22 

Pantarapurwa, zie Giripantarapnrwa. 
Panitikan, 8, 9, zie Rabut Këdung Pa- 

nitikan. 
Panawijen, 9, 19 en volgg., 10, 1. 
Pandan salas, alleeu in den titel bhreng 

Pandan salas. 

. . 

Pandakan, 20, 31 en volgg.; 21, 1 en 

Puri, 32, 5 en 19, vermoedelijk een ge- 
deelte van de hralon. 

Parwalisapura, var. van Parwatigapura. 

Parwatigapura, var. Parwatisapura, naam 
van Lobc'ücal, als heiligdom, 30, 24. 

Purwawi^esa, zie Adripurwawi^esa 

Purwapatapan, naam van Tumapël als 
heiligdom, 25, 4. 

Paramasukapura, naam van Tajung als 
heiligdom^ 30, 32. 



— 224 — 



Paramawifesapura; naam van Lalangon 

als heiligdom^ 31, 27* 
Pakémbangan, var. Sakémbangaii; alleen 

in den titel bhreng Pakëmbangan. 
Patangtangan (alas — ), 6, 6. 
Pustaka igunung — ), 8, 4. 
Palembang, 28; 23. 

Pajang, alleen in den titel bhreng Pajang. 
Pamotan, alleen in den titel Prame^wara 

ring Pamotan, en bhreng Pamotan. 
Pamalantënan; misschien geen plaats- 

naam, maar de naam van een gedeelte 

van een heiligdom, 5, 17. 
Pamélëkahan, 28, 13; misschien geen 

plaatsnaam. 
Pagnhan, alleen in den titel bhreng Pa- 

gnhan. 
Pabajangan, 2, 24 en 29, een plaatsnaam ? 
Pabangan, heet als heiligdom Laksmi- 

pura, 30, 36. 
Pangkur, 2, 1 en volgg.; 3, 3; 8, 21. 
Pangnlu (tir^fi^ — ), misschien geen plaats- 
naam, 29, 4. 
Panggih, heet als heiligdom Oiripantara- 

purwa of Giri Pantarapurwa, 29, 32. 
Datar, 21, 4. 
Dompo, 28, 22; 29, 15. 
Jon watn, 5, is; ook mandaleng wong 

sampflrna, 5, 14. 
Jawa {bhitmi — , nusa — ) 2, 6 ; 5, 9 ; 8, 17 

en volgg.; 14, 33; 21, 35; 22, 23; 

23, 24; 25, 17. 
Japan, heet als heiligdom Sarwajnapura, 

30, 2. 

Jipnt, 1, 3 en 4. 

Jajagu, 18, 12. 

Jambadwipa, 8, 26 en 32. 

Jagaraga, alleen in den titel bhreng Ja- 

garaga. 
Jinggan, heet als heiligdom Wi^nnpura, 

31, 1 en 32. 



Junggalnh, 24, 32. 

Mahibit, 18, 9 en lo. 

Mandana, 25, 30 en volgg.; 26 10. 

Mandala, zie Oran, Turyantapada, Wong 

sampürna, Lukih, Lébak, Bulalak, 

Bapa. 
Mnndung, var. van Eapundungan, 5, i. 
Matahnn, alleen in den titel bhreng 

Matahnn. 
Mataram, alleen in den titel bhreng Ma- 

taram. 
Malaya, 18, 25; 24, 27 en 29. 
Madara, 18, 19 en volgg.; 20, 25; 22, 

6 en volgg.; 23, 6 en volgg. 
Majapahit, gewoonlijk Majhapahit ge- 
speld, 23, 9; enz.; zie nog bij Trik. 
Manar, heet als heiligdom Wri^nabhawa- 

napura, 30, 20. 
Méméling, 19, 5. 
Manguntur, naam van een poort in de 

kraton 19, £o. 
Gantér, var. Kantër, 14, is. 
Ganding, 26, s. 
Gunin, 28, 21. 
Girindrapnra, misschien = giri Indrapura, 

naam van Êmbul, als heiligdom, 30, 2S. 
Gorigapura, naam van Lang als heiligdom, 

31, 16. 
Giripantarapnrwa, misschien = giri Pan- 
tarapurwa, naam van Panggih als 

heiligdom, 29, 33. 
Bnntal, 19, 26. 
Batur, 6, 23. 
Bali, 28, 22. 
Bnlalak, 1, 4 en 5. 
Bapa (mandaleng — ) 7, 12 en volgg., 

andere naam van Turyantapada. 
Badandër ('t tegenwoordige Dandër?), 

26, 20 en volgg. 
Bs^rajinaparimitapnra, naam van Siga- 

bong als heiligdom, 27, 26. 



— 225 



Bhayangkara, naam vau een poort iu de 

kraton, 24, 23; 26^ 17, 19 en 33. 
BaÜjar Kocapet, 6, 27. 



Bubat, 26, 2; 28, 29; 29, 1 eu 8. 
Boboji, naam van een tuin, 10, i 
Batil, 15, 13 en volgg. 



VcrL Öat. Oea.> .Iccl XLTX. 



lü. 



REeiSTER 

DER IN DK PARARATÖN VOÖRKÖSIIiNDE PERSOONSNAMEN, 

ffcratigscinkt volgens liet Javaansclie alphabel. 



*^ 



Anusapati, zie Nusapati. 

Éndok (Keu — ), moeder van Rajasa (Ken 
Angrok), wiens vader Bhatóra Brahnia 
was, de vrouw van Gajali para, 1,20 — 
2,20; en van Lenibong, 2,20 — ••>,*. 

Anabrang, zie Kelx) — . 

Anëngah (Sang apaüji — ), zie NuRai)ati. 

Oran anuuidahwj — ), 5, -20. 

Arok, = Angrok, zie Rajasa. 

Ardhanartt;wari, 10. 35, naar alle waar- 
schijnlijkheid niet als eigennaam be- 
doeld, zie nog Narigwari. 

Arya, zie Ralin, Tilani, Tadah, Sëntong, 
Siddhi, Wiraraja. 

Aragani (Sang apaüji — ), ook Këbo tö- 
ngah, pntilt tijdens Körtanagara (riwa- 
biiddha), 18, 22 — 19, 19. 

IJrang, zie Siring, Saya, Tobong barang, 
Péngulu. 

Ikalikalan bang. krijger van Maja])ahit 
tijdens Jayanagara, 2G, 1 en 7. 

Hasin (üewi--), echtgenote (of jongere 
zuster) van Oangdang gëndis, 13, 29. 

Usus (Tuhan — 1, Sundanees, tijdens Ra- 
jasanagara (Ilayam wuruk). 21), 4 
en 8. 

Apaïiji, ook Panji, zie Anëngah, Aragani, 
Kunal, Kénengkung, Kuncang, Toh- 
jaya, Saprang, Sudhatu, Patipati, Ma- 
rajaya, Mölong, Bawak. 

Aji, zie Ratnapangkaja, Wikrama, Jaya 



katong, Mantrolot. 

Hijo, zie Köbo — . 

Hayam wuruk ((^ri — ), zie Rajasanagara. 

llyang, zie Suksma, Guru. 

Hyang (Blira — ), geheel onzekere per- 
soon, tijdens Bhre Tumapël IV, 32, 5. 

Hyang Wfkasing sukha 1 fBhra— Kzie 
Rajasanagara. 

Hyang Wékasing sukha II (Bhra — ). 
zoon van Hyang Wi^esa (Aji Wikrama i 
en Bhre Lasëm 1, 29, 22, f 1321, 30, 31. 

Hyang Wi^esa (Bhra — ), ook Raden 
Gagak sali, en Aji Wikrama. zoon van 
Bhre Pajang 1, 29, 20, en schoonzoon 
van Rajasanagara (Hayam wuruk i, ge- 
liuw<l met diens dochter Bhre Lasëm 
1, de schoone, 29, 21, en met Bhre 
Mataram I, 30, jo: vader van Hyang 
Wékasing sukha II, 29, 22, Bhre Tuma- 
pël 11 (fl), Dewi Suhita (deprabhu istri 
II) en Bhre Tumapël Ili (6) (Kërtawi- 
jaya), 30, 3; prahhu van Majapahit, Qaka 
1311 — 1322, 30, 26—30, 34; wordt 
hhngairan. 30, 31 ; neemt de regeeriug 
later blijkbaar weer op, 31,3 — 31, 
15: t 1351, 31, 20. 

Hyang Purwawi^esa (Bhra — ), ook Bhre 
Wëngkër III, prahhu van Majapahit, 
Caka 1378 — 1388, 32, is- 32, 20. 

Hyang P«iramefwara II (Bhra — \ zie 
Ratnapangkaja. 



— 227 — 



IJmsL, variaut van Uman^. 

Amandala, zie Orau, KapunduugaU; Tn- 

ryantapada, Lukih^ Lëbak; en Bulalak. 
Amürwabhfimi (Bhatara sang — ), zie 

Rajasa. 
Amisani (Devvi — ), echtgenote (ofjongere 

zuster) van Daugdang göndis, 14, 29. 
Ampal, zie Lëmbii — . 
Amaïïeanagara, 26, 26 = Aniangkubumi, 

bedoeld is Arya Tadah, zie onder 

Tadah. 
Umang (Ken — ), var. Uma, gehuwd met 

Ken Angrok (Rajasa), 13, g; moeder 

van Panji Tohjaya, Paüji Sudhatu, 

Twan Wërgola en Dewi Kanibi, 13, 

9 en volgg. 

Amangkubhumi (palih — ), zie Arya Ta- 
dah en Gajah mada. 

Agnibhaya, zoon van Ken Angrok (Ra- 
jasa) en Ken l.)ëdës, 13, c. 

Angrok (Ken — ), zi<; Rajasa. 

Ingët, zie Gagak — . 

Ënggon, zie Gajah — . 

Angabhjiya {ntltt — ), zie Narasingha, 18, 
7; en Narapati, 31, 13. 

Nini, zie Panitikan. 

NartQwari, 10, 14: naar alle waarschijn- 
lijkheid niet als eigennaam bedoeld, 
zie nog Ardhanari^wari. 

Narasingha (Bhatara — ), ook Mahisa 
Tanipaka, zoon van Mahisa Woog atè- 
léng, IG, 18: vader van Raden Wijaya 
(Kërtarajasa) 18, 15; rnfti angabhayn, 
18, 7. 

Narapati (Bhra — ), ook Kaden Gajah, 
ralu amjabhayaj 31, 12; verslaat Bh re 
Wirabhumi, 31, 13; in 1355 gedood, 
omdat hij Bhre Wirabhumi had gedood, 

31, 32. 

Nusapati ot Anusapati, ook Panji Anë- 
ngah, zoon van Tunggul amëtëng en 



Ken üëdës, 13, 2; 15, i; vader van 
Wisnuwardhana (Rangga wuni), 16, ie; 
ratu van Tumapël, Qaka 1170—1171, 
15, 27—16, 14; t 1171, 16, u. 

Nambi, zoon van Wiraraja, 19, u; 20, 
29; 22, 28 en 39; 23, 35; patih tij- 
dens Jayanagara, 25, is; gaat naar 
Wiraraja in Lamajang, 25, 23; staat 
op, 25, 26 en 29 en volgg. 

Nangka (Imynling — ), vennoedelijk Wi- 
raraja, zie daar. 

Cahot, zie Rangga — . 

Cucupuranti, dochter van Bango sampa- 
ran en Tirthaja, 3, 26; huwt met 
Wangbang Sadang, 14, 5. 

Cakradara (Raden — ), gemaal van Bhre 
Kahuripan II, vader van KSrtawar- 
dhana, 27, u en ie. 

Campaka, zie Mahisa — . 

Ra (verkorting van sira), aangetroffen 
voor Këmbar, Kuti, Tanca, Tosan, 
Sëmi, Windan, Warak, Wëdëng, Lin- 
tang, Pang(^a, Jalu, Jangkung, Yuyu, 
Made, Galatik, Baiiak, Tati. 

Rahu (Arya — ), tijdens Bhre Kahuripan 
II (prahlm isfri I), 28, 19. 

Randi, zie Mahisa — . 

Raden, zie: Cakradara, Kudamërta,Tetep, 
Sotor, Sumana, Sumirat, Wijaya, La- 
rang, Jagulu, Gajah. 

Ratu, zie Angabhaya, Sunda, Maharaja, 
Rajasa, Nusapati, Tohjaya, Wisnu- 
wardhana, Bhre Daha IV, Mantrolot. 

Ratnapangkaja (Aji — ), ook Bhre Ka- 
huripan IV, BhraHyangParame^wara 
II, zoon van Bhre Pandan Salas I, 

30, 6; huwt met een prahhu istri (óf 
Dewi Suhita, of Bhre Daha IV), 30, 
6; met Bhre Jagaraga I, 30, 34; f 1368, 

31, 35. 

Rajasa (Qri — ), Ken Arok of Ken Ang- 



228 — 



rok. Koon van Keu Ëndok en HUatara 
Brabma 1^ 17 volgg.; aangenomen zoon 
van Bhatara Guru, 8, ao : incarnatie van 
Bhatara Wisnii 8, ;jo: ook geheeten 
Bbatara (jruru. 8, 23: 14. 13; en Sang 
Auifirwabbünii 13, 29 en volgg.; wordt 
als kind aangenomen door Lembong, 
2, 27» door Bango samparan en Gënuk 
bnntiu 3, 19, en 27 ; door den amanda- 
leng Kapundungan, 5, 28; door Mpu Pa- 
lot, 7, 11; door Lobgawe, 8, 24 en volgg.; 
doodt Tunggul amëtung, 12, 2i;buwt 
met Een Dëdës, 12, 32 en volgg.: en 
met Ken Umang (of üma) 13, g: vader 
van >fabi8a Wong atëlëng, Panji Öa- 
prang, Agnibhaya, Dewi Rimbu, Panji 
Tobjaya/Paüji Sudbatu. Twan Wërgola 
en Dewi Rambi: raiu van Tumapël, 
Caka 1144—1169, 13, 12--15, 28: 
t 1169, 15, 2ü. 
Rajasa (m;ow</— ), 17. jy en volgg. (mis- 
scbien een partijnaam tijdens Tobjaya). 
Kajasanagara (Cri — j, ook Bbatara pra- 
bbu, Qri Hayam wumk, Raden Tetop, 
daiang Tritaraju, Pagër antimun, Ga- 
gak katawang, Mpu Janeywara, Bbra 
(sang) Hyang Wëkasing sukba I, 27, 
19 en volgg.; zoon van Bbre Kabu- 
ripan II. 27, 19; vader van Bbre Lasëni 
I en Bbre Wirabbumi 29, is en 19: 
prd)hn van Majapabit. Caka ? — 
1311, 28, 29 — 30, 25; t 1311,30,25. 
Ilajasawardbana, ook Bbre Pamotan II. 
Bbre Kling II en Bbre |Kaburipan V, 
voorts nog Sang Sinagara, vader van 
Bbre Kaburipan VI. Bbre Mataram 
[1, Bbre Pamotan III, en Bbre Kër- 
tabbnmi, 32, 23 en 24; prahhu van 
Majapahit, Qaka 1373—1375, 32. 11— 
32, 13. 
Rambi (Dewi — ), doebter van Ken Ang- 



rok riiajasa) en Ken l'mang, 13, u. 
Kimbu{Dewi- ), doebter van Ken Angrok 

(Rajasa) en Ken Dëdës, 13, 7. 
Raganatba (Mpu -- ), />f7///< tijdenn Kér- 
tanagara ((.'iwabuddba ). is, 20. wordt 
iidbiinksn te TumapM, IS. im \\), \. 
Rubub, zie Mabisa --. 
Rangga cabot, Sundauecb, tijdens Kajasa- 
nagara (Hayam wuruk) 19, 4. 
Rangga kawcni, Sundances, tijdens Ra' 

jasauagara (Hayam wurukj, 29, 5. 
Rangga wuni, zie Wi^nuwardbana. 
Rangga lawe, tijdens Kërtanagara 1 (Jiwa- 
buddba;, volgt Raden Wijaya TKërta- 
rajasa), 19, lo en .'io; 20, 29: 21, 17 
t»n 20 : 22, 28, 32 en 39 : 23, r> en 37 f 
24, 25 : staat onder Jayanagara op, 
omdat bij geen ftatih wordt, en trekt 
zieb naar Tuban terug, 25, h en volgg. 
Ki, zie Uërpana, Tëgub, Wirot, Lembong. 
Kaburipan I (Bbre — ), doebter van Kër- 
tanagara, gebuwd met Körtarajasa ( Ra- 
den Wijaya j, moeder van Bbre Ka- 
buripan II (Vj, 19, 37 en volgg.: 24, 37. 
Kaburipan 11 (Bbre — ), doebter van 
Kërtarajasa (Raden Wijaya). gebuwd 
met Kaden (^akradbara, moeder van 
Kajasanagara (Hayam wuruk), i^en 
ongenoemde doebter, Bbre Pajang 
I en Bbre Tumapöl I, pnihhtf van 
Majapahit, Vaka V2oi)-- ? . 27, u— 
28, 28; priMfi i'^iri 1. f 1293 (?), 29, 32. 
Kaburipan Hl (Bbre— i, doebter van 
Bbre Pajang I, 29, 23; gebuwd met Bbre 
Pandan salas 1, 29, 20: t 1-^23, 30, 37. 
Kaburipan ]\ «Bbre - i, zie Katna|)ang- 

kaja. 
Kaburipan V iBbrr--, anjènmii iiuj ), 

zie Rajasa wardbaiia. 
Kaburipan VI 1 Bbre - ), spruit van 

Riyasawardbana, 32, 28. 



229 — 



Ken, zie Ëndok, Umaüg, Angrok, Dëdes. 

Kanaka (Tuhan — ), patih vau Majapahit, 
Qaka 1335— 1.%2, 31, 20: 31, 30. 

Kunal (Paöji — ), zoon van Bango sani- 
paran en Tirthajn, 3, 25. 

Kénengkung (Panji — ), zoon van Bango 
samparan en Tirtliaja, 3, 26. 

Keri (ra — ) (?), 2(\ is (in den variunt), 
in plaats van Kuti. 

KlSrtanagara ((^ri— j, zie (Jiwabudha. 

Kërtarajasa (Qri ■— ), ook Raden Wijaya, 
zoon van Mahisa Cjimpaka (Bhatara 
Narasingha) 18, 15; zijn lotgevallen vóór 
hij koning wordt, 19, 9 — 24, 33: ge- 
huwd luet de dochters \im Kertanagara 
((^Hwabuddha), Bhre Kahuripan I en 
Bhre Daha 1, en met Dara pëtak, 24, 
28 en 36; vader van Kala g-ëniët (Ja- 
yanagara), 24, 28, Bhre Kahuripan 11 
(Jayawi§nuwardhani, prahhu Lsfri I) en 
Bhre Daha II, 27, 13 en volgg. vergl. 
met 27, T; stichter en prahhu van 
Majapahit, Qaka 1216—1217, 24, u- 
25, 2; t 1217 (zoo te lezen in plaats 
van 1257), 25, 2. 

Kërtawardhana, ook Bhre Tumapel 1. 
zoon van Cakradhara, 27, 17. vader 
van Raden Sotor, 29, 24, f 13U«, 30, 1. 

Kërtawijaya 1. ook Bhre Tumapèl III 
(lf)j zoon van Bhra Hyang wigesa (Aji 
Wikrania), 30, 4, 5 en e, misschien 7 
en 11, verder 31, e, s, 10 en 24; huwt 
met Bhre Lasëm III, 30, 7 V; met Bhre 
Lasëm IV, 30, n?; en Bhre Daha III, 
30, 8; vader van Bhre Wëngkër 11, 
Bhre ragulmn 11, Bhre Jagaragn I, 
Bhre Taujung pura, Bhre Pajaiig 11. 
en Bhre Këling 1, 30, 12, 13. ueiiis; 
t 1349 (?), 31, 24; uit den naam 
Kërtawijayapura, bl. 32, lu, is mis- 
schien af te leiden, dat de Bhre Tu- 



mapël IV, die (>ka 1369—1373 
firabhu van Majapahit was, 32. 1 - 
32, 10, den na^m Kërtawijaya droeg: 
alsdan zou deze Bhre Tumapël IV, 
dezelfde kunnen zijn als Bhre Tuma- 
pël III (/;), en deze dus niet gestorven 
zijn in (Jaka 1349, 31. 24, voor welke 
plaiits dan zijne broeder Bhre Tumapël 
Il (//) in nanmerking zou komen, wat 
wederom onzeker zou maken wie be- 
doeld is 31, G, s en 10. 

Kërtawijaya II, naam van Bhre Tumapël 
1 V, afgeleid uit Kërtawijayapura, 32, 10. 

Kërtabhumi (Bhre -- ) zoon van Rajasa- 
wardhana, 32, 24. 

Koripan, zie Kahuripan. 

Karuman (malnmlamjinfi — \, 3, u en volgg. 

Kuda, zie ook Jaran. 

Kudamërta (Kaden — ), zie Wijayarnjasa. 

Kita, var. van Tita. 

Katawang, zie Gagak — . 

Katong, zie Jaya katong. 

Kaweni, zie Rangga — . 

Kala gëmët, zie Jayanagara. 

Këliiig 1 (Bhre — ), zoon van Bhre Tu- 
mapël III (l)) (Kërtawijaya), 30, I6, 
huwt met Bhre Këmbangjënjir, 30, ir,. 
t 1369, 31, :.6. 

Këling II (Bhre , nh'n'ntmii iiuj — ;, zie 
Rajasawardhana. 

Kapundungan (anmudalen\) — ), pleegva- 
der van Ken Angrok (Rajasa), o, 27 
volgg. 

Kapuk, zie Banak — . 

Kaping, zie Macan -. 

Kuüca, var. van Kuneang. 

Kuneaug (Panji - 1. zoon van Bango 
samparan en Tirthaja, ;>, 25. 

Këmbar Tm --). opstandeling, 28 2, 4, 0, 
9, 10, 11 ; (Vtihrlcêl imj maf 1 In araramau, 
28, 17 ; 28, 24; 28, 28. 



230 — 



Kömbang jënar (Blirc — ). liuwt met 
Bhre Ki^JIng I, 30, 16. 

Kébo^ zie ook Mahisa. 

Kébo anabrang, tijdens Jayauagara, 25, 22. 

Kttbo hijo, gunsteling van ïunggul amë- 
tung, 12, 10 en voli^g. : vader van 
Mahisa randi, 12, 30. 

Këbo tëngah, zie Aragaui (Panji -). 

Këbo mandarang, pafih van Dalia, onder 
Jayakatong, 19, 17 25, 19, 25 en 27; 
22, 9, 31 en 39: 23, 33 en volgg. 

Kabalan (Bhre — ), dochter van Bhre 
Wëngkër II, 30, 17, y 1373, 32, 5. 

Kabalon (buf/ufinff — ), bezitter van de 
dimrmahahmnasiddhi, T), 2y. 

Kuti (rn — ), opstundeling tijdens .laya- 
nagara, 2i\. 12 en volgg. 

Uaha {vahi imj — \, zie Dangdang gëiulis, 
Jaya katong. 

Daha I (Bhre — ), dochter van Kërtana- 
gara, gehuwd met Kërtarajasa ( Kaden 
Wijaya), 19, 37; 24, u, 

Daha II (Bhre — ), dochter van Kërta- 
rajasa (Kaden Wijaya), 27, 15 vergl. 
met 27, j ; gehuwd met Kaden Kn- 
damërta (Wijayarajasa) 27, 15; moe- 
der van Paduka Tori «?): t 1293(y), 
29, 31. 

Daha III (Bhre — ), dochter van Bhre 
Pandan salas I (Kaden Sumirat). 3(.), s; 
huwt met Bhre l'nmapël III (h\ 30, e. 
t 1338, 31, 21. 

Daha IV (Bhre - 1, gehuwd <?; met 
Bhre Korii)anIV(Hyang Paranie^wara 
II, Uatnapangkaja ), /nnhlnt van Maja- 
pahit, Vaka 1359— 13Ü9, 31, 211— 31, 
38; t 1369, 31, 3:. 

Daha V (Bhre — ), onzekere persoon 
tijdens Ilyang Purwawige^, 32, 18. 

Daha (Bhre — ), 29, m, onzeker wie be- 
doeld is. 



Daha (Bhre — ), 31, 10, onzeker wie be- 
doeld is. 
Dërpana (Ki--), volgeling van Nambi, 

als deze opstaat, 25, 34; 2G, 4. 
Dara pëtak, prinses uit Malayu, gema- 
lin van Kërtarajasa (Raden Wijaya), 
24, 28; moeder van Jayanagara (Ka 
la gëmët), 24, 35. 
Dara jingga, prinses uit Malayu, 24, 29, 
huwt met een dewa, of met «dewa, moe- 
der van Aji Mantrolot, 24, 19; tijdens 
Kërtarajasa (Kaden W^ijaya). 

Dewi, zie Hasin. Amisani, Kambi. Su- 
hita, Paja. 

Dëmang, zie Bueang. 

Dangdi, tijdens Kërtanagara ((.-iwabud- 
dha), volgt Kaden Wijaya (Kërtarajasa i 
19. 11 en 13: 22, 28. 

Tuhan, zie Usiis, Kanaka, Tita, Sohan, 
Sahaja, Wuruju, Wërgola, Janaka, 
Gëmpong. 

Tohjaya (Panji — ), zoon van Kajasa (Keu 
Angrok) en Ken Umang, 13, 9; doodt 
Nusapati, 15, :8 — 16, 11; miu van 
Tumapël, (;aka 1171-^1172, 16, 15— 
IS, 4; r 1172, 18, 4. 

Tritaraju {dalnmj — ), zie Kajasanagara. 

Tirthaja, 2c vrouw van Bango samparan, 
moeder van Panji Bawuk, Paiiji Kuü- 
cang, Paiiji Kunal, Paüji Kënengkung, 
en Cucupuranti, 3, 2l 

Terewes, zie Jabung — . 

Turyantapada {mandalenfj — ), zie Mpu 
Palot. 

Tita (Tuhan — ), zoon van Tuhan Sa- 
haja, vriend van Ken Angrok (Kajasa). 
:>, 30 en volgg. 

Tatar irnlu—), 23, 1. 

Tetep (Kaden — ), zie Kajasanagara. 

Tëtëg ipalih — ), krijger van Majapahit, 
onder Kajasanagara, 29, 11. 



— 231 — 



Tosan (ra — ), volger van Ranggalawe, 
als deze opstaat^ 25, 9. 

Tawan^ zie Tuhan. 

Tilam (Arya — ), palih van Daha, tij- 
dens Jayanagara ^26, 34. 

Tipar^ tumênggnng tijdens Jayanëgara, 

25, 19. 

Tapawangkéng (Mpu — ), smuf ahahiring 
Bnlalak, 1, 5, 7^ lo, 13 en 15. 

Tadah (Arya — ), palih (amafigkiéhumi 
of atnancanagara) van Majapahit, van 
gaka 1241 — ? (vóór of in 1268), 

26, 25 en volgg.; 27, 27; 28, 27. 
Tojongrang, var. van Tobong barang. 
Tanca I, opHtandeling tijdens Jayaua- 

gara, 26, 13. 
Tanca II, steekt Jayanagara overhoop 

27, 4 en volgg. 

Taöjungpura (Bhre — ), dochter van Bhre 
Tamapël III (h) (Kërtawijaya), 30, u, 
huwt met Bhre Paguhan II, .30, 15. 

Tumapèl {snntj nimwu rinif — ), zie Tiing- 
gul amêtang. 

Tumapël I (Bhre — ), zie Kértawardhana. 

Tumapël II (a) (Bhre — ), zoon van Bhra 
Hyang wi^esa (Aji Wikrama), 30, 3; 
sterft vermoedelgk jong, daar hij een 
broeder van deuzelfden naam (titel) 
heeft, van hem hier met de letter b on- 
derscheiden, óf overlijdt in Qaka 1349, 

31, 24, zie onder Kërtawijaya I; mis- 
schien is hij ook de gemaal van Bhre 
Lasëm III en Bhre Lasëm IV, 30, 7 
en 11. 

Tumapël III (h) (Bhre—), zie Kërta- 
wijaya I. 

Tumapël IV (Bhre — ), misschien ook 
Kërtawijaya (II) geheeten, prabhu van 
Majapahit, (Jaka 1369-1373,32,1 — 

32, 10; zie nog onder Kërtawijaya I. 
Tumapël V (Bhre - , mijémmj ing — ), 



zie Bhre PandaM salas III. 

Tëguh (ki — ), volgeling van Nambi, als 
deze opstaat, 25, ss; 26, 5. 

Tugaran (buyul ing — ), 7, 80, tegen wil en 
dank schoonvader van Ken Angrok 
(Rajasa), 7, 33. 

Tobongbarang (urang saking), var. Tojong- 
rang, Sundanees of Sundaneezen, tij- 
dens Rajasanagara (Hayam wurnk), 
29, 4. 

Tëngah, zie Këbo — . 

Tunggul amëtung, sang ahiwu ring Tu- 
mapël, 5, 6; huwt met Ken DëdÖs, 9, 
22 en volgg.; vader van Anusapati, 
13, 2; 15, 1; door Ken Angrok (Ra- 
jasa) gedood, 12, 21. 

Sohan (Tuhan — ) I, Sundanees, tijdens 
Rajasanagara, (Hayam wuruk), 29, 3. 

Sohan (Tuhan — ) II, Sundanees, tgdens 
Rajasanagara (Hayam wuruk), 29, 4. 

Suhita (dewi), var. Sutita, prabhu istri 
II, dochter van Hyang wi^e^a (Aji 
Wikrama), gehuwd (?) met Ratna- 
pangkaja (Bhre Koripan IV, Bhra 
Hyang Paramo<,*wara), 30, 0; prabhu 
van Majapahit. (jaka 1322—1351, 30, 

35 — 31, 28, t 1351, 31. 28. 

Sahaja (Tuhan — \ buyut ing Sagëng- 
gëng. vader van Tuhan Tita. 3, 30 
en 32. 

Sinëlir [woug — ) 17, 19 en volgg., mis- 
schien een partijnaam tydensTohjaya. 

Sunda (ratu — ). zie Maharaja. 

Sunda (imiri ing — ), 28, 29 en volgg., 
tijdens Rajasanagara (Hayam wuruk). 

Sinagara, zie Rajasawardhana. 

Sënteng, var. van Sëntong. 

Sëntong (Arya — ), var. Sënteng, krijger 
van Majapahit, tijdens Rajasanagara 
(Hayam wuruk), 29. 10. 

Qri: Hayam wuruk, Rajasa, Rajasanagara, 



— 232 



Kértanëgara, Kërtarajasa, Marmadevva, 

Wijayarajasa. 
Sora, tijdens Kërtanagara ((jivvabiiddha), 

volgt Kaden Vi^ijaya ( Kërtarajasa) 19, 

11 : 19, 30 en volgg.; de hoofdpersoon 

onder zijne getrouwen, bl. 19 en volgg.: 

(iémumj tijdens Jayanagara, 25, lo: 

zijn dood, 25, 22. 
(;ori (Paduka — ), dochter van l^hra 

PrameQvvara l (Wijayarajasa) en Bhre 

Daba II, gemalin van Kajasanagara, 

moeder van Bhre Lasëm I, (de schoone), 

29, 18: t 1311, 30, 22. 
Siring {uranij — ;, Sundanees of Sundanee- 

zen, tijdens Kajasanagara (Hayam wn- 

ruk), 29, 5. 
Suksma (Hyang- ), l, 1. 
Sakëmbangan. var. van Pakëmbangan 

(Bhre — ). 
Sada, variant van Sadang. 
Siddhi CArya — ), volger van Hangga 

lawe, als deze opstaat, 25, «. 
Sudhatu (Panji— ), zoon van Ken 

Angrok (Bajasa) en Ken Umang, 13, 9. 
Satrajali, Sundanees, tijdens Hajasana- 

gara (Hayam wuruk), 29. 5. 
Sutita, var. van Suhita. 
Sotom, var. van Sotor. 
(.iiwabuddha (Bhatara — i, ook Kërtana- 

gara, zoon van Wi^nnwardhana Hlang- 

ga wnni), 18. 11: en vader van Bhre 

Kahnripan I (»n Bhre Daba l,prahhu 

van Tumapël, (Jaka 1194-1197, 18. 

13 — 19, 20: bijgezet, 25, 4. 
Sali, zie Oagak -. 
Saprang (Sang apanji - -), zoon van Ken 

Angrok (Bajasa) en Ken Dëdës, 13, 5. 
Sadang ( \Vang])ang — ), var. Sada, zoon 

van Danghyaug Lobgawe. 14, t. lunvt 

met Cucupuranti. 14. 5. 
Saya {urnng — ), Sundanees of Snnda- 



nezen, tijdens Rajasanagara, Hayam 

wuruk), 29, 5. 
Sëmi 1 (ra — ;, opstandeling tijdens Ja- 

yanagara, 2(>, 10. 
Sëmi II (rn — ), opstandeling tijdens 

Jayanagara, 26, 1.1. 
Sumana (Raden -), zie Bhre Paguhan 

I, 27, 25. 
Samara, volgeling van Nambi, als deze 

opstaat, 25, 34; 26, 4. 
Sumirat (Raden—), zie Bhre Pandan 

salas I. 
Samparan, zie Bango — . 
Sagënggëng (huifuf inq —), zie Tuhau 

Sahaja. 
Sagënggëng {hhujangganmj — ), zie Jaiig- 

gan. 
Sotor (Raden — ), var. Sotom, zoon van 
Bhre Tumapël 1 (Kërtawardhana) hi- 
nn rimj Koripan, himvetifi Daba, hino- 
rinfi Majapabit: 29, 24, vader van 
Raden Sumirat (Bhre Pandan salas T), 

— «'. Ad» 

Singapura. (Bhre --), dochter van Bhre 
Paguhan 11, 30, is; huwt met Bhre 
Pandan salas II, 30, ig. 

Waha, zie Jaran — . 

Wuni. zie Kangga — . 

Windan (ra — ). volger van Nambi, als 
deze opstaat. 25, 35; 26, 5. 

Wiraraja (Arj'a — ), huyul ituj Nangka, 
ook Baiiak wide, 18, 17, tijdgenoot 
van Kërtanagara (^iwabuddha), wordt 
adinpati van Sungëneb (SumënÖp), 18, 
17; vader van Nambi, 19, u; speelt 
een dubbelzinnige rol tegenover Kër- 
tanagara, 18, 30 volgg.; ontvangt Ra- 
den Wijaya (Kërtanagara) en geeft 
hem goeden raad, 21, 12 en volgg.; 
deze spreekt met hem af later Java 
met hem te zullen deelen, 21, 85; is 



— 233 — 



eigenlijk de man in het complot tegen 
Jaya katong gesmeed, 22, 2 en volgg., 
id. tegen de Chineesche expeditie, 23, 
18; verhuist naar Majapahit, 23, ss; 
krijgt Lamajang lor kidnl en de tigang 
jnru, 25, is; zijn dood in Caka 1229 (?), 
22, 87. 

Warak (ra — ), tijdens Bhre Kahnripan 
II {prahhu istri D, 28, 28. 

Wirot (Ki — ), tijdens Kértanagara (Qi- 
wabnddha), volgt Raden Wijaya (Kër- 
tarajasa), 19, 12 ; volgt Nambi, als deze 
opstaat tydens Jayanagara, 25, s5; 
26, 4. 

Wurujn (Tnhan — ), dewapntra, tijdens 
Bhre Kahnripan II (prahhu istri I), 
28, 18. 

Wörgola (Tnhan — ), zoon van Ken 
Angrok (Rajasa) en Ken Umang, 13, 10. 

Wirabhnmi (Bhre—), zoon van Rajasa- 
nagara (Hayam wnrnk), als kind aan- 
genomen door een Bhre Daha, hnwt 
met Bhre Lasëm II, de dikke, 29, 19 
en 23; vader van Bhre Pakëmbangan, 
Bhre Mataram I, Bhre Lasëm IV, en 
Bhre Matahnn, II, 30, 9, 10 en 11; 
vorst over het oostelijke rijk (Balam- 
bangan?), zyn strijd met Bhra Hyang 
Wi^esa, 31, 3 en volgg.; f 1328, gedood 
door Narapati (Raden Gajah), 31, 13. 

Wikrama (Aji — ), zie Hyang Wi^esa. 

Wekasing snkha I (Bhra Hyang — ), zie 
Bajasanagara. 

wekasing snkha II (Bhra Hyang — ), 
zie Hyang Wekasing Snkha II. 

WëdÖng (ra — ), opstandeling tijdens Ja- 
yanagara, 26, 13. 

Wiffnn (Bhat&ra — ), heeft zich in Ken 
Angrok (Riyasa) geincameerd, 8, so 
vol^.; dit ook af te leiden nit, I, i en 17. 

Wiffnnwardhanay ook Rangga wnni, 

▼«k Bit Gtm., tel XLIJL, 



zoon van Annfapati, en Vader van 
Kërtanagara (Qiwabnddha), 18, u; ratu 
van Tnmapél, Qaka 1172—1194, 18, 
5 en volgg. ; f 1194, 18, 11. 

WiQe^ zie Hyang Wiigefa. 

Walnngan, zie Mahi^a — . 

Wide (Ba&ak — ), zie Wiranga. 

Wadeng, var. van Wëdëng. 

Wgaya (Raden — ), zie Kërtar^jasa. 

Wijayari^asa (Qrt— ), ook Raden Kn- 
damërta, Bhre Wëngkër I, Bhre Pra- 
mifwara I, Bhre Pamotan I, gemaal 
van Bhre Daha II, vader van Padoka 
Qori, 27, u, 16, 18 ; t 1310, 30, 19. 

Wagal, een persoonsnaam (?), af te leiden 
nit pawagal, tgdens Jayanagara, 26, 10. 

Wong atëlëng, zie Mahi^a — . 

Wëngkër I (Bhre — , aHjenêng ing — ), 
zie Wgayarqasa. 

Wëngkër n (Bhre — , aüjênéng ring -— ), 
zoon van Bhre Tnmapël III (h) (Kër- 
tawijaya), 30, 12; gehnwd met Bhre 
Matahnn II, 30, 12; vader van Bhre 
Kabalan, 30, 17; f 1351, 31, 26. 

Wëngkër m (Bhre—), zie Hyang Pur- 
wawiQOsa. 

Wangbang, zie Sadang. 

Lohgawe (dang hyang — ), var. LiOgawe, 
brahmaan uit Jambndwipa, Wi^nniet, 
de eerste brahmaan beoosten den 
Kawi, pleegvader van Ken Angrok 
(Rtyasa), 8, 24 volgg.; vermoedelijk 
zgne purohitay als hij koning is ge- 
worden, 12, 81; vader van Wangbang 
Sadang (var. Sad&), 14, 4. 

Lintang (ra — ), volger van Rangga la we, 
als deze opstaat, 25, 9. 

Larang (Raden — ), zie Bhre Matahuo I, 

27 23. 

Larang agnng, Snndanees, tgdens Rajasa- 
uagara Hayam wamk), 29, 2. 

16«. 



— 234 — 



Luki {mandalmg — ), var. Lnkih^ fautor 
van Ken Angrok (Rajasa), 6, 8 volgg. 

Lukih^ zie Luki. 

Lasëm I (Bhre — ), de schoone, dochter 
van Rajasanagara (Hayam wurnk) en 
Paduka Qori^ gemalin van Bbra Hyang 
Wi^esa (Aji Wikrama), moeder van 
Bhra Hyang Wëkasing sukha II, 29, is 
en 21 ; t 1323, 30, 36. 

Lasèm II (Bhre — ), de dikke, dochter 
van Bhre Pajang I, gehuwd met Bhre 
Wirabhumi, 29, 22; t 1323, 30, 37. 

Lasëm III (Bhre — ), dochter van Bhre 
Pandan salas 1, 30, 7; gehuwd met 
Bhre Tumapël III (6) (Kërtawijaya) 
of met Bhre Tumapël II (a), 30, 7; 
t 1355, 31, 31. 

Lasëm IV (Bhre — ), dochter van Bhre 
Wirabhumi, 30. n; gehuwd met Bhre 
Tumapël III (6) (Kërtawijaya) of met 
Bhre Tumapël II {a), 

Lawe, zie Rangga — . 

Lnlumbang {apande fmsi ring — ), zie Mpu 
Gandring. 

Lëjong, zie Jaran — . 

Ijëmbu ampal, tijdgenoot van Tohjaya, 
16, 28 en volgg. 

Lëmbu pëtëng, krijger van Majapahit, 
tgdens Jayanagara, 26, 1 en 7; tij- 
dens Bhre Kahuripan II (prabhu istri 
ï), 28, 19; (tutïiétiggung), 28, 26; wel- 
licht dezelfde als Pëtëng, zie daar. 

Limbehan (buyut ing — ), fautor van Ken 
Angrok (Rajasa), 8, 5. 

Lëmbana, zie Gajah — . 

Lembong (Ki — ), man van Ken Ëndok, 
en pleegvader van Ken Angrok (Ra- 
jasa), 2, 23 — 3, 10. 

Logawe^ var. van Lohgawe. 

Lëbak (mawlaleng — ), 3, 6 en 9. 

lingganing pati {sang — ), tgdens Wi«nu- 



wardhana tenondergebracht, 18, 10. 

Pu, zie Mpu. 

Pinatih (Ken—), een titel, geen eigen- 
naam, de vrouw van Wiraraja (Banak 
Wide), den adhipati van Sungënëb, 
21, 20 en volgg. 

Panitikan (nini ring — ), helpt Ken Ang- 
rok (Rajasa), 8, 9 en volgg.; Paniti- 
kan heet voluit Rabut Këdung Pani- 
tikan. 

Pandan Salas I, ook Raden Sumirat. 
zoon van Raden Sotor, 29, 25; huwt 
met Bhre Kahuripan III, 29, 26, en Bhre 
Singapura, 30, is ; vader van Aji Rat- 
napangkaja (Bhre Koripan IV, Bhra 
Hyang Parame^wara II), Bhre Lasëm 
III, en Bhre Daha IIL 30, 5, 7 en 8 : 
t 1323, 31, 1. 

Pandan salas II, onzekere persoon, tijdens 
Bhre Daha IV (}>rabhu ütri III), f 1355, 
31, 31. 

Pandan salas III, ook Bhre Tumapël V, 
prabhu van Majapahit, Qaka 1388 — 
1390 of 1400, 32, 21 — 32, 25. 

Pandakan {buyul ing — ), zie Macan ku- 
ping. 

Paiiji, zie Apafiji. 

Para, zie G^ah — . 

Pranaraja, de eerste der mantri's onder 
Tohjaya, 16, 20 en volgg. 

Parakrama {maniri — ), of dit een eigen- 
naam is^ is onzeker, 25, 33, tijdens 
Jayanagara. 

Purwa (Mpu — ), bhujangga boddhasta- 
paka te Panawijen, mahayanist, 9, 
19; vader van Ken Dëdës, 9, 22. 

Purwawi^esa, zie Hyang Purwawigesa. 

Pramifwara, zie Parame^wara I. 

Paramefwara I (Bhra — ), gewoonügk 
Pramifwara of Prame^wara geschre- 
ven, 27, 16; 28, »4; 29, 8 (waar zoo 



— 28B — 



te lezen is), 29, 8 en 30, i9, Prame- 
Qwareng Wéngkër, 28, 34, zie Wijaya- 
rajasa. 
Parame^wara II (Bhra Hyang— ), zie 

Ratnapangkaja. 
Prabhu, zie Qiwabuddba (Kërtanagara), 
Kértarajasa, Jayanagara, Bhre Kahu- 
ripan II (islri prabhu), llajasanagara 
(Hayam wuruk, hhaidrn prabhu), Hyang 
WiQesa, Dewi Suhita, Bhre Daha IV, 
Bhre Tumapël IV, Rajasawardhana, 
Hyang Purwawigesa, Pandan Salas III, 
en ratu, 
Prabhu [istri — ), zie Prabhu istri. 
Prabhu (Bhre — ), 28, 29,=Bhat&ra prabhu. 
Prabhu (Bhatfira— ), = Hayam wuruk 
(Rajasanagara), zie bij Rajasanagara. 
Prabhu istri I (Bhra—), zie Kahuripan 

n (Bhre—). 
Prabhu istii II (Bhra — ), zie Suhita- 

(Dewi — ). 
Prabhu istri III (Bhra — ), zie Daha 

IV (Bhre—). 
Prabhu Maharaja (van Sunda"), zie Ma- 

haraja. 
Pakëmbangan (Bhre — ), var. Sakëm- 
bangan, zoon van Bhre Wirabhumi, 
30, 9. 
Paduka Qori, zie Qori. 
Pudot, oflScier van Daha, tijdens Jaya 

katong, 19, 17. 
Patih,zie Aragani, Amaöcanagara, Amang- 
kubbumi, Nambi, Raganatha, Kauaka, 
Tëtëg, Tilam, Tadah, Pranaraja, Marga 
lëwih, Madu, Gowi, Gajah ënggon, 
Gajah lëmbana, Gajah mada. 
Patipati (Panji — ), tijdgenoot van Toh- 

jaya, 17, 2 en volgg. 
Pëtëng, tijdens Kërtanagara (Qiwabud- 
dha), volgt Raden Wijaya (Kértara- 
jasa), 19, 12. 






Pëtëng, zie Lërabu — . 
Palot (Mpu — ), amawjaleng Turyanta- 
pada, 6, 27 — 8, 4; pleegvader van 
Ken Angrok (Rajasa), 7, n, op die 
wijze bapa, tengevolge waarvan zijn 
verblijfplaats den naam Mandaleng 
bapa krijgt, en hij weer amandaleng 
bapa heet, 7, 12; 13, gi. 
Pëdang, tijdens Kërtanagara (Qiwabud- 
dha), volgt Raden Wijaya (Kërtara- 
jasa), 19, 10 en 31; 22, 28. 
Paja (Dewi—), echtgenote (of jongere 
zuster) van Dangdang gëndis, 14, 29 
Pajang I (Bhre—), dochter van Bhre 
Kahuripan II (prabhu istri I), 27, 24 ; 
huwt met Bhre Paguhan I, 27, 20; 
moeder van Bhra Hyang Wi^esa, Bhre 
Lasëm II, Bhre Kahuripan III, 29, 
20; t 1311, 30, 22. 
Pajang II (Bhre—), dochter van Bhre 
Tumapël m (b) (Kértawij-iya),30, 15; 
huwt met Bhre Paguhan II, 30, is; 
f 1373, 32, 6. 
Pamotan I (Bhre — ), zie Wijayarajasa. 
Pamotan II (Bhre — ), zie Rajasawar- 
dhana. 
Pamotan III (Ehre— ), spruit van Ra- 
jasawardhana, 32, 28. 
Paguhan I (Bhre — ), ook Raden Sumana, 
gemaal van Bhre Pajang I, 27, 25, 
neef van Bhre Kahuripan II, 27, 25, 
t 1311, 30, 22. 
Paguhan II (Bhre — ), zoon van Bhre 
Tumapël III (fe)(Kërtawijaya),30, 13; 
huwt met Bhre Taöjungpura (zgne 
halve zuster), 30, 15, en Bhre Pajang II 
(almede zijne halve zuster), 30, 15; 
vader van Bhre Singapura, 30, 17; 
32, 2; t 1373, 32, 4. 
Pagon, zie Gajah — . 
Pag6r antimun, zie Rajasanagara; 



— 236 — 



Pangfa {ra — ;, var. Pang^u, opstande- 
ling tgdens Jayanagara^ 26. 13. 

Fangen, var. van Pang^a. 

Pangaln (urang — ), Sandanees of Sun- 
daneezen, tijdens R^asanagara (Ha- 
yam wurnk). 

Pangiét, een der beste krijgers van Daha 
onder Jaya.katong, 22, so en 89; 23, 
88 en 84. 

Pa^dang, zie Dangdang. 

pedés (Ken — ), dochter van Mpu Pürwa, 
9, 28; in het bezit van de karma 
atnama^angi (dus = de vuuruitstralen- 
de prinses van West-Java)^ 9, 34 en 
^o]gg.'j gehawd met Tnnggnl amëtung^ 
den akuwu van Tumapöl, 9, s? ; moeder 
van Anusapati, 13, 1 ; gehawd met Ken 
Angrok (Rajasa). 12, 82 en volgg.; 
moeder van Mabisa Wong atëléng, 
Pafiji Saprang, Agnibhaya en Dewi 
Bimbu, 13, 4 en volgg. 

Dang hyang, zie Lohgawe. 

Dangdang géndis, ratu van Daha, tijdens 
Ken Angrok (Rigasa), 13,16 — 14,82; 
vrouwen (of jongere zusters) van hem 
waren Dewi Amisani, Dewi Hasin en 
Dewi Piga, 14, 29. 

Jönar, tijdens Bhre Kahuripan II (prabhu 
w/n l), 28, 18. 

Janaka (Tuhan — ;, zie Mantrolot. 

Jane^wara (Mpu — ), zie R^jasanagara. 

Jaran, zie ook Kuda. 

Jaran waha, volger van Rangga lawe, 
als deze opstaat, 25, s. 

Jaran léjong, opstandeling tgdens Jaya» 
uagara, 25, 88. 

Jaran bhaya (ra — ), krgger van Maja- 
pabit tijdens Bhre Kahuripan II (pra- 
bhu istri \) en Rajasanagara (Hayam 
wuruk), 28, is; 29, n. 

Jaran bangkal (/Himaf» --y, var. Bangkala, 



volgeling van Nambi, als deze opstaat, 
= Tëguh (?), 25, 86. 

Juru démung, vermoedelijk geen eigen- 
naam, maar een titel van een persoon, 
tijdens Jayanagara, 25; 32. 

Jalu (ra — )y tijdens Bhre Kahuripan II 
(prabhu istri l)y 28, I8. 

Jiput (ratigdya ring — X 1, ». 

Jayanagara (Bhat&ra — ), ook Kala gëmdt, 
zoon van Kërtanyasa (Raden Wijaya) 
en Dara Pétak, /^ofrAtf van Majapahit, 
gaka 1217 — 1250, 25, 8 — 27, 17: 
t 1250, 27, n. 

Jaya katong (Aji — ;, vorst van Daha. 
tydens Kértanagara (Qiwabuddha), 18. 
28 en volgg., verovert Tumapél en 
wordt daardoor opperheer over Java, 
Qaka 1197 — 1216, 19, 20—24, 88; 
vervaardiger van de kidut^g Wukir 
polaman 24, 33; sterft in gevangen- 
sehap ie Junggaluh, 24, 34. 

Jagaraga I (Bhre — ), dochter van Bhre 
Tumapèl III (b) (Kërtawijaya), 30, is; 
gehuwd met Aji Ratnapangkaja(Bhra 
Hyang Paramegwara II), 30, u; f 1373, 

32, 6. 

Jagaraga II (Bhre — ), onzekere persoon, 
tijdens Hyang Purwawige^a, 32, 20. 

Jagatsaya, Sundanees, tijdens Rajasa- 
nagara (Hayani wuruk). 29, 5. 

Jagulu (Raden — ), onzekere persoon tg- 
dens Bhre Daha IV (prabhu istri III), 

31, 81. 

Jabung terewes, kryger van Migapahit 
tijdens Jayanagara, 21, 1; 26, e. 

Jangkung (ra — )y volger van Nambi, als 
deze opstaat, 25, 35: 26. 5. 

Janggan, ook Janggan ing Sagénggéng, 
vermoedelijk ontstaan uit bhujangga- 
ning Sagénggéng, leermeester van Ken 
Angrok (Rqasa), 3, 84 en volgg. 



— 237 — 



Tnyu (ra — Jj opstandeling tgdens Jaya- 

nagara, 26, is. 
Yang; zie Hyang. 

Maharaja (ratu—j^ koning van Sonda^ 
tijdens Biyasanagara (Hayam warok), 
28, 81; 29, 7. 
Ilahi9a, zie ook Eöbo. 

Mahi^a campaka, zie Narasingha. 

Mahi^a randi, zoon vanKébohijo, 12, so 
en 81; 14, 2. 

Mahi^a rubnh, een der beste strgders van 
Daha onder Jaya katong, 22, so; 23, 
1, 88, en 85. 

Mahi^a walnngan, jongere broeder van 
Dangdang gSndis, 14, 20. 

Mabi^a wong atëléng, zoon van Ken 
Angrok (Riyasa) en Een Pédës, 13, 4; 
vader van Mahi^a campaka (Nara- 
singha), 16, 18. 

Mahi^ bnngalan, tgdgenoot van Wisnu- 
wardhana, 18, 11. 

Mahapati, patih amangkubhumi van Ma- 
japahit, tijdens Jayanagara, tot 1241 
Caka, 25, 11 — 26, 15. 

Menak, Yermoedelgk de Snndaneescbe 
adelstitel, 29, 1 en volgg. 

Mnndarang, zie Kébo — . 

Mantrolot (Aji — ), ratu ing Malayu, ook 
Tnhan Janaka en Qri Marmadewa, 24, 
30; zoon van Dara Jingga, een prinses 
uit Malayn, 24, 29 ; tijdens Kértangasa 
(Baden Wgaya). 

Mandala, zie Amandala. 

Macan kaping, buyut ing Pandakan, ver- 
leent Baden Wijaya (Körtarajasa) hulp, 
als hg vlncht, 20, 32 en volgg. 

Mara =? Samara. 

Marajaya (Pafiji — ^), volger vanRangga 
lawe, als deze opstaat, 25, s. 

Marmadewa (Qri — ), zie Mantrolot. 

Marga lëwih (patih ~), kryger van Maja- 



pahit, tgdens B^jasanagara (Hayam 
wuruk), 29, 11. 

Mada, zie Oigah — . 

Made (ra — >), volger van Nambi, als 
deze opstaat, 26, 4. 

Matahon I (Bhre — ), ook Baden Larang, 
gemaal van een dochter van Bhre 
Kahnripan II (prabhu islri I), 27, 24; 
t 1331, 30, 21. 

Matahun II (Bhre — ), dochter van Bhre 
Wirabhomi, 30, 11; hnwt met Bhre 
Wëngkër II, 30, 12; f 1338, 31, 21. 

Mataram I (Bhre — ), dochter van Bhre 
Wirabhumi, 30, 10 ; gehuwd met Bhra 
Hyang Wi^e^a, 30, 10; f 1338, 31, 21. 

Mataram II (Bhre — ), sprnit van Bajasa 
wardhana 32, 28. 

Malandang, zie Kamman. 

Malayn (ralu ing — ), zie Mantrolot. 

Mölong (Pafiji — ), Snndanees, tgdens 
Bajasanagara (Hayam wnruk), 29, s. 

Mpa, zie Tapawangkéng, Pftrwa, Palot, 
Janegwara, Oandring. 

Madn {patih — ), door Biyasanagara (Ha- 
yam wnruk) naar Sonda gezonden, 
28, 80. 

Minge, zie Gagak — . 

Mangnri, zie G%jah— . 

(rénnk bnntn, vrouw van Bango sampa- 
ran, pleegmoeder van Ken Angrok 
(Bajasa), 3, 24 en 27. 

Oandring (Mpu — ), wapensmid te Lu- 
Inmbang^ 11, 12 en volgg., 13, 34; 
tijdgenoot van Ken Angrok (Bajasa) 
en door deze gedood; zijn krissen al- 
gemeen bekend, en die welke hg voor 
Ken Angrok (Bajasa) maakt, speelt 
in de Pararaten een gewichtige rol. 

Géndis, zie Dangdang — . 

Gundal (Bhra --), onzekere persoon, tg- 
dens Bhre Kahnripw II (prabhu istri 



— 238 — 



I), 27, 26. 
Gnru (Hyang— j, noemt Ken Angrok 

(Rajasa) zijn zoon, 8, 20; 13, 17 en 26. 
Gnru (Bhatóra— ), zie Rajasa. 
Gowi (patih — ), krijger van Majapahit, 

tgdens Rajasanagara (Hayam wuruk), 

29, 11. 
Gélëmpo, var. van Gëinpong. 
Galatik (ra — ), volger van Rangga lawe 

als deze opstaat, 25, 9 en u. 
Gajah, in plaats van Gajah pagon (?), 

19, 31. 
Gajah (Raden—), zie Narapati. 
Gajah ënggon, patih van Majapahit, Qaka 

1293 — 1320, 29, 29; 30, 27. 
Gajah lémbana, patih van Majapahit, 

gaka 1332—1335, 31, 17 en 19. 
Gajah para, man van Ken Êndok, de 

moeder van Ken Angrok (Rajasa), 1, 

19 — 2, 20. 
Gajah pagon, tijdens Kértanagara (Qi- 

wabnddha), volgt Raden Wijaya (Kër- 

tangasa), 19, 11; 20, I6 en volgg. 
Gajah mada, ambékél ing wong Bhayang- 

kara, 26, is; patih ring Kaharipan, 

26, 21, patih ntig Daha, 26, 35; doodt 

Taiica, als deze Jayanagara heeft ge- 
dood, 27, 9; verder 27, si, 88 en 

36 ; 28, 12: angabehiy 28, 17; amang- 

kubhumi, 28, 20, 34 en 36; 29, is en 

16; t 1290, 29, 28. 
(rajah mangnri, patih van Majapahit, 

gaka 1320—1332, 30, 30; 31, I6. 
Gigah bim, tijdens Jayanagara, 25, 30, 

waar gesproken wordt van een pagajah 

biru. 
Gémpong (Tnhan — ), var. Gëlëmpo, San- 

danees, tijdens Rsgasanagara (Hayam 

wuruk), 29, 3. 
Gagak ingët, fantor van Ken Angrok 

(Rajasa), 5, 15. 



Gagak katawang, zie Rajasanagara. 

Gagak sali, zie Hyang Wi^esa. 

Gagak minge (ra — ), krijger van Maja- 
pahit, tijdens Bhre Kaharipan II (pra- 
bhu islri I), 28, is. 

Gubar baiëman, man tri van Daha, tijdens 
Dangdang gëndis, 14, 20 en 21. 

Bacang (Dëmang — ), krgger van Maja- 
pahit, tijdens Bhre Kaharipan II (f>ra- 
bhu i^lri I), 28, is. 

Bhra (ond-Jav. bhróy als titel eene 
vertaling van crï), voor persoonsna- 
men, Bhre en Bhreng voor plaats- 
namen, zoo althans zon het behooren, 
zie Hyang Wëkasing snkha, Hyang 
Wi^esa, Kaharipan, Daha, Wirabhami, 
Lasëm, Pandan salas, Prame^wara, 
Prabhn, Pajang, Pagahan^ Matahan, 
Gundal, enz. 

Bhre, zie Bhra. 

Brahm& (Bhatfira — ), verwekt Keu Ang- 
rok (Rajasa) bij Ken Èndok, 1, 7 
en 11, 

Bhreng, zie Bhra. 

Bawak (Paiiji — ), zoon van Bangosam- 
paran en Tirthaja, 3, 25. 

Bowong, officier van Daha, tijdens Jaya 
katong, 19, 17. 

Balalak (abatur ing — , oi amandaletig — ), 
zie Tapawangkëng. 

Bapa (amandaleng — ), zie Mpa Palot. 

Badandër (bwjut ing — ), tijdens Jayana- 
gara, 26, 23 en 32. 

Baja, var. van Bafiak, zie aldaar. 

Bhaya, een kalana tijdens Kértanagara 
(Qiwabaddha), 18, 24. 

Bhaya, zie Jaran — . 

Baynt, zie Nangka, Kabalon, Tagaran, 
Limbehan, Pandakan, Badandër. 

Bhayangkara (wong — ), de wacht in de 
poort in de kraian, die dien naam 



289 — 



draagt, 26, 19 en volgg. 
Bafiak (ra—), opstandeling tijden Jaya 

nagani; 26, 13. 
Bafiak, var. B^ja, onzekere persoon tij- 
dens Bhre Kahuripan II (prabhu istri 

I), 28, 25. 

Bailak wide, zie Wiraraja. 

Bhat&ra, zie Amflrwabhümi, Narasingha, 

Qiwabnddha, Wi^nu, Prabhu, Jayana- 

gara, Garu, Brahma. 
Bhat&restri, zie Dewi Snhita. 
Bangkal, zie Jaran — . 



Bangkaia, var. van Bangkal. 

Bango samparan, pleegvader van KeA 
Angrok, (R^asa), 3, 13, u, 17, 18, 
20, 21, 22 en 28; de man van Génok 
buntu en Tirthaja, twee zusters, 3, 24 ; 
de vader van Panji Bawuk, PaBji 
KuScang, Panji Eunal, Panji Kéneng- 
kung en Cucupuranti, 3, 25 en 26; 
verder 10, 24 en volgg; 13, ss. 

Bungalan, zie Mahisa — . 

Tati (ra — ), volger van Rangga lawe, 
als deze opstaat, 25, 9. 



RE&ISTER 

m DE in u tmmNiH vooRmsoE tuEnuiK '). 



Abdaljalil, 128. 

Abdullah Kadir^ pangeran, lló. 

Abdnllali Rakim, 200. 

Abo Sjaid, 160. 

Abu Tbabir, 102. 

Aceb, 56, 127. 

Adigama, 169. 

AdigaDda, Sunan, 200. 

Adikata, Arya — , 78, 81, 85. 

AdimanggaU, Eyai Adipati — , 174. 

Adaoingkong, 175, 180, 183, 190, 202, 

203. 
Adhiraia, Atya — , 121, 122. 
Aditja, 121, 122. 
Adityawannadflwa, 127. 
Adityawanna, 123. 
Agr^ia, 78, 81, 86. 
Agnng, gmtMg — , 191. 
Abmad, 128. 
Aji Saka, 201. 
Akbar, Sajit Seh — , 196. 
Aksa, 68. 

AU, Haag — , 161. 
AU, Sayit— , 196, 
Alit, 193. 
Alit, 202. 

Alit, Baden—, 175, 183, 193, 202 
Alm, 121, 122. 
Aman, 193. 
Amaücaiiagan, 167. 
Amangkabbnint, 1.32, 167. 



Aiuarako^, 181. 

Amaramula, 181. 

Amarasabba, 170. 

Ambon, 187, 189. 

Amiol, 66. 

Amiaani, zie Kala — , Lfimbn — 

Ampel, 195, 196, 199. 

Ampel, Sunan — , 196, 197, 199. 

Ampel denta, 184. 

Ampel gading, 56. 

Amflrwabhami, 53. 

Anakawijaya, 174. 

Anbia, 179. 

Andakasasi, 187, 192. 

Andalobnr, 192. 

Andamohi kalang, 115. 

Andayaningrat, 187. 

Angabhaya, rat% — , 64. 

Anggabaya, Tamgnggnng — , 115. 

Anggaraksa, 78, 81, 85. 

AagkatbnU, 188, 191, 192. 

Angkawijaya, 174, 175, 187, 193, 194, 

196, 202, 203. 
Angnyafla, 67. 
A&grok, zie Arok. 
Ailjasmaia, 166, 191, 192, 193. 
Autaknanma, 199. 
Antfiban, Jaka — , 189. 
Ana«apati, 69, 60, 63. 
Arabie, 196. 
Arabier, 194. 



ValWighcidihalTc vandtD ook de «sinigo in do loleidinK TooThandondo o 



Aragani, &4, 167. 

Ardharaja, 79, 82, 85. 

ArdiHijaya, 174, 175, 187, 189. 190. 

202, 203. 
Aripin, Seh— , 185. 
Aijona saarabaha^ UH. 
Arjiiuawijaya. 138. 
Arjunawiwiiba. 138, 139. 
Arok, Ken—, Inl.. ó3. nh, ."nl, 57. 58, 

60, 62, 66, 173. 
Arok, kidnng — , IdI. 
AryS. versmaat, 181. 
Babad BalambaogaD, 125, ITT. 
Babad Baodawasa, 125, 177. 
Babad BanHn, 112, 177. 178. 
Babad BaüDmae, 177. 
Babad bedah Kuta Mangir. 179. 
Babad bëdali NgayoKva, 177, 17H. 
Babad Bësnki. 177. 
Babad Cérbou, 54, 177. 178. 
Babad Dëmak, 177. 
Babad Dipanégara. 177. t7x. 
Babad Giyatiti, 178. 
Babad Jënggala, 177. 
Babad Karlasura. 177. 
Badad Madnra. 
Babad Majapahit, 177. 
Babad Mangkubuineo, 178. 
Babad Mangknoégara. 177. 
Babad Mataram, 177. 
Babad Paeina, 177. 
Babad Padjadjarran, 177, 
Babad Pajajaran, 177. 
Babad Piyang, 177. 
Babad Pakualaniaa, 177. 
Babad palihan nëgari 178. 
Babad Paeir, 177. 
Babad Pftcina, 177. 
Babad Sarakarta, 177. 
Babad Tanah Jawi, 54, 56, 90, 112, 137, 

177, 178, 179, 182, 183, 201, 202. ' 

V«A. B^ Gtn.. dad XLIX. 



Badong, 197; Menak— , 197. 

Bagdad, 102. 

Bagfilen, 188. 189, zie ook Mageien. 

Bago, 96. 

B(yil, 121, 122. 

Bajul efingara, 197. 

Balambangaü 55, 117, 124, 128, 150, 

153, 154, 155. 184, 185, 187, 189,' 

190, 191, 192, 19.3, 196. 197, 198. 
Balawa, 96. 
Balega, 191, 192. 
Bale Inmnr, Kyai — . 184. 
Bali, 58. 85, 102. 121. 124, 125, 126, 

128, 141, 173. 174. 175, 187. 189, 

197, 199. 201. 
Bali Anom. Kaden -. 190. 
Balilung, 189. 
Baoak kapuk, 84. 
Bafiak wide, 68. 92. 9:-ï. 117. 
Banda, 175. 
Bandiao. 128, 187, 189. 
Baudar. 92, 173. 183. 
Bandung, 191. 

Bangab, Arja— . 92. 1H3. 188, 189. 
Bangawan, 84. 
Bangka, 128. 

Bangkalan, 189, 191, 192. 
BaÖjar, 56. 187, 189, 192, 194. 198. 199. 
Bafljarmasiu, 56, 128, 187. 
Bantóü, 54, 55. 112, 113,114. 116, 195. 
Bantong, Kyai - . 194. 195. 
BaïinniaB, 188. 192. 
Baniiwa lama, 127. 
Bafinwangi, 189. 
Banwa, Giisli — . 17."!. 
Bara. Kuta — . 124. 
Baron Sakeiider, 54. 
Bataog, 79, 82, 84. 
Batara Katong, 19;i. 
Itatara Nata, 197. 
llataviaascli Öenootschap. Inl.. 59. 



Batawi, 55, 116. 

Bata baragung, 123. 

Bawa, 96. 

Bawiyan, 187, 189. 

Beal, 67, 132. 

BöUtuDg, 86, 128. 

Béng, 104. 

Beakoelen, 126. 

BörftbëB, 55, 188, zie ook Brèbés. 

Bëraw, 128. 

Böanki, 124, 154. 

Bhadrapada, 78, 80. 

Bhatara prabhu, 137, 143. 



Bijasura, Ton—, 160, 161. 

Bima, 128. 

Bintan, 56, 126, J28, 130. 

Bintara, 170, 184, 185, 197, 199, 200, 

201. 
Blacak Dgilo, -fM). 
Blater, 124 
Blitar. 57. 

BloemtiD Waïimlers, van — . Inl, 
Boddliniuirita, 13!). 
BoddliaHthfipak». 5k. 
Bonang 197. 
Boiiaiig. Uadeii ■ ■ . 196. 
Bonang. Sunan - . 1K5. 19H. 199, 200. 

201. 
Bondan kajawjin. 1H4. I«r., liW, '^)l. 
Bongkit, Itogiudo - . 140. 
Borueo. 126. 12K. ir>7. Mh. 
Bradde)!. 126. 
Brahini ;ismara. 1S4. 
Brahma, Bhatara . 53. 57. 
Biakuniara, zie Kumnm en Hrokuniar». 
Bramartani, 177. 
Brantat*. UU. 
Bmwijaya, !'■_>. 1«3. \X4. 185. 1«8, 18!). 

190, 191, 19;J, 194, 195. 190, 197, 

198, 199, 200, 201, 202, 203. 



Brebes, 55, 188, zie ook ] 

Brokamara, 174. 

Brons Middel, 162. 

Browijaya, 168, 174, 175. 

Bubat, 136, 168. 

Buddba, 121. 

Bnddbisten, 58, 78, 8i. 

Bngis, 56, 187. 189. 

Bnlang, 128. 

Bu-la-po-bu, 140. 

Buleleng, 173. 

Bumi gehi, 114. 

Bungan, Kaden — . 56. 

Bungnr, 137. 

Bnogurao, 128. 

Buntaran, lladen— , 186, 102. 

Buntar watangan. Baden — , 186, 192. 

Buntil, 173. 

Burereh, Raden — , ] 84. 

Bami, 175. 

Bntak, guniiHi/^, 77. 

Bijbelgenootschap, Ned. — , 168, 176. 

Cakradhara. Kaden—, 118, 124, 143. 

Cakrani'gam. Pangeran — , 178. 

Oanipaga. 97. 

Caodakirana. 181. 

('iiiiflraiiewi, 160, 

Candrakirana, 160, 161. 

Candrakirana, boektitel, 181. 

QaneQcara. 78, 80. 

Canggu. 64, 87, 90, 91, 170, 

Cauggu lor, 90. 

Cangkir, 87, 90. 

Cantakaparwa, 181. 

Caracap, 188. 

Carang soka, 19»*. 

Cayapurnsa. Inl. 

Cerain, 125. 

Oerliou, 54, 55, 56, 184, 185, 194, 196, 

198, 200. 
CSrbon, Sanan — , 199, 200. 



Ch'ang-k'o-cbing, 140. 

Changkn, 87, 90. 

Chéng-Ho, 154. 

Ch'engtsn, 154. 

China, 68, 76, 140, 158, 195, 

ChineeBche berichten, 66, 67, 85 en volgg., 

99, 100, 132, iSyenvuI^., 154,157. 

158, 159. 
Ohineezen, 110. 
Cina, 173, 184. 
Citrawati, 188. 
Citrawnlan, UHi, 197. 
Qiwa, Inl. 

Ciwa, Bhra — , 168. 
giwabuddlia, Int., 60, 66, 67, H4. 
Ciwaliuddbalaya. 67, 78, 81. 
Civraiten, 58, 78, 81. 
Ciynng wanara. 188. 
Cocak ijo, 191. 
Cocak pëtnk. 191. 
Cohen Stuart. Inl. :>4. TT. 91. 94. 9(;. 

98, 100, 102, 105. 12.'i, 176. 
Compagnie, ■')4. 
Cora manis, 124. 
Crawfnrd, 66, 77. 17:.. 
Qri, Dewi ^ , .^6. 
OaQ^tiyaoarita, VA><. 
Dadapan, pnlo ~ . 1 16. 
Daendels, 17^. 
DaUa, Inl., 57, 58, 66, 6'*, 76, 80. 84, HH, 

89, 90, 101, 121, 122, 160, ir>l, 183. 
Daha, Bhre — , 149, 153, 156. 166. 
Daha 1, Bhre — , 106, 118, 149, 163. 164. 
Daha II, Bhre — , 118. 122, 144, 149, 

150, 156, 163, 164. 
Daha lil, Bhre — , 145, 146, 147, 149, 

156, 157, 163, 164, 166, 170. 
Daha IV, Bhre—, 148, 163, 164, 165, 

166, 167. 
Daha, Patreng— , 153, 154. 
Dak^tama, 96. 



Dak?ottan)abfihalHörapratipak!ak?aya, 

96, Q-i. 
Damar, 195. 
Damar, Arya-, 184, 1H5, 196, 199, 

200. 
Damar wulau, 155, I6ö, 175, 186, 187. 

190, 191, 192. 193, 195, 202. 
Damar wulan lakon, li)6. 16H. 
Damar wulan roman, 54, 155. 156, 179, 

186. 191, 192, 21)2. 203. 
Dangdanf.' göndis. lul.. 168. 
Dangdang «eeana. 187. 189. 190. 
pangdang wiring, 188. 189. 
Dangdi, 84. 
Danuwinata, 156. 
Dara, 103. 127. 
Dara jinggii, 103. 104. 
Dara najana, 104. 
Darn panu, 104. 
Dara pêtak- 103. 1"6. HO. 112. 122. 

133. 
Darawati, 1!M. 195. Itt7, 19». 
Darparagi. 113. 
Dasyarflia, 131. 
Datar. «4. 

Dayaningral. 197. 20(». 
Dayun. 129. 
Dédali pétak, 196. 
Dcdali pntih, 187. Iii3. 194, 197, 
Dëdës. Keu -. IdL. 54. 56. 63. 
Deli, 126. 

Dömak, 17t». 174, 1«6, 197. 199,200,201. 
Dëmak. Paugeran — , U4. 
Dëmak, Sattan — . 114. 
DÖmung wiilar. 183, 202 
Dfirajat, Raden — . 196. 
Dërmayu, 188. 
Devic, 102. 

DewarSja, Arj'a- , 121. 122. 
Dewi Kttsnma, 159. 
Dbarmodaya Mah&^mbhn, 96. 



— 244 — 



Dilab, 184, 195. 

DipaDégar», 55, 17^<. 

Diramanggala, 115. 

Dompo, 124, 125, 126, 141. 

Drajat, 200. 

Drajat, Siinau — , 191». 

DukuhaD duku, IdI. 

Dulaurier. 125, 127, 128, 130, 132. 

Eek, van — , !M). 

Èduk, 190. 

Egginglangh, 82. 

Ende, 175. 

Èndok, Ken — , 57. 

Engelmann, 168. 

Eugelöch-Indiü, bx. 

Erlangga, 105. 

Franken, 114. 

Friederich, hil., 77, 85, 123. 

Fries, von , 86, s7. 
Gagak, 5(). 
Gagëlang, 101. 

Gajab, Kaden--, 148, 155, 156, 163, 

166, 167, 174. 
Gajah ëuggon, 168. 
Gajab léuibana, 168. 

(iajah mada, 56, 117. 121, 122, 124, 
125, 128, 136, 141, 142, 158, 159, 
160, 162, 167, 168, 169, 175, 183, 
184, 185, 186, 192, 193. 195, 197, 
200, 201, 202, 203. 

Gajah manguri, 168. 

Gajah pagon, 84. 

Gaja mada, 168. 

Galuh, 92, 188. 

Galnh, Raden ~ , 159, 160. 

Gkiodring, Mpn — , 54, 57. 155, 193. 

Gantër, 57. 

Garage, 196, zie ook Grage. 

Garësik, 184, 185, 190, zie ook Gérsik. 

Gatana, Maolana — , 200. 

Gatul, Dëmang — , 191. 



Gayn, 132. 
;Gëbang, 199. 
Géde, fftmung , 54. 
Gelang, 90. 

Gëlanggëlang, 78, 79, 82, 86, IK). 
Gëmërëncing, Putri— , 128. 
Gënëngan, 57. 
Gericke, 176. 

Gërsik, IK), 195. 196, zie ook Garësik, 
Gësang, Sunan- , 196, 199. 
Gëta« pëndawa, 201. 
Ginantaka, 78, 81^ 85. 
Giri, 185, 186, 196. 
Giri, Suuan--, 185, 197, 199, 2<>0. 
Goa, 175. 
Gorani, 125. 
Gordvn, 175. 
Gorong, 125. 
Gösan, 196. 

Grage, 195, zie ook Garage. 
Groeneveldt, iM^, 85, 86, 87, 88, 89, 

90, 94, iU), 98, 99, 100, 101, 123. 

139, 141, 154, 157. 
Gudana, 193. 

Gugiir, Raden — , 197, 199. 
Giindal, Bbre -, 144. 
Guntur, Raden — . 197. 
Gnntur gëni, 19(). 
Giirii, Bbatara — , 53, 66. 
Gurun, 124, 125, 126. 
Hagenian, 56, 175, 176, 183. 
Haüini, 79, 82, 84. 
Hari, 96. 

Ham, 124, 125, 126. 
Haryang, 78, 80. 
Hasau, Hang , 161. 
Hayani wurnk, 120, 121, 123, 137, 138. 

139, 141, 143, 144, 145, 149, 150, 

153, 157, 158, 168, 174, 202, 203. 
Uia-wang, 158. 
Hikayat raja Baüjar dan Kotariugin, 



— 245 



55, 127. 
Hikayat rajaraja Pasay, 127, 129, 132. 
Hinayfina, 58. 
Hindnisme, 58. 
HiniDgkuan, 87. 
Hnt, 27. 

Hoeveil, van, 67, 
Hollander, de, 131, 156. 
Hollanders, 54, 112, 179. 
Holle, 137, 181, 197. 
Hujung tanah, 128, 129. 
Hnmboldt, von, 67. 
Husen, Hang— , 161. 
Hyang, Bhra— 148, 170, 172. 
Hyang Parame^wara, 118. 
Hyang Paramecjwara II, 145, 146, 147, 

153. 
Hyang Purwawiee^a, 170, 171. 
Hyang Wëkasing suka I, 137, 138, 139, 
• 143, 144, 174. 203. 

Hyang Wëkasing suka II, 145, 146, 
147, 150, 203. 

Hyang Wi^e^a, 145, 146, 150, 152, 153, 
154, 156, 157, 163, 164, 170, 174. 

Ibu Bathutha, 128 

Ibrahim, 184. 

Ibrahim, Sayit — , 196. 

Ibrabim, Snnan — , 198, 200; Maolana — , 
198. 

Iccasada, 178. 

iQwara, 78, 81. 

Ike Mese, 86, 87, 88. 

Iman, Raden — , 199, 200. 

Indragiri, 160, 161, 175. 

Indrajaya, 114 

Inggris, 186, 187, 195. 

Ino, 53. 

Inscripties, Inl., 78, 94, 103, 111, 121, 
137. 

Iperen, van — , 157. 

Ipoh, 121. 



Iskak, Raden — , 196; Sayit—, 196. 

Ismangnn, Raden mas — , 156. 

Jacquet, 67. 

Jagaraga 1, Bhre — , 147, 148, 167. 

Jago, 64. 

Jagulu, Raden — , 148. 

Jagur, 190. 

Jajagu, 64. 

Jakang tulung, 191. 

Jakarta, 195. 

Jakëtra, 54, 55, 116, 126. 

Jakëtra, Pangeran— , 116. 

Jali, 193. 

Jambi, 56, 128, 129, 141, 160 

Jambudwipa, 58. 

Janaka, Tuban — , 184. 

Janggan, 58. 

Jangkung pacar, 185. 

Japan, 192. 

Japara, Pangeran — , 113, 114. 

Japar sidik, 200. 

Jaran, zie ook Kuda. 

Jaran panolih, 198, 200, 201. 

Jaran sari Jaran pumama, 127. 

Jasun wungkal, 78, 82, 84. 

Jati, gunung — , 198. 

Java, 53, 58, 67, 76 85, 86, 87, 88, 89, 
91, 93, 94, 101, 102, 103, 110, 112, 
117, 122, 124, 126, 130, 139, 140, 
141, 142, 157, 158, 159, 173, 175, 
183, 194, 195, 196, 198. 

Jawa, 55, 56, 139. 

Jayabaya, 55, 174. 

Jaya katong, Inl., 57, 66, 67, 68, 76. 
82, 84, 85, 86, 89, 90, 93, 103, 104, 

Jaya katyëng, 78, 79, 80, 82, 83, 86. 

Jaya lawung, 192. 

Jaya lëngkara, 102. 

Jaya lëngkara pakém, 102. 

Jaya lëngkara Pafiji, 102. 

Java lëngkara wolang, 102. 



246 — 



Jayanagara, 110, 111, 116, 117, 118, 122, 

123, 137, 143, 150, 167, 168, 202, 203. 
Jayanagara (Bantën), 115. 
Jayanagari (Bantën), 113. 
Jajaningrat, 160. 
Jayaparnsa, Inl. 
Jayasena, 189, 190, 202. 
Jayasuhrata, 156. 
Jayasndarga, 198. 
Jayawardbana, zie Kërtarajasa. 
Jayawii^nuwardhani, 121, 122, 123, 124, 

136, 143. 
Jayeng tilam, 115. 
Jëbat, 198. 
Jëbat, Hang — , 161. 
Jëbat betri, 184. 

Jegja, 19^, zie nog Jigja en Jikja. 
Jëmaja, 128, 162. 
Jenal kabir, 195. 
Jëpara, 195. 

Jigja, 198, zie Jegja en Jikja. 
Jigjasnra, 198. 
Jiyu, Inl. 

Jilga, 198, zie Jegja en Jigja. 
Jimbnn, Panëmbahan — , 201; Senapati 

— , 186. 
Jin&laya, 123. 
Jingga, Menak — , 155, 187, 188, 191, 

192, 193. 
Jipang, 199. 
Jiwana, 121, 122. 
Johor, 56. 

Jonge, de — , 82, 114. 
Jonker, 91, 169. 
Juldah, 184. 
Jnng galnh, Inl., 104. 
Juni, Raden — , 190, 197. 
Jnrn martani, 177. 
Juwana, 122, 198. 

Kabalan, Bhre — , 147, 148, 166, 167 170. 
KabörëbësaD; 55, 



Kadiri, 57, 58, 59, 76. 
Kahuripan, 121, 122. 136. 
Kahuripan I, Bhre — , 106, 118. 
Kahuripan U, Bhre—, 118, 120, 122, 

133, 134, 143, 144, 150. 
Kahuripan III, Bhre — , 145, 146. 
Kahuripan IV, Bhre — , 145,146, 147, 

165. 
Kagënëngan, 57. 
Kala amisani, 202. 
Kala gëmët, 110, 111. 
Kala misani, 190, 191. 
Kala muiiëng, 185. 
Kalang, 67, 86, 87, 88, 89, 90, 115. 
Kalantaka, 114. 
Kali cilik, 57. 
Kali gnnting, 92. 
Kali jaga, 198. 
Kali jaga, Sunan — , 185, 198, 199, 200. 

Kalima, Inl. 

Kali mas, 86. 

Kaliwwan, Inl. 

Kalot, 190. 

Kalungkung, 199, 200, 201. 

Kalungkung, Raden—. 197. 

Kamboja, 140, 187, 190, 192, 194. 

Kanaka, Tuhan — , 166, 167, 168,169. 

Kanda, zie Sërat kanda. 

Kanduruwan, 199, 201. 

Kantër, 57. 

Kaon, 163. 

Kapa, 193. 

Kapalembangan, 116. 

Kapulungan, 76, 82. 84. 

Karimon, 86. 

Karimon Java, 80. 

Karimata, 128. 

Karo, Inl. 173. 

Kartabangsa, 198. 

Kartapati, 191. 

Kasa, ]93. 



Eutnri, Hang—, 161. 

KasQDjaUn, Fangeran — , 113. 

Eataaakala, 67, 86, 87, 90. 

Katang, Haji - , 67 86, 87, 8Ü, 90. 

Katong, 193, 194, 195, 197, 199. 

Katong, Baden — , 197. 

Katum€ii(;gi]ngau, Patih — , 129. 

Knu-Hsing, 68, 86, 87, 88. 

Këbo, zie ook Maeea, Maheea en Mahisa. 

Efibo campaka, 53 

Kfibo hijo, 55. 

K«bo kanigara, 200. 

Këbo kënaoga, 200, 201. 

Eebo tëngah, 84, 167. 

Këdaton, Candi — , 124. 

Kédawnng, Knta— , 124, 

Këdiri, 189. 202. 

Ke^n, 195. 

Këdnng pkt, 79, 8.3, 84. 

KHëng, 193. 

Eelep, 189. 

Keling 1, Bhre — , 147, 148, 167. 

Keling, Kaden — , 161. 

Kemangi, 189. 

Kêmbang vri, 79, 83, 84. 

Kémbang jênar, Blire — , 147, 148. 

Kembaug lampir, 185. 

K6mbar, 148. 

Kenang, 189. 

Këlcana sari, 189, 190. 

Eeücana wnngn, 155, 175, 187, 190, 
191, 193, 202, 203. 

KéndaU, 193. 

EfiDtot dalit, 114. 

Kern, 67, 77, 82, 103, 123, 137, 138, 181. 

Kêrtanagara, 57, 60, 64, 66, 67, 68, 
69, 78, 80, 81, 82, 8.3, 84, 85, 87, 
90, 99, 118, 122, 123, 132, 167. 

Kertanagara, 78, 81, 85. 

Kertapati, Baden Faiiji Ino—, 53,59. 

KJrtarajaaa, 57, 106, 110, UI, 117, 



118, 122, 132, 133, 134, 143, 146, 
150, 163, 164, 167, 203. 
KertarajaBa Jayawardhana, 78, 80, 81, 

93, 105, 121, 122. 
KéplawardUana, 118, 121, 144. 
Kérlawijaya, 170, 174. 
Kerlawijavapura, 170. 
Ketek abang, 192. 
Keyzer, 176. 
Eidal, 60 

Kidang wnlan, 192. 
Eidnl, Batn bagus — , 1 15. 
Eikin, Baden — , 199, 200. 
Kirana langu, 160. 
Eilen, Fangeran — , 116. 
Elaproth, 66. 

KlSme, 78, 80, 81, 83, 84. 
Klerck, de - , 67, 128. 
Elinkert, 125, 186. 
Eota, 181. 
Koen, 116. 
Kolan, 86. 
Kombang, 92. 

KoiVcar, Menak -. 1.%, 191, 192, 19.5. 
Koripau, 101. 
Eotaringin, 55. 
Kotbata, 188, 191. 192. 
KrajÏDgaD, Knta — , 124. 
Krawang, 126. 
Krtanagara, zie KCitanagara. 
Krtarajasa. zie Kfirtanyasa. 
Koblai Kban, 67, 85, 86, 87. 
Euda, zie ook Jaran. 
Kudadn, 78, 79, 80, 81,83,84,93,111. 
Kndamerta, 118, 122, 143. 
Kada rangeyan, 187, 192. 
Enda rarangin, 187. 
Enda tilaraa, 187, 192. 
Eadns, 185, 195, 196. 
KnduB, Snnan — , 199, 200, 201. 
Ku-ksng, 142. 



— 248 — 



Knlawan, 79, 83, 84. 

KuloD, Pangeran — , 115, 116. 

Kulus, 104. 

Kumara, Bra— , 189, 202, 203, en zie 

Brokumara. 
Kumara, Raden — , 188. 
Knmpéni, 55. 
Kuningan, 198. 
Kasen, Raden — , 196. 
Kusoma, Dewi — , 159. 
Kusamaynddharipu, 78, 81. 
Kntaramanawa, 169. 
KntaramUnawadi, 169. 
Kuta waringin, 128. 
Kutay, 128. 
Kuti, 97, 117. 
KuwHng, 189. 
Kwantan, 130. 
Lais, 126. 

Lakir, Hang — , 161. 
Lakiyu, Hang — , 161. 
Laksamana, 161. 
Laksamana, Dëmang — , L13, 114. 

Lak^mi, 121. 

Uk^mikirana, Inl. 

Lampnng, 114. 

Landresse, 66. 

Larang, Raden — , 144. 

Lasëm, 196. 

Lasëm I, Bhre — , 145, 146, 150, 153. 

Lasém II, Bhre — , 145, 146, 153. 

Lasém III, Bhre — , 145, 146, 147. 167, 
170, 171. 

LA86m IV, Bhre — , 145, 146, 147, 170, 
171. 

Lassen, 67, 128 

Lara ngunynn, 195. 

Larantaka, 128. 

Lawe ijo, 191, 192. 

Lawe wangsnl. Raden — , 190. 

Layang kmnitir, 186, 191. 



Layang setra, 186, 191. 

Layang setra knmitir, 186, 192, 202. 

Lëbak ciyu, 188. 

Lebar daun, Dëmang — , 130. 

Legot, 190. 

Lëksa, 68. 

Lëmah bang, 200. 

Lëmah bang, Seh — . 1 99. 

Lömbah, 79, 82, 84. 

Lëmbah, Rëtna— , 199. 

Lëmbu amisani, 175, 183, 202. 

Lëmbn ampal, 63. 

Lëmbu pëtëng (Bondan kajawan), 185. 

201. 
Lëmbu pëtëng (van Madura), 197, 199, 

200, 201. 
Leyden, 125. 

Liman, gunung — , 192, 193. 

Lingga, 130, 160. 

Lith, van der — , 67, 102, 103, 132, 185. 

Lohgawe, 58. 

Logan, 128. 

Logënder, 186, 190, 191, 192,193,202. 

Lokapala, 96. 

Lokërëp. 170. 

Loleta, Rangga — , 115. 

London, 168, 176. 

Ludaya, 192. 

Lolumbang, 54. 

Lumajang, 189, 191, 192, 195. 

Lumbang, 155. 

Lumbang, Mpu — , 54. 

Luwanu, 192. 

Maagd, de, 78, 80. 

Macan kuping, 84. 

Macan putih, 192. 

Macan tëtunggul jurit (?), 201. 

Mackenzie, 175. 

Madangkungan, 78, 80. 

Madi pandan, 200, 201. 
I Madiyun, 197, 199. 



Mada, 168. 

Madura, 68, 76, 80, 83, 116, 185,189, 
193, 197, 199, 200. 

Maesa, zie ook Kebo. 

Maesa lajér, 149. 

Maeaa nular, Kyai — . 185. 

Maesa saei, 193, 194. 

Maespati, 156. 

Magat, 160. 

Hagelen, 188. 

Maha^ainbhti, 96. 98. 

MahS.niahino, 96. 

Habapati, 116, 167. 

Maharaja, mal. vornt, 131. 

Mah&yfina, 58. 

Mahendra, 78, 80. 

Mahesa, /.ie Maesa en K6bo. 

Ma1ii?a campaka, 63, 64, 84. 186. 

Mahi^ wong atéléng, 63 

Mahribi. Snnan— , 200; Maulana -, 196, 
198. 

Majajejer, lol. 

Majalëngka, 193. 

Majapahit, Inl., 52, 56, 60, 68, 76, 85, 
8li, 87. 88, 89, 90, 91, 92. 93, 94, 
99. 100, 101, 102, 103. 117, 121, 122, 
124, 125, 126, 127, 128, 129, 130, 131, 
132, 141, 142, 145, 150, 153, 154, 155, 
158, 159, 160, 161, 167, 163, 169, 172, 
173, 174, 175, 183, 184, 186, 187, 
18S, 189, 190, 191, 193, 194. 195, 
196, 197, 198, 200, 201. 202. 203. 

Majhapahit, zie M^apabit. 

Uakasar, 175. 

Hakdum sarap, 200. 

ïlakripat. Raden—, 200. 

Halacca, 159. 

Ma-la-cba Wuli, 142. 

Malaka, 126, 128, 131, 159, 160, 161, 
162, 184, 185. 

Ualang, 60, 191. 

Veilt. Bat. fiiju, ded XLTX. 



Malat, 59. 

Malayu, 66, 67, 103, 104, 110, 126, 

127, 130, 132. 
Maleisch, 101, 102. 
Malela, Kyai—, 185. 
Malik-al-Mahniud, 128. 
Malik-al-ilansur 128. 
3talik-al-ïLabii-, 127. 
Maloka, 184, 

Ma-Da-ha-pan-lin-pang, 142. 
Manahil, 96. 

Manangkabaw, 123, 132. 
Mandana, 110. 
Mandapa, ralu — , 54, 55. 
Mandura, Pangerau — , 45. 
Maaila, 195. 
Maniyaka, 160. 
Ma^a^rt, 123, 124. 
Manggala, Pangeran — , 115. 
Manggala, zie Ranamanggala. 
Jlaiiykasar, 56, 187, 189. 
iMangkubumi, 113, 114, 115. 
-Ulaugkiiuegarn, 178. 
Jlangkiiprüja, 113. 
Mansur qah, 159, 160, 161, 162. 
Havab ailu, 127. 
Miiima.lewa. 104. 
Mas, Pangeran — , 114. 
Masabar, 184, 185. 
Mas jiwu, 159. 
Matahuu I, Bhre — . 144. 
Matabun II, Bhre-, 145, 146, 147. 
Matan, 126. 

Mataram, 54, 55, 100, 101, 112, 115, 179. 
Matararo, Bbre — , 102. 
Mataram 1, Bbre — , 115, 146, 147. 
MatüDgenog, Bra — , 175. 
Mnyer, Inl. 
Mayers, 67. 
Me4ang, 101. 
Hegalnh, 104. 



— 250 — 



Meinsma, 93, 128, 177, 183, 201. 

Mëjagung, 200. 

Méjagung, Sunan — , 199. 

Mëkah, 185, 195. 

Mekka, 112, 198. 

Mëlati, 192. 

Mëloko, 196. 

Mëmpawah, 128. 

Menaka, 130, 160. 

Mënangkabaw, 56, 127, 129, 130. 

Mëndang, 192. 

MëndaDg kamnlan, 101, 102. 

Mëfijapahit, 162. 

Mêng-Ch'i, 68, 87, 89, 99. 

Mërtawijaya, 174, 175, 187, 192, 202. 

Merveilles de V Inde, 103. 

Ming, 159. 

Modhafar sjah, 160. 

Modin, 198. 

Mohammad sjah, 160. 

Molukken, 125. 

Mongol, 99. 

Moonier, 177, 175. 

Mrakih, IdI. 

Muhamad, 115, 199. 

Muhamad, Moalana — , 113, 114. 

Mnller, 67. 

Mulya, Rëtna— , 198. 

Mastakim, 194. 

Nagur, 199. 

Nakrakasnma, 185. 

Nambi, 68, 84, 92, 93, 110, 167, 183, 188. 

Naradiraja, 160. 

Narapati, Bhra — , 155, 156. 

Narasinga, 6^4, 78, 80, 84, 156. 

Narayana, 121, 122. 

Natakasuma, 175. 

Nawa, Ratu mas — , 199, 200. 

Nawangsasi, 190. 

NawaDgsih, 185. 

NawangwnlaD, 185. 



Nayagenggong, 191. 

Nayapati, 78, 81, 85, 111. 

Negara, Arya — , 162. 

Nepal, 58. 

Netscher, 127, 129. 

Ngantang, 59. 

Ngayogya, 55. 

Niemann, 162. 

Nila utama, 126, 130, 160. 

Nuraga, 195. 

Nyai gëde pinatih, 196. 

Nyaya, 78, 81. 

Pacëkan, 86, 90. 

Paduka Qori, 118, 143, 144, 150. 

Padnka raja, 160. 

Pagar ruyung, 123, 130. 

Pagnhan I, Bhre — , 144, 145. 

Paguhan II, Bhre—, 147, 148, 165, 170. 

Pabang, 56, 124, 125, 126. 

Pahing, Inl., 173. 

Pah-ta-la-po, 140. 

Pailir, 116. 

Pajajaran, 54, 55, 92, 93, 183^ 188, 193, 

201. 
Pajajaran, Pangcrau --, 116. 
Pajang, 178. 
Pajang, Bhre — , 102. 
Pajang I, Bhre—, 144, 145. 
Pajang II, Bhre — , 147, 148, 165,167, 

170. 
Pakëmbangan, Bhre — , 145, 146, 147. 
Pakis, 60. 
Pakuwan, 55. 
Palembang, 56, 113, 114, 115, 116, 124, 

125, 126, 128, 129, 140, 141, 142, 

159, 160, 161, 162, 175, 195, 196, 200. 
Palisir, 78, 80, 85. 
Palmer van den Broek, 177. 
Paluh amba, 191. 
Pamalang, 185, 196. 
Pamali, 188. 



-^ 251 — 



Pam&nan^ 104. 

PamaDJtjangah, Inl. 

Pamasi; 78, 80, 85. 

Pamëkas, 92. 

Pamënggër, 190, 191. 

Pamotan, 118, 122. 

Pamotan I, Bhre— , 143, 143. 

Pamotan III, Bhre—, 171. 

Pamwatan apajSg, 79, 82, 84. 

Panaraga, 193, 195. 

Panataran, 123. 

Panawijen, 58. 

Païicatanda, 196, 200. 

Pandakan. 84. 

Pandan, 199. 

Pandan, Raden Panji — , 199. 

Pandan arang, 201. 

Pandan nara, 201. 

Pandan salas I, Bhre—, 145, 146, 153. 

Pandan salas II, Bhre—, 148, 163. 

Pandan salas III, Bhre—, 172. 

Panëti, 189, 193. 

Pangeran arya pepatih, 116. 

Panggnng, ' Pangeran — , 201 . 

Panggnng, Sunan — , 200. 

Pafiji, 53, 101, 102, 159, 201. 

Pafiji-verhalen, 125, 130. 

Panular, 183. 

Paragata, 78, 81, 85. 

ParameQwara, 118. 

Parame^wara, II, Bhra— , 164, 165, 167. 

Pararaton, passim. 

Parih, 137, 138. 

Parnng ware, 200. 

Pasangan, 132. 

Pasay, 56, 127, J28, 129. 

Pasir, 128. 

Pasuruhan, 58, 124, 153, 154. 

Patah, Raden — , 170, 184, 185, 186, 

196, 197. 
Pa-ta-na-pa-na-bu, 140, 



Patani, 56. 

Patjekan, 86. 

Patsieh, 86, 87, 90. 

Pëdang, 84. 

Pëkik, 195. 

Pölembang, Ki— , 199. 

Pëmanggilan, 128. 

Pënapi, 189. 

Pëngging, 187, 197, 201. 

Përcah, pulaw — , 129. 

Përnggi, 114. 

Pëtëng, 84. 

Pijaya, Tuhan— , 86, 87, 88, 89, 90. 

Piling Daha, 154. 

Pinang, pulo — , 198. 

Pinatih, 184. 

Pitrang, Kyai— , 193. 

PiwaQya, 96. 

Plered, Kyai—, 185. 

Pontang, 124. 

Pon tang, dipati — , 116. 

Pontang, senapati — , 113. 

Porong, 127. 

Prabalingga, 154, 191, 195, 197. 

Prabalingga, 188. 

Prabangsa, Ratu bagos — , 115, 116. 

Prabhu, 68. 

Prabhu istri, 143, 164, 165. 

Prabhu istri I, 158. 

Prabu anom, 173, 183, 202, 

Prabu kënya, 175, 186, 187. 

Prajapati, 78, 80. 

Prajfiawardhant, 104. 

Pralangge, Menak — , 189. 

PrameQwara, 118. 

PrameQwara I, 143, 144. 

PramiQwara, 118, 122. 

Pranaraga, 197, 199. 

Pranaraja, 78, 81, 85, 111, 167. 

Prangbakat, 167. 

Prapen, Sunan — , 185. 



— 225 — 



Pratipak^asang^aja, 96. 

Prawiradirja, 156. 

Pringgalaya, Pangeran — , 116. 

PriyaDgan, 129. 

Pucuk umun, 54. 

Padak satégal wangi^ 188. 

Pugër, 124, 189, 191. 

Pujadewa, 192. 

Pulaw laut, 128. 

Pulaw përcah, 29. 

Pulaw tinggi, 128 

Puni, 157. 

Puraga; 195. 

Purbalingga, 189. 

Puri, 170, 172. 

Pnnii^daQanta, 139. 

Pürwa, Mpu — , 58. 

Purwakanda, 180. 

Putih, 114. 

Putling tahah, 154. 

Puyëngan, 155, 191, 192. 

Pijnappel, 128. 

Rabut carat, 79, 82, 84. 

Raditya, 95. 

Raffles, Inl., 57, 66, 77, 85, 92, 93, 102, 

126, 130, 168, 174, 175, 176. 180, 

183, 187, 188, 201. 
Raganatha, 84, 167. 
Rahmat, 194, 195, 196. 
Rahmat, Raden—, 56, 184, 185. 
Raja këcil bësar, 131. 
R^asa, Inl., 53, 57, 58, 62, 63. 
Rajasanagara, 57, 120, 123, 137, 138, 

139, 142, 143, 145, 149. 
Rigasar&jya, 139. 
Rajasawardhana, 57, 171. 
Bqasawardbant, 138. 

Raksa, 68. 
Rfima^rama, 181. 
Rama Kling, 182. 
Ramawikrama, 131. 



Ranamanggala, 138, 139. 

Rnnamanggala, Pangeran — , 116. 

Randu sauga, 199, 201. 

Rangga, zie ook Loleta. 

Rangga lawe, Inl., 68, 84, 110, 116, 155, 

186, 187, 190, 191, 192. 
Rangga luwe, kidung, Inl., 85, 91, 116, 

117. 
Rangga wnni, 60, 63, 64, 66, 90, 122, 156. 
Rangknng, Ëniban — , 115. 
Rasëksi, 194. 
Ratnapangkaja, 165. 
Ratu angabbaya, 155, 156. 
Rau, 77. 
Rëjasa, 124. 
Rëksapura, 188, 189. 
Rèksayuda, 191. 
Rëmbang, 80, 83, 84. 
Rémnsat, 66. 
Rëngarëngau, 195. 
Rëtna ayu adi, 197. 
Rëtna dewi, 190 
Riaw, 128. 
Riaw lingga, 130. 
Riedel, 125. 
Roban, 191. 
Robini,.78, 80. 
Rokan, 125. 

Rembang, Ënipu — , 193, 194. 
Roorda van Eysin^a,54, 126, 155, 156, 175. 
Rosny, de— , 67. 
RouflFaer, 82. 
Roumaniê, kaap — , 128. 
Rudra, 78> 81, 85. 
Ruku, 130. 
Saba kingkin, 20. 
Saba kingkis, Pangeran — , 201, 
Sabandar, Kyai — , 115. 
Sabrang, Pangeran — , 201. 
Sabrang wetan, 200. 
Sabyautara, 165, 170. 



— 253 — 



Sadeng, 124. 

Sagënggëng, 58. 

Said, Jaka, 184, 185. 

Sajarah, zie Babad. 

Sajarah Mëlayn, 125, 127, 130, 131, 132, 

159, 160, 162. 
Sakender, Baron — , 54. 
Sala, 55. 
Salahita, 198. 
Salalassalatiu, 159. 
Salasilah Kutay, 127. 
Salasilah raja Sambas, 127. 
Saloka, 198. 
Samatra, 125. 
Sambas, 127, 128. 
Samboja, 140, 185. 
Sambor, 130. 

Sampang, Pangeran — , 201. 
Sampang, Raden — , 200. 
Samudra, 125, 127. 
San-bo-tsai, 140, 141, 142. 
Sandimaya, 113. 
Sandiragmi, 113. 
Sandisastra, 113. 
Sanggramawijaya, Nararya — , 78, 81, 84, 

105. 
Sang-ka-liet-yti-lan, 142. 
Sangkaningrat, 161. 
Sangkhya, 78, 81, 
Santri, Raden — , 184. 
Sapu jagat, 195. 
Sapii laga, 196. 197. 
Sapurba, sang — , 126, 130, 160. 
Sari, Rëtna — , 189. 
Sarëngat, 192. 
Saruni, 116. 
Sasmitapura, 184. 
Sastra, Menak — , 189. 
Sastrajaya, 195. 
Sastrawijaya, 195. 
Satmata, 185. 



Sayit, 197, 198. 

Scheepmaker, 59. 

Schlegel, 66, 67. 

Schwaner, 56. 

Sëbatang, Datu Përpatih — , 129. 

Sëbdagenggong, 192. 

Sëbdapalon, 191, 192. 

Sëbdayuda, 192. 

Sëdayu, 86, 198. 

Sëgantung, bukit — , 126. 

Sëgara rupak, 189. 

Seh, Sayit — , 195, 196. 

Sëkandar, Hang — , 161. 

Sëkandar shah, 131. 

Sëkandar sjah, 160. 

Sëkar dalima, 184, 185, 198. 

Sëkar mandapa, 54. 

Sêkati, Rëtna — , 192. 

Sela, Kyai — , 185. 

Selaparang, 128. 

Sëmauggi, 197. 

Sëmangka, 114. 

Sëmbawa, 187, 189. 

Sëngara, Jaka — , 197. 

Sëngkëlat, 198. 

Sëngguruh, 201. 

Seram, 175. 

Seran, 124, 125, 126, 128. 

Sërasan, 128, 201, 202. 

Sërat kanda, 54, 156, 180, 181, 186, 

187, 188, 201, 202, 203. 
Setra kumitir, 191, 193. 
Sëtraprameya, 192. 
Shih-pi, 66, 68, 86, 87, 88, 89. 
Siam, 142. 

Siantau, 128, 161, 162. 
Sibrahim bapa. 128. 
Sidayu, 194. 
Siddhi, 78, 80. 
Siguntang, 162. 
Sih-lah-tan-pub-hah, 88, 



— 254 — 



Sih-la-nan-da-cba-ya^ 87. 

Silah-patti, 88. 

Silah pat-ti-sihlah-tan-puh-hah, 88. 

SilalatassalatiD; 125. 

Sinagara, 171, 172. 

Sin Derga, 175. 

Sindok, Mpu — , 58, 98. 

SinëUr, 62, 63. 

Singajaya, 115. 

Singapnra, 160, 175. 

Singapnra, Bhre — , 148. 

Singaraja, Pangeran — , 115, 116. 

Singar^ja, 173. 

Siugaraya, 160. 

Singasari, 101, 153. 

Singhalanggalaparwa, Inl.. 

Singhapura, 126, 130, 131. 

Singbajaja, 165. 

Singlar, 78, 80, 85. 

Siti jënar, 196. 

Siwatang, 129. 

Siyëm, 190. 

Siyung wanara, 92, 93. 

Snouck Hurgronje, 127, 177. 

Sokadana, 190, 192, 194, zie Snkadana. 

Sokapma, 188. 

Sombro, 189. 

Sondes 121. 

Sopal, Menak — , 189. 

Sora, 84, 110. 

Sore pajok, 191. 

Soro, 114. 

Sotor, Raden—, 145, 146. 

Srawnlan, 194. 

Srëngat, 57. 

Sri bini. Wan — , 130. 

Stanggil, 100. 

Stockholm, 103. 

Subi, 128. 

Sugalu, 86. 

Suhita, Dewi— , 145, 146, 147, 151, 152, 



153, 155, 164, 165, 166, 174. 

Sukadana, 198, 199, en zie Sokadana. 

Snkarsa, 54. 

Snkasada, 173. 

Sulakërta, 116. 

Suhi, 157, 175. 

Snmana, Raden — , 144, 146. 

Sumatra, 77, 103, 104, 123, 125, 126, 

127, 129, 132, 140, 141. 
Sumbawa, 125, 128, 141, 175. 
Sumédang, 188, 198. 
Sumëlang Gandring, 193, 194. 
Sumënëp, 68, 77, 116, 175, 199, 280. 
Sumënëp, Sultan — , 77. 
Sumëngka, 166, 170. 
Sumeru, 191. 
Sumirang, 196. 
Snmirat, Raden — , 145. 
Sunda, 124, 125, 136, 141, 168. 
Sundari, Wan—, 130. 
Sttngënëb, 68, 84. 
Supa, 187, 193, 194, 198. 
Snpala, 184. 
Supali, 184. 
Suprabha, 130, 160. 
Sura, 174. 
Sura, 198, 200. 

Surabaya, 59, 77, 86, 90, 185. 
Sura curiga, 198. 
Suradadi, 200. 
Suradi, 200. 
Surajaya, 191. 
Surakërta, 178 
Suraprawira, 192. 
Surasaji, 113, 116. 
Surasastra, 191. 
Surasowan, 113, 114. 
Snratman, 193. 

Suruh, Jaka — , 174, 193, 194. 
Suruh, Menak — , 195. 
Surya, Baden — , 199, 200, 201 



Snsarnfa, Jaka— . Raden— , 92, 93, 175, 

188. 
Sntasoma, 139. 

Tadah. Atya — , 132, 167, 168. 
Taha, 88, 90. 
Tahah, 154. 
Tajuk, 195, 196. 
Tajnng, 203. 
Talaga pagér, 84. 
Taloiümi, 195. 
Tambak baya, 198. 
TandnraD, Kaden — , 174, 175. 
Taüjuüg, 203. 
TaDJOTg, Era — , 175. 
Tai^ung balang, 130. 
TaüjUDg bemban, 126. 
Taüjung pura, 124, 125, 126, 129, 130, 

160, 161. 
Tafijnng para, Bhre — , 147, 148. 
Tan-ma-sa-Da-bo, 141, 142. 
Tanoran gagang, 55. 
Tantniar, Mpn — , 138, 139. 
Tamate, 187, 189. 
Tarnb, 185, 201. 
Tarnb, Kyai — , 198. 
Tatar, 91. 
Tayu, 195. 
Tëgal, 191. 

Teja, Arya — , 184, 192, 195. 
Temasik, 130. 
Tënggêr, 190. 
Temate, 175. 

Tërnng, 184, 196, 197, 20O, 201. 
Tolila, 78, 80. 
Tkahir, 129. 
Tidang galatiog, 169. 
Tidnng kalati, 169. 
Tigang jum, 117. 
TilótUma, 130. 
Timbalan, 128. 
Timor, 175. 



Tingkir, Jaka — , 178. 

Tirang, pnlo — , 201. 

Tirang ampel, 201. 

Tiris, 193. 

Tita, Tnhan— , 58. 

Tiyoman, 128. 

Tobjaya, 60, 63, 64, 85. 167. 

Trawnlau, 197, zie ook Gitrawnlas. 

Trönggana, Pangeran — , 201. 

Trënegann, Baden-, 199, 200, 201. 

Tribhimana. 130, 131, 160, 

Tromp, 127. 

Tning, 79, 83, 84. 

Ts'e-te'un, 90. 

Tuban, 86, 88, 90, 126, 185, 187, 188, 

189, 190, 191, 192, 193, 195, 196, 200. 
Togo, 188. 
Tnlang bawang, 114. 
TnlM, 104. 

Tnmapaa, 87, 89, 90, 154, 157. 
TnmapSl, Inl., 57, 68, 66, 67, 68, 69, 

76, 78, 79, 82, 84, 87, 89, 90, 133, 

153, 154. 
Tnmapël I, Bhre—, 144, 146, 146. 
TnmapSl II, Bhre — , 146, 146, 173. 
Tnmapêl III, Bhre—, 145, 146, 147, 

153, 156, 164, 170. 
Tnmapel IV, Bhre—, 169, 170. 
Tnmaaik, 124, 12.i, 126, 129. 
Tampang, 64. 
Tanggnl ametnng, tal., 60. 
Tnngkal, 160. 
Tniiingtsab, 86. 
Turen, 67. 
Taryantapada, 67. 
Tauk, TOn der — , lal., 60, 77, 128, 

130, 132, 160. 
Tawab, Hang — , 126, 161. 
Tawah, Hang — roman, 162. 
Udaniogkaag, 175. 
Udara, 183, 186, 190, 192, 193, 197, 202. 



— 256 — 



Ujang sabata, 183, 189, 202. 

Umanis, 78, 80. 

Undakan, Raden — , 196. 

Undung, 196. 

Undang, Raden — , 195. 

Undung, Sunan— , 199, 200. 

Urang ayu, 114. 

Usen, Raden — , 184. 

Valentgn, 125. 

Verbeek, 57, 59, 60, 64, 68, 104, 123, 

124. 
Verijssel, 178. 
Veth, 67, 115, 127, 128. 
Vreede, Inl., 156, 177. 
Wadyaji, 113. 
Wahan, 183, 202, 203. 
Wahas, 188, 189, 202. 
Wahita, 155 
Waita, 191, 192. 
Walanda, 55. 
Walckenaer, 67. 
Waleri, 189. 
W:ilere, 191. 
Wali, Seh — , 184. 
Wali lanang, Seh^ , 185. 
Wall, von de — , 56. 
Wanagiri, Nyai gëde — , 115. 
Wanawala, 201. 

Wandan, 184, 186, 187, 195, 198. 
Wangsadipa, 114. 
Wan Sri Bini, 130. 
Warigadyan, Inl., 173. 
Warigagang, 173. 
Watangan, Raden — , 186, 192. 
Weegsschaal, de — , 121. 
Wëkasing snkha, 137. 
Wëlanda, 55. 
Wölandi, 55. 
Wéngkër, 118. 
Wéngkër I, Bhre — , 143. 
Wëngkér II, Bbre — , 147, 148, 166, 170. 



Werajya, 78, 80. 

Wyadiraja, 160. 

Wijamanggala, 113, 116. 

Wijaya, Bra— . 175, en zie Brawijaya en 

Browijaya. 
Wijaya, Raden— , Inl., 53, 60, 68, 76, 84, 

85, 90, 91, 93, 105, 110, 112, 117, 

122, 133, 145, 146, 150, 167, 174, 203. 
Wijayakrama, Pafiji — . 117. 
Wijayamottama, 117. 
Wijayarajasa, 118, 121, 122, 143. 
Wikrama, Aji — , 1.50. 
Wikrama\vira, 131. 
Wikusnnia, 159. 
Wilatikta, 198. 
Wilatikta, Tumënggnng — , 184, 185, 

195, 196. 
Wilung, Menak — . 189. 
Wilwatikta, 139. 
Winter, 156, 177. 
Wirabhumi, Bhre—, 145, 146, 147, 149, 

150, 152, 153, 155, 163, 164, 166, 174. 
Wiraja, zie Wiraraja. 
Wiraraja, 68, 78. 81, 84, 93, 110, lil, 

117, 167. 
Wirasaba, 200. 
Wiro, 92, 93, 183, 202. 
Wirot, 84, 93. 
Wi?nn, Bhatöra — , 53. 
Wienuwardliana, 60, 64, 66, 90, 121, 

122, 156. 
Wi^ti, 96. 
Wiyat, 121. 
Wong atëlëng, 53. 
Wraspati, Inl. 
Wukir polaman, Inl., 104 

Wuli, 142. 

Wu Pin, 159. 

Wurn agraja, Rakryau — , 79, 83, 85. 

Wnrujn, Tuhan- , 148. 

Yama, 78, 80. 



— 267 — 



Yang Wi-si-sa, 157. 

Yasadipura, 173, 178, 

Yawa, 78, 80, 84, 121, 138, 139. 

Yogya, 178. 

Yogyakarta, 93. 



Yttan, 67, 88, 140. 
Yudanégara, 115, 116. 
Yusup, 179. 

Yusup, Maolana — , 113. 
Zabej, 102. 



Verk ikrt, Ociu, deel XLIX. 



17. 



Aaivhaïvg 



TOT 



m REGISTER VAN DE IN M AANTEERENiNGEN YOORKONENDE EIGENNAMEN. 



56, .bji>U 

56, ^bjU 

102, 103, oJjÜj- 

102, ^jÜ^ 

130, cirUuu 

56, jj[jcl«* 

56, j)jij^ 

130, |»UV IaJ 

56, jj^ 

56, jjf^ 

128, jtiU A 



160, Jttï 
56, &1« J^ 

126. ii<:„u; 



127, ^li r^)j LU^ 



180. 

126, 127, ^Ui) au 
129,'^1^^« 

129, to.y yy 

160, ^ï ^y- 

102, JJ4I» «w.jI»c cjÜT 

161, ^ 
56, ^'^ j^ 



WOOKBENSGHAT 



Tot kenschetsing van de taal van een geschrift staan twee wegen open, 
men kan er eene verhandeling over schrijven, en men kan er eene voorstelling van 
geven in den vorm van een woordenboek. 

Aan de laatste wijze van doen werd hier de voorkeur geschonken, omdat 
men daarmede den weetgierige de gelegenheid opent zelf alles te controleeren en 
een gepast overzicht te krijgen van wat er wèl en wat er niet voorkomt, beter 
nog dan door een verhandeling, waarin allicht het ]een of ander onbesproken 
blijft. Ook was in dit geval de lexicographische voorstelling daarom aanbeve- 
lenswaardig, omdat zij ook later beter in staat zal stellen het Javaansch van de 
Pararaton, waarvan de tijd van vervaardiging niet geheel onzeker is, te vergelijken 
met dat van ouderen tijd en de latere phasen. Hoewel niet zeer omvangrijk, le- 
vert de Pararaton toch het gros van de meest frequente woorden, terwijl de hier 
en daar vrij levendige stijl ook het aantal woordvormen niet onbeduidend deed 
zijn. Volledig opgegeven wat men er in aantreft, zal een geordende woordenlijst 
de legger kunnen worden voor verdere onderzoekingen, en wat juist veeltijds ont- 
breekt, waar men zich tot mededeelingen bepaalt, de directe gelegenheid tot het 
controleeren van de waarde van het gegevene tegenover het geheel, dat mist men 
bij de behandelingswijze die hier g-evolgd werd, zeker niet. 

De volgorde bij de rangschikking in acht genomen is die van het Javaansche 
hanacarakan, met de gewone veronachtzaming der klinkers, welke eerst in tweeder 
instantie daarbij in hunne waarde gelden. 

Wat de spelling betreft, — en dit geldt ook voor den tekst boven, — dient 
er op gewezen te worden, dat de h ook aan het begin van een lettergreep naar 
alle waarschijnlijkheid stom is, doch by het transcribeeren behouden werd eensdeels 
waar men haar werkelijk voorkomen in het oud-Javaansch kan staven, en ander- 
deels daar waar er geen samenloopen of samentrekking heeft plaats gehad, en 
men dus met hiaten te doen heeft. 

Daar boven de tekst in zijn geheel van woord tot woord vertaald werd, 
werd het overbodig geacht, hier de vertaling der enkele woorden nog eens te 
herhalen. Betreft het gewone, alledaagsche woorden, als anakj harep, enz. bijv. 
dan kan zij wel veilig altijd achterwege blijven; waar de vertaling moeielijkheden 
levert of onzeker is, daar geven de niet ontbrekende verwijzingen dadelijk den 
weg aan on^ elders, in de vertaling, te vinden wat men zal willen zoeken. 



i, 1, 13; 7, 6; 24, 82; 18, 88; jwirika. 

e, I, 5, 81 ; 13, i6; 16, 21. 

e, II, (-e), zie ya. 

he, 12, 18; 14, 12. 

ah, 11, 31 ; 15, 24. 

eh, 2, 13; 8, 32; 9, 12. 

ahingan, 10. 21; 11, 6 hingan. 

hana, 1, 2, is; 2, 9, 23; 3, I6, 22, 24; 
4, 4, 7, 26; 5, 1, 9, 11, 81, 88; 6, 1, 
4, 8, 21, 27; 7, 4, 10, 18, 18; 8, 20, 

27, 30, 83; 9, 19, 22, 26; 10, 8, 10, 
14, 31, 32; 11, 11 ; 12, 10, 16, 80,85; 

13, 7; 14, 2, 8, 24; 15, i; 16, 15; 
17, 26; 18, 8, 16, 19, 28; 20, 24; 

21, 30; 23, 6, 18, 22, 23, 24, 88; 24, 

8; 25, 12; 26, 12, I8, 20, 22; 27, 2, 

16; 29, 15, 24, 34; 32, 14. 

hanaba, 7, 26. 

haneng, 3, 27; 22, 1; 26, 20, 30. 

hananing, 4, 8 ; 8, 10; 12, 33; 23, 2; 26, 17. 

sahaneng; 7, 20; 13, is. 

kapibanan (?) 5, 12. 

comp,, norana. 
ano, 5, 2. 
ina. 

rama-rena, 3, 8. 
hino, 29, 24, 25. 

hinweng, 29, 25. 
uni, I, 29, 6. 

unining, 18, 33; 22, 17. 

muDi, 8, 14. 
uni, II. 

ring uni, 16, 7. 
anak, 3, 27; 5, 33; 9, 7, 14. 

anake, 14, 2, 3. 

anaking, 13, 84. 

anakira, 1, 8; 2, 80; 3, 25, 29;5, ;8«(; 6, 



1; 7, 82; 9, 16, 28; 12, 80; 13, i;14, 

1, 8, 4; 15, 12, 29; 19, n; 27, 88. 

anakmami, 3, I6; 9, 85. 

anakingsun, 2, 31; 9, 31, 88; 23, 88. 

anakputune, 12, 8. 

anakputunira, 12, 5. 

anakanak, 5, 1; 9, 20. 

ranakira, 7, 5; 9, 5; 11, 8; 27, 85. 

sanak, 12, 10. 

sanakira, 16, 12. 

sanakingsun, 15, 5. 

asanak, 27, 1. 

apasanakan, 3, 20. 

kaponakan, 16, I6. 

kaponakaningong, 16, 22. 
enak, 11, 20; 17, 6; 22, 25. 

apakenak, 19, 7. 

enakan, 17, 14. 
ëndi, 10, 28; 11, 28. 

ndi, 8, 18. 

punëndi, 7, a; 9, n; 10, 28. 
undur. 

muudur, 19, 28, 33; 20, 18, 11. 
andika, 14, 5; 16, 24; 19, 6; 22, 19, 

21; 23, 4. 

andikanira, 14, 9; 16, 29; 17, 2; 20, 

17, 85; 21, 83; 22, 20, 36. 

sahandika, 17, 29. 

angandika, 13, 15, 23; 14,'ii; 20, 7; 21, 17# 
undakan, zie undakan. 
andél. 

angandéli, 15, 8. 

ingandei, 22, 5. 

kandél, 17, 14; 18, I8. 

pikandél, 16, 2. 

kapihandël, 7, 17. 
andang. . . 



— 264 — 



aDgnndaDg, 16, 2$; 27, si. 

inundang, 15, 15. 

ingundang, 17, si; 13, 82. 
anti. 

apaDganti, 11, 25. 

apangantenan, 1, is. 
hënti, 3, 11; 22, «7. 
inte. 

inginte, 6, 15. 
antara. 

tanpantara, 8, is, I6. 

camp.: Dusantara. 
aDtariksa, 28, 14. 
antnk, 5, 2i; 28, 19. 

antnke, 2, 28. 

antuking, 22, 11. 

antnkipuD, 15, is, 16 ; 16, 4, 6; 23, 7. 

antukira, 2, 32; 12, 2, 22, 28. 

antukaning, 24, 10. 

tanpantnk, 6, 4; 19, 24. 

pakantukipnn, 22, 11. 

mantak, 3, 19, 22, 23; 2, 26; 4, 28; 

6, 80; 7, 8, 6, 7; 12, 9; 15, 14; 17, 

84; 21, 5,^ 16, 82; 22, 12, 28; 26, 81; 

27, 80. 

sira-antuka, 20, 12. 
antaka. 

antakanira, 16, 12. 
ëntas. 

méntas, 8, 28; 21, 9. 
antyanta, 3, 8I; 4, 5; vgL atyanta. 
hinwa, zie hino. 
nndnh. 

nnduhën, 4, s. 

aDgonduha, 4, 6. 
nnduk. 

iDgnndakandakaD, 6, 12. 
nndakan, 14, 26; 28, 5; vgl. andakan. 

andnl. 

. * 

angandulandul, 28, 5. 



andëg. 

mandëg, 19, 5. 

angandëg, 20, ia. 
undaDg. 

angnndangeng, 28, 80. 
nndnng. 

undangundung, 6, n. 
anugraha. 

kanugrahan, 25, 17. 
inëb. 

ingiDëban, 24, 23. 
hënëng. 

mënëng, 10, 10; 12,85; 15, 11; 16,27; 

25, 26; 28, 12. 

mënënga, 26, 27. 
iccha, 21, 21. 
ucap, 25, 12. 

angucap, 2, 20, 5, 31 ; 12, 4, 6, 18, 33, 35; 

19, 2S; 23, 18, 87; 24, 6; 25, 84; 26, 

27; 28, 9. 

ucapên, 13, 33; 15, ö; 28, 28. 

ucapakëna, 21, 38. 

pangucap, 2, 14. 

pangacaping, 12, 25. 

paDgucapira, 6, u. 
er, 24, 19. 
her, 

anger, 3, 8. 

angher, 3, 12, 82; 5, 16, I6; 6, s: 18, 

19; 23, iB. 

angera, 22, 4. 

anghera, 22, 4; 23, is- 

paDgeran, 19, 32 ; 20, 18, 80; 22, 2; 23, 

)9, 25; 26, 29. 

pangeranmn, 28, 10. 

apangerana, 26, 28. 
ari, 13, 5. 

arine, 13, 10. 

arinira, 3, 25; 13, s, 6, g; 14, 19. 21: 

27, 3, 28. 

il» (-ira), zie edra. 



— 265 — 



arah. 

apangarah; 28^ se; 31^ 5, 9. 
aran, 1^ 19; 2, i, 24; 3^ iS; I6; 26; so; 

5, 6, 16; 6, 88; 7, 4, 6, 8, ai, 34; 9, 

4, B, 10, 22; 10, 24; 11, 12, 18; 12, 10, 30; 

13, 4, 5, 6, 7, 8, 9, 10; 14, 1,4, 6,2); 

16, 16; 18, 10, 14, 16, 17, 24, 19, 11; 

20, 82; 22, 80 ; 24, 28, 29; 26, 12; zie 

ook ngaraD. 

arane, 2, 6; 10, 16, 36; 15, s. 

araning, 6, 7; 10, 20, 84; 13, 28; 15, 8. 

aranira, 13, 11. 

araningODg, 8, 34. 

ingaran, 7, 12; 19, 1; 23, 8. 

ingaranan, 13, 2. 
aron, 15, s; 17, 1. 
arik. 

saarik-purih, 14, 1. 
arëke, zie rëke. 
irika en iriki, zie ika. 
arddha, 32, 31. 
ardhanarïQwari, 10, 36. 
arit. 

pangaritaritaD, 21, 2. 
ar?a, 22, 20, 83, 36; vgL arya. 
harëp, 2, 12; 3, 33; 11, 9; 13, 26; 14, 

8; 17, 8, 4; 25, 6; 26, 2, 16; 27, 3; 

28, 37; 29, 1. 

harëpingsun, 12, 2. 

harëpharëp, 26, 28. 

kaharëpira, 10, 20. 

sakaharëpira, 10, 21; 11, 6. 

akakarëpan, 12, 33. 

angarëpi^ 6, 9. 
hurip. 

ahurip, 25, u. 
arja. 

kapaharjaha, 32, 30. 
arya, 18, 17, 32; 19, 10; 22, 1; 24, 7; 

25, 9; 26, 6, 34, 36; 27, 30, 86; 28, 

19^ 27; 29, 10; zie nog ar^. 



orëm. 

orëmira, 25, 1. 
urug. 

ingumgan, 8, 13. 
urub. 

urubipun, 20, 4. 

inurub, 2, 24, 26, 29 ; 4, 26, 27, 28 ; 10, 6, 

10, 17, 82, 84, 20, 4. 
liirëng, 8, 8, 12. 
iring. 

samering, 21, 1. 

miring, 19, 25. 

umiringi, 19, 22. 

angiring, 20, 21, 24, 26; 26, 17, 21,20. 

ingiring, 19, 10; 22, 21. 
urang, 29, 3; 29, 4, 5. 
iriDgsnn, zie sun. 
iriDgong, zie ngong. 
aku, 9, 7. 

akna, 23, 24. 

angaku, 7, 13; 10, ss. 

angaknakn, 2, 28. 

ingaku, 3, 19, 27; 5, 28; 7, 11; 29, 19. 

den-aku, 2, 27. 

akonakoningsnn, 9, 14. 
ika, 1, 9; 2, 26; 3, 6; 4, 28; 8, 21; 11, 

1, 18; 12, 2; 21, 8. 

rika, 6, 27; 8, e; 10, 11, 12. 

irika, 1, 12, u; 2, 2; 5, 11,13, I6; 14, 

24, 32; 20, 5; 22, 1; 23, 24. 

maririka, 6, ^6. 

punika, 4, 7, 9, 13, 17; 5, 20; 6, 17; 10, 

25; 11, 6, 16, 17, 20; 12, 29; 21, 21; 

22, 8, 18; 23, 7; 24, 9. 
iki, 5, 34; 6, 14; 9, 32; 11, 82; 14, 10; 

16, 22, 23; 23, 20: 25, 36; 28, 10. 

iriki, 20, 38. 

maririki, 24, 7. 

puniki, 4, 18; 9, u; 11, 30; 16, 36; 

17; 27; 20, 10, 24. 
iku, 2, 6, 6, 11, 21, 81; 4, 8, 16; 6, 2, 



— 266 — 



18; 7, 24-, 10, 12, 14, 16, 16, 86; H, i; 

12, 6, 6, u; 16, 80; 18, 3; 20, 10,23; 

23, 26; 26, 28; 28, 10. 

ptmiku, 2, 81, 83; 3, 1; 7, 7; 10, 17; 

24, 21. 

akara, 4, 24; 24, 27; 26, 24. 
akfi^a, 3, 16, 7, 23, 25; 14, 10. 
aki^ra, 3, 84, 86; 4. 1. 
ikang, 7, 33; 8, 17; ^»e ook kang. 
adi, I. 

adinya, 29^ 9. 

adining, 26, e; 29, 2. 

makadi, 13, 30, 33; 16, 21; 22, 9; 21, 

10, 33; 24, 18; 26, 5; 28, 1, 7. 

pinakadi, 22, 28, 80. 

pinakadiniDg, 14, 23; 19, is. 
adi, n. 

aDgadyani, 10, 19; 11, 9. 

angadyanana, 10, 20. 

pangadyanira, 11, 4. 

adyanadyanira, 11, 7. 
adn. 

angadn, 26, i6. 

angadokën, 16, 12. 

ingadokën, 27, 6. 

ta-adunipoD, 16, 10. 
hndan, 8, I6. 
idër- 

midër, 8, 28. 
adipati. 

adhipatia, 18, 18. 

kadipaten, 21, 23, 26. 
adyak^a, 18, 23. 
adimakya. 

adimnkyaning, 10, 6. 
adëg. 

adëging, 25, 6. 

angadëg, 15, 28; 18, 6; 25, 3; 28, 4. 

angadëga, 13, 13, 14. 

ingadëgan, 31, 9. 

angadëgakëD, 13, 22; 18, 8. 



angadëgakftna, 25, 0. 

pangadëg, 14, 7; 24, 31. 

pangadëge, 16, 22. 

pangadëgan, 29, 26. 

pangadëganira, 27, 24, 26. 
hati, 3, 34; 9, 9, 13. 

hatinira, 27, 36. 

pinakatihati, 14, 21. 

comp. : walangati, prihatin. 
iti, 32, 27. 
atër. 

ngatëra, 7, 5. 

augatërakën, 18, 26; 22, 24. 

ingatërakën, 22, 24; 24, 15. 
atur, 20, 23; 22, J5, 17; 23, 4, 12. 

aturiog, 15, 2; 17, 28; 20, 23, 81. 

aturira, 16, 27: 17, il; 19, 32; 21,20, 

30, 36; 22, 34. 

aturanira, 23, 25. 

matur, 15, 22; 16, 24; 17, 16; 18, 34; 

20, 8, 10; 21, 28; 22, 2; 28, 26, 84, 36. 

matura, 15, s; 23, 18. 

den-atur, 27, 7. 

katur, 21, 6; 32, 2. 

kabatar, 14, 18. 

angatiiri, 18, 20, 27; 21, 22, 23, 31, 32, 88. 

iDgaturau, 14, 11 ; 19, 6, 20; 20, 33; 21, 

16; 23, 27; 31, 8, 6. 

aturana, 22, 37* 

katuran, 14, 30. 

angaturakën, 19, s; 22, 17; 25, 13. 

tanpangaturakën, 28, 31. 

augatiirakëna, 22, 16; 24, 5; 28, 37. 
hëtët. 

abëtëtan, 27, 4. 
uttama, 10, 36. 
atus. 

satuse, 14, 1. 
utus. 

angutn8, 18, 24. 

ingntofl, 28, 30. 



~ 267 — 



ntüsan; 22; 81; 23, n, so. 

aatuBaii, 18, 82. 

apotnsan, 28, 3. 
atyanta, 9, 21, 25; 12, 31, 37; 14, e; 18, 

7; 21, 87; 22, 85, vgl. antyanta. 
atag. 

ingatagakëD, 7, 20. 
hitang. 

kahitang, 3, is. 
hntang, 4, 31. 

hntaDgisun, 21, 34. 

hatangta, 3, ie. 

kapihntangan, 7, 8. 
asa. 

comp. : salahasa. 
isi. 

esi, 20, 33. 

a-Ui, 20, 35. 
icmn, zie san. 
a^raya. 

comp.: paragraya. 
aframa. 

aframeng, 7, 11. 

aframanira, 1, e. 

a^ramaniDgstm, 6, 20. 
esak, 20, 14; vgl. eöjaDg. 

comp. ëmbesnk. 
astu, 1, 1; 32, 82, 33, 32. 

inastwan, 1, 12. 

iDgastwanlDg, 14, 14. 

kastwanira, 8, 22, 23. 

iDastwakën, 8, 23; 13, 28. 

astokëna, 14, 12. 
astri. 

ingastryan, 13, 29. 

ingastren, 16, 19. 
Utri, 10, 10, 14, 15; 13, 10; 19, 87; 20, 

2, 5, 6, 13, 21; 21, 5, 11, 22, 24;24, 1, 

25, 27, 1, 18; 30, 3, 6. 

istrinira, 6, 24. 
ifwara. 



comp.: parameQwara. 
iijwari, 

comp.: nariQwari, arddhanarifwari. 

isëm. 

mesëm, 7, 6. 
asing, 11, 1. 
ewu. 

wolung ewu, 3, 7. 
awih. 

awihën, 25, 1. 
iwëh. 

kewëh, 5, 9. 
iwuh, 

sakewuhira, 27, 35. 
hawan, 4, 34; 5, 4, 16. 

tanpahawan, 8, 27. 
awiramena?, 28, 32. 
awak, 1, 8. 

angawaki, 25, 31. 

pangawaking, 6, 29. 
awus, vgl. huwus en wns. 

awusan , 22, 37 ; 23, 2. 

kawus, 24, 12. 
huwus, zie ook wus et* awus, 2, 22; 

11, 13, 20, 32; 12, 23; 14, 7, 32; 

16, 2, 19, 7; 23, 23; 24, 4; 25, 18; 26, 

26; 28, 21. 

huwusa, 11, 18. 

huwusing, 1, 17; 2, is; 11, 26; 18, 24. 

huwusnira, 1, u. 

den-hu wus, 11, 22. 

anghuwusakëna, 3^ 16; 7, 16. 
awighnam, 1, 1. 
hwang. 

humwang, 8, 16. 
awang. 

awangawang, 5, 22; 14, 26, 31. 

angawangawang, 14, 23. 
awëng, kawëngan, 10, 7. 
ala, 10, 11; 20, 37. 
I alaala, 19, 8. 



— 268 — 



alaalanC; 24^ 17. 

ingalan, 21, 4. 
ilu. 

milu, 5, 2; 9, 8; 14, 28; 22, 37; 23, 

26; 28, 25. 

milna, 23, 22. 

suD-iloDana, 31, 6. 
ula. 

ulanipun, 18, 37. 
alah, 3, 13, 21,- 14, I6, so; 18, 10. 

alabira, 3, 2I. 

angalabakën, 23, 26; 27, 15 

angalabakéna, 14, g. 

kalab, 14, 10, 28, 34; 23, 23; 24, 4; 

26, 9; 28, 21; 31, 7, 10. 

kalabing, 24, 12, 13. 

kalaha, 14, 10. 
alib. 

aDgalib, 23, 28; 29, 25. 

ingalibakën, 26, 34. 
ulab. 

nlabaning, 10, 21. 

polabing, 26, 21; 28, 34, 86. 

polabira, 7, 12; 23, 12. 

sapolabira, 15, 30. 

angulabakëD, 1, 19. 
ulib. 

saulibira, 9, 28; 10, 9; 26, 32. 

mulib, 2, 11, ]8; 6, 28, 32; 7, 35: 14, 

38; 23, 26; 25, 20; 26, 21, 22. 

den-mulib, 2, 17. 

muliba, 1, 11; 3, 16; 22, 2I; 23, 20. 

angulibi, 25, 16. 
olib, 11, 12; 12, 6; 24, 27; 25, 24. 

olibing, 1, 7; 32, 31. 

olibira, 4, K 

tanpolib, 11, 31. 
bulnn. 

pabnlunan, 16, 18. 
bëlar. 

pihakahëlarira, 5, 26. 



pinakabëlaranira, 5, 23. 
hëlët, 25, B, 21, 28; 27, 7 (lët); 28, 16; 

31, 16. 
ulat. 

angulati, 8, 29; 24, 6, 8^ 

ulatana, 9, 1. 
alas, 5, 1, 2, 3; 6, s, 7, 16; 20, 2», 24. 

31; 21, l; 28, 4 

alasing, 22, 5, 11; 23, 4 6. 

angalas, 6, o. 

paii^alasan, 23, 27; 26, 12, 20. 

pangalasaning, 15, 26, 17, 22. 

pangalasanira, 15, 16; 23, 19, 20, 26. 
balisyus, 8, 13. 
haliwawar, 8, 15. 
alalang, 4, 19, 26; 21, 2. 
alap. 

angalap, 11, 5; 15, 9; 29, 17, 26; 30. 

6, 16. 

angalapa, 10, 15. 

ingalap, 24, 37; 27, 25. 

kalap, 27, 23; 29, 23; 30, 7, 10, 11, 13, 

14, 15. 

kalaping, 27, 14. 

(len-alapa, 23, 38. 

saii-alape, 11, 3. 

alapën, 27, 2. 

jiugalapdo, 3, 24. 

kulapdo, 30, 16. 
alaya. 

comp,: dewalaya. 
ulam, 6, 23. 

polaman, 24, 88. 
alang, I. 

kalangan, 19, 34. 
alang, II. 

palangalaDganiug, 4, 26. 
aling. 

alingan, 28, ^. 

ingaÜDgan, 5, 28. 
hilang, 3, e; 6, 14. 



— 269 — 



parahilang, 24, 19. 

angilangakën, 5, 8; 16, 31, 30; 18, 9, 23; 

25, 31; 32, 2. 

angilangakëna, 16, 29, 35; 17, 13. 

ingilangakën, 5, 5; 8, 3; 16, se; 17,5, 

9, 23, 24; 26; 25, 22, 82; 26, 11, 14,3], 

27, 3; 28, 28; 31, 32. 

ndak-ilangakën, 16, 30. 

ilangakëna, 16, 33; 17, 4. 

kelangan, 6, 13. 
iling. 

angilingilingi, 1, 17. 
apa. 

angapa, 16, 23; 26, 28. 

angapaha, 2, 16. 

sun-kapakëna, 2, 16. 

punapa, 10, 11, 27, 34; 15, 4, 10; 17, 16; 

20, 23; 21, 29. 
api. 

apiapi, 22, 3. 
ipu. 

kepwan, 6, 13. 
ipnb. 

epuh, 23, 32; zie ipu. 
upah. 

angupahakën, 15, 30. 
apan, 6, 2, 21; 11, 32; 12, 26; 13, 17 ; 

14, 23; 17, 26; 19, 1, 7; 20, 8, 11, 

27, 34; 21, 13; 23, 21; 24, 4, 12, 17; 

25, 16; zie nog pan. 
ipun (-ipun), zie pun. 
open, 32, 31. 
npacara. 

upacaraning, 4, 5. 
ingnpacara, 24, 14. 
apura. 
ingapura, 22, 8, 18. 
kahapuraba, 27, 34. 
upakara. 

pangupakaranira, 21, 37- 
upata, 7, 26. 



apës. 

kapësan, 31, 17. 
apus, 1, 9. 

apusira, 1, 3. 

angapus, 24, 33. 

ingapus, 24, 20. 

angapusi, 25, 7. 

kapusan, 25, 7. 

pangapnsisnn, 23, 25. 
upaya, 22, 2. 

upayanisun, 23, 18; 24, 7. 
upama, 2, 33. 

npamanira, 16, 26. 
adnh, 19, 28. 
uduh, 7, 2. 
hidëp. 

ahidëp, 13, 27; 17, 23; 20, 31. 

ahidëpa, 22, 10 ; 24, 20; 25, 8; 28, 10, 30. 

angidëpakën, 4, 27. 

den-hidëp, 28, 10. 

kedëp, 3, 10; 18, 20. 
idam. 

ngidam, 10, 3. 
adang. 

angadangadang, 4, 34; 6 22. 
aja, 3, 8; 22, 37; 23, I8; 24, 17;25,1J. 
aji, I, 

ingajen, 3, 7. 
aji, II, 18, 34, 36; 22, 17, 18, 19; 24,31, 

82; 26, 12; 29, 21. 

siraji, 13, 14, 19, 22; 14, 8, 9^ n, 15, ie, 

19, 25, 30; 16, 29; 18, 19, 27, 28, 31, 
82, 33, 19, 2, 7; 21, 6; 22, 3, 4, 6, 8, 
16, 17; 20, 26, 82, 36, 36; 23, 6, 12,13, 

82, 39; 24, 30; 25, 13, 27, 31; 27, i; 

30, 6. 

comp.: rabihaji, kakaji, binihaji. 
ajar. 

majarakën, 9, 84. 

kjgar, 5, 20. 
i\|ar, 3, 16; 7, 23; 18, 18. 



— 270 — 



ujaring, 6, l ; 15, 84; 17, lü, 2i ; 20, 84, 

37, 24, 20. 

ujarira, 11, 4; 25, ii; 26, 28. 

ujarisun, 21, 17. 

saujarira, 28, 11. 

innjaraD, 26, 28. 
ajak. 

aDgajak, 23, 17, 23. 

ingajak, 4, 48; 6, 22. 

den-ajak, 2, 12. 
ajëng. 

angajëngana, 11, 5. 
ayi. 

yayi, 16, 9, 10; 20, e, s, 13,21; 21,5, 

11 12, 24; 24, 2. 

rayi, 20, 9. 

rayinira, 14, 29. 

rayi-pakanira, 20, 9, 12. 
hayn, 9, 22, 26; 10, il; 23, 24; 29, 18. 

hayunira, 10, 7. 

ahayu, 29, 22; 5, 2. 

comp. listu-hayu. 
hayo, 2, 8, 9, 28; 7, 23; 24, 11. 
iya, 9, 3; 11, 17; 20, 10, 28; 26, 29. 
hayuD, zie ynn. 

kahayuning, 20, 24. 

kahaynn, 21, 1. 
ayur. 

comp.: dirghayar. 
aysab, 3, 11. 
ayam. 

angayam, 20, 20, S4. 
hyang, 1, 4, c; 2, 9; 3, is, 22; 6, 29; 

7, 16, 19; 8, 17, 19, 22; 12, 32; 14, 17; 

27, 22; 29, 20, 22; 30, 3, 5, 10, 24, 26, 

29, 31, 34; 31, 8, 6, 7, 9,11,2c; 32,5, 
15, 18. 

comp. danghyang, guruhyang. 

ayëng. 

angayëngi, 16, 2. 
hiOar, 1, 18: 9, 18, 13; 10, 32; 12, 12, 



17; 29, 34. 
efijang, 4, 12, 29; 21, 11 ; vgl. esuk. 
hëm. 

pahëman, 8, 13. 
hum. 

abum, 8, 8, 10. 

ahumaning, 8, 17. 
om, 1, 1; 32, 32. 
ama. 

rama-rena, 3, s. 

ramane, 2, 21. 

ramanira, 3, 10; 15, 8, 81. 
amab, 14, 22. 
umah, 2, 12; 4, 23; 6, 25» 

umahipau, 26, 23. 

umahira, 17, s. 

aomahomah, 2, 14. 

pomahomabingsün, 2, 17. 

pomahomahira, 3, 4. 

sapomabomahira, 3, 4. 

somabira, 27, 4. 

sasomab, 3, 2. 

somaban, 10, 4. 
Hman. 

ingumanumaD, 3, 7; 28, 25. 
amuk, 15, 25; 19, 13. 

angamuk, 20, 7, 11, 18; 19, 8ü. 

ingamuk, 15, 4; 19, 84. 

den-amuk, 24, 24« 

pangamnkira, 20, 8; 21, 28. 

angamuki, 24, 25, 

angamukana, 24, 7, lo. 
amit, 10, 22; 11, 15; 15, 14; 17, 

84; 22, 10; 23, 13; 25, 16, 24; 26, 

21, 24. 

amita, 23, 12. 
ëmas, zie mas. 
impër. 

kempër, 16, 12; 18, 20. 
ambab. 

angambah, 27^ la- 



— 271 — 



ëmban^ 25, ss. 

aDgëmbaii; 20; 21. 

ingëmban, 2, 26; 7, 31; 20, U; 31, il. 
ambëk. 

piambék, 11, e; 27, 4. 
émbesak, 24, 14; vgl. esuk. 
ambil. 

angambil, 4, 17; 22, 2; 27, 15; 29, 

21; 30, 12. 

angambila, 4, 30; 6, 12, 17; 16, 9. 

kambil, 30, s, 18. 
ëmbang, 7, 18. 
imëng. 

keméngan, 24, 6. 
uga, 3, 8; 5, 34; 24, 7, 11; 26, 2. 
ugi, 7, 7; 17, 27; 21, 31, 36; 22, 2, 4. 
ibu, 15, 4, 6, 10, 11, 13, 14; 16, 18; 27, 1. 

ibunira, 15, 4. 

ibn-pakanira, J.5, 3. 
abhiseka, vgL biseka. 

abbi^eka, 14, 13; 18, 6, 7, 16; 25, 3. 

abhisekanira, 13, 29; 24, 38; 32, 11. 

comp. dbarmabhi^eka. 
ébang. 

ingëbang, 15, 17. 
ang. 

puDang, 11, 80. 
ing, 1, 5, 6, 16; 2, 1, 9, 14, 19, 20, 23, 

24, 29; 3, 8, 5, J3, 80, 34; 4, 4, 8, 10, 
14, 15, 20, 26; 5, 1, 11, 13, 15, 19, 
20, 21; 6, 8, 10, 22, 24, 29, 31; 7, 2, 
12, 15, 19, 22, 23, 31, 32; 8, 1, 8, 12, 
18, 27, 80, 31, 32; 9, 2, 4, 24, 26; 10, 
9, 23, 26, 80; 11, 24, 26; 12, 2, 3, 

4, 13, 23, 27, 28; 13, 18, 27, 32; 14, 
8, 26, 31, 32, 84; 15, 4, 5, 20, 80; 16, 

5, 25, 28, 30; 17, 9, 11, 12, 16, 21, 28, 
29, 85; 18, 9, 19, 24, 26, 84; 19, 2, 5, 15, 
24, 27, 84; 20, 16, 19, 21, 31; 21, 1, 
2, 6, 6, 8, 9, 11, 14, 15, 16, 19, 24, 26, 
26, 34; 22, 7, 13, 15, 16, 18, 24, 28; 



23, 8, 12, 16, 17, 18, 28, 26; 24, 2, 12, 
23, 24, 26, 87, 38; 25, 8, 16, 24; 26, 2, 
7, 19; 28, 82, 33; 27, 8, 31 ; 28, 3,5,8, 

10, 17, 29, 32; 29, 6; 30, 29; 31, 12, 

18, 14; 32, 2, 11, 21, 28. 

ing, II, (-ing), passim, vergl. ning. 
hang. 

humungii, 19, is. 
hingan, zie ahingan. 
ingin. 

kapengin, 4, 8; 11, 2. 
angkën. 

angangkën, 10, 24. 

angangkëna, 8, 24. 
ingkene, zie kene. 
angkat. 

mangkat, 6, 9; 7, 16; 15, is; 17, 86; 

18, 9; 19, 2; 21, 18; 22, 15; 25, 80; 

27, 86: 28, 8. 
ingkab. 

kengkab, 10, e. 
ingët. 

engët, 11, 26; 18, 29; 20, 6. 

pakanira-ingëtakëna, 22, 8. 
angso. 

pangangsonc, 9, 32. 
ungsi. 

Hmnngsi, 3, ii. 

angungsi, 1, 4; 5, 7, 10, I8, 14, I8, 26, 

27, 82; 6, 4, 5, 7; 7, 19, 28; 8, 4, 5; 

13, 26; 14, 26; 15, 22; 17, 12,27; 19, 

26; 20, 24, 25; 22, u. 

inungsi, 8, 5. 

kongsi, 3, 12; 26, 2. 
ingis. 

kengis, 10, e. 
ingsnn, zie san. 
angsëd. 

angangsëd, 20 7. 
angge. 

ingangge, 12, u, 15; 16, 17. 



— 272 — 



anggo. 

inganggo, 12, 20. 
anggu(h). 

munggwing, 16, 26. 
ënggen, zie nggen. 
enggal, 7, 10. 
anggëk. 

kanggëk, 21, ie. 
anging, 9, 34; 10, 20; 11, 5, lo, 21; 16, 

25; 18, 37; 20, 16,18; 21, 31; 25, u, 

26; 26, 17. 
ingong (-ingong), zie ngong. 
ne (- ne), zie ya. 
nihan, 1, 2. 
nini, 2, 15, 17; 6, 24; 8, 9, 11. 

ranini, 8, u. 
nir. 

comp.: nirwighoa. 
nira (-nira), zie sira. 
nora, 1, 7; 4, 7; 5,38; 7, so; 9,32; 11, 

10; 12, 16; 13, 16, 20; 17, 4; 24, 19; 

25, 36; 26, 1, 27; 28, 10. 

norana, 1, s ; 11, 12 ; 26, 6 ; 28, 10; 29, 29. 
n&rlgwari, 10. 15. 

comp.: ardhanartQwari. 
nirwighna, 14, 6. 
nakti. 

ananakti, 3, 15; 8, 6. 
ndi, zie éndi. 
ndan, 6, 5; 8, 15. 
ndak (ndak-), 16, 30. 
nduk, (zie ook duk), 18, 19; 19, 19. 

nduking, 30, 9. 
nta (-nta), zie ta. II. 
natar, 4, 5, 13, U; 18, 20. 
na^a, 32, 31. 
nosa, 8, 17, 19. 

Banüsa, 23, 24. 
nisan (-nisun), zie sun. 
nÜ9&ntara, 16, 23; 28, 21. 
nastapa. 



anastapa, 9, 7. 
nipun (- nipun), zie pun. 
nya (-nya), zie ya. 
nayana. 

comp.: trinayana. 
nëm. 

nënëm, 5, 29, 33, 34; 6, 2. 
nom. 

anoiii, 3, 24; 13, s; 15, ö, 29; 20, 

2; 20, 8, 12; 21, 16; 24,3,38; 30,13. 

rabi anom. 
nama, 15, 29. 

makanama, 8, 23. 
namas, 1, 1. 
naga, 8, 15. 
nagara, 13, 29. 

nagareng, 5, 5; 8, 2; 13, I8, 27. 

nagaraning, 14, 6. 

nagaraningsuD, 14, 9. 

comp, amaücanagara. 
nabhi, 16, 26. 

ning (- ning), passim, vergl. ing, IL 
nangkën, 6, 12, 18, 19, 26; 21, 3. 
ningBun (-ningsun), zie san. 
ningong (-ningong), zie ngong. 

CHCUh. 

acucnh, 14, 17. 
candra. 

comp.: rapacandra. 
cor. 

cinoran, 17, 14, 15. 

kacoran, 17, 32. 

pakanira-eorana, 17, 30. 
carn, 1, 9. 

pinakacaru, 1, 10, 14, IG. 

makacarnaning, 1, 10. 
cuma. 

kacurna, 15, 30. 
cakra, 8, 31. 
cakrawati. 

aiiakrawati, 10, 16; 11, 1. 



— 273 — 



cidra. 

aüidra, 11, u; 12, 26. 

ingsun-cidrane, 11, 7. 
caturbhnja 

acafurbhiga, 13, 24. 
citta. 

kacitta, 4, 9. 
celeng, 

cinelengceleng, 26, 15. * 
caya. 

cinayakën, 24, 86. 
campur. 

kacacampuran, 2, 5, 11. 
camëti, 28, 6. 

den-camëti, 28, g. 
cangkrama. 

acangkrama, 10, 3. 

pacangkramaD, 10, 9. 
cangkring, 12, 1?. 
ra, 25, 8, 14, 35; 26, 12, 13, U, 23, 

26, 28, 31. 

rena, ranini, ranak, rakaki, raputu, 
rayi, rama; rahaden en raden zie bene- 
den. 

ri I, 1, 14, 17, 2, 9; 10, 16; 15, 25; 
16, 26; 18, ], 23; 19, 2f; 20,26; 25, 
9; 27, 2. 
ring uni, 16, 7. 

ri II. 
rinipun, 12, H; 18, 37 (rwi). 

ro, vgl. rwa, 31, 1:. 

roro, 16, 2*», 3:); 18, 5; 24, 27; 25, 

27. 

rong. 25, 28; 26, 10, 3;?, 84; 32, 22; 
25, 31. 

pingro, 27, 7. 
amingroni, 11, 13. 
aparo, 12, s. 
isun-parone, 21, ?5. 
ro>\ë rts, 31, 17. 
reh, 28, 83. 

YkA. Bat. GiB^ deel XLIX. 



rehing, 6, 32; 22, 27. 
rahi. 

rahine, 28, 9. 
ruhnn. 

rumuhun, 17, i; 28, 8, 

karuhun, 29, 7. 

angruhuni, 28, 2. 
rahina, 12, 23. 

karahinan, 5, 19. 
rahaden, vgl. raden, 16, 86; 17,2,6,7, 

16, 26, 35; 20, 2, 32; 21, 13, 16,29; 

22, 37. 
rabasya. 

rahasyane, 10, 32. 

rahasyanipnn, 10, 1?, ir, 34. 

rahasyanira, 10, 6, 
rahayu, 1, 3; 9, 30, 35; 10, 2,; 11, 8. 

rabayuaning, 18, 20. 
ron, 5, 24. 

roning, 5, 22; 8, 28. 
rena. 

rënarëni, 2, I6. 
rena, zie ina. 
ranak, zie anak. 
rantnn. 

parantunaning, 22, 7. 

aparantanan, 23, n. 
runtik, 16, 28; 17, 23; 25, 13; 28, 27; 

31, 7. 
rantab. 

arantaban, 21, 19. 
rara, 7, 33; 9, 26. 
rare, 2, 22, 23, 23, 26, 28, si, 33; 3, 1, 

18; 6, 10; 7, 24; 8, 30; 13, 1. 

rareng, 2, 21. 

raryangon, 3, 29. 
ruru. 

aruru, 23, 7. 
ruruh. 

rinuruh, 8, 8; 17, 6, 88. 
reren. 

18. 



— 274 — 



areren, 6, 31; 21, 11. 

parerenaD; 7, i. 
rëröb. 

angrërëb, 21^ 9. 
rëko, 11; 18. 
rika, zie ika. 
raden (vgL rahaden) 14, 28; 15,28; 16, 

29, 31, 33, 3*; 17, 3, 8, 10, 11, 12, 16, 
26, 28: 18, 15; 19, 9, 14,20,23,25,26, 

28, 29, 33, 35; 20, 1, 8, 5, 6,10,13,17, 
20, 21, 22, 28, 30, 36; 21, 4, 7, 10, 11, 
14, 16, 22, 23, 24, 25, 34, 37, 38; 22, 1, 
2?, 23, 34; 23, 2, 10, 12, 13, 14,15,17, 
26; 24, 1, 2, 28, 34, 35, 37, 38; 25, 3, 
16; 27, 13, 14, 15, 17, 20, 23, 23, 25; 

29, 2], 24, 25; 31, 12, 13, 32. 

ratu, 11, 1, 2, 3; 12, 6; 13, 13, 14, 19; 

14, 7; 15, 27; 28; 16, 15 ; 18, 2, 6,7, 

11, 28; 23, 19, 23, 24, 25; 24, 31: 26, 

31; 31, 13, 34. 
karatunira, 18, 6; 29, 31. 

pararaton, 32, 27. 

ratu angabaya, zie baya. 
ratri, 2, 29; 4, 24; 12, 19; 3, 18. 

saratri, 4, 9; 20, 14. 
raténg, 4, 8; 11, 20. 
rus. 

paDgrus, 29, 2. 
rasa. 

rasaning, 1, 13, 16; 8, 16; 14, 15. 

rasanipun, 23, 8. 

ararasan, 27, 31. 

karasa, 16, 27. 

comp.: bhawara. 
ré^i, 14, 14. 
rësab, zie mërsah. 
ru8ub. 

arusub, 5, 32; 8, 2. 

angrusub, 5, 5. 

rinusubaD, 7, 30. 
nisak, 4, 14, u, ie- 19,3; 25, 36; 29, lo. | 



rusaking, 26, 8. 
rësëp, 3, 2. 

rësëpira, 12, 16. 

amirësëp, 2, 25: 5, 22. 
r\va, zie ro. 

pingrvva, 21, 26. 

karwa, 32, 30. 
rwi. 

rwiüing, 4, 17. 
riwa. 

ariwariwa, 13, 13. 
rawuh, 17, 35. 

rawubireng, 18, 3. 
rowaug. 

rowange, 26, 20. 

rowangira, 4, 34; 25, 9. 

rowangnira, 1, is. 

rorowang, 25, 7- 

sarowangira, 25, u; 26, 7. 

sama-rowangipun, 19, 86. 

rioowang, 2, 8; 5, 2; 7, 33. 

rinowang, 10, 2. 

ingsnn-rowang, 9, 7. 

den-rowanga, 2, 12. 

angrowangana, 8, 9. 
rupa, 16, 25. 

rupane, 12, 1 : 16, 22, 23. 

rupaning, 3, 34, 35. 

rupanira 9, 23; 13, 25. 

sarupanc, 11, 21. 

arupa, 12, 7; 15, 11; 18, is: 22, 5; 

23, 11. 
rupacandra, 4, 3. 
ridu, 20, s. 

aridu, 19, se. 
raja. 

comp.: mabaraja. 
rajaputri, 23, 20, 23; 24, 4, 11, 12, ie, I8, 

19, 21, 22; 28, 33, 87. 
rajapisuna, 26, 15. 
rojong. 



— 275 — 



snn-rojoDg; 21, S5. 

angrojongi, 26, 36; 27, 32. 
^ayi, zie ayi. 
reyong, 29, e. 
rama, I, sic ama. 
rama, II. 

araraman, 28, 1, 17; 29, j2. 
rame^ 17, 22. 

rainenüig, 22, ss. 
rémën. 

arëmën, 12, 13. 
rampak, 19, 13. 
rëgrëg. 

parëgrëg, 3!, 5, I6. 
rabi, 3, 24; 11, j; 15, S9; 30, 17. 

rabi-anom, 3, 25. 

rabini, 11, 3. 

rabining 11, 5. 

rabinira, 10, 17, 31; 21, 24, 38. 

arabi, 11, 5. 

rabihaji, 29, 13. 
rubuh, 28, 5. 
rëbat. 

karëbat, 14, 22. 
rëbut. 

arëbut, 25, 10. 

karëbnt, 23, 39. 
ring, 1, 4; 2, 1, 3, 9, 12, 13, 28, 29, 31 

33; 3, 6 f 8, 9, 10, 11, 15, 29, 32, 33; 34 
85; 4, ], 12, 13, 18, 19, 25, 28,29; 5, 1 
3, 7, 9, 10, 13, 17, 18, 21, 22, 26, 27 
31 ; 6, 3, 4, 6, 7, 15, 20, 23, 25, 27, 29 
32, 33; 7, 1, 2, 4, 8, 10, 13, 15, 16, 17, 18 
19, 21, 23, 24, 27, 28; 8, 1, 2, 5, 7 
9, 10, 11, 13; 17, 19, 25, 26, 27, 23 
33; 9, 1, 8, 9, 10, 14, 16, 17, 19, 20 
21, 26, 29, 35; 10, 1, 4, 8, 15, 18, 20 
29, 31, 33; 11, 5, 7, 9, 11, 14, 15, 17 
24, 25, 26, 27, 29, 31 ; 12, 5, 8, 9, 11 
26, 27, 31, 32; 13, 12, 14, 15, 17, 20 
21, 23, 27, 28, 29, 31, 34; 14, 1, 9, 16 



28; 15, 2, 3, 12, 16, 17, 28; 16,2,9,18, 
16, 18, 23, 29, 31, 32, 84; 17, 3, 10, 12, 

18, 15, 26; 18, 8, 12, 13, 18, 26,28; 19, 
7, 12, 16, 20, 24, 26, 29, 36; 20, 7, 25, 
31, 87; 21, 8, 11, 17, 22, 23, 25, 27, 28, 
80, 88; 22, 2, 4, 6, 11, 14, 22,25,26,27, 
29, 38, 89; 23, 1, 4, 10, 12, 13, 15, 16, 

19, 23, 24, 25, 37; 24, 3, 4, 10, 14, 16, 
18, 23, 24; 29, 31, 32, 37; 25, 2, 4, 12, 
26; 26, 17, 23, 24, 25, 28, 31, 33, 84,35, 
87; 27, 9, 11, 12, 16, 16, 17, 22, 26, 27, 
29, 31, 32; 28, 2, 4, 7, 14, 21,22,24,27, 
29; 29, 3, 24, 26, 31, 82; 30, 1, 2, 12, 
16, 20, 21, 23, 24, 31, 33, 36, 87 5 31, 1, 
14, 16, 25, 27, 81, 85; 32, 4, 9, 12, 19, 
24, 28. 

rengö. 

angröngö, 8, i6; 15, 30; 16, 33. 

karëngö, 14, 7, 15, 30. 
ringa. 

pinariringakën, 17, 1. 

rungu. 

angrungu, 22, 27 ; 7, 8, 23 ; 17, 7, 10, 24; 

27, 36. 

karungu, 7, 25; 9, 23; 25, 12; 28, 13. 

pinarurungokëD, 17, 7, I6. 

aparungon, 27, 4. 
rangknl. 

riuangkiil, 9, e. 
rangdu, 26, 11. 
rangdya. 

rangdyaning, 1, 18. 
ki, 2, 13, 28; 3, 4; 7, 4; 11, 2, 14, 3i; 

12, 4, 25, 29; 13, 16; 14,2,16; 17,27; 

23, 18, 37, 38; 25, 25, 34. 

ko, 2, 4; 6, 30. 
keh. 

kehing, 25, 11. 

kehipun, 5, 29. 

sakeh, 29, 11. 

sakehe, 26, 17. 



— £76 — 



Bakehing, 20, 20; 23, 29. 
akeh, 4, 22; 18, 2b; 19, 4; 31, 33, 35-, 
20, 28; 21, 18; 29, 8. 
ken, I, 1, 2, 19, 20; 2, 1, 2, 5, 7, 12, i3, 

18, 28, 27, 30; 30, 3, 4, 5, 8, 10, 11,17, 

19, 23, 26, 28, 31, 32, 33; 4, 3, 8, 10, 

11, 18, 21, 23, 24, 28, 20, 30, 32; 5, 2, 
8, B, 6, 8, 10, 28, 30; 6, 3, 5, 6, 7, 12, 
16, 18, 22, 24, 26, 83; 7, 1, 5,6,8,9,11, 

12, 14, 16, 17, 18, 19, 21 £3, 25, 26, 27, 
29, 81, 33; 8, 1, 2, 6, II, 21, 24, 29,31, 
8*; 9> h ^y 5, 7, 8, 17, 22, J:5, 27, 10, 
h 3i 4, 6, 6, 8, 9, 13, 15, 21, 23, 2Ö, 27, 
80; 11, 17, 21, 23, 23, 24, 25, 28, 31 ; 
15?, 1, 7, 8, 9, 11, 13, 14, 16, 18, 21, 
81, 33, 84, 36, 37; 13, 1, 3, 4, 7, 8, 

13, 14, 27, 28, 32; 14, 7, 11, 28; 15, 
7, 12, 14, 16, 29. 

ken, II. 

aken, 11, 20; 16, 9; 2i, 7; 30, 29. 

kinen, 4, 28, 29; 8, 26; 16, 33; 17, 

13; 21, 12; 27, 31. 

akenkenan, 18, 31. 

kenkenaningsun, 11, 29. 
kon. 

akon, 16, 31; 23, 4. 

kanon, 3, 15; 5, 22; 7, u, is; 8, 7; 

15, 16; 16, 28, 34; 18, 18; 22,16,21, 

26; 25, u; 27, 6; 28,6, 9, 11. 

akonkon, 11, 31; 23, 28. 

konen, 11, 18. 

den-kon, 6, 15. 

8Un-kon, 23, 22. 
kana. 

ngkana, 32, £9. 
këna, 12, is; 19, 36. 

kénaha, 20, 26. 

angênakën, 2, 3 ; 7, 26 ; 22, 32. 
kina, 13, 32. 

kinakina, 13, I8. 

kuna, 3, 20. 



kene. 

ingkene, 5, 33; 6, i. 

ringkene, 8, 33. 
kanin, 19, 4, 8. 
kiutii, 32, 33. 

kantun, 21, 3; en zie katun. 
kunëng, 13, 31 ; 24, 3C. 
këeap. 

kéeapira, 2, 3); 27, 33. 
kacang, 7, 3?, 31. 

pakacangan, 6, ii, 0. 
kari, 3, 10; 5, 30; 18, 26; 23, is; 26, 

32; 29, 9, 15. 

aiigareni, 20, 15. 
kira. 

akirakir.M, 15, 30. 

kinire, 10, 1. 
kuren. 

akurëuan, 1, 18. 

kiikurÖnCn, 6, 25. 
kavana. 

karananira, 7, 14. 

karananingsun, 11, 6. 
kérta. 

krétaning, 1*, 6. 
kërti. 

comp,: bamakërti. 
këris, 11, 11, 12, 14, 18, 26, 28; 30, 32: 

12, 2, 5, 22, 20, 28. 

kërisira, 12, 4, 21 ; 16, 4; 24, 24. 

angëiis, 9, 81; 10, 18; 11, 9. 
krsnapaksa, 32, 30. 
kar)'a, 11, 17. 

karyaningsun, 10, 27. 

akarya, 6, 9; 11, 13; 12, 29; 15, 13, 

17; 16, 4, 6. 

pinakaryaken, 21, 2. 
karayita. 

sakarayita, 17, 8. 
krama. 

kramanira, 12, 32. 



-^277 — 



akramaha, 27, 2. 
karma, 9, 34. 
kirim. 

akirim, 18, 33; 22, 15; 23, 3, 21. 

angirim, 2, 1. 

angirimi, 1; 20. 
knrèb. 

kumurëb, 21, lO. 
karëng (arëng). 

sakarëDgan, 22, 5; 27, 28. 
kuraDg, 11, 11; 23, 6. 

kakuranganira, 7, 13. 
kurung. 

juru kurung, 16, 10. 
kaka, 12, 13; 16, 4, 8. 

kakaji, 28, 35. 
kaki, 2, 8, 13, 20, 32; 3, 8; 5, 31, 32; 

33; 6, 3, 17, 19, 20; 7,3,7; 8,1; 9, 3, 

7, 12, U; 10, 10, 12, 14, 15, 19, 23, 

26; 11, 4, 9, 29, 30; 15, 8; U; 16,35; 

17, 1; 22, 20, 32, 36; 23, 20; 24,28; 

27, 36; 28, 7. 

rakaki, 7, 6. 
këkëh. 

pakanira-këkëbana, 22, 14. 
kukub. 

angukubi, 8, 21. 

angukubana, 8, 17. 
këkëb. 

angëkëb, 27, 4. 
kadi, 7, 26; 10, 25, 29; 16, 26; 18, 5; 

19, 7; 20, 13, 26, 30; 23, U; 29,7,14. 
këdö. 

akëdö, 20, 29. 
kuda, 29, 12. 
kudu, 28, 32. 
kidul, 4, 18; 19, I8, 21; 25, 17. 

kiduling, 20, 15. 

mangidnl, 22, I6; 29, 9, 13. 

pangidnlira, 26, 3. 
kadasg; 4, 19. 






kadang-warganira, 12, 28. 
sakadang-warganira, 12, 24. 
kidung, 24, 33. 
katu, 5, 13. 

kita, 2, 3, 10; 8, 9, 3i. 
katuD, vgl. kantun. 
katananira, 7, ie. 
këtug, 8, 14. 
katang. 

kakatang, 8, 28. 
kasir. 
kasirkasir, 24, 30. 

kasirkasirira, 27, 19. 
ksatriya, 14, 19; 16, 30; 27, 2; 29, 24; 

SO, 18. 

paraksatriya, 27, 3, 13. 

kakfiatriyanira, 24, 35; 29, 20. 
kuswa. 

anguswakën, 27, 29. 
kiwa, 5, 23, 25; 8, 31. 
kuwu. 

akuwu, 5, 6; 9, 10, 13, 15, 17,29; 10, 

18, 31; 12, 27; 19, 34. 

sirakuwu, 10, 18, 31; 11, ?, 8, 10. 

pakuwoD, 12, 19. 
kweb. 

kwebing, 13, 11. 

Bakwebing, 29, 5. 

akweb, 28, 27. 

kwebaniDg, 32, 31. 
kawara, 12, 20. 

kawa^a II, 4; 20, 17, 18, 35; 27, 6, 29. 
kawula, 17, 29; 20, 9, 38; 21, 1,3; 22, 

6, 7, 11, 13; 26, 21. 

kawulanira, 17, 88; 18, 24; 19, 29; 

20, 20, 21, 24, 31. 

kawula-pakanira, 20, 23, 24; 22, 12. 

sakawulanira, 19, 23; 23, 16. 

angawula, 17, 14, 30. 

pangawnlanipuD, 17, 30. 
kawung. 



— 278 — 



kaktfwnnganing, A, 19. 
kala; 12, 19. 

kalaning; 20, 4. 

comp.: tatkala. 
kali, 5, 8. 
kele, 6, 11. 
kalih, 3, 8, 10; 4, 4; 14, 21 ; 16, 8, 25, 

29, 31, 82, 83, 31, 35, 37; 17, 6, 7, 10, 

11, 12, 16, 16, 20, 28, 24,26,28,36: 19, 

37; 20, 1; 24, 6, 86, 37. 

kakalih, 3, i; 5, 24; 27, 1. 
kilen. 

mangilen, 31, 11. 
kulon, 24, 10; 25, 26; 31, 7. 

mnngulon, 29, 13. 
kalana, 18, 23, 2^. 
kalade^a, 9, 9; 25, 24. 

kalade^anipun, 18, 35; 19. 32. 

pangaladccaning, 18, 20. 
kilat, 8, li. 
knlimis. 

akulimis, 7, 34. 
kapo, 6, 17; 11, 32. 
kaponakan, zie anak. 
këpang. 

angëpaug, 28, 2, 8. 37. 

kinSpang, 28, 12. 

kakëpang, 5, 17. 
këdik. 

akédik, 18, 26: 20, 21. 
kadaton, 14, 32; 15, I8; 17, 33, 36:24, 

2; 31, 7, 10; 32, 22, 2i. 

kadatoning, 24, 2. 
këdang, 8, 6. 
kigar, 5, 20. 
kaya, 15, 7; 28. 5. 
kayu, 28, 5, 9. 
kniici. 

kinnficcD, 24, 23. 
kailcana. 

eomp. : .dharmakaacana, dharmakafica- 



nasiddhi. 
kaficit, 28, 18. 
kamakara, 2, 20 ; 16, 22. 
kémit. 

akëmit, 26, 28. 

kémitan, 27, 7. 

kémitane, 26, 19. 
kampil. 

kakampilan, 7, 34. 
kampul. 

akumpul, 8, 8. 
këmbar. 

akëmbar, 16, 11. 

angëmbari, 15, 25. 
këmbal. 

akëmbaian, 20, S3. 
këbo, 3, 6, 7. 
kabeb, 3, 28; 8, 11, 18; 19, 20; 12,25; 

13, 19, 32; 14, 12; 15, 6; 21, 24; 
22, 10; 24, 6. 

aDgabebi, 28, 17. 
kuboD, 21, 1. 
këbëk, 19, 27. 
kita. 

comp.: sakita. 
kuta, 18, 8; 25, 26. 

comp.: saknta. 
ka tab. 

katahing, 20, 9. 
katik. 

pakatik, 27. 
kang, 2, 6, 16, 26, 28, 31 ; 3, 6, 12 ; 4, 

18, 27; 5, 8, 9, 28, 29, 30, 31; 6, 2, 
3, 6, 17; 8, 14, 18, 81; 9, 2, 80; 10, 

14, 17, 36; 11, 29; 12, 1, 6, 24, 96; 
13, 20, 30, 31; 14, 5, 23; 15, 7; 16, 
7, 13, 17, 34; 17, 6, 38; 18, 1, 26; 

19, 1, 2, 3, 4, 5, 8, 9, 12, 13, 16, 30: 

20, 24, 84; 21, 12, 85; 22, 6, 9, 12, 

16, 21, 28, 30, 34, 35; 23, 29, 31, 32, 
34; 24, 6, 9, 16, 17, 82, 26, 27, 28, 



i 



— 279 — 



29, 36; 25; 8; 84; 26, 18; 97> S8; 36; 
28, 3, 6, 9, 11, 85; 29, 10; 31, 5, 6. 
vgL ikang. 
de, 8, 23; 26, 26; 32, 30. 
dene, 11, 12 ; 12, 5; 16, 23; 18, 2; 
23, 38. 

den-, 2, 12, 17, 27; 6, 10, 11, 15; 9, 
33, 35; 11, 20, 22; 14, 2; 23, 38; 24, 
24; 26, 2; 27, 7, 24; 28, 8, 10. 
dening, 1, 6; 2, I6; 3, 8, 3i; 4, 13, 
10; 5, 19, 20; 6, 13; 7, 13; 8, 3, 22; 
10, 7; 12, 18, 24, 28; 13, 30; 14, 22; 
15, 2, 12, 19, 24, 30; 17, 20, 38; 19, 
21; 20, 1, 3, 14; 21, 33; 22, 23, 24; 

23, 1, 3, 6, 13, 16, 33, 39; 24, 1: 25, 
19; 26, 26; 28, 10 ; 29, 1, 6. 
denipun, 1, 13, 14 ; 4, 6 ; 14, 22 : 1 6, 35 ; 

17, 30; 19, 25; 20, 19. 
depun-, 21, 21; 22, 19; 23, 7. 
denira, 2, 8, 23, 25, 29; 3, 3, 5, 6,13, 

18, 20, 21, 23, 27; 4, 4, 8, 23, 25, 30; 

5, 2, 5, O, 30, 34; 6, 4, 12, 28; 9, 29; 

7, 11, 14, 17, 19, 23, 25, 31, 33; 8, 13; 
9, 2, 6, 23, 27; 10, 2, 6, 20, 30; 11, 
30; 12, 14, 15, 18, 19, 31, 36, 87; 13, 

6, 2j, 33; 14, 15, 28, 33; 15, 9,14,15, 
18; 16, 1, 6, 19, 22, 30, 33, 36; 17, 5, 

8, 13; 18, 18, 21, 23; 19, 10, 14, 35; 
20, 1, 5, 6, 10, 27; 21, 10, 14, 27, 38; 

22, 17, 25, 31; 23, 10, 16, 34, 35, 36; 

24, 15, 19, 25, 28, 37; 25, 15, 18, 22, 
23; 26, 14, 2J, 22; 27, 4, 5, 7, 8, 9, 

23, 25, 30 ; 28, 27 ; 29, 19, 23 ; 30, 7, 
8, 10, 11, 14, 15, 18; 31,3,9,10,11,12. 

denira-, 20, 6. 

dera, 2, 27; 3, 7. 

dera-, 11, 10 ; 12, 1. 

deningson, 9, 4; 10, 13, 32; 11, 8, 9, 

31; 20, 28. 

denisun, 21, I8; 26, 2. 

demami, 10, 19. 



denta, 33. 

den-manira, 15, 23. 

den-pakanira, 17, 14; 22, 15. 
do. 

tando, 6, 16; 9, 1. 
doh. 

dinohakén, 18, 18. 
dahat, 4, 8; 20, 34; 23, 8; 24, »1. 

dahating, 10, 35. 
dahut, 14, 2i; 26, o, 8. 
dan. 

dandan, 25, 11. 

andandani, 12, 32. 
dun (?), in pL v. don? 

anduni, 19, 21; vgl- duk II. 
den, zie do. 
don. 

done, 26, 22. 

donira, 3, 28. 

don-pakanira, 22, 8. 

andon, 14, 16; 24, 27. 

andona, 18, 21*. 
dana. 

adanaha, 8, 1. 
dina, 6, 12, 13, 18, 19, 21, 26; 8, 7; 12, 

25; 17, 16, 20; 21, 3; 24, 27; 32, 28. 

comp. : pratidina. 
dannng. 

dnnungane, 24, 26. 

dumunnng, 21, 23; 26, 23. 

dinitnungakën, 21, 26. 
dur. 

comp.: durbhiksa. 
dera, zie de. 
dërwe. 

adërwe, 11, i; 25, 11. 
dliarma, 25, 4, 6; 27, 27; 30, 38; 31, 

26; 33, 9. 

dhinarma, 16, 13; 18, 12; 25, 8, 4; 

27, 26; 30, 215 31, 14; 32, 6,12,19. 

dhinarme, 32, 5. 



— 280 — 



dhinarmeDg; 15^ 26; 18, 3; 27, 11 ; 
29, 31, 32; 30, 2, 20; 22, 23, 82, 36; 
31, 1, 24, 25, 26, 36, 38; 32, O, 7. 
comp,: yagadharma* 
dharmakancana, 6, 29; 7, 9, 15, 27, 29. 
dharmakaücanasiddbi, 6, 30. 
dharmaputra, 26, 12. 
dharmabhi^eka, 29, 31, 3?; 30, 2,20,21, 

23, 37; 31, 1, 14, 25. 
dirgha. 

comp.: dirghayur. 
dirghayur, 32, 32. 
durbhiki^, 32, 31. 
durung, 2, 20, 21; 11, 32; 2G, 16. 
dereng. 

derengira, 9, 21. 
duk, I. 

duk, 1, 2, 12; 8, 27, 32; 9, 7,21; 13, 
21; 15, 19, 27; 16, 31; 18, 30; 19,8; 
20, 33; 21, 18; 23, 5; 24, 12, 13, 33; 
26, 16, 18, 20; 29, 24; 31, 15,34, vgl. 
ndnk. 
duk, II. 

anduka, (te lezen anduna?), 19, 26. 
dikara, 19, 10« 
dékong. 

dékunge, 8, 30. 
dadi, 1, 7, 9; 2, 23; 3, 18; 4, 17; 5, 9, 
22, 24; 7, 82; 8, 1; 9, 19; 10, 8, 16; 
11, 1, 2, 3, 13; 12, 1, 8; 18, 7, 23; 
19, 14; 31, 3, 5, 6; 4, 31. 
dinadekëD, 1, 2. 
kadadinira 8, 31. 
didi. 

didine, 20, 37. 
didinipnn, 21, l. 
dada. 
dada, 15, 7, 10; 26, 29; 37, 32. 
sadadanira, 27, 35. 
dede, 21, 21. 
de^a, 19, 3; 21, 8; 23, 11 ; 26, 9. 



pradega, 8, 28. 

prade^aning, 7, 30. 

prade^anira, 2, i. 

comp.: kalade^a, paradepa, 
dosa. 

dosane, 9, 3?; 26, 15. 

dosanira, 18, 30; 28, 28. 

dosaningsan, 16, 37; 17, 4. 

dosamanira, 17, 12. 

pinadosa, 31, 32. 
dwa. 

adwa, 17, 2. 
dawa. 

adawa, 8, 30. 
dewa, 8, 10; 12, 32; 19, 28; 20, s; 24, 29. 

paradewa, 8, 8. 
dewi, 13, 7, 11; 14, 32; 30, 4. 
devvata, 8, is, 20, 23, 24. 
dwitiya. 

dwitiyaning, 32, 30. 
dwiwara, 4, 3. 
dewalaya, 14, 26,' 31. 
dewapatra, 28, 13. 
duwëg, 12, 19; 16, 8; 18, 35; 20, 11. 

duwëgira, 16, i9. 

duwëgan, 20, 35. 
dalem, 12, 19; 15, is; 17, 23: 21, 32; 

22, 27. 
dulur. 

adulur, 16, 20. 

dttlardalur, 4, 11. 
dinalaraniog, 12, 20. 
pandalaring, 13, u. 
pandadular, 4, so. 
dëlëng. 

délëngen, 13, 24; 16, 22. 
daya. 

pinadaya, 28, 1, 2. 
dayaka. 

dayakanira, 5, 83. 
dam. 



281 — 



aduni; 19; 29. 

dinumaii; 19^ so. 
damar^ 20; 13. 
dëmang; 28; 18. 
dëmung; 25, 19, 29. 
daga. 

andaga, 25, 6, 10, 13, 14. 
dagang. 

adagang, 23, S3. 
dangit; 26, 33. 
danganan. 

adaDganan, 12, 12. 

ta I, 1, 8; 9, 10, 12, 13, 14, 15, 16, 18; 
3, 12, 19, 27, 33, 36; 4, 4, 17, 32; 5, 

I, 3, 4, 5, 7, 8, 11, 13, 14, 17, 18, 19, 
21, 26; 6, 3, 6, 8, 14, 26, 27,29,30,31; 
7, 1, 9, 14, 18, 25, 30, 31, 3i; 8, 10, 

II, 13, 21, 23; 9, 20, 22, 27, 20, 34; 
10, 20, 23, 26, 32; 11, 2, 10, 25; 12, 
7, 17, 30, 31, 35, 36; 13, 8, 20, 22,23, 
2t; 14, 9, 13, 17, 23, 24, 25, 31, 32; 

15, 9, 11, 15, 29; 16, 15, 37; 17, 1,2, 
7, II, 13; 18, 16, 19, 28, 35; 19, 36; 
20, 3, 4, 6; 7, 23; 30; 21; 10, 21; 22; 
1, 5, 8; 11, 19; 37, 28; 23; S, 8; 20; 32; 
24; 5, 8, 14, 16, 19; 26; 16; 27;ii, iC; 

31; U. 

ta II (-ta), 3, 16; 18, 2. 

(-nta), 2, 4, IC; 8, 20, 33. 

(ta-), 16, 8, 10. 
toh. 

atoh, 24, 19. 

atotohan, 3, 13, 21. 
tuha, 3, 21; 18, 37 ; 19, 22. 

atuha, 3, 2; 19, l; 24, 29, 37. 

panuha, 20, 2, 6, 9. 

panawa, 20, 5. 

piuituhaDipim, 17, 31. 

wong atuwane, 2, 22. 
tuliU; 3, 22; 5, 32; 6, 1; 15, 6; 16, 6, 
12; 17, 30; 19, 28; 22, 9; 23, 14. 

Verlu B«t Oen., doel XLIX, 



tuhuning, 4, 6. 
mituhU; 19, 8. 
tahuü; 5, 9; 18; 11 ; 25, i; 6; 21,27,2s; 

26, 10, 34; 27, 10; 28, 15; 29, I6, 2r; 

30, 29; 31, 5, 16, 17; 20; 30; 32; 14, 22. 
satahnn, 11, 20. 

tuhan, 18, 20; 24, 29; 28, 12; 29, 3,4, 

8; 31, 20, 29. 

tuwan, 3, 30, 32, 33; 4, 4, 32, 34. 
tëhër, 6, 22; 7, 26; 8, 14; 12, 9, 18; 15, 

19; 16, 28. 

atëher, 3, 32. 

nëhër, 7, 10 ; 10, 6; 15, 23. 
tahil, 6; 31. 
tan, 1, 3, 15; 17; 2, 9, 31, 33; 3, 10, 28, 

32; 4, 6; 5, o, 17, 33; 6, 25,33; 7,10, 

11, 26, 27; 8, 9, 33; 9, 22, 26, 28, 29, 

31, 32; 10, 2, 7, 8, 20, 21, 29; 11, 4, 
13; 12, 16, 20, 33, 36; 13, 18, 2', 26, 

27, 35; 14, 24; 15, 3, 5, 30; 16, 56; 
17, 7, 14, 17, 23, 30; 18, 2, 8, 18, 20, 
29; 19, 15; 20, 2, 12, 18, 19, 21, 28, 
34, 35, 37; 21, 2, 34, 38! 22, 19, 20; 
23, 1, 24, 32; 24, 22; 25, 20, 2.J, 25; 

26, 17; 27, 1, 2, 5, 7, 24, 29, 30, 32; 

28, 20, 28, 37; 29, i, 8, U; 30, 6,14, 
15, 16; 32, 14, 30, 31; zie tanpa-, en 
tambontën (onder bonten). 

ton. 
tumon, 4, 8, U; 5, 12; 9, 26; 12,15; 
20, 3v; 21, 15; 22, 27; 24, 12. 
tamona, 24, 1 6, 18. 
katon, 2, 29; 4, 27; 8, 31; 9, 2, 4; 
10, 6, 32; 13; 24 ; 18, r, 2; 25, 24; 

27, 3. 
tani. 

atatanen, 1, 20. 
tuna. 

tunalëwihiug, 32, 31. 
tunu. 

katanon, 4, 27. 

18«« 



— 282 — 



tandi (?), 8, 17. 
tando, 6; 16; 9; 1. 
tandang. 

tumandang; 26^ 4. 
tampa-, 2, 14; 3; 12, 145 4, 11; 6, 4,20; 

8, 15, 16, 27; 11, 31; 12, 12; 19, 24; 

20, 26; 22, 35; 28, 31, 83, 34. 
tanding. 

tandiDgën, 25, 35. 
tunduDg. 

tinunduDg, 4, 23. 

patundungira 4, 24. 
taném. 

atanëm, 5, 27; 29, so, 34; 6, 2. 

tnmanëm, 12, 23. 

ananfim, 4, 5; 7, 32. 

tatanfimanira, 4, 5. 

tor, 2, 22; 4, 18; 5, 31; 11, i7; 13, 23, 
26; 14, 14; 17, 32, 33; 19, 28, 33; 20, 
6; 21, 16, 31; 22, 21; 25, 7; 26, 32; 
28, 6, 9; 29, 9; 31, 13. 

tari. 
iDgsun-tarinipuD, 10, 23. 

tura. 
makatnratura; 28, 33. 

turn. 

aturu, 2, 9, 10, 12; 4, 10, 18, 25,28,29; 

21, 20. 

pataroüira, 12, 20; 21, 25. 

sapaturon, 10, 2. 
tnrun. 

tumuruD, 2, 2; 10, 6, 31; 4, 10; 21,7, 

15; 28, 26. 

katurunan, 8, 7. 
trinayana. 

atrinayana, 13, 24. 
tarnka. 

anaruka, 22, 7, 11; 23, 5, 6. 

pakanira-tarukaha, 22, 6. 
tërus, 12, 21 ; 20, ie. 
triwantj 4, 3. 



tërap. 

tinërapakën, 26, 35. 
tëka, 2, 11; 5, 2, 30; 6, 26; 8, 25 

10, 27; 11, 17; 18, 26; 19, 16; 20,31 

21, 25; 24, 3, 11, 22, 27, 32; 25, 25 

26, 24, 31; 28, 12, 14, 16; 29, 13. 

tëking, 5, 4; 9, 23; 10, 6; 19, 27; 21 

5; 22, 16, 25; 24, 25. 

tëkane, 2Q, 2. 

tëkaning, 4, 9 ; 7, 20 ; 14, 26 ; 24, 21. 

tëkanira, 19, 24. 

satëkaniüg, 22, 21 ; 23, 30. 

satëkanira, 7, 9; 9, 9; 10, 1,4; 24, 3 

tëkaha, 24, 18. 

tëkahaning, 6, 22. 

anëkani, 14, ]6. 

katëkan, 8, 12; 11, 1; 17, 34; 21, 34 
taken. 

ataken, 15, i, 4. 
takon. 

atakon, 11, 17, 23. 

ingsun-takoni, 10, 34. 

tinakontakonan, 26, 25. 

patakoning, 8, 19. 
tukar. 

atntnkaran, 17, 22. 
tikël, 26, 8. 
tuduh. 

tinaduh, 19, 9. 

katuduh, 18, 25. 
tut. 

atnt, 17, 4, 5; 26, 35. 

anut, 20, 19. 

tinut, 1, 13; 5, 26, 27; 19, u, 24, 84j 

24, 26; 26, 4; 31, 12. 

katut, 12, 12, 26. 

kinatutakën, 12, 22. 

tutut, 4, 29. 

tatnta, 23, 25. 

tinntutan, 20, 14. 

katututan, 31, 13; 20, 15. 



— 283 — 



katutataning; 23; 86. 
tata. 

atata; 26; 2. 
tatba; 32; 82. 
tithi, 4, 2. 
titih. 

anitibi; 21; 24. 

katitihan, 14; 19; 29; 12. 
totoh. 

tinotohakëü; 3; 5. 
tutur. 

atutur, 21; 27; 82. 

tumutureng; 8; 34. 

tinuturakëD; 19, '20. 

katutuF; 3; 26. 

katuturanira; 1; 3. 
tatkala; 17; I8. 
tutut; zie tut. 
titis. 

turaitisa, 1, 11, 13. 

titisakëna, 1; ic. 
tutng. 

tutuga; 9; 31. 
tus. 

tumusa, 12; 8. 
tawu. 

atatawU; 5, 29. 
tuwa, ziè tuha. 
tuwi, 6, 25. 

pituwi; 10; 7. 
tuwu. 

katuwoD; 10; 5; 12; 19; 13; lé. 
tuwuh. 

atuwuh; 18; 30. 
tuwan, zie tuhan. 
twaO; 13; 10; 14, 32. 
tawan. 

atawan, 19; 4,, 8. 

isun-tawauanC; 23; 20. 
tawoD; 14; 24. 
tëwëk. 



tinëwëk; 12; 23. 
twas. 

twasira; 4, 22; 12; l; 21; 16; 26. 
tiwaS; 27, 34. 
tuwawa. 

atuwawa, 20; 36. 

tftl; 5; 18; 19; 23; 24. 

tëlu. 
tëlung; 8; 23 29; 32; 14. 
katëlU; 22; 31. 

tuli. 
tumuli; 2; 2, 11, 18, 29; 3; il, 99; 4, 
12; 6; 25; 9; 3; 24; 13, 28; 16, 7, 
9; 18; 5; 19, 34; 23, 3, 4; 25, 28; 
29; 30; 26; 11; 27; 28; 28, 16, 19,36; 
29; 27, 34, 35; 30, 27, 28; 31, 5, 18, 
21, 23; 32, 1, 3; 8; 15; 17, 20; 22; 26. 

anuli; 2; 7; 3, 20; 4, 25; 5, 12; 6, 

7; 12; 2; 19; 20; 14; 14; 17; 36; 18, 

3; 21, 4; 16, 18, 25; 23, 2; 24,3; 25, 

31; 28, 2i; 29, 25; 32; 21. 

nuli; 11; 16. 
tilik. 

atilik; 21; 12; 25; 24. 

atilika; 21, 12. 
tëlas, 3, 4; 13; 12; 24; 25; 32; 28. 

tëlasira; 1; 16. 

atëlasaO; 29, 23; 31; 16; 19; 29. 
tulis. 

tUliSC; 8; 30. 

tulus, 21, 6. 

anulus, 10, 7. 
tulumpak. 

tumulumpak; 31, 12. 

anulumpak; 21; 5. 
talanipakaU; 28; 26. 

talampakanira, 16, 27; 19, 22; 28, 

29; zie nog pakanira. 
tuluug. 

tumulung, 7, 25. 
tinuluDg; 13; 33. 



— 284 



tapa L 

atapa, 9; 90. 
patapanira, 9, 27. 
tapa II. 

comp.: nastapa. 
tapak. 

anapuk, 27, 20. 
tëpas. 

katëpas, 22; 10. 
tipis. 

:mipis, 21, 9. 
tfida I. 

tëdanipun, 21, 3. 
tëda II. 

anëda, 17, 13; 22, 3, 18. 

anëdaha, 23, 4. 

ingsun-tëdanipun, 15, u; 16, I6. 

pakanira-tëdaha, 22, 6. 
tadah, 14, 27; 21, se; 22, 1. 

anadah, 15, 19, 20; 19, s, is. 

tinadah, 20, 23. 

katadahan, 28, 27; 28. 

panadahan, 21, 27. 
iëdan. 

tnméduD, 19, u. 
tëdas, 11, 10; 27, 7, s. 
taji. 

tinaji, 27, e, 8. 

anajia, 27, e. 

anajeni, 16, 11. 
tuju. 

anuju, 8, 28; 22, 33; 23, i; 29, 13. 

anujw, 19, 15. 

katuju, 5, 39; 9, 26; 26, 18, 19; 27,5. 

pannjuning, 4, 1. 
teja, 8, 15. 
toya, 14, 27; 24, 20. 

toyanipnn, 20, 33. 
tyaga, 7, 22, 24, 26, vgl. tega. 
tafia. 

tina&aD; 9, 3. 



taBcëb. 

tinaücëbakën, 13, 22. 
tamu. 

tatamu, 6, 22. 
tëmn. 

atëmu, 2, 15; 10, 29. 
anëmwa, 9, 35. 
tëmokëna, 14, 4. 

katëmu, 2, 7; 5, 27; 7, 1; 9, 28; 11, 
27; 20, 8. 
tanian, 10, 4, 6. 
tëmën, 10, 29; 11, i; 24, 13. 
tam pa. 

anampa, 21, 20. 
tinampa, 21, 33. 
tëmpub. 

anëmpub, 19, 3I; 33; 23, 39; 25, 34; 
26, 6, 8; 29, 9, 12. 
anêmpuba, 19, 32. 
tampak. 

tampaking, 4, 16. 
satampaking, 14, 2. 
atampakan, 8, 27. 
tëmbe, 2, 6; 12, 6, 6; 21, 35. 
tambontën, zie bonten en tan. 
tunibak. 13, 22, 23. 
tumbaking, 19, so. 
katumbak, 20, ie. 
timbang. 

timbangana, 7, 10. 
tiga, 18, 30. 

titiga, 27, 19; 29, 20. 
tigang, 12, 36; 15, 9; 25, I6, 17,21; 
28, 15; 31, 5, 20. 
katiga, 14, 32. 
tega, 7, 27; tv//, tyaga. 

parakategan, 7, 20. 
tagib. 

tinagih, 3, 14. 
tëguh, 11, 10. 
atëguh, 11» 19. 



285 — 



tigas. 

aninigasi; 11^ 28. 
tégal; 5, 11; 18, 35. 

tfigaling, 4; 33. 
tugël, 8, 26. 
tub. 

atnb; 4, 6. 
tiba. 

anibakën, 9, 30. 
tabuh. 

tatabuban, 19 3, 16; 22, 35. 

tinabnhan, 5, 20. 
tang, 4, 10. 
tong. 

katong, 18, 28. 
tangi. 

atangi, 4, 24. 

tinangi» 4, 28. 
tangeh, 7, 24. 
tëngah, 21, 2. 

tSngabing, 4, 26; 21, 8. 

patéténgahan, 4, 28. 
tangan. 

tangane, 8, 30. 
tëngën, 5, 28, 25; 8 30. 
tëngër, 32, 2i. 
tingkab, 28, 32. 

ÜDgkabanira, 10, 8; 20, 28. 

satingkah-polahing, 23, lO. 

satingkab-polabira, 12, 34. 

atingkab, 25, 26. 
tangkis. 

anangkis, 19, 12; 29, lO. 
tangkil. 

panangkilaii; 24, 26; 28, 24. 

tUDgklll. 

katungkul, 6, ii; 16, ii; 23, 13. 
annngkul, 22, 3, 18; 29, 1. 
tangkëp. 

atangkëp, 22, 34. 
patangkëping, 22, 38, 



tangis. 

anangis, 2, 25, 26; 5, 21; 26, 27. 
tingal. 

tinghalira, 15, 5, 6« 

satingbalira, 4, 20; 12, 11. 

tuminghal, 2, 24; 10, 7; 15, 5. 

tininghalaD, 11, 30; 21, 14. 

aniningal, 22, 35. 

aningbali, 24, 13. 

aniniugalana, 22, 33. 

katingbalan, 2, 9; 4, 12, 26; 8, 22; 

9, 12; 10, 13; 20, 5. 
tangga. 

tatangganira, 17, lo* 
tunggu. 

atunggu, 4, 18. 

anunggua, 3, 8. 

tinuiiggu, 5, 19. 

anunggonana, 3, 9. 
tinggal. 

atinggal, 18, 14, 15. 

katinggal 12, 36; 15, 9. 
tunggal, 3, i; 5, 30; 9, 21; 17, 31; 20, 

2; 24, 80; 26, 9; 31, 37; 32, 6. 

tunggaling, 16, 17. 

tunggalau, 29, 15. 

patutunggalaLing, 6, 33. 
tunggul, 19, 3, 16. 
tanggap. 

ananggapi, 24, 16. 

tinanggapan, 16, 6; 27, 80. 

pakanira-tanggapana, 22, 13. 
tënggung. 

tumënggung, 25, 19, 83; 28, 19. 
tunggang. 

anunggang, 10, 4; 28, 5. 
sa- I. 

sawiji, 19, 29; 20, 36; 24, 28. 

sapuluh, 24, 27. 

sawëlas, 29, 16. 

satuS; 14, 1. 



— 286 — 



salaksa^ 26; 2* 

sapalih; 21, 35. 

sapasar, 2, 21; 20, 24. 

sapasang, 20, 37. 

satabiin, 11, 20. 

saleng, 18, 5. 

sakarëngan, 22, 5 ; 27, 28. 
sa- IL 

sagunung, 25, 7. 

sawaringin, 5, 13. 

gapangon, 3, 3. 
sa- III. 

sapaturon, 10, 2. 

sapalaki (?) 1, 9. 
sa- IV. 

saratri, 4, 9; 20, 14. 

sawëngi, 4, 11, is. 

sawërdhining, 4, j. 

sanasa, 23, 24. 

sagërha, 21, 20; 23, 29. 

Pakeh, 20, 20; 23, 29; 20, 17; 29, u. 

sarupane, 11, 2. 

mz., 3, 4; 7, 20; 9, 7; 10, 21; 

11, e; 12, 24, 34; 13, 15; 14, 1; 

15, 30; 17, 29; 19, 23; 21, 36; 23, 10, 

16, 27; 24, 11; 25, 14; 20, 7; 27, 35; 
28, 11. 

sa- V. 

sawetaning, 9, 23; 13, 12. 
sa- VI. 

sasampnnira, 23, 15. 

satëkane, 7, 9; 9, 9; 10, 1, 4; 22, 21; 

23, 30; 24, 3. 

sadatëDgira, 21, 14. 

sapungkurira, 23, 21, 27. 

satinghalira, 4, 20; 12, u. 

sapafijënëng, 18, 23. 

saulihira, 9, 28; 10, 9; 20, 32. 

sie voorts sawyakti, sakuta, sajati, enz,, 

en mana, mangka, mangkana. 
si I, 8, 20; 19, 28; 20, 9, 38; 21,17,29; 



24, 7; 25, 3C. 
si II, 28, 10, 19. 
sah, 1, 4; 3, 14, 17; 28; 5, 6, 10, 16; 6, 

7; 7, 27, 29, 3:>; 8, 4 ; 9, 8; 10, 27; 

11, 16, 22; 20, 31 ; 26, 17; 32, 22. 

asaha, 27, i9. 
sih, 1, 19; 23, 14. 

sihira, 10, 2. 

asih, 3, 1; 10, 24; 13, 21. 

asihsiliau, 3, 31; 12, 11. 

silihasih, 12, 37. 

kakasihira, 12, 10. 

kinasibau, 22, 25. 

kasyasih, 13, 32. 
soh. 

sobaning, 24, 26. 
saha, 23, 30. 
suhun. 

siiuihun, 28, 14. 
sabur, 20, 29. 

sahuring, 20, 10. 

saburira, 10, 19; 15, 7; 10, 37; 20, 29; 

24, 11. 

asahur, 10, 24. 

sumabur, 4, 15; 5, 32; 6, is; 7, 3; 

8, 19; 9, 5, 12, 15; 10, 12, 22, 23, 30; 

11, 8, 24, 29; 13, 17; 16, 9; 21, 29; 

24, 7; 26, 28. 

auabura, 4, 31. 
saos, 16, 18; 27, 1. 
sabasa. 

sinabasa, 9, 27. 
sabaya, 17, 33; 24, 17» 

sahayanira, 17, 33. 
sun, 2, 14; 23, 2ï. 

isun, 2, 33; 3, 8; 4, 31; 15, 5; 19, 

7, 8; 21, 18, 29, 35; 22, 33; 23, 19; 

24, ö; 27, 32; 28, 21, 23. 

ingsun, 2, 8, 9, 14, 16, I8; 5, 33; 6, 

19, 21, 24, 25; 7, 3, 4; 9, 6, 13, 14,15; 
10, 20, 22, 23, 29, 80, 38; 11, 2, 8, 9, 



— 287 — 



iB, 18; 12, 8; 13, 17, 20; 14, 13, 16; 
15, 4, 9; 17, 3, 4; 20, 86; 26, 1. 
sun-, 2, 16; 11, 3; 12, 14; 13, 21; 

23, 22; 27, 35; 31, 6. 

isun-, 5, 32; 21, 35; 23, 20; 31, 9. 

ingsun-, 9, 7; 10, 25, 34; 11, 30; 15, 

14; 16, 15. 

-isun, 21, 17, 34; 23, 25. 

-Disun, 21, 18, 35; 22, 33; 23, 22, 18; 

24, 7; 26, 2. 

-ingsun, 2, 17, 31 ; 6, 1 8, 19 {na een vocaal)] 
9, 14, 31,33; 11, 29; 12, 2; 13, 21,24; 

15, 6; 23, 88. 

-ningsun, 6, 4, 20; 9, 4; 10, 13,27,31, 
32; 11, 6, 8, 9, 11, 31; 14, 9; 15, 10; 

16, 37; 17, 4; 20, 28. 
iringsun, 6, 5; 9, 33; 10, 24, 29. 

sinahu. 

asisinabu, 32, 32. 
sanak, zie anak. 
sanda, 15, 21. 
sanidya. 

comp.: siddhisanidya. 
sënët. 

asönëtan, 8, 2, 13; 17, 3, 6, 9, 17. 

asënëtana, 8, 9; 17, 1. 
santosa, 9, 16. 
sande, 15, 20. 
sandinnr. 

asanding, 4, 19. 

sandingira, 27, 8. 
sor, 5, 20; 7, 10 ; 25, 19, 36. 

isoring, 26, 11. 

kasoran, 22, 31, 23, 3. 
^ri, 13, 29; 16, 3G; 18, 11, lé, 21, 23; 

24, 30; 25, 1, 4, 25; 27, 22, 16, 17, 19; 

30, 5; 32, 11. 

asri, 22, 35. 
sira, 1, 4, 5, 10, 13, 14, 15, 17, 19; 2, 2, 

3, 6, 7, 11, 12, 13, 14, 15,16,17,19,20, 

24, 27, 30, 3J, 32, 33; 3, 1, 3, 5, 8, 9, 



11, 13, 14, 17, 2-), 21, 22, 23, 24, 

26, 27, 28, 29, 30, 31, 32, 33, 3i, 35, 

I, 3, 4, 10, 13, 14, 17, 18, 23, 24, 

27, 29, 30, 31, 32, 34 ; 5, 3, 4, 6, 7, 

II, 12, 13, U, 15, 16, 17, 18, 19, 
22, 24, 25, 26, 23, 29, 31, 32; 6,3, 

5, 7, 8, 9, n, 13, 16, 17, 20, 2?, 24, 

28, 29, 30, 31, 33; 7, J, 5, 7, 8, 9, 
13, 16, 17, 18, 20, 21, 23, 27, 28, 

30, 35; 8, 2, 4, 5, 6, 7, 8, 11, 12, 
16, 22, 23, 21, 25, 28, 29, 9, J, 3, 

5, 6, 7, 8, 9, 10, 12,15,16,17,20,22, 
25, 26, 28, 30; 10, 4, 5, 7, 8, 9, 10, 12, 

18, 22, 23, 24, 26, 27, 28, 29, 31, 
34; 11, 7, 8, 9, 10, 16, 17, 20, 23, 
27, 29, 31; 12, 2, 4, 7, 9, 11, 13, 

21, 26, 27, 82, 36, 37; 13, 3, 4, 6, 
8, 9, 10, 13, 21, 23, 24, 28, 30, 31, 

33, 34; 14, 10, 11, 12, 14, 22, 28, 
32; 15, 2, 3, 4, 8, 11, 12, 19, 20, 

24, 25, 26, 28, 31 ; 16, 3, 5, 6, 10, 13, 
16, 17, 18, 20, 24, 25, 26, 28,29,31, 

34, 35, 37; 17, 1, 2, 6, 8, 9, 10, 
15, 18, 23, 24, 25, 26, 37; 18, 3, 

6, 7, 9, 10, 12, 14, 16, 20, 22, 26, 30, 
33, 37; 19, 6, 7, 8, 10, 11, 12, 17, 
20, 24, 30, 31; 20, 1, 2, 5, 7,8,10, 

13, 14, ]6, 16, 17, 19, 27, 29, 31, 
33, 37; 21, 4, 5, 8, 10, 11, 12, 13, 
15, 17, 19, 22, 23, 25, 28, 29, 30, 
32, 34, 35, 37; 22, 18, 22, 24, 28, 

31, 32, 37, 39; 23, 1, 4, 12, 15. 
18, 19, 20, 23, 24, 25, 27, 35, 36, 
24, 1, 2, 6, 11, 14, 19, 25, 37, 38; 

25, 1, 2, 5, 6, 8, 11, 12, 13, 18, 19,20, 

22, 24, 25, 26, 32, 34; 26, 4, 6, 6, 
10, 14, 18, 20, 24, 25, 27, 20, 30, 32, 

36; 27, ), 3, 4, 6, 9, 10, 11,13,20, 

22, 2i, 28, 31, 33; 28, 4, 6, 8, 9, 

14, 17, 18, 19, 20, 23, 21, 25,26,28, 

33, 3i, 35, 36; 29, 8, 10, 16,18,21, 



10 
25 

4, 
25 

10 
21 

4, 
27 
11 
29 
13 

4, 
24 

16 
33 

26 

17 

7, 
32 

31 
23 
15 
32 
11 

5, 
31 

19 
12 
32 
14 

31 
30 

17 

37 



21 

7, 
35 
21 
12 
32 



— 288 — 



26, 29; 30, 4, 7, 20, 22, 28, 29, 34, 37, 

31, 7, U, IC, 17, 19, 29; 32, 4. 

sireng, 6, 23. 

sira-, 20, 12. 
sore, 17, 18, 32, 3t; 24, 10. 
sërah. 

asrab, 22, 21. 

as^rah, 24, 21. 

sinérahakön, 24, it. 
surak, 29, 7. 

suraking, 2, 20. 

asumk, 8, 24; 29, n. 
Burud. 

murud, 14, 23. 
grddha, 32, 30. 
(raddhana. 

pa^raddhanagung, 29, 27. 
sërat. 

sinëiat, 32, 29. 
Burat, 18, 33; 22, 17; 23, 21. 

anarat, 32, 33. 

sinnrat, 32, 28. 
sarwa, 24, 13, 18. 
Burawe. 

asurawean, 18, 31; 23, ]j. 
Birëp, 4, 10; 19, 31. 

Birêpiug, 12, 19. 
Burup, 15, 21. 
sarama. 
asaramalia, 22, 26. 
paBasaramaniDg, 22, 26. 
Bëréng. 

Bërëngën, 4, 23; 7, 18; 28, 8. 
sërang. 

nöuërung, 4, 17. 
siring, 29, 6. 
saka I. 
Baka, 13, 19; 18, 18; 19, 2, 4, 21; 23, 

31, 32. 
saka II. 

(saka-); 3^ 2; 4^ 32; 13| 18^ 25. 



5aka II, 15, 26, 28; 16, 13; 18,4,9,24, 

31, 34; 25,2,15,22,28,29,30; 26,9,11, 

27, 10, 18; 28, 15, 16; 29, 15, 27, 

28, 29; 34, 35; 30, ], 19, 24, 27, 28, 

32, 3t; 31, 4, 15, 16, 18, 19, 22, 23, 

24, 28, 29, 32, 3i, 35, 37; 32, 3, 8, 9, 
12, 16, 17, 18, 19, 21, 24, 26, 28. 

siki, 19, 37; 24, 36. 
suka, 2, 16; 4, 30; 9, 15; 13, u; 15, 
so; 21, c; 22, 19, 22; 23, 5, 13, 27; 

25, 25; 26, 12; 31. 9. 
Bukaliauingong. 22, 20. 
akasukan, 4, u; 10, 3; 1^. 27. 

goka, 4, 14. 
sakarayita, 17, 8. 
Qakti. 

kagak tinira, 7, 10. 

ka^aktiningsun, 13, 21, 24. 
sukët, 8, 13. 

sak^at, 13, 17, 23; 26, 2. 
sëkul, 6, 14, 17, 21, 23; 20, 34, 35. 

sëkulc 6, 12. 

Bëkuling, 6, lu. 
sakala, 4, 2 ; 14, 33. 
sikëp. 

asiköp, 23, 39. 

Biniköp, 12, 27; 26, 15. 

kasikëp, 24, 1. 
Bakita. 

Bakitaha, 17, 29. 

sakuta. 

* 

Binakuta, 21, 30. 
sakiDg, 1, 4; 2, 17; 3, 12, 15, 17, 28; 
4, 11, 20; 5, 5, 6, 8, 10; 6, 16, 26, 

30; 7, 3, 28, 29, 35; 8, 3, 4, 5,21,26; 

9, 7, 8, 11, 13, 28; 10, 5, 9, 27, 28, 

31; 11, 16, 22; 12, 16; 13, 30; 14, 

10, 25; 15, 29; 17, 23; 18, 3i; 19, 
4, 6, 15; 20, 31; 21, S; 22, 1;, 13, 
S6; 23, 30, 31, 33, 34; 24, 5, 27; 25, 

10; 26, 325 27, 345 28,13, 16; 29,12, 



'2é9 — 



23, 21, 29 ; 32, 22. 
j9udnk. 

sasudukan, 22, 32, 34, 38* 

asosudukana, 22, 33. 

anuduk, 17, 18, 19, 21. 

amiduka, 17, 17. 

sinuduk, 7, 19; 11, 13; 12, 2, 21; 

15, 29, 23, 16, 12; 17, 20; 26, 22; 

27, 8. 

dera-suduka, 11, 11. 
siddha, 7, 28. 

siddhaning, 7, 27. 

comp, prasiddha. 
siddbi, 

cotnp. : dbarmakaïïcanasiddhi. 
suddha. 

snddhanira, 15, 23. 
siddhisanidija, 6, 30. 
saddhya. 

saddbyanisun, 21, 35. 
siddham, 1, 1. 
sat. 

asa ia, t? , o « « 

BOt. 

sotira, 5, 28; 10, 1. 

sotmami, 9, 36. 
stri, 9, 21; 10, 11, U, 3t, 35; 24, 36; 

27, 23, 26; 29, 18, 22, 23; 30, 4, 7, 

11 ; 31, 28, 37. 
Qatru, 18, 29. 

comp. ajayasatru. 
setra. 

setraning, 9, 20. 
strisamaija, 2, 3. 
fitapaka. 

comp.: boddhastapaka. 
Batya, 1, 10. 
Qagib, 15, 9. 
Basar. 

kasas^r. 
saBtra; 3; 35, 4, i ; 32,^ 31. 

Verh. Bat. Qeflu, deel XLIX. 



comp.: swarawyafijanasastra. 
Qewa. -^ 

Qewa-sogata, 13, 16, 30.' 

ka^ewan, 27, 22. ' 

sawab, 1, 20; 2, 1, 7; 19, 25; 21, 8, 9. 
8warawyafijana(jastra, 4, 1. - 

sewaka. 

asewaka, 9, 13 ; 13, 27 ; 22, 8, 25 ; 23, i#. 

sewakaba, 22, 2. 

sumewakaba, 9, lé. - - 

pakanira-sewaka, 22, 4. 
sawala I. 

anawala, 5, 4, 11, 16; 6, 39; 7. 4. - 
Bawalan IL 

pasawalanira, 18, 28, 33; 22, 16. ' 
Bwapna, 10, 29. 
sawyakti, 12, 26. 
swayambara, 27, u. 
swagata. 

Binwagatan, 6, 23. 
sawung, 16, 3, 9. 

sawungira, 16, 12. 
BowaDg, 19, 30; 28, 4; 17, 33. 
salii, 4, 18. 
Qela, 12, 8. 
salab I. 

salab, 8, 15. 

sinalaban, 17, 6. 
salab, II. 

asalab, 18, 21 ; 27, 7. 

asalaba, 27, 7. 

Binalabakën, 7, 3). 

den-salabakën, 6, 10. 
silib. 

sun-silibe, 12, 17. 

silibasib, 12, 37. 
salabasa. 

analabasa, 12, 7. 
sulak^ana, 4, 1. ■ ■• ' 

BÜit, 18, 3. • • 

S3lës6k 



— 290^ 



sinëlësik, 26, 4. 
sélang. 
samëlang, 11, 24. 

salanggap. 

asalanggapan, 8; i8. 
sapa^ 10, 12; 14, 9; 22,37; 25, 36; 31, 6. 

sinapa, 6, 17. 
sapn. 

ananapua, 8, lo. 
sépi. 

asëpi, 21, 2. 
sipi, 10, 2; 21, 84. 
sapih. 

sinapih, 17, 23. 
sapek^, 2, 31; 23, 3, 15; 29, 8« 

sapek^ha 12, I6. 
snpek^a, 2, 31. 
eaptawara, 4, 3. 
sëdah, 5, 12; 14, 27; 21, 20, 22. 

asédahan, 5, 12. 
sadwara, 4, 2. 

aëdeng, 1, 18; 13, 32; 14, 15; 16, 12,82; 
19, 34. 

sëdënging, 8, 10. 
sëdëngipan, 17, 17. 
sëdëngira, 15, 19; 19, is. 
anëdëng, 4, e. 
sëdëngan, 20, ss. 
Baji, 3, 13. 
sajati, 15, 12. 
sajöng, 19, 6, 18. 
sajëng, 21, 28; 22, 1. 
sayat. 

anayuti, 23, 17. 
saujata, 14, I8, 19, 2t; 18, 18; 19, 2, 
4, 9, 12, 14, 21; 21, 5; 22, 14; 23, 
30, 31, 34; 24, 12; 25, 26: 29, 10. 
sanjata-ing, 14, 17. 
siSjang, 21, 23. 

«aina, 4, 4; 7, 2], 22; 8, I8, 22; 13,12, 
18, 2G; 14, IF, 27, 30; 16, 11, 25; 17, 



2, 26, 3], 34, 35; 19, 13, 19, 22, 23, 37/ 
20, 16, 21, 22, 29; 21, 1, 33; 22, 27, 
29; 23, 7; 24, 22; 25, 8; 26, 7, 27, 
30; 27, 1 ; 28, 4, 19, 28 ; 30, 8; 31, 6, 6. 
samanipan, 3, 1. 
samarowangipan, 12, 36. 
comp.: prasama. 
sëmn. 

asëmu, 11, 31. 
somah, zie omah. 
samana, 28, 23. 
smara. 

kasmaran, 10, 8. 
samadaya, 16, 20, 21, 23, 25; 28, 7. 
samasa. 

samasanira, 15, 7; 16, 5. 
sampun, 7, 7; 9, 28; 10, 26; 11, 19; 
12, 36; 14, 23; 15, 21, 23, 27; 17,82, 
19, 1, 22; 20, 8, 9, 10; 22; 21, 31; 
22, 14, 22; 23, 10, 11, 16, 34; 25, 
33; 28, 35; 31, 8; 32, 30. 
sampune, 17, 15. 
samponing, 5, 21. 
sasampunira, 13, 15. 
sampfiraa, 5, 14. 
samaya, 9, 30 ; 24, 21. 
samayanira, 11, 26; 21, 37- 
pasamayanira, 25, 16. 
comp. strisamaya. 
sambi, 21, S7. 
sSmbah, 16, 24. 

anëmbah, 13, I6, 20. 
anëmbaha, 13, 25, 26. 
anëmbahi, 13, 19. 
sëmbahën, 13, 20. 
sambat. 

asasambat, 5, 21. 
sambat. 
anambut, 11, 17. 
sinambut, 2, 26. 
kasambat,.26, üö. 



— 291 — 



denira-sambnt; 20, 6. 
samangka, 17, 18; 8, 21; 9, 37; 11,25; 
12, 4, 7 f 27; 13, 27; 14, 13, 17, 22, 
25; 17, 9; 18, 25; 19, 1, 8, 9, 
22, 29, 36; 20, 13; 21, 10, 21, 33; 22, 
23; 23, 2, is; 24, 24, 34; 25, 20; 26, 

14, 19, 80; 27, 2, 13, 85; 29, 16. 
samangkana, 5, 9, 21; 8, 15, 26. 
Bega. 

sëganp, 6, 18, 19. 

sëganing, 6, 13, 15. 
sagara, 29, 14. 
sogata. 

comp.: sewasogata. 
snb, 26, 32. 

kasnb, 9, 23; 23, 8. 
seba. 

asesebana, 9, 9. 

amara^eba, 9, 17; 10, so. 

sineba, 9, lo; 21, 12, 13, 16. 

pasebanira, 21, 13, 

paseban, 21, u. 
sabran, 12, 25. 
Babrang, 2, 19; 5, 23, 25; 9, 13. 

anabrang, 21, 7; 22, I6. 
gabda, 5, 22; 7, 25; 8, is; 20, 22. 

sabdanira, 24, 21. 

(abdaniiigsuD, 6, 4. 
sabuk, 21, 33. 
sftbel. 

asëbel, 11, 32. 
(nbham, 32, 32. 
sang, 1, 5, 7, 16; 2, u; 5, e; 7, 17,22, 

24, 25; 8, 18, 22, 23, 25; 9, 10, 11, 12, 
13, 14, 17, 29; 10, 17, 22, 84; 12, 27, 
13, 2, 6, 14, 29; 14, 6, 8, 12, 16, 29; 

15, 1, 7| 9, 10, 14, 17, 18, 21, 22, 25, 

27, 29, 30, 81, 82; 16, 1, 8, 9, 11, 13, 16, 

28, 32, 83, 87; 18, 9, 22, 87; 20, 2, 8; 

21, 6, 27; 22, 1, 27; 23, i, i6, 19, 23; 

24, 2, 6, 7, 12, 16, 18, 19, 37, 88; 26, 



5, 7, 18, 25, 30, 31, 34, 86; 27, 8, 23, 
24, 26, 30, 86 ; 28, 1, 8, 6, 14, 23 ; 29, 
II, 21. 22, 23, 38; 30, ], 20, 31, 32, 
37; 31, 36; 32, 4, 12^ 23, 24, 30, 33 
sing, 29, 13. 



SUDg. 



asung, 23, 13. 

asuDga, 21, 3. 

tanpasung, 28, 34. 

sinung, 15, 16; 25, 85; 27, 1. 

sinungakën, 12, 14; 15, 14; 16, 5. 

siDUDgakening, 16, 8. 

Binungan, 18, 17; 29, 1. 
sanga. 

sangang, 27, 10. 
Bangn. 

Bangnmpnn, 23, 6. 
sangka, I. 

sangkane, 4, 15; 6, 6, li; 26, 19. 

^sangkaning, 7, 11, 34; 18, 2, 10 ; 24, 

16; 25, 10. 

sangkanira, 11, 28; 13, 16; 18, 21, 

20, 30; 28, 8. 

BaDgkaningsan, 9, 4; 10, 31. 

saDgkaring, 29, 3. 
(aDgka II, 8, 30. 
Bëngka. 

BuméDgka, 19, 25. 
Bangketa. 

Bangketanira, 1, 16. 
Bingkal. 

Bisingkalan, 19, 27* 
Bungkélang. 

anangkëlang, 12, 12, 17* 

sinnngkëlang, 16, 7. 
Bangkapani. 

asangkapani, 13, 31. 

anangkapanéni, 16, 32. 
singkab. 

kaBingkab, 10, 82. 
singid. 



~ 202 .-- 



, , BijBingidan^ 6, 15, 
singse. 

kasiDgse, 18, i. 
.sangsaya, 3, 1; 6, 8; 16, 27. 
sangawara, 4, 3. 
sanggub. 

sinangguh, 10, 35. 
sënggafa. 

pasënggahan, 18, 17. 

apasëDggalian,^ 18^ 3^. 

SëDggulh 

anëngguh, 2, 28; 7, 4; 17, 8. 
«ëDggeh. 

sinënggeh, 17, is. 

anënggeh, 18, 34. 
singgih, 2, 26, 30; 3, 19 ; 6, I8; 9, 9, 5; 

11, 29; 16, 10, 24; 22, 34; 23,8; 24,8. 
sanggaruh. 

asanggaruhan^ 8, 24. 
saDggup. 

Bangguping, 17, 26; 29, 2. 

sanggupipun, 17, 31. 

BaDggupira, 7, 8; 24, 4, 9, 18; 27, 3G. 

asanggup, 1, 9, 10: 24, 6; 26, 31; 

28, 35; 29, 1. 

saDggupa, 24, 9. 
sanggama. 

asanggama, 2, 2, 4, 8, 12, 32; 5, 8; 7, 33. 
weh. 

tanpaweh, 2, i4t 

wineh, 4, e; 19, is; 26, 12 

winehan, 26, 21. 

Bun-wehi, 13, 24. 
woh, 21, 20. - 

wohing, 4, 7, 9; 12, 13, 14, 21, 22, 80; 

23, 8. 

awoh, 4, 4. 
wahn, I, 8, 2b ; 10, 2, s. 
wahn, II. 

winabonan, 28, is. 
WTin. 



wunwnnanira, 4, ij, 21, 
wani, 4, 7; 12, 33; 16, 25; 22, 9, 37; 23, 38. 
wano, 17, 36. 
wunuh. 

winunuh, 26, 15. 
wanten, 28, 6. 
wontëu. 

wontën, 3, i2; 6, 32; 10, 13, 24, 30; 

13, 18; 14, 30; 15, 13, 16; 16, 4, 33, 

37; 17, 17; 18, 36, 37; 19, 36; 20, 4; 

21, i, 2, 12, 13; 22^ 6, 12; 23, 8.- 

wontëna, 9, I6; 20, 38. 
wënang, 12, 35. 

amënangi, 22, 26. 

kawënang, 14, 23. 

kawëwënangane, 14, 3. 
waca. 

amaca, 24, 17. 

winaca, 22, 22. 
wicara. 

amicara, 6, 4. 
wor. 

kaworan, 12, 37. 
wara. 

comp. : triwara, sadwara, saptawara, 

sangawara, paficawara. 
wira. 

comp,: prawira. 
wuri, 26, 3. 
wruh, 5, 18; 6, 33; 8, 10 ; 9, 4, 29; 10, 

8; 12, 24; 13, 21; 15, 8, 32; 23, 32; 

26, 37, 24. 
- kawruhan, 5, 17, 19. 

wruhanira, 2, 8. 

wrahanta, 8, 20. 

depun-kawruhana, 22, 19. 

pakanira-kawruhana, 22, 10. 
warah. 

awarah, 9, 33; 10, 8, 9; 16, 34; 26, 

26, 29. 

awawarab; 26, 33. 



— 293 — 



winarab; 4, i; 25, Z2\ 26, «7. 

Avinarahan, 3, 35; 4/ 4; 7, 8. 

pawarahira, 8, 32. 
wërdhi. 

sawerdhining, 4, 1. 
wrat. 

awrat, 6, 31. 
wërta, 15, 1. 

wërtanira, 14, 7. 

awërta, 2, 28; 15, 12; 28, 11. 

kawërta, 5, 4; 6, 3a; 8, 2; 9, 22; 15, 28. 
waruju, 3, 26; 28, 13. 
warga. 

comp.: kadangwarga. 
warang. 

awawarangana, 28, 30. 
wirang. 

awirang, 16, 26; 20, 28; 21, 18. 
wuning, 25, 6. 
waringin. 

sawaringin, 5, 13. 
wëka, 2, 27; 28; 3, 19; 5, 28; 7,n;10, 

24, 33. 
wuku, 4, 3. 
wikan. 

wikana, 2, 32; 3, 33; 24, 33. 
wukir, 24, 33. 
wëkas. 17, 16. 

wëkasira, 2, 9; 11, 14; 28, 6. 

wëkas-pakanira, 20, 24. 

sewëwëkasira, 23, 27. 

awëkas, 23, 4, 12. 

amëmëkas, 6, 24. 

winëkas, 17, 32. 

wëkasan, 2, 22; 3, 2, 6, 10; 5, 4; 8, 

6; 10, 16; 17, 22; 20, 21; 21, 19; 

22, 38 ; 23, 1 ; 24, 35 ; 26, 29. 

awekasan, 20, 19. 
wadi. 

sawadinipnn, 21, 36. 
wado^ 14; 22, 23; 29, 6. 



wëdi. 

awëdi, 2, 14 ; 6, 81; 7, 4; 13, 12; 15, 

2; 24, 13; 26, 1. 
widhi, 8, 7; 10, 5; 12, 20; 13, u. 

widhining, 3, 18; 22. 

winidhi, 13. 25. 

wimdhyan, 8, 24. 
waden, 1, 19 ; 2, 21 ; 3, 26 ; 5, 1 ; 10, 

13, 16; 13, 6, 11; 23, 38. 

amadoni, 27, 1. 
wndun. 

wuwudun, 16, 26. 
wadwa, 14, 20. 
wëdal. 

mëdal, 7, 21. 
widyadbari. 

kawidyadharen, 30, 36. 
wadfuig. 

wadung-pacule, 14, 2. 

winadung, 5, 20. 
wit. 

witing, 4, 5; 5, 18. 
wet, I. 

weting, 20, 3. 

wetning, 6, 19; 12, 15. 
wet, II. 

awet, 18, 2. 
wëtu. 

mëtu, 2, 22; 4, 11, 20, 25; 8, 21; 19, 

13; 23, 32. 

mëtna, 5, 8; 9, 32. 

amëtoni, 23, 31. 

winëton, 4, 25. 

kawëtunira, 10, 28. 
wetan, 5, 24, 25; 8, 19, 27; 20, 25; 23, 

32, 84; 25, 36; 26, 8; 31, 10. 

wetaning, 1, 37 ; 4, 33; 7, 27; 13,12. 

sawetaning, 9, 23; 13, 12. 

mangetan, 25, 32. 
watara, 17, 20. 

awatara, 17, 15. 



— 294 



watëk, 8, 17, 18, 19, 20, 22, 24. 

wëtisira, 10, 6. 
wëtëug, 2, 21. 
was. 

kawaswasan, 12, 2S. 
WU8 (vgL awus en huwus), 8, 33; 25, 7, 
*-32, 36; 29, 7. 

wusing, 24, 33. 

wnsira, 12, 6. 

kawusanira, 32, 29. 

wësi, 13, 84. 

wastra, 21, 32; 24, 15. 
waspada. 

kawaspadan, 26, 14. 

winaspadakën, 9, 2. 
wawa. 

amawa, 6, 30; 7, 21; U, 27; 16, 8; 

17, 8b; 19, ib; 22, 21; 24, 17, 22. 

amawaha, 30, 3. 

kawawa, 22, u; 23, ie. 

sie ook tnwawa. 
wiwaha. 

wiwahanëD, 28, 8S. 
wiwal, 18, 8. 
wolu. 

woluDg, 3, 7. 

angawolu, 25, 20. 
'walah. 

kawalahan, 4, 22. 
wëlah. 

wëlaban, 6, 9, 15. 
wëleh. 

apamëleh 28, 24, 25. 
. wulan, U, 18, 19, 22, 26; 12, l; 25, 

81 ; 26, 88. 
/walër. 

maler, 2, 19. 
walukn. 

amalnkn, 6, 9, 11; 19, 27. 
wnlaka. 



wnlnkane, 14, 2. 

amalukna, 6, 16. 
walat. 

den-walating, 9, 33. 
wëlit. 

amëlit, 4, 19. 
wnlat. 

mnlat, 4, 20; 12, 13. 
walës. 

winalës, 13, 33. 

pamalës, 15, 82. 
wëlas I. 

sawëlas, 29, ie. 

rowëlas, 31, 17. 

limawëlas, 26, ie. 

pi tn- wëlas, 25, 5; 31, so. 
wëlas II. 

wëlasira, 12, 31. 

awëlas, 13, 31; 16, S3. 

amëlasakën, 6, 26. 
wilasa, 7, so; 8, 5. 

awila^a, 20, 28. 

tanpawilasa, 3, 12. 

tanpawilasaha, 20, so. 

winilasan, 12, 31. 

pawilasane, 13, 88. 

pawila^anira, 21, so. 
walang. 

walangati, 7, 7; 21, 31; 28, 86. 
wilang. 

wilangën, 5, 34. 

kawilang, 23, 10. 
wulaDg. 

den-wnlang, 24, 24. 
wadab. 

winadahan, 24, i4, 15. 

den-wadahi, 6, 11. 

wëdus, 1, 6, 9; 14, 24, 

... 
wgi. 

wgine, 7, 34. 

saw^i, 19, 89; 20, 89; 34, ts. . 



— 295 — 



wyil, 21, 35. 

wijiling; 5, 15; 8, 20; 13, l, 4. 

myil, 24, 6; 27, 29; 29, 18, 80,22,25, 

30, 3, 5, 7, 8, 9, 18^ 

amijilakén, 19, 6. 
wayah. 

awayah, 3, 3. 
waynh. 

awayah, 3, 24. 
wyanjana. 

comp.: swarawyafijwasastra. 
wyakti, 11, 7. , 

pangawyakti, 13, 21. 

cofnp.: sawyakti. 
wiyata. 

wiyatanira, 3, 33. 
wayang, 5, lo. 

awayang, 27, i. 
wighna. 

comp.: nirwigbna. 
wibh&wajanma, 1, il. 

woDg, 1, 18; 2, 20, 23; 4, lo, 31, 34; 

5, 1, 4, 12, 14, 16, 16, 19, 82; 7, 1, 
4, 6, 24; 8, 1, 3, 20; 9, 20, 31, 33; 
10, 10, 13, 15, 16, 11, 6, 12; 12, 8, 

16, 19, 24, 25, 33; 13, 4, 5, 13; 14,4; 
15, 17, 18, 19, 22, 23, 24, 31 ; 16, 2, 

17, 23; 17, 17, 18, 19, 20, 21, 22, 24, 
25, 27, 28, 31, 34; 18, 10, 25; 19, 3, 

13, 31, 33, 34, 36, 36; 20, 1, 4, 14, 16, 
19, 34, 36, 37; 21, 28; 22, 5, 11, 24, 
37; 23, 5, 6, 29, 33, 39; 24, 1,8, 7, 10, 
17, 20, 22, 23, 24, 37; 25, 7, 31, 36; 26, 
8, 6, 8, 12, 17, 18, 30, 32; 28, 3,8,12, 

14, 30, 32, 33, 34, 86, 37; 29, 9, 10, 12, 
13, 14; 32, 2. 

wongira, 16, 8; 18, 16; 20, is; 21, 12; 
22, 26, 36; 23, 2, 8, II. 
sawoDg, 24; 11. 
wong-atnwane, 2, 22. 
apawoDg, 12, lo. 



amoDg, 6, 28. 

winoDging, 14, 17. 

ingsun-wong, 9, 7. 

pamongmong, 15, 2, 3. 
wëngi, 19, 34; 20, 4; 26, 17; 31, 12. 

sawëDgi, 4, 11, 18. 

ainëméngi, 21, 4. 

kawëngen, 21, 8 
wangku. 

amaDgkubhumi, 26, 36; 27, 28; 28^2, 

3, 7, 20; 29, 16. 

mangknbhami, 7, 82 ; 27, 30. 
wangke, 29, 14. 
wangkawa, 8, 15. 
wungkul, 12, 12. 
wcngkang. 

pamëngkang, 16, 2. 
wungsu. 

pamungsu, 27, 24; 30, 4, 8; 32, 23. 
wangsul. 

mangsul, 6, 3; 18, 26; 19, 23; 20,19; 

21, 12; 22, 24. 
wangbang, 14, 4. 
lab I. 

lab, 3, 8; 4, 30; 6, 19, 20; 7, 5;. 9, 

16, 30; 11, 18, 21 ; 13, 20, 23 ; 16, 9, 10 ; 

20, 7, 18 ; 21, 17 ; 22, 32 ; 24, 6 ; 27, 35. 
lab II. 

lumab, 21, 27. 
lëbëng, 20, 12. 
lubung, 21, 18. 
lan, 24, 31 ; 25, 29 ; 26, 9, lo ; 29, 8, 

18; 30, 13. 
len, 6, 1; 27, 2. 
Ion. 

depnn-aloD, 21, 31. 

alonlonan, 20, 19. 
lina, 15, 21 ; 16, 13. 

linanira, 15, 25; 18, 4. 

comp, : pralina. ;: 

lante. .: 



— 296 — 



panglantO; 14, 17. 
lantar. 

palantaran^ 31, 22. 
lintang. 

malintang, 4, 3i; 5, 4^ 16. 
lindu, 8; 14. 

palindu, 32, 3. 
landëp. 

lalandëp, 24, 13, 16, 18, 22. 
l$inde. 

landeyanipan, 13, 22. 

lanang, 1, 19; 2, 21, 22,23; 13,2,4,5,6, 

8, 9, 10, 11; 18, 14, 15; 21,23; 24,35. 
lor, 18, 9; 19, 5, 12, 13; 23, 31, 33; 25, 7, 17. 

loring, 14, 18; 19, 2, 4, 9. 

mangalor, 19, 20; 20, 14; 21, 7; 23, 39. 
lara. 

alara, 12, 30; 25, 24. 
lara. 

lalaron, 20, 13. 
lurab, 23, 36; 25, 17. 
laris. 

Inmaris, 7, 7* 
Inrang. 

anglamng, 14, 14. 
lek, 12, 36. 

leking, 2, 22; 13, 1. 
laki. 

lakine, 1, 20. 

lakimn, 2, 4. 

lakinta, 2, 4, 10. 

aliki, 24, 29. 

pinaka-lakinira, 27, 14. 

sapalaki, 1, 6. 
lakn. 

laknnira, 12, 21. 

Inmakn, 1, 3; 2, 19; 20, 14, 17, 18, 

35, 37. 

amalaku, 1, 6; 3, 25; 11, 3; 21, 30; 

24, 4, 11, 22. 

malakn, 11, 6. 



pinakalakn, 11, 30. 

pamalaknnira, 1, 12. 

papalakoning, 1, 9. 
lakar, 6, 31; 7, 16. 
likur, 30, 29. 
laksa. 

den-salakseng, 26, 2. 
laksana. 

laksananing, 10, 11. 

laksananipun, 10, 12. 

comp.: salaksana. 
lud. 

linud, 27, 8. 
lët, 27, 10; zie hëlét. 
ISs, 6, 2. 
listu. 

listu-hayuning, 9, 21. 

listu-hayanira, 10, e. 
luwe, 6, 21. 
lawah. 

lalawah, 4, lo^ 16. 22. 
lëwih, 5, 34; 29, 11. 

tunalëwih, 23, si. 
lawan, 2, 2, 4, 10, 14, is; 3, 35; 4, 2, 

84; 9, 14; 10, 29; 12, 11, 35, 37; 13, 

4, 7, 34; 14, 3, 4, 7, 20, 27, 28, 32; 
15, 6; 16, 10, 22; 17, 8, 22, 31, 34; 
18, 5, 28, 30; 19, 8, 19, 87; 20, 2, 

20; 21, 10 ; 22, 19, 82; 23, 14,19,31, 
85; 24, 35; 25, 6, 17, 21; 26, 13, 30; 
27, 10; 28, 15; 30, 17; 31, 3. 
pinakalawanira, 22, 34. 
kalawan, 2, 11, ie, 33; 3, 28, 3i, 88, 
32; 4, 8, 82; 9, 34; 13, 8; 14, 4; 15, 
5; 19, 3; 21, 87; 24, 16; 27, 25. 
alawan, 22, 37. 
anglawana, 7, 6. 
linawan, 3, 21. 
ingsun-lawanane, 28, 80. 
isun-lawanane, 31, 9. 
lawon. 



— 297 — 



sakalawonlawoD, 3^ 2; 4, 32. 
liwar. 

aliwaran, 21, ie, 
liwat. 

aliwaty 8, 30. 
lawas. 

lawasC; 12, 1. 

alawas; 3, 27 ; 5, 15 ; 9, 17 ; 10, 26, 27, 29; 

11, 24, 26; 12, ib; 13, i; 14, 7; 15, 

1, 25, 18, 25; 26, 20. 

dera-Iawas, 12, 1. 
lawang, 1, 7 10; 24, 28. 
lalah. 

lalahan, 21, 9. 
lilir. 

anglilir, 7, 26. 
lapa. 

lapa-inggnn, 6, 19. 

alapa, 23, 6. 
luput, 16, 30 ; 28, 9. 

lupnta, 16, 85. 

luputeng, 14, 1. 

kaluputan, 15, 12. 
laju. 

lumaju, 21, 11. 

lumajua, 21, 32. 

Isyêng. 

malajëng, 17, 37; 20, 3. 

palajënging, 19, 36. 

kapalajëng, 22, 36. 
layu. 

malayu, 5, 25, 27; 7, 19; 15, 22; 17, 

9, 19, 20; 22, 29, 30; 24, 26. 

palayunipun, 22, 31. 
apapalayon, 19, 23. 
amalayokën, 9, 80; 24, 2. 
pinalayokën, 9, 27, 29; 17, 38. 
kapalayu, 14, 23; 19, 13 ; 23, 1, 36. 
layang. 

anglayang, 5, 25. 
aDglayanga, 5, 23. 

Yerh. Bat. Oen., deel XLIX. 



laficing. 

laficingan, 19, 29. 
linok, 1, 16. 

aliöok, 5, 33. 
lama. 

lama, 18, 35. 

alama, 3, e; 22, i, 82. 

alalamia, 7, 33; 12, 33; 13, s; 15, 28; 

16, 2. 
lému. 

alëmu, 29, 23; 30, 37. 
lima, 6, 31; 26, I8. 

limang, 11, is, 19, 22, 26; 12, l; 28, 4. 

lilima, 5, 30. 

anglilima, 28, 4. 

limiawëlas, 26, I8. 
lëmah, 13, 23. 
lëmëh. 

alëmëh, 27, 33. 
lamnh. 

alumuh, 2, 13; 24, I6. 
lamun, 3, 9; 4, 7; 6, 24; 10, 11,18,19, 

22; 11, 20; 12, 8; 14, 10; 20,12,18, 

28; 21, 36; 22, 8, 5; 23, 23; 27, 20, 

21, 33, 34; 28, 13, 21. 

lampah. 

lumampah, 3, 17. 

amalampah, 20, 33. 

amalampaha, 6, 21. 

pinalampahan, 1, 6. 

papalampahanira, 11, 28. 
lumpang, 12, 3. 
limbe. 

aDglimbekën, 28, 5. 
lagi, 11, 32; 19, 6; 24, 12. 

comp.: pralagir 
ligar. 

tanpaligaran, 22, 35. 
lëbu. 

linëbon, 18, 10. 
labuh. 

194. 



— 298 — 



alabub, 24, 19. 
alabaha, 24, 20. 
ling^ 8, 18. 
lingira, 1, 7; 2, 7, 15; 4, 7, 15, 30; 
5, 10; 6, 9, 5; 20; 28; 7, 1, 2, 26, 35; 

8, 9, 11, 29; 9^ 3, 6, 11, 16, 30, 33; 
10, 10, 11, U, 21, 25, 26, 34; 11, 15, 
19, 21, 28, 31; 12, 8; 13, 16, 19; 14, 
12, 16; 15, 10, 12; 16, 4, 8, 10, 16, 21, 
86; 17, 26; 18, 1; 20, 27. 

angling, 1, 9; 10, 7. 

kalingane, 6, 17; 12, 26; 15» 10. 

kalinganira, 9, 29; 15, 4. 
leng. 

saleng, 18, 5. 
long. 

longing, 19, 33, 37- 

alolongan, 17, 22. 

anglongi, 14, I8. 

linongan, 14, 18. 
linga. 

palingaha, 20, 30. 
langha, 3, 8, 10; 5, 29, 30; 6, 2,3,6; 8, 

4; 10, 80; 25, 10; 26, 18; 28, il; 31, 

9, 12. 

longaha. 31, I8. 
Innghanira, 6, 26. 
alnlongha, 7, 3. 

linggir, 24, 10. 
linggib, 18, 21 ; 28, 19. 

alinggih, 13, 23. 

lininggiban, 21, lo. 

apalinggih, 7, 17. 

amalinggiha, 28, 6, 7, 9, 11. 
longgnh, 25, 10. 

sama-lnnggnh, 28, 4. 
pa-. 

paranggalawe, 25, 5, 15, 21. 

pakoningan, 32, 8. 

paknti, 27, 10. 

pataüca, 27, 10; 28, 16. 



patnmapël, 24, si. 
pasunda-babat, 28, 29. 
pasora, 25, 21, 29. 
pasadeng, 27, 28; 28, is. 
pawagal, 26, 9, 10. 
palasém, 26, 10. 
palungge, 25, 27. 
pajarndémung, 25, 28. 
pamanda^a, 25, so; 26, 10. 
pamalayn, 18, 30; 24, so. 
pamadasiba, 29, 85. 
pagigabbirn, 25, 30. 
paba&n-pindab, 28, 16. 
pa, 11, 12; 14, ij z\ zie ook mpn. 
punta, in kapontan?, 7, 21. 

po, 7, 13. 

pabe, 15, 5, 6. 

pabea, 17, 30. 
piban. 

kapibanan {van bana?), 5, 12. 
pubara, 16, 27. 

pnbaranira, 17, 17. 

apnbara, 24, 1. 
pabido. 

apabido, 19, e. 
pabat. 

amabat, 5, 1. 
pabit. 

apabit, 23, 8. 

kapabitën, 23, 7. 
pabil. 

pabiian, 31, 23. 
pan, 11, i; zie apan. 
pnn, 16, 35; 17, s; 19, 21, 20, 26, 30, 

38; 21, 21. 

-ipun, 5, 29; 11, 21; 13, 22; 15, 13, 16, 

17; 16, 4, 6; 17, 17, 81; 18, 86, 37; 

19, 86: 20, 4; 21, 9: 22, 11; 23, 7: 

26, 28. 

-nipnn, 1, is, u; 2, 82; 3, i ; 4, e; 10, 
2, 13, \l, 34; 12, 12; 14, 22; 16,35; 



— 299 — 



17, 80, 31 ; 18, 86,87; 19,26,26,27,32; 
20, 19, 27, 88; 21, 1, 8, 36; 22, 9, 81 ; 

23, 6, 8; bij wwy 10, 26; 15, u; 16, 

10, 16. 

voorts in pnnëndi, punarëke, punika, 
pnnlki, pnnikn, panapa, punang, depnn. 
pani. 
comp,: sangkapani. 

pënnb, 19, 3; 22, 86. 
punëndi, sie Öndi. 
punarëke, zie rëke. 
panek. 

amamanek, 5, is, 19. 
punika, zie ika. 
puniki, zie iki. 
puniku, zie iku. 
pënëd. 

apënëd, 20, 26. 

den-apënëd, 11, 20. 
punta. 

kapuntan, zie pu, 7, 21. 
panas. 

panase, 2, 21. 

apanas, 12, 1. 
punapa, zie apa. 
panapen, 7, ia. 
pande. 11, u. 

apande, 12 9; 13, 34; 14, 1; 10, 21. 
pëning. 

apëningan, 1, 7. 
punang, zie ang. 
pucuk. 

pucuking, 13, 23. 
pëcut. 

pëpëcut, 28, 18.* 
pacuL 

wadung-pacule, 14, 4. 
pra-. 

zie pradeQa, prawira, pralagi, pra- jurit, 

prasama, enz, 
para L 



mara, 3, 84; 6, 27; 8, 7, 11, 12; 9, 
8; 11, 27; 17, 24. 

mareng, 1, n, 12; 5, 14, 26; 6,28,82; 
7, 8, 7; 12, 20; 16, 8; 17, 86. 
mareringsun, 10, 29. 
paran, 9, 28. 
paranira, 17, 7; 20, s. 
saparanira, 9, 7. 
pinaran, 2, 26, 29. 
parananira, 6, is. 
para- II, 3, 28, 4, 16; 7, 20; 8, 8;13, 

16, 16, 17, 24, 26; 14, 12; 27, 8, 18. 

para- III. 

parahilang, 24, 19. 

amaraseba, 9, 17; 10, 30. 
para- IV, 

zie paradepa, para^ raya, enz. 
pira, 2, 21; 19, 7; 20, 9, 26, 80; 24,9. 
purih, 14, 1. 

sa-arik-purih, i4, 1. 
parahu, 8, 27; 21, 6, 8; 23, 21; 24, 

19; 31, 12, 13; 24, 16. 

parahunisun, 23, 22. 
prihatin, 24, 12. 
parahilang, zie hilang. 
puma. 

comp.: paripuma. 
praua. 

pr&nanira, 12, £i. 
paran, 4, 15; 6, 14; 11, 23; 13, w; 16, 

22; 21, 17; 22, 20. 
paren. 

paronira, 12, 4. 
pëmah. 

pëmabing, 3, 12. 

pëmabira, 4, 19; 26, 26. 

kapëmab, 4, 83; 16, I6, is; 32, 24. 
parëk. 

marëk, 16, 3, 20; 17, 11, 16, 28; 21, 

19, 21; 22, 7, 18, 16; 27, 6, 29. 

pinarëk, 21,- 25. 



— 300 — 



pinarëkiDg; 16, iq. 
pinarëkaii; 2, 25. 
parëkakënE; 17, 27. 
pirak^ 8, 1. 
purik. 

apupurikaD, 31^ 1. 
parakrama, 2b, 33. 
pariksa. 

pinariksa; 4^ 27* 
prade^a, sie de^a. 
paradega. 

amaradega; b, n. 
pSrit, 5, 11. 

pratidina; 6, 21; 18, 27; 21; 38. 
prati^ta, 27, 18. 
parthayajüa, 25, 12. 
paragraya. 

pakanlra-paragraya; 20, 26. 
prasiddha, 14, 28. 
pragasti. 

pragastine, 26, 3. 
prasama, 21, 20. 
paraseba, zie seba. 
puTwa, 13, 12, 
prawira, 14, 18, 30. 
pnrwaka. 

pürwakanipun, 2, 32. 
pralagi, 7, 26. 
pralina, 1, n. 

kapralinanira, 1, 13. 
përëp. 
amërëp, 18, 9; 19, 2; 23, 23, 30. 
amërëpa, 14, 8. 
amërëpeng, 23, 17. 
pinërëp, 19, 6. 
paripurna, 14, 6. 
prajnrit, zie jurit. 
parajaya. 

kaparajaya, 19^ 19. 
paramegwara, 29, 8. 

pramefwareng, 28^ dS. 



prabhu, 8, 19; 13, 28; 18, I6, 19; 24, 
3é; 25, 1, 3, 27; 27, I8, 19; 28, 29; 
29, 7, 17; 30, 4, 6, 26,35; 31,28,37: 
32, 1, 9, 14, 16, 21, 22, 24. 
kaprabhunira, 27, 22. 
parab. 

parabira, 1, 6; 6, 28. 
prabangkara, 15, 21. 
parëng, 29, 6. 
prang, 14, 23. 
përange, 25, 24. 

aprang, 14, 18, 22, 30; 20, 15; 26,2; 
29, 12. 

amëraDg, 5, 24. 
amëranga, 5, 22. 
amërangakën, 19, 4. 
pinërangakën, 12, 3. 
paprang, 23, 29. 
paprangan, 14, 26; 28, 11. 
pëk. 

amëki, 31, 32. 
pinök, 31, 13. 
paka-. 

maka-, 1, 10 (-ning). 
pinaka-, 1, 3; 4, 33; 5, 25; 14, 23; 
18, 29; 19, 18; 22, Z4>; 27, u (telkens 
met bepalend suffix). 
pakanira, 10, 19; 15, 3; 17, 5, 12, 13, 
14, 16, 16, 29; 19, 28, 32; 20, 9, 11, 
25 ; 21, 31, 36; 22, 2, 3, 4, 6, 7, 10, 13, 14. 
-pakanira, 15, 3; 20, 9, ]2, 23, 24; 
21, 29; 22, 8 
pakanira-, 17, 30; 20, 26; 22, 4, 6, 

8, 10, 13, 14. 

den-pakanira, 17, 14; 22, 15. 

vgl. talampakan. 
pëkik. 

apëkikpëkik, 16, 25. 
pikat. 

papikatan, 5, 11. 

pak^a. 



— 301 — 



paksanipun, 19, S6. 
pak^anira; 6^ 16; 1, 22. 
amaksakëD; 26, 22. 
amak^akna^ 2, lo. 
amaksakëna, 20^ ii. 
comp.: krsnapak^a. 
pikal. 

amikul, 18; i^ 2. 
pinikul; 17, 38 ; 24, u. 
pukul. 

samamukul, 7. 22. 
pukulun, 4, 16; 7, 2, 5; 9, 5, 11; 13, is; 
16, 24, 25; 17, 12, 29; 18, 34; 20, 11, 
23, 80, 38; 21, 21, 86; 22, 17, 34. 
pada. 

comp.: madhyapada. 
paduka, 16, 25; 18, 34, 35; 22, is, 19. 
pat. 

papat, 13, 7. 
pataDg, 18, 30; 31, ie. 
pet. 
amet, 6, 19; 15, 32. 
ameta, 4, 7. 
Dgamet, 6, is. 
pinet, 6, 12. 

pati I. 

pati, 21, 18; 24, 19. 

patine, 25, 29. 

patining, 12, 30; 29, 17. 

patinira, 12, 7. 

mati, 2, 5, 10, 20, 22; 10, is, 19; 11, 

7; 12, 5, 7, 22, 29; 18, 24; 19, 20; 

23, 34, 36, 36; 25, 14, 22, 27, 32; 26, 

7, 11, 14, 16, 31, 35; 27, 10; 28, 28; 

29, 7, 14; 30, 28; 31, 4. 

matya, 25, 34. 

matia, 5, 24; 9, 31. 

matieng, 29, 1. 

amatimatia, 1, s. 

amateni, 12, 5, 6; 15, 11. 

amatenana, 1, 22; 15, 16, 17; 26, si. 



pinaten, 24, 26; 27, 9. 

pateni, 7, 23. 

patcnana. 11, 3. 

kapatinira, 15, 32. 
pati II. 

patya, 20, 19. 
pitu, 30, 29; 31, 30. 

pipitu, 12, 6. 

pitung, 1, 14. 

pituwëlas, 25, 5; 31, 30. 
putu. 

raputunira, 7, 6. 

anak-putu, 12, 6, 8. 
patih, 19, 12, 16, 22; 22, 31, 39; 25, 

6, 33; 26, 37; 27, 28; 28, 29; 29, 

11; 31, 17. 

patihing, 28, 32. 

patihira, 18, 19. 

apatih, 18, 21, 37; 19, 19; 25, is; 

26, 34, 86, 36; 28, 1, 7; 29, I8, 29; 

30, 29; 31, 20, 30. 

apatiha, 30, 29; 27, 33, 34. 

amatiha, 27, 32. 

pinatih, 21, 22, 33. 

pinatihira, 21, 20. 
putih, 20, 34. 
putra, 18, 14, 15; 24, 35; 29, 18,19,22. 

23; 30, 4, 8, 10, 11, 13. 

putranira, 15, 6; 16, ie; 24, 36; 29, 

24; 30, 7; 32, 23. 

putrestri, 30, 3. 

aputra, 13, 4; 16, I8; 27, 19; 29,22, 

25; 30, 5, 9, 12, 13. 

apuputra, 24, 29; 27, 24; 29, 20; 30, 

6, 14, 15, 16, 17. 

comp.: dhannaputra, dewaputra. 
putri, 24, 5, 27 ; 26, 31 ; 28, 29 ; 29, 17. 

putrinira, 9, 22; 19, 37. 

comp.: rajaputri. 
pater, 18, 14. 
pntër. 



— 802 — 



amutér^ 2, 6. 

kapntër^ 13, 12; 14, 83. 
potraka, 22, is. 
patik, 18. 84; 22, 17. 
pataka. 

camp.: papapfitaka. 
patnt, 3, 28. 

patatira, 18, 8. 

patatan, 13, 8; 24, 35; 27, 16. 

patutanira, 13, 2, 7; 14, 4. 

apatntan, 29, 18. 

pinatnt, 32, 
pntus. 

pntnsiDg, 20, 22. 

amntiisakena, 1, 8; 7, 16. 
pituwi, 10, 7. 
pësCh. 

apësèh, 4, 21. 
pisah. 

apisah, 20, 2. 

kapisab, 17, 37. 
pisan, 14, 32; 16, lO; 17, 24; 19, 17; 

24, 55 27, 7. 

amisan, 27, 35. 

kapisanan, 12, 22. 
pisnna, 26, 10. 

amifunakën, 25, ]i. 

pinisnnakën, 25, 21, 23; 26, u. 

comp,: rajapisuna. 

pasar. 

sapasar, 2, 20; 26, 24. 
pasuk. 

sakapasuking, 13, 18, 25. 
pésat. 

inësat, 5, 13. 
pnspata. 

puspatanira, 10, 33. 

apnspata, 9, 20. 

pHspapata, 18, 19. 
pasagi, 24, u, 15. 
pa?tL 



kapasti, 10, I8. 
pasaDg. 

sapasang, 3, 6, 7* 

amasang, 15, 21. 
pwa, 8, 12. 
pawahan, 8, 13, 22. 
pain. 

papalonipiiD, 11, 21. 
palih. 

sapalih, 21, 35. 

apalib, 12, 4. 

amalibana, 25, J7. 
pnlih, 3, 21; 14, 25. 

apulih, 19, 20; 23, 2; 26, ö. 

amapalihakën, 19, 24; 29, 10. 
puluh, 18, 30. 

sapuluh, 24, 27* 
polab, zie nlab. 
palar. 

malar, 4, 31; 11, 3; 20,7,26; 23,25. 
pëlësat. 

pamëlësatanira, 18, 13. 
palapa, 26, 33; 28, 20, 2i, 28; 29, 16. 
pelag, 20, 34. 
palugang^, 7, 21, 22. 
papa, 10, 15. 

papaning, 25, 12. 
pnpa I. 

pupune, 20, 16; 24, 24. 
pupu II. 

pinupu, 4, 13. 
papak. 

tapapak, 22 38. 
pëpëk, 28, 24. 
papapataka. 

papapatakaning, 1, 7. 
pada, 3, 31; 4, 20; 5, 29; 13, 26, 32; 

17, 32, 33; 20, 18; 22, 31. 

den-pada, 14, 2. 

amadani, 9, 22; 10, 8; 23, 24. 
pëdök« 



pépë^^kirs, 4, 13, 1%. 
podati, 10, S9i 29, 13. 
pa^Sm, 24, SG. 

pa^ëmira, 15, ii. 
pa^aDg. 

amamadangi, 9, 34. 
ptüa, 8, 31; 9, 9, i. 

miya, 8, S3. 
pijSr, 6, 11, 18; 19, 6. 
payang, 14, S4, S7; 26, s. 
paiica. 

paücawara, 4, 9. 
pafical. 

am^cal, 19, !6- 
pa^ji, 3, S5, S6; 13, 6, B, 10; 16, 17; 

17, 3; 25, 8; 29, 3. 

apai^i, 13, 3, 6; 15, S9, 30; 16, 1, 

3, i, 7, 8, 13, IS, 16, 17, 10, 91, 31, 39; 

17, 9, 6, 10, 83, 37; 18, 1, 2, 86, 97. 

parapafiji, 3, 98. 

papuljiuira, 13, 9. 
pailjara. 

kapaüjara, 24, i. 
paüjalin, 4, 17. 
paSjang, 21, 19, 11- 
panjing. 

maiijing, 24, 9. 
paman, 25, 3s; 32, 91. 
pagut. 

apagnt, U, 18; 23, 36; 28, 35. 

amagnt, 26, 7. 

amagnta, 19, 9. 

pinagnt, 29, 6- 
pégat, 2, 13- 

pëpegatane, 2, il. 

apégatana, 2, I6. 

tanpapSgutan, 4, 11. 

amégati, 1, 3, 9. 

kapégataning, 4, s. 
pégfit. 



kamfigfitanira, 15, is. 
ping. 

pingro, 27, 7; pingrwa, 21, 96. 
paugan. 

amangaD 4, 19, 16, 91, 98; 23, 7. 

tanpamangan, 6, 90. 
pungnn. 

pnpuDgun, 4, ss. 
piogit. 

pininghit, 4, n. , 
pnngknr, 14, 8i. 

paniungkure, 18, 1, 2. 

eapuiigkurira, 23, 81. 

sapuDgkuriDg, 23, 97. 
pinggir, 19, 15. 

pin^ring, 5, ia. 

pamiDggtring, 21, 8. 



apanggifa, 12, 36. 

apanggiha, 8, 96. 

papauggib, 13, 3. 

papanggihira, 13, 1. 

amanggih, 2, 31; 3, is, S9. 

amamanggih, 2, 99. 

kapanggih, 3, 80; 4, 97; 7, 6, 39; 

9, l, 9, 10, 96; 10, 98; 11, 93; 15, 

18; 17, 7; 20, 6, 9, 19; 28, 4. 

kapanggiha, 20, 38. 

panggihakfina, 19, 37- 
pnnggatig, 32, 39. 
40. 

eomp.: alapdo. 
dub, 20, 37. 
^ühüDg, 11, 13; 12; 19, 16, 17, 98; 15, 

16; 16, 6. 

dnbungïra, 15, 13; 16, 7. 
darat. 

adarat, 21, 24. 
dnknb, 4, 33. 

dnknhira, 9, 9S. 
data, zie kadatoo. 



daKng, 6, 16, 22; 7, 8, 16; 


9, 


34; 


10, 


pr^nrit, 22, 30. 




23; 18, 33; 21, 16, 19; 24 


21 


28 


6; 


jnning. 




31, 14. 








jurungen, 28, 32. 




daKnga, 6, 20; 20, as. 








jaka. 




datengira, 22, 26. 








parajaka, 4, 15. 




sadatëugira, 21, 14. 








amarakajaha, 3, 34. 




dawak, 16, n. 








j«ti. 




dewek, 6, 32; 26, 29. 








sajati, 15, 12. 




dalang, 27, 30. 








jawa. 




dada. 








angajawa, 10, 33. 




dadanipnn, 19, 87. 








jalu, 3, 15, 17; 30, 4, 9, 12. 




dadap, 23, 39. 








juluk. 




dampul, 30, 4. 








jnjulukira, 27, 20. 




adampul, 30, 4. 








jfiplak. 




danghyang, 8, SE, 89, 32; 9, 


i> 


3, 6 


18, 


aQjëplakakëD, 28, 13. 




16; 10, 10, 12, 14, 17, lö. 


SS, 


33; 


il, 


jaja. 




4, 23; 13, 31; 14, 3; 16, 


33, 


37. 




jajanira, 12, 23, 27. 




ianma, 1, 8. 








jnjüg- 




angjauma, 8, si. 








aiiJTUUg. 9, 24. 




comp.: wibhawajanma. 








jayft- 




iënfiDg. 








comp.: parajaya. 




jumeoSnga, 21, 36. 








jayasatrn, 14, 32. 




aifjëuëDg, 15, 27; 16, IB; 


18 


16, 


19; 


jambn, 4, 6, 7, 8, B, 18, 14, 15, 18, 17 


30. 


24, 34, 37, 38; 25, 27; 27 


15 


17 


30, 


jambunira, 4, 13, 21, 23. 




12; 31, 3i; 32, ii, 31. 








jaga, 19, 37. 




paüjenËng, 25, i. 








ajaga, 23, 34. 






11. 






jaganën, 23, 3i. 




sapiiöjeneog, 18, 23. 








jngjug- 




j«ro, 2, 2J; 6, 16; 17, 36; 


20, 


31, 


24, 


aiijugjag, 19, 16. 




8, 24. 








jaba, 4, 85, 26; 24, 23; 28, 3. 




jëroning, 24, ï2. 








jabaning, 24, 85. 




mtnjero, 21, 25. 








jabuDg, 15, 20- 




juni, 14, 27; 25, ]6, 18, 29. 








jëng, 17, 16. 




jura-kurung, 16, lo. 








ya, 3, 36; 5, 3, 4, 6; 6, e, 88; 7 


, 1. 


afljuru, 22, 39. 








6, 9, 13, 23, 25; 8, 11, 13, 23; 9, 


89; 


tarah. 








12, 31, 35; 15, 9, 99; 17, 8, 7; 


20, 


k^arah, 20, i, p; 26, 3. 








30; 23, 5, 32; 24, 6; 26, 15. 




jerih. 








-e, 2, 21, 28; 6, 13, 16, 17; 8, 


so; 


jfijërih, 22, 9; 25, 12. 








11, 81, 32; 12, 1, 26; 14, 1, 9 


3; 


jarit 








15, 10; 16, 2ï; 17, 16; 18, 1 


2; 


lyiirit, 5, 15, 








21, 3i; 23, 38; 24, 17; 24, 26; 


25, 



— 305 



24, 86; 26, 17, 19, 22, 26; bij ww. 
11, 3; 12, u; 21, 36; 23, 20; 28, 35; 31, 9. 
-ne, 1, 20; 2, 21, 22; 3, 10; 4, 16; 
6, 6, 14, 18, 19; 7, 24, 34; 9, 31, 32, 
35; 10, 32; 11, 8, 12, 19, 21; 12,1,6, 
8; 13, 33; 14, 2; 16, 22, 23; 18, 
2, 20, 16, 37; 22, 87; 23, 38; 24, 17, 
24; 25, 6, 29; 26, 2, 3, 15, 19; 28, 9. 
-nya, 3, 2; 11, 11; 29, 9. 
yan, 1, 8, 16; 2, 4, 10, 16; 3, 22; 10, 
20, 25; 11, 6; 12, 32; 14, 7, 11, 30; 

15, 6; 16, 5, 12, 33, 34; 18, 29; 19, 

6, 21, 28; 20, 11, 25; 22, 14, 19, 20; 
23, 3, 8, 16; 24, 4, 10, 19; 26, 16; 
27, 1; 28, 30; 29, e. 

yun, 7, 22. 

ayun, 2, 39; 7, 3; 9, U; 11, 20; 
. 13, 13; 15, 8; 18, 34; 19, 30; 22, 4, 

13, 18, 32; 25, 20; 27, 2; 28. 20, 

29; 31, 7. 

ayunira, 17, 35; 22, 22. 

tanpayon, 28, 33. 

kayun-pakanira, 21, 29. 
yen, 2, 8, 16, 27; 5, 19, 33; 6, 1, 21; 

7, 6; 8, 1, 2; 9, 16, 22, 23, 33; 10, 

11, 14, 3i, 36; 11, 8, 9, 10, 13, 26; 

12, 16; 13, 14; 14, 8, 15; 15, 5, 8; 

16, 36; 17, 4, 6, 10; 24, 25; 20, 6, 
38; 21, 12, 30; 24, 7, 13, 18; 25, 12, 
32, 35 ; 26, 23, 26, 29 ; 27, 20, 83 ; 28, 
2, 10, 33. 

yoni, 11, 12. 

yoninya, 11, 11. 
yaddha, 31, 6. 

yadyan, 10, 15; 22, 13; 24, I8. 
yatna, 16, 1. 
ya^adharma. 

aya^adhanna, 5, 21. 
yajfia. 

comp.: parthayajna. 
yaya, 8, 17. 

Verlu Bat. GtxL, deel XLIX. 



yayi, zie ayi. 
yom. 

ayom, 26, 30. 
yuga. 

yugamami, 2, 5; 7, 2*; 8, 20. 

yuganingong, 2, 11. 

ayuga, 2, 3. 

ayugaha, 1, 18. 
yogya, 8, 19; 10, 20. 

angyogyan, 10, 25. 

kayogyan, 8, 22. 
yang, zie hyang. 
mu (-mu), 2, 4. 
maha, 4, 9. 

minahai 12, 23. 
mahu, 5, 33; 13, 13; 18, 19 ; 23, 

32, 32. 
maharaja, 16, 36; 28, 31. 
mahisa, 3, 6. 

mahisanira, 6, 10. 
mahayana, 9, 19, 21; 10, 1. 
man, 21, 34. 

mon, 6, 25; 16, 80; 20, 28. 
mana, zie samana. 
mëne, 2, 6; 7, 6; 17, 17. 
mono, 8, 33. 
manih, 2, 13, 16, 17, 18; 3, 16; 4, 29; 

6, 5; 14, 26; 19, 34; 22, 12; 23,18; 
24, 6, 8; 25, 26; 29, 22, 23; 30, 4, 

7, 8, 10, 11, 13, 14, 16; 31, 5. 
maneb, 20, 7, 11. 

manira, 11, 24; 15, 2; 17, 12, 13, 14; 17; 

20, 18; 22, 2, 15. 

-manira, 17, 12. 

manira-, 10, I8. 

den-manira, 1-5, 23. 
mannk, 5, 12; 20, 29. 
menak, 29, 1, 2, 9. 
mantnn, 18, 21. 
mantri, 16, 19, 21 ; 22, 27, 29 ; 23, 

16; 24, 6, 9; 25, 83; 26, 30: 28, 1, 

20. 



— 306 — 



3, 6, 17; 29, 12. 

mantrinira; 14, 20. 

mantrinisaii; 22, 33. 
mano^a, 1, 2; 8, 20, 34. 
manawa, 2, 31; 5, 34; 6, 3, 4; 13, 20, 

21; 14, 10; 26, 22, 23; 27, 3. 
manawi, 11, 10, 20; 17, 1, 14,30; 22, 12. 
mandala, 1, 14 ; 5, 31; 6, ], 3, 10, U, 

13, 16, 19, 20, 23; 8, 17. 

mandalaning, 5, 14. 

mandaleng, 5, 26, 27; 6, 8, 27; 7, 12, 

16, 28, 29, 31, 35; 8, 1, 4. 

amandala, 3, 6, 7, 8; 5, 28,29,31,32; 

6, 14, 17. 

amandaleng;, 13, 34. 
macan. 

macanipun, 18, 36, 37. 
mflr, 1, 15. 
mari, 26, 88. 

mariniDg, 17, 37* 
marene, 23, 22. 

marenea, 17, 32. 
maririka, zie ika. 
maririki, zie iki. 
mfirsah, 5, 3; 6, 8; 13, 26. 
marga, 6, 33; 7, 4. 

margane, 25, 6. 

marganipon, 20, 27. 

marganira, 1, 11. 

margahaning, 15, 82. 

margahanira, 5, 23. 

amarga, 19, 6. 
maiang, 7, 14. 
maring, 1, 11, is, 20; 2, 7, 17, 18; 3, is, 

16, 19, 20; 4, 26; 5, 2, 7, 12, 16, 23, 

26; 6, 27; 7, 29, 36; 8, 4, 6, 27, 84 ; 

9, 18, 24; 10, 4, 23, 31; 11, 6, 16, 

16, 22; 12, 9, 19; 13, 26; 14, 8, 14, 

16, 26, 33; 15, 16, 18; 17, 2, 19, 21, 

33, 88 ; 18, 16, 24, 32, 36 ; 19, 23 ; 20, 

SS; 21, 4, 6, 11, 13, 32; 22, 23; 23, | 



11, 20, 21, 22, 26, 28; 24, 3, 16, 26; 

25, 6, 20; 26, 16, 24, 31; 27, 2, 6; 
28, 1 ; 29, 8. 

muka. 

mnkanipan, 19, 27. 
mokta, 18, 3, 12; 19, 2I; 25, i; 27, 

9; 29, 31, 32; 30, 1, 9, 19, 21, 22, 

23, 24, 31, 36, 37; 31, 1, 21, 24, 25, 

26, 28, 31, 35, 36, 37; 32, 4, 5, 6, 

12, 18, 19, 20, 24. 

moktanira, 18, 11 ; 21, 7; 25, 2. 

miüoktan, 31, 13. 

kamoktanira, 21, 27. 
moktah, 14, 19 ; 15, 23, 30; 20, 27. 

moktahning, 14, 21 ; 15, 31. 
moksa, 24, 33. 
moktah, 2, 6; 14, 32. 
made, 27, 81. 
madhya. 

madhyaning 4, 24. 

madhyapada 1, 12; 7, 24. 
mitra. 

mitraningsan, 11, 11. 

mitra, 18, SO; 23, 19. 
mas. 

angémasi, 19, 19, 22 ; 25, 34 ; 26, 8 ; 

29, 7. 

tanpangëmasi, 3, 14. 

angëmasana pati, 21, 18. 
mfisa, 4, 2, 10; 5, 24; 8, 16; 17, 34; 

20, 38; 24, 10; 32, 29. 

masanira, 15, 20. 
musnh. 

musnhingong 16, 23. 

pinakamusuhira, 18, 29. 
mwah, 1, 12; 2, 4, 6; 3, 4; 5, 24; 13, 

6; 14, 21. 
muwah, 7, 35; 18, 36. 

mnwah-mnwah, 2, 10. 
muwah, 3, 11. 
mali, 25, 86. 



— 307 — 



mnla. 

mnlaning; 8, 26; 13^ S7; 23^ 5. 

mnlanira, 1; 2; 14^ 13. 
male. 

pamnle; 2, 32. 
malib; 4, 18; 13; 3; 21^ 28. 
malandang; 3, U, 20; 21. 
maling. 

amamaÜDg; 2; 23; 3, 2; 5, 17. 

amalingi; 12; ]8. 

minalingaD; 12; 18. 

mpU; 1; 5; 10; 13; lé ; 6; 28; 30; 31; 38; 

7; 2; 8, 10, 11; 13, 14; 9; 20; 25, 26; 28; 

l'O; 33; 11, 19, 26, 27; 18, 20, 21, 22; 

19; 1 ; 27, 22 ; zie ook pu. 
mapan, 32, 31. 
maja, 23, 7, 8. 
maöcanagira. 

amancanagara, 26, 25. 
mami 8, 9, 10, 31 ; 9; i. 

-mami; 2, 5; 3; 16; 7,24.; 8; 20; 9; 36. 

de-mami; 10; 19. 
mimba; 26, 20. 
mogha, 5, 7, 8; 7, I8, 23; 9, 31, 32, 

35; 12; 17; 32, 36. 
mangka; zie samangka. 
mangke, 3, 7; 4, 10 ; 1, 12; 33; 12; 17, 

23; 13; 22; 14; 31; 18; 35; 19, 32; 

21; 28; 22; 15: 23, 20, 21; 27, 33. 
mangko, 13, 20, 21. 
mangkiu, 3, 1 ; 5, 3; 6, 8, 14; 14, 3; 

15; 6; 17, 6, 13; 19; 33; 20; 6; 21; 

21; 22, 37; 24, 8; 27; 36. 
raangkana; 1; 12, 15, 18; 2, ]8; 5, 9; 

6, 13; 7, 25; 8, 8, 11,18,23; 9,16; 31; 

33; 10, 11; 18, 14; 2-2; 26; 35; 11; 8, 

U; 12; 6; 34; 13, 19; 14; 5, il; 15, 
27; 17; 30; 18; 32; 21; 37. 
zie samangkana. 
mongkono. 
mongkonoa; 19; 7. 



ge- 
age, 31; 8. 

age-age, 24, 12. 
ganti. 

aganti; 20; 5; 21. 

gumanti; 16; 15; 86; 18, 22; 19,24; 

22; 28; 25; 3; 26, 85. 

anggantyani, 15, 27. 

angganteny, 29; 29; 32; 1. 

ginanteii; 5; 30; 18; 22. 
gunita. 

anggnnita, 20; 22. 
gëntër; 8, 14. 
guntur, 25, 27; 28, 16; 29, 7, 35; 30, 

27; 31; 18; 32, 8, 17, 26. 
gantung. 

gumantang, 14, 26, 31. 
gënép, 2, 20, 22; 5, 34; 11, 26; 13, 1. 
gnnëm. 

pinagnnëmakëning; 24; 9. 
ganung; 8; 4; 7, 10, 12; 14, 52; 29, 14, 34. 

sagnnnng; 25; 7. 
garu. 

ginarU; 21, 9. 
gëru; 23; 18. 
giri; 29; 33. 
guru. 

aguru; 6; 29. 

paraguruhyang, 7, 20. 
gurib. 

agurih, 7, 34. 
gurnh. 

gamarub; 8; 16. 
gërha; 21; 23. 

sagërba; 21; 20; 23; 29. 

pagërbaD; 21; 16. 
gurinda; 12; 3. 

anggugurinda, 11, 27. 

ingsnn-garinda, 11, 30. 

gugurindane, 11, 21, 32. 
gurnita. 



— 808 — 



ghftmitaning^ 29, 6. 
gaijita. 

garjitanira^ 9, 25. 
gftrgut. 

anggërgut^ 29, 2. 
gering. 

agering, 25, 24; 27, 28, 
gringsing, 19, «o, 
get. 

kaget, 4, 3ji, 26; 21, 15; 28, u. 
getth, 29, 9, li. 
getob. 

manggetoha, 29, 2. 
gatana. 

agataua, 11, 19. 
getak. 

anggetak^ 4, 22. 
gUBti, 28, 7. 

gustine^ 22, 37. 
gasali, 11, 17. 
gawa. 

anggawa, 23, 20. 

ginawa; 23, 30. 
gawe, 20, 37. 

gawene, 7, 24; 11, 19. 

agawe, 1, 5; 4, 32; 11, 12: 12, 2,22; 

25, 26; 29, 2. 

agawea, 1, 7. 

anggawe, 11, 26. 

ginawe, 24, 28. 

pagawene, 11, 12. 

pagawening, 10, 6. 

pagawekena, 11, I8. 
gawok. 

gawoking, 22, 27* 

agawok, 20, z^. 
gala. 

tanpagagala, 12, 12, 
gulu. 

panggulu, 3, u. 



galihe, 25, 36. 
geiar. 

ageiar, 4, 12, 14. 
gelig. 

agelis, 24, 1. 

ginelis, 27, 9. 

geiem. 

agëiem, 27, 34. 
gaieng. 

galëngipuD, 21, 9. 
giling. 

giliugan, 10, 4; 21, 24. 
güling. 

pagnliuganira, 16, 1. 

pagnlingan, 27, 6, 9. 

aguling, 27, 8. 
gopiira. 

gopuraning, 1, 6. 
gëpok. 

anggëpok, 20. 13. 
gopala, 7, 31. 
gadag. 

gadage, 18, 1. 

gadagta, 18, 2. 
guyu. 

gumuyu, 28, 26. 

kagyat, 17, 36. 
gafijar. 

gafijarane, 28, 28. 
gamël. 

ginamelau, 5, 2. 
gaga. 

pagagau, 6, 9; 7, 33. 
guguh, 18, 37; 19, 1. 
g6ger, 17, 37. 
gubug, 21, 2. 
gebag. 
agebagan, 24, 21. 

g6ng. 
I agën^, 20, 4. 



— 309 — 



gong. 

gönge, 5, 13. 
gung. 

gungC; 21, 34. 

agung, 4, 31; 7, 34; 19, 14; 20, 27; 

27, 35; 29, 3, 7; 31, 15, 23, 23. 

den-agung, 9, 25. 
gangga. 

comp,: palugangQa. 
bahud. 

ambahud, 11, 9. 

binahud, 9, 31. 

manira-bahud, 10, 18. 
bini. 

binihaji, 24, 28. 

binihajinira, 13, 8. 
bënër. 

abënër, 24, 20. 
béndu, 11, 31. 
bonten. 

tambontën, 16, 37; 18, 36. 
banteng. 

bantengipun, 18, 36. 
bëcik. 

bëcike, 24, 17. 

abëcik-bëcik, 19, 12; 22, 97; 23, 30. 

bëciki, 18, 2. 
bhra, 27, 23, 26; 28, 34; 29, 8, 17, 20, 

21 ; 30, 3, 5, 6, 10, 14, 19, 20, 24, 26, 
29, 31, 34 ; 31, 3, 6, 7, 9, 11, 13, 26, 28; 
32, 15, 18. 

bhre, 27, 30; 28, 29; 29, 18, 19, 20, 
21, 22, 23, 24, 26, 31, 32; 30, 1, 3, 4, 
5, 7, 8, 9, 10, 11, 12, 13, 14, 15,16,17, 
18, 23, 26, 37; 31, 1, 5, 8, 10, 21. 24, 
25, 31, 32, 34, 35, 36, 37; 32, 1, 2, 4, 
5, 6, 8, 11, 15, 18, 20, 21, 23, 24. 

bhreng, 27, li, 15, 16, 18, 19, 24, 25, 
26; 30, 16, 22. 

bari. 
baryan, 6, 13. 



bora. 

ababurn, 18, 34, 35. 

abnbaron, 30, 9. 

amburu, 5, 20, 21; 6, 1, 2, 4; 7, 21. 

amburna, 6, 6. 

binura, 5, 17, 26, 27; 17, 20; 19, 14, 84. 

isun-buru, 5, 32. 

amburu-binuru, 22, 38. 
brahmana, 8, 26, 26; 9, 6,9,115 10,22, 

32, 34; 11, 5; 14, 14; 16, 32, 34; 17, 1, 2. 
baranang. 

ambranang 17, 36. 

ambarananga, 17, 33. 
bra^ta, 29, 14. 
bhakta. 

ambbakta, 6^ 10. 

bhinakta, 2, 26; 3, 19, 22; 17, 28; 

24, 3; 31, II, 14. 

binaktanya, 3, 2. 
bhukti. 

amukti, 1, 13; 26, 33; 28, 21, 93. 

mukti, 29, 16. 

'amuktia, 21, 25; 28, 20. 

kabhukti, 25, I8. 

pamuktine, 9, 31. 
bhiksa. 

comp,: durbhiksa. 
bëkël. 

ambëkël, 26, 19, 33; 28, 17. 

bëkëlan, 28, 4. 
buddhi. 

baddhinipun, 22, 9. 
boddhasthapaka, 9, 19. 
bot. 

abobot, 12, 36. 

binotan, 23, 33. 
botoh. 

bobotoh, 3, 13; 10, 24. 

kabotohan, 3, 20; 9, 1. 
batur, 17, 24, 27, 32, 35. 

abatar, 1, 6. 



— 310 — 



bfttang. 

babatanganiray 18; 17. 
bhasa. 

abhasa, 22, 8. 
bisa, 4, 8; 7, io; 20, 37; 22, 9. 

bisaning, 27, 34. 

biaanira, 23, 14. 
bhiseka, 8 23; 24, 30; 27, 11, ie, 17; 

27; 30, 4; 31, 12, 

bhisekaning, 25, 4; 30, 32; 31, se; 

32, 9. 

bhi^ekanira, 27, 22; 30, a; 32, 15. 

zie: 'abhiseka; comp.: dharmabiseka. 
bhawarasa. 

abhawarasa, 20, 22. 
bale, 21, ii, 19. 
bëlah, 12, 8, 4. 

abëlah, 31, 4. 
bnlub. 

amolahi, 28, 25. 

kabolahan, 28, 27. 
balik. 

malika, 25, 14. 

kabalik, 19, 24. 
bëlëk. 

abebeifik, 4, 20. 
baiem. 

bal6man, 14, 20, 21. 

balémaning, 20, 4. 
balongbang. 

binalangbang, 16, 2. 
bapa, 7, 12, I8, ie, 28, 29, 32, 35; 8, 1, 

4, 9, 26; 10, 10, 13, 17, 19, 22, 30; 11, 

2, 8, 4, 6, 7, 15, 24; 12, 80; 14, 8, 5; 

15, 6, 6, 1], 13; 16, 14, 18: 22, 84. 

bapaningsim, 15, 10. 

abapa, 3, 1. 
bhi\ja. 

camp.: catorbhqja. 
beji. 

bejine, 9, 82. 



bajang. 

pabajangan, 2, 24, 29. 
bhujangga, 9, 19; 13, 18, 19, 30: 14, u. 

parabhnjangga, 13, 15, I6, 17, 24,25; 

14, 12< 

baya I. 

baya, 11, is; 18, 36; 21, is. 
baya II. 

ratn-angabaya, 18, 7; 31, 13. 
buyut, 3, 80; 6, 29; 7, 15, 19. 

buyuting, 7, 30, 32; 8, 5; 18, 17; 

20, 32, 36; 26, 23. 

abnyut, 26, 32. 
banu, 5, s. 

bafione, 9, s2. 

ababafia, 17, is. 
bëücah. 

binëöcah, 20, ss. 
baiicana. 

pinakapamaücanaDing, 1, s. 
bnücal. 

binnücal, 2, 23. 

depnn-bancal, 23, 7. 
baöol, 27, 1. 
bhümi, 2, 6; 8, 21; 14, 33; 21, 35. 

comp.: mangkabhumi. 
bamakërti li, 19. 
bhage, 9, 11. 
bhagawan, 30, 34. 
bhagya. 

bhagyane, 9, 35. 
baba. 

ababn, 2, 33. 
bubuh I. 

bnbahan, 19, is. 
bubuh II. 

bubuhën, 27, 5. 
bubar, 14, 24; 19, 85. 
bëbök. 

pambfibëkan, 12, 3. 
babad. 



— 311 — 



ababad, 22; 7; 23, 6. 
bëbëng. 

kabëbëng, 5, 7. 
bhatfira, 1, 17 ; 2, 2, 3, 6; 32; 8, 23, 32; 

14, 17, 26, 29; 14, 10, 13; 15, 24; 

16, 3, 5, 25, 27; 17, 4, 8, 13; 18, 7, 

8, 16; 19, 5, 18, 21, 22, 37; 20, 1; 

21, 7, 27; 24, 36; 25, 3; 26, 20, 26, 

28, 32; 27, 4, 6, 7, 17, 19, 29. 

abhatS,ra, 26, 16, 18,23, 29, 32; 30,36. 
bhatari, 6, 24. 
bang, 1, 6, 9. 
bong. 

tabongbong, 16, 8. 
bëngang. 

binëngang, 21, 2. 
ngon. 

angon, 3, 6, 29; 4, 32; 6, 10. 

angODDgon, 3, 5. 

pangon, 6, 14. 

pangone, 6, 15. 

pangonira, 6, 15, 19. 

pangoningsun, 6, 18. 

sapangon, 3, 3. 
nguni, 8, 32. 

ringuni, zie uni. 

makanguni, 16, 20. 
nguniweh, 19, 16. 
Dgaran. 

Dgaraning, 5, 3. 
ngkana, zie kana. 
nggen, zie ook ënggen. 

nggenipun, 15, 17. 

Dggenira, 2, 1; 4, 17,33; 5, 13; 11, 14. 
nggon. 

nggonira, 29, 13. 
ngong, 8, 33. 

-ingong, 8, 34; 16, 22, 23; 22, 20. 

-niDgODg, 2, 11. 

iringong, 22, 10. 



De rupacandra-^ (wawatekan) of séngkalO' 
woorden. 

1. 

indu, 29, 28 (1290). 

iku, 30, 1 (1308); 30, 24 (1311)5 32,9 

(1373); 32, 26 (1403), 32, 27 noot 

(1533). 
awani, 29, 15 (1279). 
naga, 30, 27 (1319), vgl. onder 8. 
ratu, 27, 10 (1250). 
rupa, 24, 34 (1216); 30, 19 (1310); 30, 

24 (1311); 31, 28 (1351). 
dara, 24, 32 (1198). 
daging, 28, 15 (1253). 
tunggal, 24, 32 (1198); 25, 18 (1233); 

29, 27 (1284); 29, 35 (1307); 31,33 
(1355); 32, 18 (1386); 32,21(1388). 

sitangsu, 24, 34 (1216); 30, 32(1321); 

30, 34 (1322); 31, 28 (1351); 31,86 
(1368); 31, 37 (1369) ; 32, 22 (1388). 

samadhi, 24, 31 (1197). 

wit, 32, 17 (1384). 

wulan, 26, 9 (1238); 30, 19 (1310); 

31, 15 (1328); 31, 34 (1359); 32, 8 
(1372*); 32, 8 (1373); 32,16(1378). 

wong, 25, 15 (1217); 25 23 (1222); 
25, 29 (1235); 25, 30 (1236); 26,11 
(1240); 23, 30 (1293); 29,34(1298); 

30, 27 (1319*); 31, 16 (1332); 31, 18 
(1333*); 31, 23 (1348), 31, 24 (1349); 

31, 29 (1352*); 32, 13 (1375); 32, 25 
(1400); 32, 28 (1535). 

lëmah, 31, 22 (1338). 
janma, 30, 28 (1320); 30, 32 (1321). 
medini, 30, 24 (1311). 
bhümi, 25, 15 (1217); 27, 18 (1250); 31, 
19 (1335). 

2. 
netra, 30, 32 (1321); 30, 34 (1322). 



— 312 — 



ro, 29, 87 (1284). 

karna, 29, S4 (1298). 

dwi, 24, 34 (1216). 

ton (anon), 28, 15 (1253). 

tangan (anangani), 25, 23 (1222); 27, lo 
(1250). 

lara, 31, 15 (1328); 32, 27 noot (1522). 

paki?a, 25, 15 (1217); 2.5, 28 (1233); 
25, 29 (1235); 25, 30 (1236); 26, li 
(1240); 27, 18 (1250); 29, 13 (1279); 
29, 30 (1293); 30, 28 (1320), 30, 34 
(1322); 32, 16 (1332); 31,29(1352*); 
32, 3 (1372*); 32, 27 noot (1522). 

mata, 29, 28 (1290). 

ba, of baba, 25, 23 (1222). 



3. 



antëln, 31, 33 (1355). 
api, 25, 88 (1233). 
ambah (angambah), 31, 22 (1338). 
agni, 30, 32 (1321); 30,34(1322); 31, 19 
(1335); 31, 28 (1351); 31, 34 (1359); 

31, 35 (1368); 31, 37 (1369); 32, 18 
(1386); 32, 28 (1388). 

rama, 30, 84 (1311). 

kaya, 28, 16 (1253); 30, i (1308); 30, 27 
(1319*); 30, 28 (1320); 31,16(1332); 
38, 18 (1333*); 31, 19 (1335); 31, 22 
(1338); 31, 24 (1349); 32, 9 (1373); 

32, 21 (1388); 32, 26 (1403). 
tëlu, 32, 17 (1384). 

sahat (anahat), 26, 9 (1238); 30, 19 
(1310); 31, 16 (1328); 31, 83 (1848); 
32, 3 (1372*); 32, 8 (1373); 32, 13 
(1375) ; 32, 16 (1378). 

weda, vgl. onder 4. 

weint, 32, 8 (1373). 

gU3ja, 25, 29 (1235); 25, 30 (1236); 
29, 30 (1293); 29, 86 (1307); 31, 16 
(1332); 31, 18 (1333*); 31, 28 (1352*); 



32, 28 (1535). 
bahni, 32, 9 (1373). 

4. 

sagara, 32, 26 (1403). 

weda, 26, n (1240): 31, 18 (1333*). 

vgl. onder 3. 
pat, 29, 27 (1284); 32, 17 (1384). 
yuga, 31, 23 (1348); 31, 24 (1349); 

32, 25 (1400). 



5. 



anila, 31, 28 (1351). 
artha, 25, 29 (1235). 
wi^aya (amisaya), 27, 18 (1250); 32, 13 

(1375); 32, 28 (1535); 32, 27 noot 

(1522). 
panah (amanah), 31, 34 (1355). 
pawana, 31, 19 (1335). 
pafica, 31, 31 (1359). 
bhuta, 27, 10 (1250) ; 28, 16 (1253) ; 

31, 33 (1355). 
bayu, 32, 28 (1535). 

6. 

rasa, 24,34 (1216); 25, .30 (1236); 31, 37 

(1269). 
wihat (wiyat), 31, 29 (1352*). 
gana, 31, 38 (1368); 32, 3 (1372*) ; 32, 

18 (1386). 

7. 

rë9i, 24, 31 (1197); 29, 35 (1307). 

kuda, 25, 15 (1217); 32, 13 (1375). 

turangga, 29, 15 (1279). 

parwata, 32, 9 (1373). 

sapta (wellicht saptagni of saptagnya), 

32, 16 (1378). 
wiku, 32, 8 (1373). 



— 313 — 



8. 



ula, 29, 27 (1284); 32, 17 (1384). 
naga, 24, 82 (1198); 26, 9 (1238); 29, 34 
(1298); 31, 15 (1328); 31, 23(1348); 

31, 86 (1368); 32, 21 (1388); 32, 22 
(1388); sie nog onder 1. 

liman, 31, 22 (1338). 

matangga, 30, i (1308). 

brahmana, 32, 16 (1378); 32,18 (1386}; 

32, 21 (1388); 32, 22 (1388). 



9. 



nawa, 31, 37 (1369). 



sanga, 24, 31 (1197); 29, 15 (1279); 

29, 30 (1293); 31, 24 (1349). 
leng, 29, 34 (1298). 
manawa, 31, 31 (1359). 

muka, 24; 32 (1198); 29, 88 (1290); 

30, 27 (1319*). 

O. 

ambara, 32, 26 (1403). 

nora, 26, ii (1240); 32, 25 (1400). 

9unya, 29, 35 (1307); 30, i (1308); 

30, 28 (1320); 32, 25 (1400)- 
gagana, 29, 28 (1290); 30, 19 (1310). 
bhasmi, 27, lo (1250). 



De in deti leksi voorkomende sengkala's, van welken er eenigen niet met volk 
zekerheid Ie lezen zijn, in geregelde volgorde tol staving van de hier voorgaande opgaven, 
en om te lüten zien, dat zij naar waarschijnlijkheid eerst later bij de jaartallen in 
cijfers bijgeschreven wet^den, toen in dezen reeds fouten ingeslapefi waren. 

1197, rësi-sanga-samadhi, 24, 31. 

1198, naga-mukadara-tunggal, 24, 32. 

1216, raBa-mpa-dwi-sitangsu, 24, 84. 

1217, kada-bhnmi-paki^aning-wong, 25, 15. 
1222, ba-ba-tangan-wong, 25, 23. 

1233, api-api-tangan-tunggal, 25, 28. 

1235, artha-guna-pak^a-wong, 25, 29. 

1236, rasa-guna-pak^a-wong, 25, 30. 

1238, n&ganahut wnlan, 26, 9] de 2 niet uitgedrukt 

1240, nora-weda-pak$a-wong, 26, 11. 

1250, bhasmi-bhnta-nangani-ratn, 27, 10. 

1250, Qunya-wi^aya-paksa-bhami, 27, 18. 

1253, kaya-bhnt&non-daging, 28, 15. 

1279, sanga-turangga-pak^wani, 29, 15 

1284, pat-ula-ro-tunggal, 29, 27. 

1290, gagana-moka-matendn, 29, 28. 

1293, gana-sanga-paki^aning-wong, 29, 30. 

1298, naga-leng-karnaning-wong, 29, 84. 

1307, rë^i-^unya-gnna-tunggal, 29, 85. 



— 314 — 

1308^ matangga-^onya-kayekn; 30^ i. 

1310^ gagana-rfipfinahat-wnlaD; 30, 19. 

13 11, medini-rüpa-rameka; 30, 24. 

1319*; makaning-wong-kaya-naga, 30, 97; in den tekst 1317^ volgens de séngkala^ 
woorden ten onrechte. 

1320, (junya-pak^a-kaya-jauma, 30, 28. 

1321, janma-netragni-sitangsay 30, 32. 

1322, netra-paksagüi-sitangsn, 30, 3*. 
1328, naga-laraDahut-wulan, 31, 15. 
1332, paksa-guna-kaya-won^, 31, I6. 

1333*, kaya-weda-gunaniiig-wong, 31, 18; in den tekst 1343, volgens de sengkala- 

woorden terecht, maar weda kan ook drie kunnen beteekenen. 
1335, pawanagni-kaya-bbumi, 31, 19. 
1338, liman-kayangambab-lëmab, 31, 22. 

1348, naga-yugdnabat-wong, 31, 23. 

1349, sanga-ynga-kaya-woDg, 31, 24. 
1351, rupSnilagni-sitangsu, 31, 28. 

1352*, pak^-wibat-gananing-wong, 31, 29: in den tekst 1363, volgens deséngkalo' 

woorden misschien terecht, 
1355, bbata-manab-aDtSlu-tuDggal, 31, 33. 
1359, manawa-paiicagni-walan, 31, 34. 

1368, naga-ganagni-sitangsn, 31, 35. 

1369, nawa-rasagni-sitangsu, 31, 37. 

1372*, pakj^-gananabatwnlan, 32, 3; in den tekst 1362, volgens de séngkal€^vüoor- 

den terecht, 

1373, wélat-wiku-anabat-wulau, 32, &; in den tekst 137. . 

1373, babni-parwata-kayeku, 32, 9. 

1375, wi^aya-kudftnabut-wong, 32, 13. 

1378, brabmana-saptagnyanabat-walan, 32, 16. 

1384, pat-Hla-tëlung-wit, 32, 17. 

1386, gana-brabmanagni-tunggal, 32, iS- 

1388, brabmana-naga-kaya-tunggal, 32, 21. 

1388, brabmana-nagagni-Qitang^a, 32, 22. 

1400, ^UDya-nora-yuganing-woDg, 32, 25. 

1403, kaya-ambara-sagareku, 32, 26. 

1522, lara-pak^mii^ayeka, 32, 27 (noot). 

1535, wi^aya-guna-bayuning-wong, 32, 28. 




VERKLARESra 



VA.N DE MEERT BEKENDE 



jiwmmi 




IK POËZIE. 



DOOR 



W. MEIJER RANKEFT. 



INLEIDING. 



De Javaansche raadsels in poëzie zijn bij de bevolking niet zoo algemeen be- 
kend, als die in proza, omdat vele desa-bewoners de zangwijzen niet kennen. 
Als er eene goede, lagere school in de buurt is, wordt dat anders, want in de 
middelste en hoogste klasse wordt daar eerst iembang maljapaf en later lémbang 
gedé behandeld. 

Er zijn reeds heel wat Javaansche raadsels in poëzie bijeenverzameld en 
uitgegeven, doch, voor zoover mij bekend, zijn ze nimmer met verklaring in het 
licht verschenen. 

In de jaargangen 1870 t/m. 1875 van den Javaanschen almanak, uitgegeven 
door G. C. T. van Dorp & Co. te Semarang, komen eenige honderdtallen voor. 
De 68 raadsels van Raden Ngabehi Sasra Eoesoema in eerstgenoemden jaargang 
zijn de beste. Die van de andere jaargangen verdienen, ook volgens het oordeel 
van bevoegde Javanen, minder belangstelling en zijn dan ook niet onder het volk 
bekend geworden. Dit zou trouwens ook moeielijk gaan, omdat telkens de rang- 
getallen in de strophen zijn opgenomen. Ze schijnen opzettelijk voor den almanak 
vervaardigd te zijn. 

Van beter gehalte zijn de 250 raadsels, voorkomende in een werkje, door 
F. L. Winter uitgegeven en in 1879 bij Jonas Portier & Co. te Soerakarta gedrukt, 
waarvan de titel luidt: 

Q .O O.O. O/^ 

Hier vindt men de raadsels, die het meest bekend zijn bij het Javaansche 
volk, en juist deze omstandigheid heeft mij aanleiding gegeven om ze te verklaren. 

Ik heb het niet noodig geacht de daar voorkomende volgorde te behouden. 
Omdat het werkje van Winter voor Javanen bestemd is, moest er, om eentonig- 
heid te vermijden, voor afwisseling in melodie gezorgd worden. Met deze verkla- 
ringen is dat niet het geval en kon dus elke zangwijze afzonderlijk afgehandeld 
worden. Elk raadsel toch staat op zich zelf; er bestaat geen verband tusschen 
de verschillende strophen. 

Alleen de n» 2 — 4 van de zangwgze Mas koemambang en 1 — 3 van Mégatroeh 
zyn aan bovengenoemden almanak voor 1870 ontleend. 

De alleen in poëzie gebruikelijke woorden, welke in deze verzameling voorko- 
men, vindt men mei beleekenis aangegeven in de toelichting op de raadsels^ waarin 



n 

men ze voor de eerste maal aantreft. Verder gelieve de lezer de bijgevoegde lijst 
van die woorden op te slaan. Ook zijn de hier voorkomende samcfitrekkin^en in 
een afzonderlijke lijst opgegeven. 

Bij de raadsels op de zangwijze Poeljoenij komt het herhaaldelijk voor, dat het 
voorwerp, waarnaar gevraagd wordt, Bapa Poetjoemj wordt genoemd. Als vocatief 
gebezigd, heeft men dan al dadelijk een goed begin; want wanneer men, zooals 
hier het geval is, aanneemt, dat de strophe uit vijf i)ada-ling8a'8 bestaat, telt 
de eerste pada-lingsa met den eindklank oe vier lettergrepen. 

In andere werken neemt men aan, dat elke strophe uit vier pada-lingsa's en de 
eerste daarvan uit 12 lettergrepen bestaat. In plaats van 4oe. 8oe, Ga, 8ienl2a 
wordt dan de volgorde 12oe, 6a, 8i en 12a. 

Hierbij moet worden opgemerkt, dat men in het laatste geval toch altijd de 
samenvoeging van 4 en 8 in het oog houdt. De melodie geeft namelijk aanlei- 
ding om na de vierde lettergreep even te rusten en de dichter zorgt dan ook, dat 
die syllabe altijd de eindlcttergreep van een woord is. 

Een sterk voorbeeld van dit verschil in %oe bij de zangwijze Poe/; oew</ vindt 
men in de verschillende uitgaven van de Sèi^at Kanljil. 

In de uitgave van Van Dorp & Co. te Semarang van 1875 bestiiat de eerste 
pada-lingsa uit 12 lettergrepen met den eindklank oe, waarbij als regel is aan- 
genomen, dat de vierde lettergreep altijd de eindlcttergreep van een woord moet zijn. 
In de drie keeren, dat deze zangwijze hier voorkomt, is dit consequent volgehouden. 

In de uitgave van het Koninklijk Instituut voor T. L. en V. van N. I. van 
1878, bewerkt door Dr. Palmer Van den Broek, vindt men 4oe en 8oe door een 
dirgchmoeraras (pangkat) gescheiden. 

In de herziene uitgave van 1889 is dit tecken weggelaten. 

• 

Opmerkelijk, doch tevens begrijpelijk, is, dat de Javanen eene bepaalde 
voorliefde hebben voor enkele zangwijzen. Aan wien, hij zij hoog of laag in rang 
men ook vraagt, welke melodieën hij het liefst hoort, altijd is het antwoord: 
Damlang goela en daarna Sinom en MidjiL 

Hoewel men bij het kiezen der zangwijzen niet aan bepaalde regels gebonden 
is, houdt men toch wel een weinig rekening met de te behandelen onderwerpen. 
Bezingt de dichter bijv. oorlogstooneelen, dan bezigt hij meestal Dociina en Panq-- 
koer. Schetst hij treurige scènes, dan kiest hij bij voorkeur Maskoemambang en 
Megatroeh. Voor tafereelen, waarin de vriendschap op den voorgrond treedt, gebruikt 
hij liefst Damjang goela en MidjiL 

Zelfs in deze verzameling is dat eenigszins merkbaar. Zoo is hier de 
zangwijze Doenm, van het begin tot het einde, één oorlogskreet. Doch het is 
een strijd van vredelievenden aard, omdat bijna uitsluitend onderwerpen uit de 
Javaansche huishouding bezongen worden. De personen, die werken, zijn dan de 
strgders; hunne werktuigen zijn de wapenen en de te verwerken stof is het vijande- 



m 

Igke leger. Karakteristiek is de bespiegeling over het oorlogvoeren in no. 4 van 
de zangwijze Pangkoer. 

Bij herhaling worden in Javaansche poëzie voorwerpen als personen voor- 
gesteld. Nu eens geschiedt dit met vroiiwennamen; als : a^^nx »:Mêj^\ v^'^'^f^^ 
ajiasnfft40ii^\ a!» (U)» ^ tAt ma^ enz.; dan weder met namen van mannen^ als:«:na4AjiKa 'r^Mt^jênji 

Onwillekeurig vraagt men zich af, of de Javaansche dichters ook redenen 
kunnen gehad hebben om sommige voorwerpsnamen als vrouwelijk en andere als 
mannelijk te beschouwen. Ik kan die vraag niet met zekerheid beantwoorden; 
doch, wanneer men de talrijke voorbeelden in deze raadsels aan een nadere be- 
schouwing onderwerpt, komt het voor, dat de dichters hier geheel willekeurig heb- 
ben gehandeld. 

In deze verzameling van de meest bekende Javaansche raadsels in poëzie be- 
hoort ook melding gemaakt te worden van: j^Een kunstige Javaansche slrophe/' 
voorkomende in het ïijdschrift voor Ind. T. L. en V. deel XXXVI, bladz. 231, 
luidende aldus: 

/o. o Ooa^ooo. /^ 

(CTya ».ji,nm§(na:mauJisnt/nct'n.»$\ mntJtoEJi^^aji^ntAinajax aijêii^i9pi^ct^ncmt»p\ a^Kmanm» 

,00 ..ooo o o o ^ o o o 

tn^a\iA'^0iiK9(rn(u»afrncmea»:n(e/iêfnêA0\ 

De bedoeling met dit letterraadsel is daar zoo volkomen duidelijk uitgelegd, 
dat er niets meer van te zeggen valt. Ik kan er alleen nog bijvoegen, dat de op 
bladz. 232 bedoelde stereotype strophe in Sinom, waarin de persoon, die het 
raadsel opgegeven heeft, zijn bevinding meedeelt, aldus luidt: 

o. oooo o o, o , . . 

wf»nêJMA^^tjfnin\ »Ji'j^»ti(iJt*AênHu\êm9U^AnikA9ati^f^mnA»OM\ a{\»:;f<n'rtajÊtoyinn^9rL0n\ A/n «oi .^ t) «m 

o .ooo - o / 

iK»'rt$jnam»sna\ am ^ tAên êon t/n •ai .^nrt iüiajÊ»n'ri\ \fQ39 

Dit beteeken t. 

„Ik zal oplossen, welke letter gij in de gedachten hebt. (Ik zal) probeeren 
„mij met u te meten; de overwinning is nabij. 

„De Javaansche letters zijn 20 in aantal; maar er ontbreekt één: de letter 
„die gij in de gedachten hebt, is de letter — .'' 

Tevens kan hier nog iets omtrent de herkomst van het raadsel worden aange- 
teekend. Het is een van de meest bekende tjangkriman's in MiddenJava en 
terecht, want men moet erkennen, dat het geestig gevonden is. Daarom treft het 
de aandacht, dat deze strophe uit onsamenhangende zinnen bestaat. Onwille- 



IV 

keurig toch vraagt men zich af, of de (lichter niet in staat geweest zou zijn om 
voor hetzelfde doel bij elkander behoorende uitdrukkingen te gebruiken. Tevens 
doet zich dan de vraag voor, of het ook brokstukken uit een gedicht kunnen zgn. 

Ik informeerde daarom naar de herkomst van dit raadsel bij verschillende 
personen, die zich met de studie van het Javaansch bezighouden. Na niet weinig 
keeren vergeefs gevraagd te hebben, vernam ik, dat het gedeelten uit verschil- 
lende, doch opeenvolgende strophen uit de Poestaka radja waren. 

Voor zoover mij bekend, is dit werk nooit in lêmbang uitgegeven (1). In een 
handschrift, toebehoorende aan Raden Djaja Sajana, Demang te Soerakarta, waar- 
van mij het 1® deel welwillend ter inzage werd afgestaan, vond ik op bladz. 
510—511 de bedoelde strophen. Behoudens enkele, verbeterde schrijffouten luiden 
ze aldus: 

iüMIL *^(^^*'*'**^*^*^*''*^'*^iy^ ajna^t4^^iK9tj»kaAnrt»\ 9Lii^'ri9h9Jt^9u^j:nt9M\ ti « e» « ti i ktï -»/ii 
o^*u^Êjn*<n^\ ^^'l^-^'3222^{^f0^^ •atn»jÊt»atojtên»fn»ijtAoni\ t3i*m»^*.iAM9j>fi(Ka»JÊ\ «m ax» "n #of -s* 
•jtt>7)C7}9s4 A^\ ÊUitn^jitai 13» injêntii^nMVÊ n lij IL» aria's (fQÊS 

ngA/i 9^fCrnf9d»»aiii,t9Jinitxap\ «yn d» »jt kw «j am ««7 .^ ti \ vuiri^êm^^inamtitns «a a>i a <t n t>n «^ e« 1 4rm *a 

o *. o n O ^ O o / . o o o ^ 

Eins «ni£i««^ei9v|^0«4e«\ iKiZA'»jie/iajtMjiê>M€A»nn\ 0«4 c« ^ 'n »m «i <sn t 'V) «n a \ t^n as>jj»»Jt.£*»tt ^a»Ji»irt^o>^\ 

«V O o. o r 

9ui§ai9nf»Oên^/rtrn»»ni5nnrnLCi*^4'Yi\ *^M 

/ . Q. .O . O - O O o 

Q .«ooo oOo. o. o % o 

f /^ Q OOoto 00 ' i^ ^ 

(iCTjfl «oii^ «>j I K) 4Tn «I tn «n «sn ^ iunx:%%M9>M.iA'im^n.jnm\M\ tmn\/n9.(\9cn(mn9jk'f9 9^nén^\ 9sn9p^\\m(m 

^9(\mA\ üJiMê!jnomi¥fn.9 9^^asn^\ 90K7têAJi90tS»m'ri^jêaia\ /tciyA«A'yiti»(njinm\ foi «xt irn «$n »^ «n <^ <y»» 
%ln CU ' (J co co \.Mfk 

Het raadsel is dus samengesteld uit de 
1* en 2* pada-lingsa van de 1« strophe 
3« en 4e „ „ „ „ 2* „ 

5« en 6e „ „ „ „ 3e „ 

7e, 8e en 9e „ „ n » 4 

Alleen in de 4e pada-lingsa bestaat verschil in redactie met het bovenvermelde 
raadsel, terwijl ook het eerste woord van de 7e pada lingsa anders is. Hierbij 
moet worden opgemerkt, dat de redactie van de strophe uit het „Tijdschrift" de 



(]) Eeoe prozB-bewerkiag iu 4 dln, komt voor onder de uitgaven Tau Vogel van der Heqde & (;o, t« 
Soerakarta en eene in 5 dln. onder die van H. Bnning te Jogjakutt, 



juiste is. Gaf men het raadsel Tolgens de aangehaalde regels nit dit handschrift, 
dan zou het niet geheel aan de gestelde eischen voldoen. 

De vier strophen behelzen een gedeelte van den strijd tusschen het rijk Mamënang 
(in Kediri) en den reuzenvorst Kala Soewedda. Volledigheidshalve volgt hier de 
verklaring. 

Spoedig werden de legers zichtbaar; bij het te voorschijn komen raakten zij 
slaags. Vrienden en vijanden raakten door elkaar. Luidruchtig vielen zij aai]^; 
beurtelings drongen zij elkander terug. Zij verdreven elkander, tot hunne krachten 
waren uitgeput. Eindelijk werd het leger der reuzen overwonnen en sloeg het op 
de vlucht zonder verder tegenstand te bieden (1). 

Dadelijk sprak Sri Kala Soewedda de tooverspreuk kamajan sari uit. Als een 
bliksemflits (oogenblikkelijk) werd een aangename geur waargenomen. Een groote 
Dang Hjang verscheen en drong op de vijanden in, die zeer ongerust werden en 
zich verlaten gevoelden. Eenigen tijd daarna werden zij overwonnen. Hunne 
harten werden steeds kouder (zij werden steeds angstiger), alsof zij betooverd 
waren door de liefde (2). 

Sang Kala Soewedda kwam nader; luid sprekende ,hoonde hij zijne vijanden: 
„Waarom zijn de strijders van Mamënang zoo stil? Later zal uw vorst verschijnen ï 
van zijne lippen zullen toornige woorden tot u komen. Gij zult genoemd worden 
menschen zonder verstand, daar gij zoo weinig beteekenend zijt en het werk niet 
ten einde kunt brengen (3). 

Blijkbaar zijt gij machteloos om de bevelen uit te voeren en brengt gij uwen 
vorst in het ongeluk. Het is nu geheel anders dan bij het begin; toen vocht 
gij vreeselijk. Het past een leger-aanvoerder geen gevaren te kennen. De slechte 

(l) In de laatste pada-lingsa vao deze strophe vindt men eeue bijeenvoeging van woorden, die met dezelfda 
letters geschreven worden, hetgeen men een (Ckia§<n(nn\ noemt. Dikwqls heeft zulk een samenvoeging geen 
bepaalde beteeken is en dient dan alleen om het aantal lettergrepen voltallig te maken. 

Hetzelfde komt tweemaal voor in de tweede strophe, nl. in de zesde pada lingsa met de letters 9^\ en »>i \ 
en in de achtste pada-lingsa met tsns eu a^ix 

( ) eeniEMnA\ voor Knm»ieMtSh\ 

êcntr^bn%'r%êoa\ = overwonnen worden. Het verbum Snm»9\ is niet in gebruik^ wel de vorm 
«r^tsn%nÉn%*ri 9na\ ^ wed^veren. 



o 



«sniriAOAufTix =^ voor «sn'y?«nty»«^'r>ik 



( ) MJtn»^a\ voor v»^aM9\ = KnnAi3h\ 

Anjg«^c«»2|^ is eene uitdrukking, welke ook in het dagelqksche leven voorkomt in de beteekenis van 
veinig beduidend. 



VI 

Soera Wilaga is als de reus Singa Wërgil. Stellig wordt zgn hals de boete voor 
het verspreiden van ongelukken'' (1). 

Verder teeken ik hier nog aan, dat op het eerste blad van het handschrift wordt 
medegedeeld, dat hmpoe Oedaka de vervaardiger is van het oorspronkelijk kawi- 
geschrift Poesiaka radja en dat de overaetting in kawi djarwa is geschied door 
Raden Ngabehi Rongga Warsita in het jaar 1791 A. J. (= 1862 A. D.), welk 
jaartal met de volgende tjoudra sangkala wordt aangeduid: jy«cin(<sn{^rmi^n?)tm^% 

Ten slotte betuig ik mijn dank aan Dr. Brandes te Batavia, eerstens voor de 
nauwkeurige inlichting omtrent alles, wat over Javaansche raadsels, zoowel in 
poëzie als in proza, verschenen is, en verder voor de belangrijke mededeeling 
betreffende het woord ijangkrinum. Met het oog op de nog verborgen afkomst 
van dit woord heeft diè mededeeling vooral waarde en laat ik ze dus hier volgen. 

Dr. Brandes schrijft: „Dr. Van der Tuuk vestigde, nu reeds eenigen tgd 
„geleden, mijn aandacht op een versje in Rallies History of Java, 2e ed. (die 
„van 1830 in 8°) deel I, bl. 457. Daar staat niet anders dan: 

„ Chechangkrimau . 
„(Sung by a Mother to her Child on her Arm.j 

„Niahi ayu kapakan maniankil wakul, 
„Kalong mabalanjar lakune manolenole, 
„Sada ^su, 
„Dayanin tuah kablag 'gandang. 

„My haudsome girl! in bringing a purchase from the market, 
„When you have paid the price, cast not your eyes behind, 
„But move quickly, 
„Lest men may seize upon you. 

(*-) 40M2«s»« beteekent eigenlek gezonden worden. 

«»«jamt«|«i*\ Toor tuamtuiShs De taling taroeng wordt er dikwgls onuoodig bjjgevoegd. 

dêimwu^ ^ MMaahn\ 

»ntcnÊAMin*Jt»tnnn\ = geen gtvai-eii keuueii. 

c|«nf|^ voor 4Bic|«n9|> 



vu 

„Het hooge belang van deze plaats is, 1« dat zg het eenige voorbeeld geeft van 
„een strophe in poetjoeng voor Bali; waar men de maat anders niet kent, en 2« dat 
jj^lêSt^Mi&Mji^ hier voorkomt met de beteekenis van slaapliedje, kinderdenntje. 

„De verdeeling is anders dan op Java, doch dat merkt men bij andere 
„maten ook op. Toah moet monosyllabisch worden gelezen, nl. twah." 

Dat ik bovengenoemde inlichting noodig had, bewast reeds, dat ik nog niet 

voldoende op de hoogte ben van de Javaansche litteratuur; nog minder kan ik 

op vergelijkende taaistudie bogen. Ik heb slechts eene verklaring vafa de meest 

bekende raadsels geleverd als eene bijdrage tot de kennis der Javaansche taal. 

Magelang, Mei 1893. 

W. M. R. 



INHOUD. 



BI. 
Inleiding. *. I— VII 

ZANGWUZEN. 

Sinom 1. 

Kinanti • 22. 

Pangkoer 28. 

Doerma 40. 

Dandang goela 45. 

Poetjoeng 65- 

Asmara dana 72. 

Midjil 82, 

Mas koemambang 85. 

Mégatroeh 87. 

Gamboeh 89. 

Djoeroe-dömoeng 91. 

Lijst van in poëzie gebraikelgke woorden^ welke in deze verzameling 

voorkomen 107. 

Lijst van in poëzie gebruikelijke samentrekkingen en verkortingen^ 

welke in deze verzameling voorkomen 113. 



8 I N o 



2. 



L/n 



oO oo'^'^ o.ooo o . 



. o Om 

tiKmasnctMAênjit Êiu aju ênnAO^\ 



Hij kijkt telkens op in de lucht en likt de vingers. Hij loopt overal rond. 
Vervolgens ziet hij Sang Uétna, die mooie kleeren draagt. Hij legt op haar 
aan; treft hij haar, dan valt zij bezwijmd op den grond en wordt zij gevat. 
Hij neemt haar (dan) op de armen en blaast op haar. Zij wordt gestreeld 
en naar de slaapplaats gebracht. 

Oplossing: iemand, die met een blaaspijp schiet. 

Toelichting: Het nat maken van de vingers geschiedt, opdat de klei niet 
aan de vingers zal blijven kleven. 






l'ëH' ~ '1^'' 



ii**4«w> = het juweel (benaming voor eene lieve vrouw)] hier: de vogel. 

Q — — O _«_ 

•oijgfix = »nt^Qt\ = bezwijmd. 

SnjÊiJtSinjo^x is een verkorting van den pass. vorm t%inrM«^i^«i|x^% 

r' .^— -t /»• - '. (h. O . . O O 



/^ o o. .o '^o. o . >r» o O y^ " * 

.o O / 

Men heeft reeds lang naar de schoone vrouw gezocht. G-aarne vermaakt 
zij zich in den vijver. Zij draagt een blauw kleed, sierlijk met kant gegarneerd. 
Zij verspreidt een weiriekenden geur. De man nadert haar haastig. Sang 
Djah wordt gevat en krabt. 

Hare kuiten worden zichtbaar en schitteren. 

Verh. Bat. Gen., Deel XLIX. 1. 



— 2 — 

Haastig buigt de man zich eerbiedig voor haar neer en knst haar aanhou- 
dend. Weldra is zij machteloos en geeft zich geheel aan hem over. 
Oplossing: de bloem van de pandan. 
Toelichting : «^«3if».^«g'x = iemand met een gele huidskleur. Een bekende 

uitdrukking voor eene schoons vrouw. 
Het woord «;« rm -»i •$«; = krabben is hier gebruikt met het oog op de doorns. 

Cl nA -^»o ; voor (uhcjr,, i^êoji = gezocht worden. 

•Jl^€•x^5= •mSciS. = zich vermaken. 

^^\ = fraai; sierlijk. 

«ootfON = kant; passement. 



/ 






o o. . . o^ 



n o O o 



•Jt^j* eene in poëzie dikwijls voorkomende benaming voor eene /t6ve t;f*<>tiu;. 
«j»i^x gewoonlijk «ji^«ji»gs =7 aanhoudend^ keer op keer. 

^,.. £= uitgeput; machteloos (na krachtsinspanning). 

o ^« 

unf|A xa uc »o « tTTi 0T> d'ij «o rrm \ ^jttjiKnên un^MiotHnên\ •xiêrniuii th êot ^ t/n 'rt êm» §oê C4(m>^c« 
oo.ctOo .0 o • 00 . 

IfKnêihciüAitnÊt «91 «il on «9 ^1*014% 

Slechte roovers worden vermeld, die gezamenlijk een werk uitvoeren. Als 
de persoon, op wien het gemunt is, uitrust, bukken zij zich en loopen lang- 
zaam. Het vijftal valt gezamenlijk aan. Als de aangevallene gepakt wordt, 
komen weer vijf makkers, die zich een beetje ter zijde bevonden, dadelijk 
hulp verleenen aan hen, die niet te vergeefs gewerkt hebben. 

Oplossing: iemand, die een vlieg vangt. 

Toelichting: S^m^ = wf»a>9M^% 

/o 

•iotjnx — (mnv»\ 

— — o 



— 3 — 



o nn 



Ö«C 



\ — sn 



*m% 



De uitdrukking «^^<^«aix in den slotregel hoort men, als volgt, in het dage- 

lijksch leven gebruiken: njcic}«/n44«^L/iii«^rLff^«^43»x =is je reis niet te vergeefs 
geweest? 

Oo^/o^o o. ./o o 

. o 

Er is een gedaante te zien; alle menschen in de wereld hebben haar. 
En alle schepselen blijven niet in gebreke haar te vertoonen. 

Vast en zeker neemt zij den vorm aan van hem, die haar bezit en volgt 
hem overal. (Ook) aan al de goederen van 'tgeheele huis ontbreekt zg 
niet. Evenwel kan niemand haar grijpen. 

Oplossing: de schaduw. 

Toelichting: wfumt-niJiüs ^= niet missen. 

iiü*ajs voltallig; niet ontbreken. 






V^-IL '^"fl'^M '^'''^*7'^"'^*^ «''^ A/nêh tnnnt9n^4t^txty \aL/tnrmt0i^i/n^»Ji»f^nm\ »jê ajt \jê tSt n 



/ 



o. o o', o o. o o. o . /^ / ^ 

Er worden vermeld vijf broeders, die één zijn, als zij werken. Zij hebben 
slechts één gereedschap. Bij het werken gebruiken zij dat tegelijk en zij 
loopen ook gezamenlijk. 

Hij, die al onderwijs genoten heeft, behoeft maar naar de sporen van het 
werktuig te kijken, om juist te weten, welk geheim de arbeiders hebben. 

Oplossing: iemand, die schrijft. 

Toelichting: Kn^s = wijze, manier van doen. 

o _ . 

njQiÊsnjis = achtergebleven spoor, teeken. 

o. __ 



— 4 — 
Het woord 9j»»:4\ beeft betrekking op iüiéfvfentvf»n\ en op •w.#ót5'r>n|».i'n#^;% 

6/ o o. o. . / o o. (;) o o .o o 

o o o . o r». o o. 



De bloem der vrouwen is niet gescheiden van hem, die haar bezit. Omdat 
hij erg met haar ingenomen is, wordt zij overal meegenomen, waar hij gaat. 
Zij is verborgen en kan niet gezien worden ; slechts een punt van haar kleed 
is zichtbaar. Zij spreekt snel, maar niemand begrijpt het. Als zij te voor- 
schijn komt, wijst zij den tijd aan. 

Oplossing: een horloge. 

Toeliehlinq: *.i.»^«f?;«/vj^x = de bloem der vrouwen. 

<w«5«s»^x == verborgen. 

mn^-yis aau hct ciudc van den laatsten regel, is hier vermoedelijk voor 
den rijm bijgevoegd. 

7 o fi. o o / O 

o o ..oo. O^ 

o o o / 

. o 

De bloem dei' sehoonen is het kind van Batara Brama. In haar loop ver- 
mengt zij zich met den wind. Als zij loopt, houdt zij niet stil; ten laatste 
is zij niet meer te zien. Niemand kent de plaats, waar zij zich (dan) bevindt. 

Als men bij de geboorte van Sang Rëtna dicht bij haar is om mede te 
kijken, huilt men onverwacht, zonder redenen. 

Oplossing: de rook. 

Toelichdng: «^«4«trm« hoort men nog in de desa als krama van ^mMfnj. 

o o 



«oia^^>>«?)>nci»% = de bloem der schoenen. 



iëMt\9sn\ =^ «>nd«oj^ 



n 

itsnpis voor Êsnên^/nên% 

9jnffh\ voor »ji§oijA% 0jf9n\ = ft>M/mi«g«nj% 

cn«««n«m#n|x =* onverwacht. 



8. 



— 5 — 

:> r^. o o O o o o o. /^ o. ., 

O o . _ _ O . 



»i C/n 44 n AO «V «O * «utAn tu«KY«sn«»qt|n^«9ornt^««nt4«« m ct #| 



/' 



Als zij jong i8, verandert zij niet en^ als zg oud is, ook niet Als zij een 
vriendelijk niterlgk heeft, behoudt zij dat steeds «n zoo ook, als zg een on- 
aangenaam uiterlijk heeft. 

Zij heeft ooren, oogen, een mond en een neus: evenwel kan zij met dat 
alles niets uitvoeren. 

Oplossing: een portret. 

Toelichting: c-ci. =■ mismoedig, ontevreden. 

9 f o o o . o o o 

vSi^ *^*'^*?^ *'**^*^^ *'"■*'" '*'**l^' *ji^»nTi«|a^ «j» «A X «n4M»«^x».^t<^«o«Qi'T2«o^ #m/«#^A/i»'r>«a» 

•o^xnuf «i4»f ^14.4 r«n«^ ft/n iiv « -«jia»! ^nj'Ti^^«o»4Nitj#/r|> «iinn«oM>i ri^^jKi «^•«i> •j^ftKH%X'9% 

o o o / 

. o O 

Twee dingen zijn er te zien, die slechts één naam hebben. Voor jonge 
menschen heeft het gewoonlijk geen nut; oude menschen schatten het hoog, 
omdat het voor hen noodzakelijk is het bij de hand te hebben. 

En als er menschen zijn, die onvermijdelijk er den heilzamen invloed niei 
van kunnen ondervinden, noemt men hen ongelukkig. 

Oplossing: een bril. 

Toelichting: De laatste zin doelt op de blinden. 

o 

o 



4J*AST}4\ voor a/n *» asiti^ 



_ oo .oD of 

o 
If tm ^n Cl t^ êTijii t7n«ji\ mn §n ê<riê üa *sn\ 

Twee vaders zijn het, die vermeld worden, en twee zoons. Zij gingen sa- 
men naar het boscb en wilden herten lokken en schieten. Toen slaagden 



— 6 — 

zg in hun werk en \ingen drie herten. Nu wordt het zoo geregeld, dat bg 
de yerdeeling elk één krggt; het mag niet minder zgn. Raad eens, hoe de 
verdeeling is. 

Oplossing: vader^ zoon en kleinzoon. 

9o^ is hier een tydsbepaling. 



•u»C4 



n»9fÊshn\ YOOr 9i9 tm^jn\ 






mM^jb0imên§n.sA*M\ «j»«9«r?^«^AJif^#o«sn«n «^4;i#fi«o«ji«i«^ij« H^iiA 



Onder de vrouwen is er niemand, die het heeft; het zou wonderlgk zijn, 
als ze het hadden. De mannen hebben het allen, veel of weinig ; zij hebben 
het zeker en het dient bij hen als sieraad. Niettegenstaande dat, zijn er 
onder degenen, die het reeds hebben, die het niet mooi vinden en het (daar- 
om) wegnemen. 

Oplossing: knevels. 

lOCUCnttng^ MJ^^nÊsn^ =^ «1 <jii -on tovtfo* Ik 
o «__ o 

0/000 /^ 00 o. o 0/* / o. 

a.'> o o , o O o f 

9^ en Hn ^ 9J9 ÊL» et nm 9 UÊ\ •mêjnnunt'^t tni^jÊtwrttm êO'^'^^ v3 31 

Het heeft geen hoofd, alleen een hals, twee schouders en twee armen ; 
maat de beneden-armen missen de gewrichten, de handpalmen en de vingers. 
Ook heeft het geene boenen. De vormen van den rug en het middellijf zijn 
te zien. De borst is tot boven toe gespleten en de sluiting is als die van 
vleugeldeuren. 

Oplossing: een jas of buis. 

Toelichting: Strm*mJ|^ = (rn«t|« 

Qntn^ =s gespleten. 



— 7 — 

/o Ooo. o Oo / 

. o ^ o 

ff ten asn et tjjt Mêt fmm4êotm'rt% 

Er is een land zonder menschen. De steden zijn zonder muren en ook 
zonder haizen ; de zeeën en rivieren zijn alle zonder water. De sawah's, te- 
gal's en pagagan's zijn alle zonder gewassen. De bosschen en bergen zijn 
zonder boomen. Landdieren en vogels zijn ook niet te zien. 

Oplossing: een landkaart. 

Toelichling: Onder (^wf»sn%^ verstaat men eigenlijk landdieren^ in tegenstel- 
ling met vischen en vogels. Dieren^ in het algemeen^ drokt men uit door 

»Jty»5ntnêm*JH<tê\ Of enkel n§<néüto<iê% 



^«c> 



9nam'r}% 



tn9n|><]i«sn\ = *jthmKmMsn\ 



\m09^êo\ =^ ê,mêjt*KU»^9n% 



>t»o^i 



o 



o _ 

U/ o . O o on O o, o o 

Ti^^ êAtj^M'r}§fnniai'n\ mktsnê/nMiêfnêmtxiruy tShêa»»nM^0JfUM\ »S9oniamêhiên^vi'rt^\ éji 
n»ntar»^§nin9qMt90»jn(iatnAtStn»a^\ f^Qiff 
ffKnêanaiLAênÊx »m tAs êAt r» t^ »atÊ% 

Den geheelen dag zit zij vergenoegd voor het fraaie sehutsel. Aan hare 
rechterzijde staat de met een vloeistof gevulde kuip op een voetstuk. 

Van haar linkerarm is slechts de bovenarm te zien. In de rechterhand 
houdt zij een werktuig, dat zij in de vloeistof dompelt. Zij manoeuvreert 
er mee op het schutsel, sporen achterlatende. 

Oplossing: de batikster. 

Toelichling: Het bedoelde werktuig is de kleine mk^x De kuip en de 
tjanting zgn met was gevuld; de dichter spreekt van water of liever van 
een vloeistof. 



n 



•m'^\ =^ •&ji»\ 



-- 8 - 

o o 

— O- 

o o 

_ o. o . . o. o o o ^ oCy . 

«CTiitti tr}ju^->i«m|^ «^ A 477} M «LI m Cl 4>« ^ «114 rnj jL9.ui«<i »><L| ^|^\ 9J» uil JA 91 lUÊ 90 jn •rn»nÊ\ UM^jtm» 

O o r». . o c%. Q f 

Vergeuoegd zit bij en is voor/ien van een uitmuntend wapen. Niet ver 
van hem liggen de geweerkogels en al de krijgsbenoodigheden opgestapeld. 

Hjang Brama bevindt zich vóór hem ; deze is zijn tegenstander in den oorlog. 
Dadelijk wordt er iets op hem gericht; de kogel treft (hem zelf), maar dit 
vermeerdert zijne krachten. 

Oplossing: iemand, die opium schuift. 

Toelichlhig : het uitmuntend wapen = de opiumpijp . Hjang Brama = het vuur. 

Met de laatste drie regels van de strophe bedoelt de dichter het volgende : 

een balletje (ila^ wordt met het vuur in aanraking gebracht; de schuiver 

zuigt dan den rook naar binnen, waardoor hij opgewekt wordt, 
o o o 

o O . 

o 

«RL *• «-^ 

o ^_ 

_öo o. o. o. . JO'^o^.*,^ -.^ . ^ 






Een edelman heeft een echtgenoote, die hij in hooge mate vreest; want 
telkens, als hij nader komt, pijnigt zij hem onschuldig. Bijgevolg komt hij 
nooit dicht bij haar, als hij niet luid geroepen wordt om den bijslaap uit te 
oefenen. Hij is werkelijk een man van weinig beteekenis. Als er oorlog is, 
trekt zijn echtgenoote ten strijde. 



~ 9 — 

Oplossing: de vogel poejoeh (gemak). 

Toelichling: •oi*>»«fli> = in hooge mate; bijv. ry^^/toiiM««» = in hooge mate 
haten. 

__ o 

O (^ 

O^ 

iLaaAa^\ Kiama van ant^ttnnji^ 

o o. o o o o o. . 

o O a. o o, 00/ 

. o 

Er is eene zeer schoone vrouw, die in de zee woont. Telkens, als zij trouwt, 
neemt de man er nog andere vrouwen bij. Haar alleen tot vrouw nemen 
wil niemand doen. 

Niettegenstaande dat, als Sang Rétna van haar man gescheiden wordt, 
heeft hij een tegenzin in al hare mededingsters. 

Oplossing: het zout. 

Toelichling: Het raadsel doelt op de omstandigheid, dat het zout slechts 
één van de ingrediënten is, die men bij de spijsbereiding gebruikt. Niemand 
zal enkel zout nuttigen en zonder zout maken de andere ingrediënten het 
eten toch niet smakelijk. 

«ji«o«nAtA|\ voor «•aMjnntjnêAAti 



«J( 



•ot/TAx — iut0jant»nj\ 



«yntitfóx voor »jn»n9jh\ 



»jn$Aatriê\ — n/n (l»(L9é\ 



IQ/'o/'oo / a. Q. f>. Of», 

f/^J^ 90) «o 0/1 «^ pt <n>* <ru £4 N «rta fji iM ^a ^ t/n VA €* (SA tiA * ëJKUÊ iKp *.* rrtn tm »-nn ^ <un Mji\ t/ii <j» ' 4 «sn ki n >«> 

C^ G) Q o n Q o a. •/ 

. o o X 

Er worden vijf dieven vermeld, die willen gaan stelen. Vier zijn reeds 
de opening binnengetreden; zij hebben het op het huis, binnen het hekwerk, 
gemunt. De achtergeblevene volgt de anderen en sluit de opening. 

Zij, die in het huis zijn, worden allen gevat en gedood; het bloed stroomt 
uit de opening. 

Verh. Bat. Gen., Deel XLIX. 2. 



— 10 — 

Oplossing: een siribpmim. 

Toelichting : Met hel hekwerk bedoelt men de duiden ; met den acbtergeble- 
vene de labaL 

Cl. 



o. 

P- • rrnfw -P «~ — . .P-. 



mscms = «<i«3i7n% 



«M) «o «9 'S voor «>f I »n a^ c/i ik 

Den 4*icii regel: A?ii.«5*.«4f?.Mi;i^miV3» meen ik aldus te moeten opvatten: 
op het huis is gericht (bun) wil = /ij hebben het op het huis gemunt. 

10/ o /^ o. 00. 00.^^ rt. o 



o . o o. X /" 



fi«7n bHcn>L| «/i|i t<c rLi -in T» ^ 

Er is een woord van vier lettergrepen. Als men de voorste twee daarvan 
afscheidt, krijgt men den naam van een werktuig, dut men gebruikt in het 
water. De laatste twee lettergrepen vormen den naam van iets, dat vliegen 
kan. En als de lettergrepen niet gescheiden worden, is het de naam van 
iets, dat in de lucht gezien wordt en de rivieren in verrukking brengt. 

Oplossing: een wolk. 

Toelichting: rmmMs = *>w«jit/n*j.% 

p — 

om K TJX — — «ï irnTi.r»» 1% 
co « ^* 

/ o^ 

^,1^,, s= werpnet. 

«n-nx = duif. 

20. fei^ o«k«»?i»s|*o ton jI"i »n^ 9ji$4i'i i^unjitxjn »i^L» h.4\ c/n ^ J k/i fo «.u i/n a^ «n \ m mji «o ^4 «/) «ut { t^n «nt 

•m«2<{\ *jn i^imvn tonen pi \ A.nau»m*jiHh»u»aün «<n*/yi miil«^ L'NC»^«ai|\ •L»tu»(i^^tjnpima:n 
o o C) o. / 

. o o ^ 

Mijn naam heeft vier lettergrepen. Ik ben van een boom afkomstig en 
word dikwijls als geneesmiddel gebruikt. Als de voorste twee lettergrepen 
worden afgescheiden, hebben ze de beteekenis van een aangenamen smaak. De 
laatste twee lettergrepen zijn (de naam van) een toespijs bij het eten. Vele 
fzouden de soorten van djangan zijn), als ze alle vermeld werden. 

Oplossing: kaneel. 



— 11 — 



Toelichling: «^.oi^. = *yn«3«»i^ii 
4/iï«^. van Lc) = afkomst. 



o ^_ 



4yn«ui«o> t=< 



*^«jx = geneesmiddel (dat ingenomen wordt) 
rftsntr»^ id (uitwendig) 



o 

^-nK»»\ — ,£,9 man 9% 



o o^ o. 



•j»«K/n>\ == a^i/K% «wj^^-iiooia^ornx =^ ecn voof cen. 

OjTJtflx vftA9§n^inHiMsit»<rtun^i.i^\ 9Laam'n$<n^L3ntu4jtnct*AMi^ij\ mrmn ft »n *sii »n r^'tn en ut \ fnêoiaj» 

o o. o o. O o / 

•jT/ij^ */«*:»->»• itjnt^êainxnt9n^mriJisn^x/n0i».i^tii'n\ ((njjt 

Weder een vierlettergrepig woord. Het is de naam van iets, dat geen 
gedaante beeft en ook geen bepaalde plaats. Alleen zijn geluid wordt gehoord. 

Als slechts de eerste twee lettergrepen genomen worden, is de beteekenis 
ian prahcJn (geen verschil). De twee kawi-lettergrepen achteraan vormen 
den naam van eene plaats, waar men bloed doet storten. 

O p lo s s i n g : de wind. 

Toelichling: ,,^»<, «^^ is hier gebruikt in plaats van «Si^n^x met het oog op 

de eindvocaal. 

ajt»sA§n\ = ajtttimtpjtottk 

0t»aiiutn.i\ = KJtrtt/n%. 
o o 

G) 

<netnt9nii\ - — Ajnnamt^rtjx 

o O o 

Ttutnriy orn ast» ^ * 

o o 

(K$ itj* 'yi on \ — «jn iLiiMji^ 



'-n9n\ — • mi 



Ö"Ï3»' 



99 /o. .x'o /o. o O ^ ci- OO o 

(ojffl mn^inxm aaintnypjim fj»y «moutfoxsri ic^tt» r>i9L*^\ tf^ scn *<i Km 9<2 *ü *^*on .£jt\ »^ \ji aat ^i»»^ •sjti^ 

. o 
IfxmtsnKut^fnaz n om i »niE;t nr^^ 

Hetgeen (dezen) naam draagt, is weer een woord van vier lettergrepen; 



— 12 — 

(het is) het samenvoegen van twee stukken hout, zoo dicht bg elkander, 
alsof ze gelijmd waren. 

Als de voorste twee afgescheiden worden, (vormen zij) den naam van iets, 
dat zich richt tot den neus. De laatste twee lettergrepen (vormen) het woord 
der vrouwen tot hare mededingsters, die ontevredenheid veroorzaken. 

Oplossing: gonda-maroe. 

Toelichdng: »»»oi^v = #a»a^^ 

kjnin-h\ voor éun nrixm^ 

n tm t jo \ ^= M/n iP»\ 
f ^ CO 

OQ / /' o. . .. o o o. o o o 

(<^J|/f *J> «5>1*J» KI #-^ j^i VïtJ»x '^ "^l '^ *^ *7 '^ '^ 7 ^ (?i/J^ auinnjt^nmo-^'ritn^tüÊtJUx nvmêo^ji^Jt^êfn tiA^ 

o, o y' o o o o o o. .o o. o , oy^ o 

«y/i<7?^«> a^ «IJ «o «.i v» ^1 '» \ tmtsniutiKHE/i^MMfOis naan»niLmêatAntut9n\ *yiic|'>»«*w#ai*»*f» #o\ 



o. . . o / 



o 
't»^j90 9.i»n ^i 9<n Kn i« ## nm .jn «n «« *» \ 



Mijn naam bestaat uit vier lettergrepen; ik bevind mij bij de vrouwen en 
en ik breng de mannen in verrukking. 

Als de voorste twee lettergrepen afgescheiden worden, is de beteekenis 
laslari (bestendig) of sampocn tinoehoe (reeds gekocht). 

De laatste twee lettergrepen worden nu vermeld; zij zijn de naam van iets, 
dat vliegen kan. 

Oplossing: de boezem. 

Toelicht iugi t^Juji. = >.nik 

iut*AAêjn~n\ msa. van «^«^^ 



«71 



o o. o. o o o. «k^ / 



If Kn Êsh xn tJt M»t n ■mt9n'y»<i»»% 



Weder een woord van vier lettergrepen; het is de naam van eenschoone 
vrucht. Als men slechts de eerste twee lettergrepen neemt krijgt men den 
naam van iets, dat onzichtbaar, onaangenaam of lekker is en door den neus 
kan worden waargenomen. 

De laatste twee lettergrepen zijn de naam van een aanzienlijk familielid. 

Oplossing: gonda-rija (kleine ronde vruchten, die met azijn worden 
ingelegd)» 



— 13 — 

Toelichting: de unéitfmfo-nêM\ is een groote boom. 



o . 

<y /- 

o __« o « (r) 



y^l^ *^ '«>ïl *»-* '>^ *» «« »o 'T! \ 45)2iU|^«/n»o«m«n9o9<u>4^\ *o} «!>• c| »o «>• 1^ «O nri «/ii Wil \ »m êo» oTi» ^ 9 Lé om 

.^ ^.^ «o o y ^ Q o CV^ /"o . o CT. o o o. 

£f^ «4»/ï*<Ti»ow«7>4/n««i\ •.« 'T) 'T) 90 %/n «/c ff/} ft^l *n « « «cnf)ffOffni«of9t>i^9i4'm\ c«rLf f rc««sn««ft/it 
o o o o o / 

. o o 

De naam van een kostbaar gewas bestaat uit vier lettergrepen. Als men 
de eerste twee lettergrepen er van afscheidt, hebben deze de beteekenis, dat 
het lichaam zijn gezondheid verloren heeft. 

De twee lettergrepen, die zich achteraan bevinden, vormen den naam van 
een der zeven dagen. 

Oplossing: lara-sëtoe; Mal. JL*. j Bij de Europeanen bekend onder 

den naam van akar tvangi. 

Toelichtinij: Lara-sëtoe is eene grassoort van een meter hoogte. Van de 
welriekende wortels (akar wangi) maakt men waaiers, stoffers, mandjes en 
allerlei luxe-artikelen. Vooral in sommige streken van Bagelen komt dit 
gewas veel voor. 

tv' o . 






o. o_ Q o , , O d O ^ o o» o. o 

o / o o . o r 

tm oji $m •en tut (foa \ k/n Kn^oTt ttjutnnnm^^iut^tnithxn (Hia ^ li^l±l) 



o o 

)»:nasnKniLa$niit ojt xn ctji 9n t^ 



If Km asnci ^ »09\ 

Het wordt gebruikt door den vorst en mag niet door de dienaren gebruikt 
worden. De naam er van bestaat uit vier lettergrepen. Als de voorste twee 
genomen worden, is de beteekenis een gevreesd wouddier, dat zijne makkers 
verslindt. 

De laatste twee lettergrepen vormen een kawi-woord, waarvan de betee- 
kenis panganggé (kleedingstuk) en doenoengan (plaats) is. 

Oplossing: singa-sana = troon, vorstelijke zetel, 



— 14 — 



Toelichting: »off'n(•n^ = -y^ww^ 



•ai»S- = #9*»n% xTnojÊtmuTfiéiMÊs = 6611 kawi-WOOrd. 

•Sci% 1« kaw, = ««»;,»oa% 2« KN. = l66uw. 

o /" 

97 /!-*. n n y' o. o y^ o ^ Q, o o 

o o. o o. o . / o. o . o o. o. o 

ft/n «o n 477} tyi7 4^»i \ »^% tvazjn unttj»êa**nti9s^t^»o ^t r:*<VA {jf^JJI 
, o o O 

Er is ecu bloem, die tot de onbeduidende gerekend wordt; de naam 
bestaat uit vier lettergrepen. Als de voorste twee worden afgescheiden, 
vormen zij den naam van een verheven persoon, die zich niet met aardsche 
zaken bemoeit. 

De laatste twee lettergrepen hebben de beteekenis, (zegt men, van) alles, 
wat men dicht vóór zich lieeft. 

Oplossing: wali-kadëp = een heester, waarvan de bladeren als medicijn 
gebruikt worden. 

Toelichting: uui^^jtj^^ pass. van «.^ti»4f;. = front. 

OÖ / ^ Ci a Q y^ Q o /o o. o. Q o 

o, et O . rt o o o o. o. C^ . 

tntctin»m9a/n9nnK7»pt\ aai(rn»jf^jitnihrn4iiasnÊ5n9iji.famM\ (iciflfl 
• o / 

Er wordt weder vermeld een bloem van een gele kleur; de naam bestaat 
uit vijf lettergrepen. 

Als de voorste twee genomen worden, heeft men een kawi-woord, dat 
begin beteekent. 

De laatste drie lettergrepen vormen een ngoko-woord, hetwelk beteekent: 
„de plaats van beschaafde manieren." 

Oplossing: de zonnebloem. 

1 OellC/t tl Hg .* i :t 9n L* tsti = »ni *j» -n «sii tk 

o Cl . 

tji êji ^^ 95t$ \ ê<n n% 

I a> 

n /- 

asrtvn^^y hoort meu in de uitdrukking: fyi/nf'r)4ji'>j;«sn«»i^«. -= geen ma- 
nieren kennen. 



30. 



— 15 — 

#L.#n|x is bijgevoegd voor de maat. 

C> a o /^ o o o o. , c o. o. * ^ o , o. oo 

-- f> o . . o. /* 

. o 

Er is een woord van vier lettergrepen. Als de voorste twee worden 
afgescheiden van de laatste twee, is de beteekenis njakét (naderen); en 
moendoer (achteruitgaan) vormt de tegenstelling. 

De laatste twee lettergrepen vormen het tegengestelde van laroena (jong). 

Als de lettergrepen niet gescheiden worden, noemen ze den naam van 
zoogenaamde ouders. 

Oplossing: schoonouders 

Toelichling: aS«3?;x == ai%*jimiHi/iy. In het dagelijksche leven gebruikt men 
voor legenslelling meesfal t7w»,f«y».ii#/wni% 



/!-.-. o. o. /o. 00.0^^ / .. 

, o. o o. o. . o o y^ o 

o. o. o o .0 / 



ff mn êsh tci AA itnjt •mtAAua 



o 



Ik behoor tot de houtsoorten en mijn naam bestaat uit vier lettergrepen. 
Dikwijls word ik gebruikt als ingrediënt voor borèh en dien ik als geneesmiddel. 

De voorste twee lettergrepen (beteekenen iets), dat in de keuken gebruikt 
wordt en (verder) voor allerlei dingen dient. De laatste twee lettergrepen 
zijn de naam van hetgeen ontstaat uit hetgeen gegeten wordt. 
Oplossing: kajoe tahi. 

Toelichling: Deze houtsoort is steeds verkrijgbaar bij den »ji^^=ver- 
kooper van specerijen. 

tLm»jnx»\ 01 *Ai!KA»jn\ 

Q 1 / O / o. . rt o. o /^ o, Q. O. . o Ck 

((CTj^ Tfz:»t»n*nttv>ttAJi»jinm\ #0 ^ot/n <wr) 4>i«<tJ»i» »^ ooi «s>i -i w m^ »<> tyn#m.i* 'T» > a/ii «ai ê/nin» «'M ^t «il 

00. 0.0 000. o. 



o 
Tm mn 



*^^/^ '^'^i^i?'?*^*^^*^''**''^^^ ('^iM 



fi vnn v>n t.i LI tn , t .on ^ 1 1 /i vu a 



— 16 — 

Er is eene soort van sieraad, waar de vrouwen zich mede tooien; de 
letters vormen vier lettergrepen. De eerste twee vormen den naam van een 
waterdier, dat een këris vóór aan den kop heeft. De overblijvende laatste 
twee lettergrepen zegt men van eene vrouw met een mooi uiterlijk. 

Oplossing: oerang-ajoe (naam van een bijzonderen vorm van oorknop). 

Toelicht ing: ajn-y^s garnaal. In het midden van den kop heeft de garnaal 
een naar voren gericht scherp, hoornachtig uitwas. 

Q ^^ O 

QO / . o. o. o /^ o /^ o. o o. . o o. 

fc7j[A «ji«öom n)«>i tsntjf^ i/i}«o^v ajn^%^>iu9aêAJitAi»JKLn\ »^^it^€miUioji»n*i\ »inHn9a9*m»tj^êjn 

o o /" o f) O . O ■ o » • o o. Q <i. 

n en asn xn tA a^t art étn ru Lt% , 

Eene (zekere) plantensoort wordt dikwijls als geneesmiddel gebruikt. De naam 
bestaat uit vier lettergrepen. Als de voorste twee worden afgescheiden, heb- 
ben zij de beteekcnis van ranghep (dubbel) en van poeloeng (gebroken). De 
twee overblijvende lettergrepen zijn de naam van iets hards in het lichaam. 

Oplossing: tikël-baloeng (een naar een cactus gelijkende plant). 

QQ / CT. . O Q. C^ Ci, ^ O. O. _ O O . 

v'SXll *^**V*n*^*^ ^^^f^^ ^^'^'^ »sn»fnui.u»o^9%ê nrttcnn\ 9jmsn4uomtnajnêcn .sA'n* MLtftj»c>««c»9 -«-1 
o .00. 0000.. o o. . o o. a. 

o o / 



o 



gKTtasncitjtanjit ojt'riMM 



(Ui\ 



Het is de naam van eene betrekking en ook van eene melodie. De letters 
vormen vier lettergrepen. De deelen (waaruit het woord bestaat) zijn kawi- 
woorden. 

De eerste twee lettergrepen zijn de naam van werktuigen bij het oorlog- 
voeren. De overblijvende twee lettergrepen beteekenen een gevecht, waarbg 
aan beide kanten veel tegenstanders zijn. 

Oplossing: sara-joeda = een ambtenaar om rechtszaken te onderzoe- 
ken, tevens de naam eener melodie van de gamelan. 

Toelichting: Als iemand de salèndang wordt aangeboden om te dansen en 
hij heeft daarin om de een of andere reden geen lust, dan geeft hij de ge- 
bruikelijke gift en verzoekt een sara-joeda te spelen. De danseres zingt er dan bg, 



o 



o o. 



Êsnmt^ 



— 17 — 

[^•jf^jr = oorlogvoeren. 

o . 

«jiTix = orn tm Cii «0|% 

*XA f O _ Q C%. o Z' Q, o CT. / o, . 

Q Q o ^ o, /^ o Q. o. o. . 

rLM^\ tjt(»o tnnt/n n/f^pjy •in[^^ ajniiJtnrmajÊ»n'n^^\ êaiaL»^tt^nmiunétjtfQtisnÊ\ ojê tut tsn .jn en Knrt via 

tsn^aoÊ'^ Knnnrtt§ri^9a»<t}n»Jtn^T»têow^CMt»nnÊsn%êAM\ (f^ff 
. o o ^ 

Er is een plant^ die in het water groeit ; de naam bestaat uit vier letter- 
grepen. De twee voorste noemen datgene, waarmee men allerlei dingen ziet. 
De twee laatste lettergrepen (beteekenen datgene), imf de beend^ireu omffeefty 
en ook een dier, dat in het water keft. 

Oplossing: mata-iwak (naam van een waterplant). 

Toelicht inff : 9j»M'n*j*iis = tonw^vmi^ 

unp = 1« vleesch ; 2« visch. 



o 



o Q. » O O Q» , O. u y O 

'tij- Kt» t^yurtjt ^ ^ TLi m n êot Ut n njÊ Kt 49 \ m «o n k) «o rt* ^m «oi foi |n «wr« > ijniiAt<n»/Tnj»Kn9Ji\wfiM»<nmM^'i 

o o o. . O o. o o jT) o. / ^ 

MMtK^ny ajn êcn irni^ ttm vn »o tL» om in ^ cnnÊ\ («ryft 

Vier lettergrepen vormen den naam van een dier, dat in het water leeft. 

Het beteekent hetzelfde als roeniéksa (oppassen), als men slechts de twee 
voorste lettergrepen neemt. De twee overblijvende lettergrepen vormen een 
kawi-woord, dat iemand noemt, die ons haat en dien wij wederkeerig haten. 
Oplossing: djaga-ripoe (naam van een visch). 

Toelicht ing : «^ hti <j» «^ rii ^ voor 0^tm^nj»Sn\ 

»Jt9Xtp^ Ol OsA9X»n% 

;Sntn^\ ntAJifOi^im»n»»Qi^\ »jKq ^^ i^ tsn'ri om m ^ »nji\ »ji «oi |n ^ -n ty?i fói \ §mMfinjÊ^w?i(m 3h 
njk'n\ a::nKn<nAcinnr}90^,m9fnrt^o»^êmruê^\ \^/U 

Verh. Bai. Gen., Deel XLIX. 3. 



— 18 — 

Er 18 een woord van vijf lettergrepen, dat de naam is van zekeren 
berg. Als men de <lrie eerste lettergrepen afscheidt, is het datgene, wat 
men gebruikt om het paard te sturen. De twee laatste lettergrepen 
(beteekenen) de nerven der bladeren van aren en klapa. 

Oplossing: kéndali sa<la. 

Toelichting: «fJim^ia^Arix is de naam van een berg, die herhaaldelijk in de 

wajangverhalen genoemd wordt, als de plaats, waar m^ kyi ^4 K)|74jn kluis had. 

Ongeveer drie paal NNV. van Ambarawa bevindt aw\\ een heuvel van 
den/elfden naam. De Javanen zoeken verband in die twee omstandigheden ; 
want sedert lS6,o, toen laatstgenoemde plaats en Hajoe-biroe door eeue 
henge aardbeving geteisterd werden, hoort men vertellen, dat iit«^>of 

£4a.Mv dat gedaan heeft. 

/o . 

•47 ' ;') _ r") / o o o .00. o 

Kr is een boom wiens bloemen een aangenamen geur hebben ; de naam 
bestaat uit slechts «Irio lettergrepen. Als men de voorste lettergreep neemt, 
is de beteekenis: veel van iets houden. 

Do twee overblijvende lettergrepen vormen een kawi-woord; (het beteekentj 
steunpilaar van het leven (eten) en hetgeen gebruikt wordt om iets aan te 
vatten (hand). 

Oplossing: sëmbodja (de bekende boom op de begraafplaatsen). 
Toelichting : 

"XSl / •o. o o. a o o o o. /^ 

' yfSJÈ. ''^ *^ '*"* "* '''* tif *^ "^ ^ •>» «W tsn rji ^ I n *o -ai IJ"! «#? . wtt4jitn,jt»jfftnnA'rttt7}iyi\ 4j|^*iMi«nt«(rt 

tMt:t^9fi\ •fJtKtvn rnt/mn^jÊ Mijn iti^ Hl» ^^ v^Ml 

a 
M i.-n «>»* f?f «^ MVJs «t r»> I «o iL| 'T) % 

De naam van een zekere plant bdstaat uit vier lettergrepen. AU meude 



— 19 — 

twee eerste letter^epen afecbeidt, vonuen zij den naam van iets, dat niette 
zien is. Alleen met den neu8 merkt men, of het onaangenaam of aangenaam is. 

De twee laatste lettergrepen vormen een kawi-woord, dat de naam is van 
een groot en traai huis. dat boven alle andere nitmnnt. 

Oplossing: gonda-poera. 

Toelichfing: De ^mfêotjtTts is een struik, waarvan de bladeren gebruikt 

worden om er de bekende vluchtuie olie van dien naam uit te destillcercn. 

ilQ / "* /'o. 0.0 o o. o y^ a.o._ 



o y^ Q :» o o o. o o o Qi » oo. q. 

a O o O Q o r 

Er is een woord van vier lettergrepen ; het is de naam van een uitstekende 
olie, die dikwijls als geneesmiddel gebruikt wordt. 

Als de twee voorste lettergrepen afgescheiden worden, vormen zij den 
naam van liet liandvatsel van zeker timmermansgereedschap. 

De twee laatste lettergrepen hebben dezelfde beteekenis als loegél (gebroken) 
en tmtlépés ^geknakt). 

Oplossing: sangkal-poetoeng. 

Toelivlilimj: -ki,»m»M^Kn» is een soort olie, die vooral bij been- en armbreu- 
ken gebruikt wordt, om er mede te wrijven. Naar men beweert, verkrijgt 
men deze olie uit den staart van zekere slang. 

•»#o«> verk. van 9jnttênjk% 



o_ o O:^ o et. o o /CU Q^ o, » .00. o. o 

«A ?9*7'^'^l%^^ 9o« »« Miv f il »otvn Cl 9««Mr|x *mtAM,vtéJt nAtM Hnany n inn4%i4m*nt nA^JU(m\ tffuckTiwt 

f*M»m€A^p2\ asficiwipj»têpw»iéétên9atên4fn,jn§aict'ri\ \^êff 

. o O 

De letters v(»rmen vier lettergrepen, die de naam zi]n van een fraaie bloem. 
Als de twee voorste lettergrepen afgescheiden worden, noemt men eene vrouw, 
die zoo goed als onvatbaar is voor schaamte en met alle mannen wil (omgaan). 

De twee laatste lettergrepen beteekenen: eenigszins vochtig, bijna droog. 

Oplossing: soendél-malëm (Ae bekende welriekende bloem : polyanthes 
tnberosa). 

Toelichhny: ^^ De beteekenis, waarin dit woord hier voorkomt, wordt 



— 20 — 

niet opgegeven in de woordenboeken. Men hoort het als zoodanig door de 
kinderen bij het knikkerspel gebruiken voor heel eventjes, :?oo jorrf a/j?, raken. 
#.ii«?iflk^x = niet vatbaar. 

o. o. 



J.1 / o y o o o. o o o ,00. >/^ 0.0. 

ci a, o. y o o o.. Ci Q. Q. o Q 

o. O o o^ .0 / 

Eene vrouw, die geeu man heeft, heelt een naam van drie lettergrepen. 
Als de twee voorste lettergrepen genomen worden, is het een schitterend licht 
bij nacht. 

Als de voorste lettergreep weggelaten wordt, blijven er slechts twee let- 
tergrepen over, die den naam vormen van de (ocgi/l bij het koopen van 
dingen van weinig waarde. 

Oplossing: woelandjar (eene weduwe, die nog geen kind gehad heeft). 

Toelivhimg: n»^,,^ = Q>S% 

.ü?*j.^ kr. van «.jcj^x = toegift (eigenlijk: vermeerdering). 
«^-ri^ycA^x = onbeduidend. 

10 / o /o. ■ 0.00. o o 00 t _0 

00 y o o 00. o. p 



*^n*AA{*U9^\ tMAjnaru9n^»Ji»n9ueA^^^aji»jt€A**i»^'y vÜlUl 



. o Q ^ 

a tm 4s*i Cl *A «oAs c| 9Jt .^ zm \»jci^ 

Er is een woord van vier lettergrepen. Als de twee voorste kawi-letter- 
grepen worden afgesclieideu, zijn zij de naam van toekomstig zaad; (men 
heeft daarvan) vele en vreemde soorten. 

De twee overblijvende lettergrepen bcteekeuen : eene slechte handeling in 
't geheim uitvoeren. 

Oplossing: poespa njidra (naam van een sierplant). 

o . 

r:tn^an\ = #oico\ VaU «oii4o% 

4ïl / y o. . . o. Q y Q. c% o 



— 21 — 

00.00 Q, y^ o ... .00. 0.0 

0ij»^Vftnc9»*\ MA hnivuhi' êO ajHÊui\ •JtnrtBn ênarrinjm/Ê»sAf\ «7 tn #9 «o «ni »rn «x» f «i/j nm \ iunvt'n9»êAM0^9A 

o o. . O / 

Voorwerpen om iets in te doen, gemaakt in overzeesche landen, worden 
veel op het eiland Java gebruikt. De naam bestaat uit vier lettergrepen. 

Als de twee voorste afgescheiden worden, is het iets, dat een vorst machtig 
maakt om zijne vijanden te wederstaau. 

De twee laatste lettergrepen noemen het ongeluk, (dat we) met glas- en 
aardewerk (kunnen krijgen*. 

Oplossing: bala pétjah = porselein en glaswerk. 

Toelichting: m<^ = ^fi^jtt^ 

/o 

o 

In het dagelijksch leven gebruikt men cit^2»»jif*. voor drinkglazen en 
porseleinen kopjes en schoteltjes; ^«i» voor glazen ruiten; »at*J^^ voor 
spiegels; S»*t»^ voor scherven van glas en porselein en in het algemeen als 
stofnaam voor glas. Elen glazen knikker bijv. noemt men »mi7«o^£f&« of 



o_ o o. 

êo- 

.co 

.0 



êa»n^ênwiê>\ 



ir»i^^«o|> van het Ned. steen. 



KINANTI. 



1 •' . O o o o. . a. o o . 

. o 

Er is eenc buitengewoon solioone prinses ; niemand is met haar te vergelijken. 
Ilct liciiaam van Sanji: Rëtna verandert eiken dag. 

Over dag zijn liare stralen zonder glans: alleen des nachts schittert zij in 
hooge mate. 

Oplossing: de maan. 

fc> '"> o o o. . o o o ") ) o o. 

o. o o o y' .o V ") o / 

o o O o 

'' I -' v^ o 

Er wordt een sciiouwspel vernield ; velen kijken er naar. Mannen en 
vronwTn zijn opeengehoopt en vt»rdring(»n «Ikander. Maar zij zijn niet blij en 
wensohen, dat er spoedig een einde aan kome, opdat het geen verdriet 
aan andere mensehen zal vero<»rzaken. 

Oplossing: een huis in brand. 
Toelicit timj : ry\*^^ = i .71 «j» ^m % 

^V'"i^ voor ^é^nA•f^.n^M^ Bij de samentrekking verandert de soekoe in ««« 

fnjÊ — nrfinwê nam vrnruÊ% 

M/n êAf \ = »7t tK% 

tK MIX Ol 4^*0% 

3/ o y r^ o rt o o. . 00 

o 0000. o,./ 00/ 

.0 o '> o^ 

MMsntt>ti r.t c| MTAc «m 4Af «üI «j» rm t^n % 

Als het op visite komt, is het zonder böböd of tapih. Die het ontvangen, 
zijn blij en ijverig in <le weer om het te verzorgen. Als het heengaat, 
wordt het gekleed en tevens beweend. 



— 23 — 

Oplossing: een pas geboren kind. 
Toelichting: «o^n^^ = *o'f'iKM% 



\'n\ — - Kit 



o o 

«%f/n^«nM = bovendien, en dajirbij. 

».) o » o . .'^ .") o o. o . . o z' 
.o . o O 

Er zijn twaalf zeer scboone broeders. Zes houden er veel vaa om dag Qn 
nacht in het water te piassen. Üe andere zes zijn bang voor het water : hun 
goeroe (^raadgever) is Sang Iljang Rawi (de zonnegod). 

Oplossing: de twaalf mongsas. 

Toelicht int/ : De twaalf mongsa's zijn de twaalf maanden van hetniongsa- 
jaar^ eene verdeeling van het zonnejaar niet het oog op de werkzaamheden by 
den landbouw. In 1855 werd door den Socsoehoenan van Soerakarta, Pakoe 
Boewana Vil, eene vaste indceling aangenomen^ bekend onder den naam van 
h'atmta mofiffsa. Zie hieromtrent liet overzicht van de Jamamche tijdrekefung 
door Dr, Cohen S/tiart, dat elk janr in het 2e gedeelte van den Kegeerings- 
almanak voor N. I. voorkomt. 

o Q 

. . o /^ o 



5. 



O .^ O. O ' > . oa/* .o . o 



o o 



• o 
ff tnf» êsn tn mjê »ojt i^ nri| ^ 

Van jongs af tot op hoogen ouderdom draagt hij een kleed met het ba- 
tikpatroon knljipir. De haren van zijn kuif zijn rood. Qp zijn lichaam zijn 
overal vruchten. Het kleed dient als geneesmiddel voor menschen, die een 
weinig lusteloos zijn. 

Oplossing: djagoeng. 

Toelichting: Met kampoeh bedoelt men de schutbladen van de vrucht. In 
den laatsten zin wordt er op gezinspeeld; dat men die schutbladen (klobot) 
gebruikt om inlandsche cigarettes (rokok) te rollen. 
êin^M KI. van TJK>ifi|% 

«ntic«^^> KI van n mtnAnni,nÉ% 
wf"n(U\ KI. van 'nfjtvnj% 

^4o«o. van {^Sêoji kr. van «-n^nN == overal verbreid. 



6. 



— 24 — 

e')©.© o oo . - C^ o f 

ff rm ÊO» astAA iOÊt amêJKtMÊ% 

Het geheele lichaam omwonden^ wordt zij dadelijk met kracht neergeworpen. 
Een poos trippelt Sang Rëtna. Zij wordt gevat en hoog opgeworpen. Op- 
gevangen in haar val, sterft Sang Djah in de hand. 

Oplossing: een tol. 

Toelivhtiufi : Smm^ ^= ^S,% 



o Q C^ Q Q. Q Q O r 

. o a * Q o 

nacnénngntAiOêt <bii «ju «a «j» «k4| % 

Er worden vermeld vijf jagers, die in een bosch jagen. Twee sluipen overal 
in; (de andere) drie volgen achteraan. 

Als zij (iets) krijgen, dooden ze het dadelijk in huis en het is net, alsof 
het daar opgegeten wordt. 

Oplossing: iemand, die luizen zoekt. 

Toelichting: De laatste zin bedoelt, dat de vijf vingers zich dan naar den 
mond begeven. Het beestje wordt tusschen de tanden gedood en daarna 
uitgespuwd. 

o 

«»#i|«^«i»^Ki|' ^^^ suiüx an doelt hier op herhaling. 

o o 

0jt»onjMtsnÊ\ (Spr» oji0Jtemji^j ^= alSOI. 

8r /^ Q o _ .0.0 00 o .0 oC^ o 



o o O «O o O • o / ^^ 

0ftm»m.s0\ »oêt)aên»Jt.£M't/»aAiLt^M\ arn Mrhfi ^fhi »j9 éu njf ^ ' («M/r 

. o ojD o 

n en »sn ta tA tnjit ênQê0^isn% 

Er worden zeven broeders vermeld ; zij ontmoeten elkander nooit gedurende 
hun leven. Beurtelings zijn zij een voor een te zien. Al sterven ie, 
toch worden ze beurtelings weder levend. 
Oplossing: de zeven dagen. 
Toelichting: tfnSav^^^ = «iicjc|{% 
— c ^ 



— 25 — 

9. /<CTj/| êJt^AtMê(nAt§S9nm\ »jÊtSêmff0nM^m\^9snr^\ ênfm^9j§nnrtAMA*M9nji\ ünam§n^jn 

Twee krijgslieden worden vermeld; men laat ze roet elkaar vechten. Ak 
ze in 't strijdperk komen, willen ze niet worstelen. Hun moed komt te voor- 
schgn, als ze geslagen worden; dan gaan ze strijden. 

Oplossing: het laten vechten van gangsir's. 

Toelkhling: De gangsir's worden vóór 't gevecht geslagen met een«oi«n% 

nerf van een klapperblad. De kleinere djangkrik's worden gekitteld met 

een grashalm. 

aSA^êjnA^x = elkander van de plaats dringen. 

Er wordt een belooning vermeld ; niemand kan haar noemen. Velen streven 
er naar en doen al het mogelgke om haar te krggen. 

En toch (gebeurt het) zelden^ dat zij^ die haar begeereu; er dadelgk mede 
begiftigd worden. 

Oplossing: voorspoed. 
Toelichting: «^d>«t«ai% = zelden. 

y Km Êth Êsi tAêOjft êjè €M êm êS êji ,jn»hinênm'n 909 njKÊÊ^f MM §nÊ\ 

Het is nog donkerder dan de nacht; niets kan het ophelderen. Ook al 
wordt het door de zon bestraald, dan nog ziet het er donker uit. Men kan 
geen middel vinden om het juist te weten (voor dejuisteduidelgkheid er van). 

Oplossing: alles, wat nog niet gebeurd is. 
Toelichting: Knffnr»\ &» ^i^ei«^i 



0«f «9% 






12. (^/Êjt fsm^ên»Jt''ni^êf^9fms ^•^êMKéUÊ^^fvrnS^ ênMÈ^tmn§n9nnAêJt\ ênêt^hêêmêU^êf 



— 26 - 

. o n 

Voor hem, die het hebben wil, is er geen middel om het te koopen ; zelfs 
een vorst kan het niet. 

Maar z% die zich willen beijveren en er zich van jongs af mede bemoeien, 
zullen, het geen door hen beoogd wordt, stellig verkrggen. 

Oplossing: bekwaamheid. 

Toelichting: «^^^^^ van «fm^-^u 

o o __ y o xrarx t tl 

fC^f^n^^ — •>4JuirL*\ van ^%i^ 

00.0 o O /!l (?) O o o f 

. o o ^ 

In een grot wordt iets gezien; het weet den smaak zonder te eten. 

t' Is niet te gissen, welk een grooten invloed het heeft. Het verooorzaakt 
geluk en ongeluk. Het is in staat iemand een belooning te doen krggen, 
(maar) veroorzaakt (ook) hartzeer. 

Oplossing: de tong. 

Toelichting: In den eersten zin bedoelt men, dat de buik eigenlijk eet, 
omdat die alles krijgt. In de volgende zinnen heeft men het oog op ver- 
standig en onverstandig spreken. 
M^ttfn|\ voor«»^i»*ï% 

14. (^i êthvnên»êMniai'nüjntMê^\ êaiiiun^in.jn^nKnM\ êfmasn>fnêsnênJi»jt§oJi»JÊÊOÊ\ m 

Die het maakt, wil het niet. Die het bestelt, neemt het niet in bezit. 
Die het koopt, heeft het in het geheel niet noodig voor zich zelf. 

En degene, voor wien het bestemd is en die het ook gebruikt, ziet het niet. 
Oplossing: een doodkist. 
Toelichting: ^cnonx ss «^«^«^^^ 

fetf£ ik««r>f«ni«n>rL9^«n>«nn|x KnêmAfm^MjntmêotA^x SmmÊ^9fnn»nêJiêaê»»\ ^^^tAns^ {& 



— 27 — 

Twee hoofden worden gezien en ook twee annen. Hy heeft in het geheel 
zes beenen en slechts tien vingers. Slecht vier beenen loopen en de twee 
andere raken den grond niet. 

Oplossing: iemand, die te paard rijdt. 

Toelichting: ^tSwfênAx voor ^tS«^»o«^«<»x 

Dat «A^ is er maar bijgevoegd om de pada lingsa op t te doen eindigen. 

Zijn lichaamsbouw is niet (altijd) dezelfde. (Er zijn) lange en korte, groote 
en kleine. Als men zijne diensten wil gebruiken, moet men herhaaldelijk op 
hem slaan. Langzamerhand verbergt hij zich dan en wordt slechts zijn hoofd 
gezien. 

Oplossing: een spijker. 

Toelichting: ÜQ^êojis = êmm»Q^êon\ 



9tê\ mnêOKêasnmMvn 



Er worden alleen vermeld vier pooten, die niet gebruikt kunnen worden 
om te loopen en maar recht op blyven staan. Maar zij zgn toch nuttig en 
geven gemak aan het lichaam; door het (lichaam) op den schoot tó nemen, 
brengen zij het tot rust. 

Oplossing: een stoel. 

Toelichting: c«t%40{«%x van ijgrli 



PANGKOER. 

■"j^tM' (mi 

In den nacht verschijnt de Raden op het oorlogsveld; gewapend met een 
Bcherpen ynurpijl. Vele vijanden gonzen om hem heen; allen zijn dapperen 
met een bovennataarlijke macht begaafd. Zij vallen in groot aantal op hem 
aan en vechten ongeregeld. (De Raden) wreekt zich niet, (als) hy dooreen 
overmacht overvallen wordt ; niettegenstaande dat worden zijne vijanden weg- 
gevaagd. 

Oplossing: een lamp. 

ToeUchling : Het raadsel doelt op de insecten, die 's avonds om de lamp 
vliegen. 

^«s*^% SS vuurpijl, van ^«4> en «>fi^% 

o o o 

•k|'n\ =^ A3i«^\ of Man nMÊ% 

<n|tSê^^ = weggevaagd. 

Zg, die worstelen, vliegen in de lucht en beijveren zich om elkander te 
overwinnen. Werkelijk zyn zij met een buitengewone macht begaafd. 

Zy vallen op elkander aan met scherpe wapenen, die dienen als middel 
om te verliezen of te overwinnen in den oorlog. Als een van beiden het ver- 
loren heeft, wordt hij weggeworpen en valt op grooten afstand neer. 

Oplossing: menschen^ die een vliegerwedstryd houden. 

Toelkhling : De vliegertouwen worden daartoe met een mengsel van Igm 



— 29 — 

en f^n glas bestreken. Oroote menscheDy vooral Chineezen, bepalen soms 
den inzet tot op een gnlden. 

«untmtruji^ = overwinnen. 
kmmóm- = wogworpen. 

Een dicht bosch wordt vermeld, met slechts één soort geboomte. Er zijn 
geene bladeren en geene takken, en ook geene bloemen en vrachten. 

Er is slechts één soort van wild. Als (die wilde dieren) menschen eten, 
veroorzaken zij moeite aan den grondeigenaar. 

Oplossing: het hoofd. 

Toelichting: De bedoeling is, dat het bosch alleen stammen bevat. 

Welke wet veroorlooft den menschen om elkander te doooden, te berooven, 
enz.; ja zelfs, dat men daartoe gelast wordt? 

Hij, die het bevel ten uitvoer brengt en amoek maakt, wordt geprezen. Als 
hij den last niet opvolgt, valt hij in ongenade. 

Oplossing: oorlog. 

Toelichling: Met het woordenboek in de hand, zou men t>»^«nfji<m9^ ver- 
talen met roem inoogslen, en dat is ook goed; doch de hoofdbeteekenis 
van het subst. den. «>(yh<m =shet prgzen. 

on^tAifx «=: rooven. 

ciêsn<mÊ\ = aansporen, in den zin van gelasten, 

êgêSnMêx = niet opvolgen. 

Êsn£9feh\ voor vnmlKn&% 



— 30 — 

o . o (^ o V o <* o . o 

Zgn geaardheid is tweeërlei ; hij veroorzaakt moeite en hij helpt. Als hg 
toornig is^ verwekt hij vrees en veroorzaakt armoede. 

Om de waarheid de te zeggen^ is waler, hetgeen hij als vyand beschouwt, 
en olie is zgn vriendin, omdat zij in alles met hem meewerkt. 

Oplossing: vnur. 

Toelichting: £nM^ = «a«ai% 



6/ (•o o o o. o o o 



ion 



o y^ o o o* o (Pi o o m. 



«^A|. (gjj^ 



Van zijn geboorte af wordt hij opgesloten ; (maar) hg is van buiten dmdelgk 
zichtbaar. Hij beweegt zich heen en weer. 

Als men zich met hem bemoeit, geeft hij uitmnntende lessen, alhoewel hg 
stom is. Men behoeft hem slechts aan te zien om de windstreek te weten, 
die hg op het oog heeft. 

Oplossing: het kompas. 

Toelichting \ c«tiu^«>ux = duidelijk te zien. 

^ o 

a o ' o - o o O.o/^ 



• o 



Er is een dier te vermelden. Als hij nog klein is en begeert te loopen, ge. 
bmikt hij vier beenen. In zijne jongelingsjaren loopt hij maar op twee bee- 
nen. Als hij reeds oud is, gebruikt hij een drietal beenen om op te loopen- 

Oplossing: een mensch. 

Toelichting: «oi^« = «oi^S^u 



— 31 - 

Zy wordt gevat en gespleten (in stnkken gesneden). Dadelyk wordt zy flink 
gewreven op een plaat^ van scherpe punten voorzien^ en aanhoudend zeer 
fijn verdeeld. Zij zou niet in staat zijn terug te keeren (weer heel te wor- 
den). 

Vervolgens wordt zij in de gevangenis gezet en gebaad en geknepen; ter- 
stond vloeit het witte bloed. 

Oplossing: iemand, die kokosnoten raspt en daarna uitperst. 

Toelichting: Aynt^cjc^x =zeer fijn. 

9fm»tam\ = 2t£n(m»\ = iu Staat Zlju. 

o _« ^^ o 

«sn^mx voor unên.jn MTis = terstoud. 

Er is een woord van vier lettergrepen. Als de twee voorste worden af- 
gescheiden, is het de naam van een waterdier. De laatste twee zegt men 
van iemand, die alles vergeet. 

Als ze (de lettergrepen) niet gescheiden worden, vormen ze den naam van 
een ommuurde desa. 

Oplossing: Bajalali. 

Toelichlitig : Dit raadsel is vermoedelijk uit den ouden tgd. Althans de 
laatste zin bedoelt, dat Bajalali een versterkte plaats is en als. zoodanig is 
het ook in de geschiedenis bekend. Ten tijde van den eersten Javaanschen 
successie-oorlog had Soenan Mas aldaar zgn grootste legermacht bgeen. 



o. 

> — ^ wtajn 

cr 



(UMafn\ ntm*La% 



'mojy = verkorting van êMttÊnji\ 

Mijn naam bestaat slechts uit drie lettergrepen. Ik word niet anders ge- 
bruikt dan als speelgoed voor jong en oud. 



— 32 — 

Als de voorste twee lettergrepen worden afgescheiden, is het de naam van 
een uitstekend middel om elkander zgne gedachten bekend te maken. De 
overblgvende lettergreep heeft geen beteekenis. 

Oplossng: een vlieger. 

Toelichling: •S-nt^'r»*»^ voor •o»<ft'n&«3b = ft/fitj»|m% 

o o ^ o o 
éut&\ ==^ ssnamê^X 

Er is woord van drie lettergrepen ; het beteekent een grenzelooze waterplas. 

Als de twee voorste lettergrepen worden afgescheiden, is het de naam van 
een werktuig, dat gebezigd wordt in het water. De overblgvende lettergreep 
beteekent een stuk grond, dat dicht begroeid is en uit de verte gezien kan worden. 

Oplossing: de oceaan. 

Toelichling: Sütsn^ = t:na:m% 



<0 



êpéUt\ ^ A«IM«ntf* 






In de laatste pada lingsa is £>« een samentrekking van mA% 

Er wordt vermeld een woord van vier lettergrepen; het is de naam van 
een lekkemg in een geel omhulsel. 

Als de twee voorste lettergrepen worden afgescheiden^ vormen ze den naam 
van een dewata, die gel^ktgdig geschapen werd met EQang Gk)ero6. 



— 33 — 

De laatste twee lettergrepen (beteekenen) bedwelmd door geestrijke dranken 

Oplossing: sëmarméndëm (een lekkernij van vleesch^ këtan en eieren). 

Toelichting: De dichter spreekt hier van een geel omhulsel; dit doelt op 
het gebakken ei; dat vooraf geklutst en dus geelachtig is. Nadat het vleesch 
en de këtan afzonderlijk bereid zijn, wordt een weinig vleesch in këtan ge- 
wikkeld en het geheel met een dunne eierkoek omgeven. 

Sëmar is een van de meest bekende figuren uit de wajang. Hij was de 

vader van Pétroek en Nalagarèng. 
c^ 

4ICA3l«Snx Ol M«A-UitOI% 
iUÊMJI\ = 4B»«4% 

Er wordt een bloem vermeld, wier naam uit drie lettergrepen bestaat. Als 
de voorste lettergreep genomen wordt^ is het de naam van hem^ die in zgn 
land de oppermacht alleen in handen heeft. 

De laatste twee lettergrepen zijn de naam van een uitmuntenden slagtand. 

Oplossing: sri-gading (naam van een bloem met witte bloemkroon en 
rooden kelk). 

Toelichting: De bijvoeging van <$». achter •7»t^l^^ dient alleen om het 
aantal lettergrepen met één te vermeerderen. 

tmct-fjtnjAy paSS. VaU i/ntêaruA'ik 
CO <UI f^ <--« 

«%M74S(\ van ftjiéi^\ ^ tru^jt^if 

(j CT |j 0»Mj»tfg»q(mt*ji»jÊÊa9n,9OÊ\ njt^ênnri^tsnfLKmênasnfn^M^s niM»n.jfn»QMsn.£*ÊiKfmKn9Minji\ 



• o o 

jy en «PI K9 c| «ojs •«i'ncnv 

Er is een soort lekkernij; de naam bestaat uit niet meer dan drie letter- 
grepen . 

Als men de voorste lettergreep neemt, is het een woord, dat tot de kawi- 
woorden behoort en Unangkoeng (uitstekend) beteeken t. De twee overblijvende 
lettergrepen beteekenen de tegenstelling van laki. 



— 34 — 
Oplossing: soerabi (de bekende ronde gebakjes van meel en santen). 

nnjnun^i\ nuinwm»?M^9VKm t^nurtMên^iA*^tt\ ^^^êxi^^^jttr^-ui^^ns ^ tx ^ 9sn Mëot mm 3h tut 

Ik ben een bloem; mijn naam bestaat uit vier lettergrepen. Als de voor- 
ste twee afgescheiden worden, zijn zij de naam van den zetel der ziel. 

De twee overblijvende lettergrepen vormen den naam van een gebrek aan 
de oogen en (beteekenen ook) niet vlug in hel tellen. 

Oplossing: raga-ina (naam van een paarse bloem, zonder geur). 

Toelichting: «i»l3^«^x van Qi^% 



AmÊsns — 


- Kmnt% 


•JIMIX ^ 


»jÊCta5nÊ% 


•?•"© = 


= c«csn% 


o o 


^ «yn«m% 



•rinmx = iunMJtêonÊ% 



— tunajtêonÊ^ 

Mijn naam bestaat uit vier lettergrepen. Ik kan slechts een weinig licht 
geven en ik ben afkomstig van een plant. 

Als de voorste twee lettergrepen afgescheiden worden, vormen zij den naam 
van een kleinen visch. De laatste twee lettergrepen zijn eveneens de naam 
van een kleinen visch. 

Oplossng: oetjèng-oetjëng = lampen-pit (van een tjaloepak). 

Toelichting : Het lampenkatoen voor de tjaloepak wordt vooral van kapas londa 
gemaakt, &ta^ = «^«j»«^ioitfx = visch (in onderscheiding van «^<ji«ai|. = vleesch). 

n/o* o» o o, Cï o o o 

o 



utsmÊtnÊaêAênêt '^^'gP'^J^ 



— 35 — 

Ik behoor tot de vruchtsoorten ; mijn naam bestaat uit niet meer dan drie 
lettergrepen. Als de voorste twee afgescheiden worden, (beteekenen zij) een 
bedekking van het hoofd, die men meebrengt, bij het aanschouwen van het 
eerste levenslicht. 

De laatste lettergreep heeft dezelfde beteekenis als ora. 

Oplossing: ramboetan. 

Toelichting: ^m\ = £t(nn^% 

«4«^«/n»x Deze beide woorden worden meermalen bij elkander gevoegd en 
krijgen dan de beteekenis van natuurlijk licht. 



i^ÜM. *^^^^^****^^^^'^*'^'^ iL»j^&0Jiên»snfti(miE4§niut\ êjtM^^^^MiêoiaiJi^ciaMtnÊs AMt^wfên 

o. . o O o /" 
"O ^ o 

(Ik ben) hetgeen op sommige tijden aangeboden wordt. Mijn naam bestaat 
uit vier lettergrepen. Als de voorste twee worden afgescheiden, is het de 
naam van een vrucht, die niet lekker smaakt. 

De laatste twee lettergrepen beteekenen een hooge eerhewijzing. 

Oplossing: boeloe-bëkti = een kleine schatting, welke jaarlijks door de 
zoogenaamde vrije desa's opgebracht wordt, 

Toelichting: ^Am9sn\ verkorting van AjnKnMt^s = hetgeen men aanbiedt. 

De boeloe-bëkti dateert uit den ouden tijd. Het is een onbeduidende op- 
brengst, die voornamelijk dient als bewijs van onderdanigheid. Ook in som- 
mige Gouvernementslanden bestaat die gewoonte nog. In Madioen bijv. zijn 
nog vrije (perdikan — , midjen — , pakoentjen — of kapoetihan — ) desa's, die 
jaarlijks, gewoonlijk in de maand Moeloed, de boeloe-bëkti ouder gewoonte 
brengen aan den Sultan van Jogjakarta, en andere, die deze hulde aan den 
Regent van Madioen bewijzen. 

Zie hierover het belangrijke artikel van den heer Fokkens: „Vrije desa's 
op Java en Madoera,'' voorkomende in Deel XXXI van het Tijdschrift voor 
Ind. T. L. en V. van het Bat. Gen. 

o o o. • o. o. • / O • o 

, Q. o o f ^ 

n t/n «^n xn O.» «sn \ (<CTJfl 
. o 



— 36 — 

Er is een woord van twee lettergrepen. 

Het is de naam van een bloem, die niet tot de fraaie (soorten) behoort. 

De voorste lettergreep beteekent om. De laatste lettergreep is een ngoko- 
krama woord en is de naam van een vlaktemaat voor bouwgronden. 

Oplossing: tandjoeng = een boom met stervormige bloemen, die een 
aangenamen geur verspreiden. 

nSWL 7***^^*-'*^'^7*^*''^^ '"^•''M^f/l(f^^*^''^*^ tiMW%ên^nji^9vi(mcttAM»nj A^&f 

fl Kn Kfi KI ÊJi MÊt C««JI«!l*0|% 

Er is een geslacht van hnisspinncn; de naam is een drielettergrepig woord. 
Als de voorste twee lettergrepen g( nomen worden is het de naam van een 
wouddier, dat er op nagehouden wordt door vorsten. 

Als de lettergrepen niet geseheiden worden, is het (ook) de naam van 
een spel en van een kot'ps piadjoerils (in de kraton). 

Oplossing: matjanan f een kleine huisspin). 

Toelichting: Het spel matjanan is een soort belegering-spel, dat met 
22 steentjes gespeeld wordt. De eene partij speelt met 21 steentjes, 
die menschen voorstellen; de andere partij met één steen, die een tijger 
voorstelt; van daar de naam matjanan. 

De menschen en de tijger nemen standplaats op de kruispunten en be- 
wegen zich langs de lijnen van de figuur, die uit 40 vakken bestaat (36 
drieh. -f 4 trap.). De eerste partij moet trachten den tgger in te sluiten. 
De tijger moet trachten de menschen op te eten en mag dit alleen doen, 
als er een oneven aantal menschen op de uaastbijliggende kruispunten 
zijn ; hij springt er dan over heen en neemt ze weg, evenals bij het damspel. 

Mooie borden houdt men er niet op na; men teekent de figuur maar even 
op den vloer of op een plankje met krgt of houtskool. 



t «» 



^ fetfA ''^^^*^*l'^**?^f^*'7'^"^^ •Jt^^^iükfO(fnSti(miEM9n*^\ aS9êqKinji.iA&tmtaê/UêffA 

De letters van den naam van een waterdier vormen drie lettergrepen. Als 
de voorste lettergreep weggelaten wordt, (is het een woord), dat men zegt 
van iemand; die geen geheugen heeft, van nature of wegens ouderdom. 



— 37 — 

Als men het woord in zijn geheel laat, beteeken t het ook kalimpoel ing alt 
(vergeten). 

Oplossing: kalalen = een van de lekkerste rivierviii?schen ; hij heeft 
geene schubben. 

**fcfr/7*'''&*^*^* ««nw-^fowtswénwis» Aio«««^#min|\ •.*».^»« #t*inr»>ci»o«*^^ êonimt^o^ 
ffcnasnÊSHLAênat «hi cm tm 141^1% 

De letters van den naam van een zangwijze uit het middel-Javaansch vor- 
men v^f lettergrepen. 

Als slechts de voorste twee lettergrepen worden genomen, noemen zij een 
vronW; die nog nooit, voor de eerste maal, met een man in aanraking is 
geweest. 

De (andere) drie lettergrepen zgn de naam van een land, dat vroeger tot 
de montja nagara behoorde. 

Oplossing: kénjap-kadiri. 

Toelichling: £ld^8ttcn^»^mêOf = zangwijze van het middel-Javaansch; in 

tegenstelling met £»é«^«^«>. = de oude zangwijzen in kawi-gedichten en 
tsn^€MM^tsnji^ =sde gewone Javaansche zangwijzen. c|j%> = <:»«^ÉAi«n|% 
wf^tanêncmtis ss dc gcwcston Kcdiri, Madiocn. Kedoe, Bagelen en Banjoemas. 






•^fA^êicj*' (sa 

Weder een woord van vgf lettergrepen en ook de naam van een zangwijze 
uit het middel-Javaansch. 

Als de voorste drie lettergrepen genomen worden, is het (de naam van) 
een groot en sterk dier; als het woedend is, wordt het zeer gevreesd. De 
laatste twee letterprepen zijn de tegenstelling van boemi (aarde). 

Oplossing: maésa-langit. 

Toelichting: y^nns = cic|«m|^ 



— 38 — 



U ijffmTtéOÊ^ 



De naam van een uitgestrekte plaats^ met water gevnld, bestaat slechts uit 
drie lettergrepen. Wanneer de voorste twee genomen worden, (is het de 
de naam van) het noodzakelijkste voedsel. 

Als de voorste lettergreep weggelaten wordt, zijn de twee overblijvende 
de naam van het hecht van een mes. 

Oplossing: een vijver. 

Toelichting: Het woord fuix* «o ^ hoort men nog in de benaming voor de 
pandapa van den Soesoehoenan : 9ji9Ji»o0fMMj»êa»x d. i. de p!aats, waar men 
voor den vorst verschijnt. 



MC«A> 


o o 
1 — 4/n*w»% 


«tdviomx =^ »jÊKn§nji% 


\Sin*M9(n%\ = «^cjii|A3i% 


(StJL ^^^^ffl'^^*^'^^ 


4ji|MJki'n% êJÊtsniiMun nêo 


^isnêy 


^ 


ffisnén 


SfêAêOÊt ianrunm'k 






Er is nog een plaats met water; de naam bestaat slechts uit drie letter- 
grepen. Als de laatste lettergreep er afgenomen wordt, zgn de voorste let- 
tergrepen de naam van een spleet in den grond. 

En wanneer de voorste lettergreep weggelaten wordt, is het een kawi- 
woord, dat vijand en oorlog beteekent. 

Oplossing: een meer. 

O^ /■ / o .00. o_ o. o o o. O O o 

*^§'^k' dm 

De naam van de plaats, waar de letters staan, bestaat slechts uit drie let- 
tergrepen. Als de voorste twee lettergrepen genomen worden, is de betee- 
kenis: iets, waarnaar tnen zich richt. 

Als de voorste lettergreep weggelaten wordt, vormen de twee overblijvende 
een woord, dat men zegt van iemand^ die te haastig is. 



— aO- 
Oplossing: dalantjaDg (kr. van *n-a|«ix) = papier van inlandsch 
fabrikaat. 

Toelichling: Dit papier wordt vooral gebruikt voor het overschrijven van 
godsdienstige werken. 

njtt^s = te haastig iets (waar men eigenlgk niets meê noodig heeft) doen. 

o, o o o. » o /^ o o _, o O- J>o o,. o. o. 

De naam een klein vogeltje; dat zeer bewegelijk is^ bestaat slechts nit 
drie lettergrepen. Als de voorste twee lettergrepen worden afgescheiden^ 
(vormen zij) den naam van een werktuig; dat gebruikt wordt om de paarden 
schoon te maken. 

De laatste lettergreep beteekent ora. 

Oplossing: sikatan. 

Toelichting : •sn«^'Viirm\ •= •KnnênÊ^ 

Er is een oorlogswerktnig; waarvan de naam uit drie lettergrepen bestaat. 
Als slechts de voorste twee lettergrepen genomen worden, is de beteekenis 
waloeja (beteren) en ook kèndél (ophouden). 

En als de voorste weggelaten wordt, beteekenen de twee overblyvende 
lettergrepen hetzelfde als /iq^ lindri (bevallig). 

Oplossing: een kanon. 



DOERMA. 

v3M ^^^^'^^ ^'ri0i»n*onffcnf^MMUi\ »jt&êjn»Jtim&St\ asnSlfXiMaxinjis mMcmu%,jnStMa 
9mSinn^\ 0y»oic|C|{ AJi^ix^x C|«»|^«m«0ott'r)#o|\ êanctênwiênfJt^Kn&^\ UsêÊ 

Luidruchtig en donderend is het geluid. De strijders sdjn alle voorzien 
van knotsen. Zij vechten als tijgers, trappen op de hoofden en slaan aan- 
houdend. 

De vijanden worden overwonnen; van hunne kleeren beroofd, zien ze er 
gehavend uit. 

Oplossing: menschen (meestal vrouwen), die ryst stampen. 
Toelichting: ^Sn^ = «^«^««1^ «mg« = cmM^ 

'^'Si'SJI" ^^ &Mtwjis = trappen 9fKn9M^cn£t^\ ==^ er ordeloos, erg gehavend 
uitzien. 

•Qnn'n\ ^êamtasnJ^tn^»ji&\ £n&f êhtlüaji^s tj&'nci A{«tr&\ (^jii 
MasnaSm&^êOÊt «m«lit€|*.|x*.ï«% 

Rëtna ning Djah heeft werkelijk een boven natuurlyke macht in het oor- 
logvoeren. Van hare honderdduizende vyanden is er niemand, die haar 
weerstand kan bieden. 

Reeds zijn zg alle in de gevangenis. Met één hand worden zy gegrepen. 
De vyanden worden gezuiverd; het witte bloed vloeit. 

Oplossing: iemand, die rgst wascht (vöör dat ze gekookt wordt). 

Toelichting: i^^f^Aa«(% =» het juweel der vrouwen. 

ÊSênf9È»AM\ voor êauifêMêiSh^ 
mêQ9tm\ van Mêjt9{m% 



— 41 — 

•off^i^ asn90(mpMUitnên9JiiEJi\ éOjk^^nncnnÊaênAs tm^nên^^i^^MêJtTtMs [f^ÈÊ 
. o o % O 

Te gelijk doen de strijders een stormenden aanval ; allen zijn zeer dapper. 
Zij, die hun zijde kiezen, zijn allen van zwaarden voorzien. 

Hunne vijanden zijn tien millioenen in aantal; allen worden onthoofd. 
Vervolgens worden ze aan elkander gebonden en in de gevangenis gezet. 

Oplossing: menschen, die padi snijden. 

Toelichting: QfeA^^y een stormenden aanval doen. 

o o o 

^,«.«1» = afhonwen. 

O . .o o O^ö öQ o-^o/" • 

•at^iijns §fn*fn^t5naxajtêAJi»a».ia€j>\ mnintcna^^Jts «Mi«o'r)fnt.«/i9'r)fs»icn« {j^ÊJI 

.o o . G) 

Haastig rukt de Raden voorwaarts. Hij is gezeten op een strijdwagen 
met twee trekbeesten en heeft een knods in de hand. 

Dadelijk laat hij opmarcheeren. 

De aangevallenen worden allen rechts en links van een geseheiden en 
overreden door den schoonen oorlogsw«ngen. 

Oplossing: iemand, die ploegt. 

Toelichting: de knods doelt op de zweep. mtswN = strijdwagen. tj«3'ntaj\ 
= trekbeest. «8> voor >unui^ 

O CO') o o o . o • • o o / 

0icnMJin»ni&iiari^\ «snjn .ml m i^ <k cti C4 >ji .•<• \ t) t» m ki *>) n irtt»t»nm rvinêo K0»in\ (cm^ 

. o 

Op den weg wordt zij aangerand en wordt er om haar geworsteld. De 
borst wordt opengesneden en gescheurd tot op de maag; hare ingewanden 
komen er uit. Zonder te jammeren sterft zij. Haar stoflFelijk omhulsel blijft 
onverzorgd op den grond. 

Oplossing; koepat. 

Toelichting: De eerste zin bedoelt, dat, wanneer koépat op den weg te 
koop wordt aangeboden, de mensehen toesnellen om er het eerst bij te zijn 
CU er de grootste uit te zoeken. 

Verh. Bat. Geo., Deel XLIX. 6. 



— 42 — 

Twee krijgslieden laat men naar het slagveld oprukken. Zij slaan zich 
zelven op de gouden borsten. De oogharen staan overeind. Onafgebroken 
wordt beurtelings hun gelaat afgeveegd. Hevig brullende, stormen de strij- 
ders op elkander in. 

Oplossing: menschen, die djangkrik's laten vechten. 

Toelichting: Het afvegen van het gelaat doelt op het bestrijken met een 
grashalm om den moed op te wekken. 

if-n.x of .f-ni.^'n.^ 

Sicn^uctK^ =zich op de borst slaan. 

ciununun^ = ovcrciud staan. 
i^c»•nKm^ = brullen. 

By het aanbreken van den dag komen zij uit de grot te voorschijn. Het 
is juist in de mongsa kapat. Dadelijk vliegen zij. Hun aantal is onfclbaar. 

In de lucht gekomen, verdwijnen zij spoedig en vallen zonder vleugels op 
den grond. 

Oplossing: de laron's. 

Toelichting: Niet alleen 'savonds; maar ook in den vroegen morgen komen 
de laron's te voorschijn; wij merken dat zoo niet op, omdat onze huizen dan 
gesloten zijn. 

Aangezien het mongsa-jaar (voor Soerakarta) op 22 Juni aanvangt en de 
eerste drie maanden 41 + 23 + 24 = 88 dagen tellen, begint mongsa 
kapat op 19 September. 



— 48 — 

Hij; die een aalmoes wil geveo; zit aan den kant ^an het water. H9 
denkt: moge mijn gift opgegeten worden. 

Als er iemand iS; die ze (de gift) eet, wordt het hem dadèlgk belet; hij 
wordt gepakt en het loopt op zgn dood uit. 

Oplossing: de hengelaar. 

Toelichting: Mutê<i\ = aalmoezen geven. 

v3ii «aj/)^^«««{ >^i/n4^«>niitnvi«^M|iA\ &iim9^«ao^^*m\ c«i cfn «m km rm "n \ AêmnjtêJtm 

Hij, die wil worstelen, rukt spoedig voorwaarts. Hij is gewapend met een ver- 
schrikkelijke knods en draagt een gevangenis (kooi) aan de hand. 

Wien hij ontmoet, wordt met de knods neergeslagen. Is hij getroffen, dan 
wordt hij, dood of levend, haastig gepakt en in de gevangenis gezet. 

Oplossing: iemand, die sprinkhanen vangt met een pantjak. 

Toelichting: Deze sprinkhanen moeten dienen als voedsel voor den vogel 
gemak. De pantjak is een stuk leer of een stuk gevlochten bamboe aan een 
langen steel. In Madioen noemt men dit werktuig tepak; het bestaat daar 
uit eeu rond stuk leer, aan een dunne bamboe bevestigd. 



(SÊA *^*^*'"^^^*^^^'^*^^*^*^''**^'^ SjÊfniLÊ.iMnn*atwhiiüt^\ Mt^jf^êffivmTtx &*^QQ^& 



4J»\ §fn 



rnifnÊJi&n^^Mnnmfttpj' ^jf^'Q*!)?'^^ itt<f}|»o9tfncii^«at ottn\ fajfl 



» o o . 

ji en «s)i -c-i êA ênêx t»ti JLt) un rm «lj % 

Er wordt iemand vermeld, die oorlog voert in de rivier. Hij is voorzien 
van een uitmuntend wapen en heeft een gevangenis bij zich. Rechts en 
links werpt hij zijn wapen; de getroffenen behoeft hij niet tweemaal te 
treffen (één keer is genoeg). Dadelijk worden zij in de gevangenis gezet, tot 
zij sterven. 

Oplossing: iemand, die vischt met een djala (werpnet). 

00 00 . o .oy^ 00/ 



~ 44 — 

Allen; die naar de strijdende krijgslieden kijken^ staan in een kring. 

Zij (de strijders) worden luidrucbtig toegejuicht. Eindelijk worden ze 
gescheidefn om hen te laten uitrusten. Straks mogen ze den strijd wéér 
voortzetten, totdat een van beiden het verloren heeft. 

Oplossing: menschen, die hanen laten vechten. 

Toelichting: ^Kn(t?rt^ gevecht van man tegen man, 

i^^*nts straks. 



DANDANG GOELA. 



Sang Pëkik had slechts twee vrouwen. De eeue had veel kinderen, allen 
schooue jongelingen, te zamen zeven en twintig. Als men ze een voor een 
opnoemt, wordt de moeder het eerst vermeld en de vader het laatst. 

De zonen en de vader zijn allen op het slagveld gesneuveld en worden (nog) 
door velen in eere gehouden. 

Oplossing: de dertig woekoe's. 

Toelichting: De geschiedenis van Watoe Goenoeng, vorst van Giling- Wësi, 
met zijne twee vrouwen, Dewi-Sinta en Dewi-Landëp, van welke eerstge- 
noemde 27 en de tweede geene kinderen had, is overbekend. Evenzoo, dat 
de 30 woekoe's naar deze 30 personen genoemd zijn, waarbij Sinta de eerste 
en Watoe- Goenoeng de SO»*® woekoe is. 

9J^Ü9fmêatJ|^ = dc schoouc (waarmcê de vorst Watoe-Gocnoeug bcdoeld wordt). 

O • o o ..• o o O cy o » . o y^ 

. o 

Een groote, vreemdsoortige boom wordt vermeld. Een boom met acht na- 
men, welke men beurtelings gebruikt. 

Van zijne takken wordt vermeld, dat zij niet meer dan twaalf bedragen, 
elk met dertig en sommige met negen en twintig bloemen. 

De vruchten aan de takken (zijn groepen), elk van zeven. 

Bloemen en vruchten zijn gedeeltelijk wit en gedeeltelijk zwart. 

Oplossing: het (Javaansch-Mohammedaansche) jaar. 

Toelichting : De acht namen doelen op de jaren van een windoe. Verder 



— 46 — 

worden de maan-maanden van 30 of 29 dagen en de woekoe's van zeven dagen 
bedoeld. In de 9^® en 10^® pada-lingsa denkt de dichter aan dag en nacht. 

De takken zijn de maan-maanden: 

de bloemen ^ „ datums; 

de vruchten „ „ dagen der week. 

«m 'h «m 'T) «j» 1 frn»jnu^Mnx:n*jn»o'rt3s$utunrL»y mlu»o Jo^i^ «o co «ji mi An«* feif J 



Vgf broeders worden vermeld ; hanne bekwaamheden zijn zeer verschillend. 

De macht van den l^n is, dat hij het vermogen bezit om volkomen te ruiken. 

De 2« heeft het vermogen om tehooren. 

De 3® heeft slechts de macht om goed te zien. 

De 4e neemt kennis van alIeS; wat voelbaar is. 

De 5^ kent het verschil van al de smaken. 

Als ze gescheiden worden, ontstaat er een gebrek. 

Oplossing: de vijf zinnen. 

Toelicliting: M>&\ = eene toovcrformule om iets bovennatuurlijks te kunnen 
verrichten, 
êjêmSi\ KI van o,t3cn% 

tjiKnut»jfjA§r>ê\ van iun»»»^\ 
• o o 

Kr worden een groot aantal broeders vermeld; hunne namen hangen af 
van de kleeding. Talrijk zijn hunne bedrijven, als men ze alle vermeldt. 
Telkens veranderen zij van kleeding. 

Zij dooden en worden gedood. Naakt zijn de genen, die dood zijn. 

Als zij leven, willen ze hunne broeders niet kennen en leggen het er wer- 
kelijk op toe om elkander in hun vrijheid te belemmeren. 

Oplossing: de twintig letters. 



— 47 — 

Toelichting: De 6e en 7® pada-lingsa doelen op het gebruik van de pa- 
sangan's en het teeken palen. 

De 8^y 9e en 10^ pada-lingsa doelen op de ietterS; die pasangau^ noch pa. 
tèn bij zich hebbnn en dus met vollen klank worden uitgesproken. Houdt 
men één te lang aan, dan geschiedt het ten koste van een ander. 

A»#«^ = ctTi^s = bedoelen; het er op toeleggen. 

^ O • et o o ._ ooo o. 

&4J»^iunAUièjiw?»'yi\ njt^foStHivnTtcTiÊJiiunMtnêmx »<n êsn 9m Mn m ^Kmêo \ fa^a 
• o 

Zij; die eendrachtig zijn in het werk; worden vermeld. Zij hebben een 
groot huis in de hoogtC; met een ontelbaar aantal deuren. 

Zij leven eensgezind. Hun huis is in kleine kamertjes verdeeld. De bouw- 
materialen voor het huis komen uit den mond en de diensten daarvan zijn 
onmisbaar. 

Indien zij geplaagd >vorden, gaan zij gezamelijk steken en de këris blijft 
achter in de wond. 

Oplossing: de bijen. 

Toelichting: De 8« pada-lingsa heb ik als boven vertaald, omdat men in 
het dagelijksch leven ook hoort zeggen: ü-r^êsn ^Siynêmip^MoQw^iAênM ^ dsit 
boek bewijst vele diensten. 

KTttmmy ^ ê}n<fn<m\ = t/ii«c«4n\ = plagen. 



O o. 



•fn»sn\ — tninriêoê^ 



^Klnfo\ =* «snisnm 

(StJL (^•^**'*'^-^*^"^7'*"^"^*^r «ywwirjiy tjii ru IJ ton #o»óifu»tfj.m \ &ênmn9<n^&ajnin 

«oirMf «jMiil'>it^rmA«'n\ •*'n*jnqinMunu^tnir^*rnMêp»mfnrvi^\ ^m'^r\>(nta3hu\y^%Ztnn\ (fOêa 

Een prabajaksa op twee stijlen heeft acht deuren en (nog) één, waarvan 
de vleugels van hekwerk voorzien zijn (de mond). 

Drie zijn vleugeldeuren (mond en oogen); twee er van dienen om er door 
te kijken en één om lessen te geven. 



— 48 — 

Twee zijn djamban^s. 

Twee deuren dienen om geluiden op te vangen. 

Twee dienen om geuren op te nemen en z^ijn van binnen met onkruid 
begroeid. 

Oplossing: de negen openingen (van liet menschelijke lichaam). 
Toelichting: ^cn MM êoi^ = het vrouwenverblijf in de kraton. 

Het is mij niet duidelijk, welke redenen de dichter gehad kan hebben 
om het menschelijke lichaam zoo te noemen. 

Het hekwerk doelt op de tanden. 
»Mcnf<n^8:x = ccu pagiir mct opstaande punten. 

êOitAtsn^Y (vechtende kapellen) = vleugeldeuren. 
KnKn^mntna^ is eigenlijk een opening door ingraving gemaakt, 

•n/f»' '^^ 9jitn\ 

^ » o o. o o o o oOo. • __ 

o o C"^ C) Q. o o o y o, o. o o_ 

o o o Q. . Q Q o Q Q , Q. y f 

. o 
n tnrt ton «tv i.i êom 



o o . 



De vijanden van de bloem der schoenen zijn ontelbaar en zitten reeds in 
de ge\aügenis; zij worden overgelaten aan den god van het vuur. 

Na een geruimcn tijd worden ze uit de gevangenis gehaald, in eene andere 
woning geplaatst en gebaad. 

Daarna worden ze weer overgebracht naar de eerstvermelde gevangenis. 
Vervolgens komen ze er uit in den vorm van een nandjoeng (rijstmandje). 

Oplossing: iemand (eene vrouw), die rijst kookt (in een koekoesan, die 
In een dandang geplaatst is). 

Toelichting: De dichter spreekt van vijanden, omdat de vrouw er zooveel 
moeite mede heeft. De tweede zin doelt op het overstorten van de rijst, welke 
als dan met kokend water overgoten wordt. Deze bewerking c»^l^ dient om 
de rijst zacht te maken. 

«k«Tl»0'r>\ voor (CÈi^nritmMmx 



«igt-n, = 


^ »jitJintJiJdi% 






êji %n rrn ^ 


\ van iui(rrn^\ 


— ê^(m^ 


\ 


\êA»jiêjn\ 


O . 






"1^/' 


= •JttJtnaji.i*'^ 






«St^»0|\ 


o o 

IJ» »ji tmê \ 90 tin \ 


a^i. 



— 49 — 



._ o O o o. o /" 



ijn httis ziet er niet aantrekkelijk uit en veroorzaakt wel eens tegenzin. 
Alleen hetgeen er zich in bevindt, bewijst ons vele diensten; alle menschen 
zijn er mee ingenomen, aanzienlijken, geringen en vorsten. 

Groot is zijn invloed en het is in staat ons tot het slechte en het goede 
op te wekken. 

Als wij het niet bezitten, zijn wij werkelijk verdrietig. 

Oplossing: geld. 

Toelichting: De eerste zin doelt op de onooglijke geldzakken, die van 
«snoouMx het bekleedsel van den kokosboom, ter plaatse, waar de bladstelen 

uitschieten, gemaakt zijn. 

HnntMMitjÊ\ voor iaiiuuinvn(tJt'h 

In ^•ntsn- is ^N = «^-Dm w. •-: 

«,.^«o|> = ^•rtcn> = opwekken; van «n5iu ,. 

»jnÊAM\ 18 nier ■= (cn<f<a tm*fi 
o o o 

o. o o. 

. y^ o o Cy . /Ooo o. • / 



.0 o O 



% 



Het juweel der vKouwen slaapt onaigebroken eu ligt in volle lengte, uitge- 
strekt, op den rug, in hare legerstede. Nooit spreekt zij ; het is, alsof zij 
dood is. 

Gedurende haar gansche leven heeft ze geen man en toch is het genoemde 
juweel der geuren nu en dan zwanger. Als zij een kind ter wereld brengt, 
vliegt het weg als de wind en brengt verderf aan hem, die er door getroffen 
wordt. 

Oplossing: een kanon. 

Toeltchting: »oi«m«n\ =-- ^mM£l(m^^ = onafgebroken. 

o. - _^ 

^ o .... 

Verh. Bat. Geo., Deel XLIX. ?• 



— 50 — 



»f$sni'»'ntaj\ IS 660 benaming voor een schoone vrouw. 

Het komt voort uit den grond of uit de lacht; er zijn vele soorten van. 
Het is uitermate sterk en kan door nauwe openingen dringen. Als het uit- 
gelaten is, kan niet iedereen het weerstaan. 

In de geheele wereld is het gebruik er van noodzakelijk. 

Het iS; alsof het geen waarde heeft, maar, als het er niet is, geeft het 
moeielijkheid. 
Oplossing: het water. 

Toelichting: fn^tutMa^ = «oi&«o>«n«% 

^\^9f^v:%ÊV^J^^ === door ocu kleine opening dringen. 

Bekend is de uitdrukking: w^^% ^tK9njt3nKi£ntiA^\ = op alles een middel 
weten te vinden. 

SA^êTnvtidMtm^s ss kiozeu dengene, die het wederstaat =s niet iedereen kan 
het wederstaan. 

w%%Mfi3tn%n^n9vi^tauu§nji\ «x w«o'ri«nic>n|^«jii%> iu»cj'tAiaiMam«oif«^{^ Sh9Ky^9Jiu»'Y\9»jiy 
n(Uiff90HU§m^ên.jnMJk^aa»ê\ Ann&amiütf^êa^ên^tsntJtêJt3i\ iunfpm»<Ji^Èjn&nê0.jnÊSn\faê» 

Ik geef u een raadsel op, dat uit vijf lettergrepen bestaat; het is de naam 
van eene onbeduidende bladsoort. 

Als de voorste twee lettergrepen genomen worden, is het de naam van 
iets, uit de zee afkomstig en dat door alle menschen gebruikt wordt. 

De overblijvende drie lettergrepen beteekenen het loon (de rente) bg het 
uitzetten van geld. 

Oplossing: oejah-oejahan. 



— 51 — 

Toelichting: Deze bladeren worden door de doekoen als geneesmiddel 
aangewend bij vrouwen, na een bevalling. 

i^«L«arn4/iio«^*n|% c«its»«/y«ü«at«S»{4%ci'n\ «Bii«Mif|oin«o«n»S'n\ iu»if«sni«sn«A«j»^Ki|\ «m 
fItsntSnKnéAêOêt iunnj»*jntv»% 

Er is weer iets, dat ik weet; het is een woord van vier lettergrepen. 

Als het gehalveerd wordt, is er geen onderscheid in beteekenis tusschen 
de voorste twee en de laatste twee lettergrepen (nl): een dier zonder pooten. 

Als (de deelen) niet gescheiden worden, is de beteekenis: de hoofdnerf 
(wervelkolom), die zich op den rag van het lichaam bevindt. 

Oplossing: de ruggegraat. 

Toelich ting: AMnjiênjx = «/n k» % 

•jnioi/nm\ ^= ojuns ^= hoofdncrf (hier: ruggegraat). 

. o 

Er wordt vermeld een groote stad ten oosten van Soerakarta; de naam 
bestaat slechts uit vier lettergrepen. 

Als de voorste twee lettergrepen afgescheiden worden, vormen ze een kawi- 
woord, dat beteekent: niel bang zijn voor goden en reuzen. 

De laatste twee lettergrepen zijn de naam van een dier, dat in het water 
huist en (ook) op het land kan loopen. 

Oplossing: Soerabiga. 

Toelichting: &wx s= «^«01^^ 

U/ o. y <%» o Ci o oo.» 

00.00 0.0 o. 00. ^ 

Weer een woord van vier lettergrepen; het is de naam van een vogel, die 
zich gaarne in het water ophoudt. 

Als de voorste twee lettergrepen genomen worden, is het de naam van 
een bedekking van bet lichaam ; er zijn vele soorten van (die bedekking). 



— 52 — 



De twee overblijvende lettergrepen (beteekenen) een voortbrengsel uit het 
plantenrijk en het dient ook om stoffen met elkander te verbinden. 
Oplossing: sandang-lawé (een steltlooper met grauwe veeren). 

Toehen tlfig §nt»ninA\ = «••omiva^ 

^^y, = soldeersel. 



«i^\— ■•«•^?^^ 



i^'rïtsntsn^fmv «i;i»ncfl«iAi«jf«m'ri#oï A\ 9f êam Miru ^ *u om a mms iSi«^^4jv^A itj«A|\ ff-yt^Aim 

Er is nog iets, dat ik weet; uok een woord van vier lettergrepen. Het is 
de naam van een klein mensch; zijn werk is achter iemand te loopen en 
alles te doen, wat (zijn meester) verlangt. 

Als de voorste twee lettergrepen afgescheiden worden, zijn zij de naam 
van de haartjes, die overal op het lichaam verspreid zijn. 

De laatste twee lettergrepen zegt men van vogels en land-dieren, die 
aan de menschen gewend zijn. 

Oplossing: woeloe-tjoemboe (panakawan\ 

Toelieltiifig: Als een panakawan eene reeks van jaren bij dezelfde familie 
gediend heeft, wordt hij door de familie-leden woeloe-fjoemhoe genoemd. 

é§' van ^^. = l^ltyt"^ 



o 



«riAx verkorting van MiAiü»È\ 

nMtMnêfr}\ voor njimj»§ni^\ 



KI. van 



me* ivi. >£iii TtfêÊsnêt 



/^ Q. o (?) /o. o Q. y o, o . o o. 

tüf<n<LXk%n.jn»JkêaÈ\ ftn*o«sniij»'Yjt^^tJ]^\ "n%n^^^jkên9Sii9\Apnn\ w%kAM^a.^Q>»\*<nta%jukMÈ\ 5^'^ 

utmaSnatMiOÉt mn win x/n 9ij»\ 

Ik behoor eigenlijk tot de grassoorten. In de groote wouden is mijne 
plaats en in de vlakten. 

Mijne taak is, als bedekking te dienen op een huis. Mijn naam bestaat 
uit vier lettergrepen. 

Als de voorste twee afgescheiden worden, beteekenen ze de tegenstelling 
van oedjoei' (in de lengte). En de laatste twee lettergrepen beteekeuen 
preeies hetzelfde. 



— 53 — 



Oplossing: alaDg-alang. 
Toelichling: tsnQx ^^ 



ajt»jtÊ:7tê% 



xAtn»\ = dwars, in de breedte. 

feifl «J*^t»J»M^»<3»aOT«i>iorn€<tr&^\ cs^&t|il|ot'^(ma«>ft^nrn« êat*/nintpni(mniM^9iA'ri0f»n\ 

Er wordt weer een woord van vier lettergrepen vermeld; het is de naam 
van een groote deur, die toegang verleent tot de kraton. 

Als de voorste twee lettergrepen afgescheiden worden, zijn zij een kawi- 
woord, dat de naam is van uitmuntende werktuigen, welke men in den oorlog 
gebruikt. 

De laatste twee lettergrepen vormen ook een kawi-woord, (dat beteekent) 
de bron der gedachten en (die) een booze natuur (kan) hebben. 

Oplossing: bradja-nala. 

Toelichting: ^«^% vindt men in de woordenboeken verklaard met if^mmMi^ji^ 

doch het is eigenlijk een steekwapen en kan dus zoowel ^%ik4|> al8«s»«««rN|^ 
beteekenen. 



êonê\ = imtsn\ 



^snl^J^ verkorting \Sai ajnas» ^t\ 

MCMA \^u^Mjncniü/h tot 90 MJt 9a <rm\ ét»*^»o9A»nêJi§jnm9Cinm\ rumjt»r>3tM9Ji^t»§n9f*n\ 9a»êfnfu^ 

o 00.0.0 o. q, , o r 

.o Q 

ffrmasnc}MAt^li^ tj» mr êj» km 9aiÊ'\ 

Er wordt een groot rijk uit den ouden tijd vermeld; de naam is een vier- 
lettergrepig woord. Als de voorste twee lettergrepen afgescheiden worden, 
zijn zij de naam van een vrucht met een lekkeren geur, maar die niet tot 
de fraaie soorten behoort. 

De laatste twee lettergrepen zijn de naam van een onaangenamen smaak. 

Oplossing. Madjapait. 

Toelichting: •oi.oiui is hier met onaafUfenaam vertaald, doch beteekent 

eigenlijk gebrekkig. Men zegt bijv. Tjtj^tnarnaijA^fn&fc^&u&^i 



— 54 — 






Ik ben eene plantensoort; die er fraai uitziet; en bevind mg op de bergen ; 
mijn naam bestaat slechts uit vier lettergrepen. 

Als de voorste twee afgescheiden worden^ zijn z\j de naam van een zeer 
nuttig gewaS; dat door iedereen gebruikt wordt. 

De laatste twee lettergrepen zijn een kawi- woord, dat twee beteekenissen 
heeft: sijoeng (slagtand) en wadah (doos; of liever alles, waar men iets in 
kan doen). 

Oplossing: pari-djata (naam van eene soort kleine roode vruchten). 

Toelichting: De opmerking in het Wdb., dat deze schoone, doch niet lek- 
kere vruchten door zwangere vrouwen gegeten worden, in de hoop daardoor 
een schoon kind te zullen krijgen, is juist. Om dezelfde reden wordt in die 
periode ook de £n^êJittJ^^ een vogel met geele veeren, gegeten. Geel is nl. 

de schoone huidskleur bij uitnemendheid. 

Er is weer een woord van vier lettergrepen. Als de voorste twee worden 
afgescheiden, beteekenen zij iets, dat licht geeft en grooten invloed heeft. 

De laatst twee lettergrepen vormen een kawi- woord, dat beteekent: wamt 
(gedaante) en gocloe (hals). 

Als de lettergrepen niet gescheiden worden is het de naam van een werk- 
tuig, dat gebruikt wordt om vuur uit de lucht te halen. 

Oplossing: een brandglas. 

Toelichiihg: 4::mum\ := m^»^*»^ 

«mfftx dikwijls 00k«nt{A = ff^&% 

by samentrekkiDg van ^&% 



-&5 - 

fetff ^^^^SêêJta^om&Mdüis êntmüêffjt&UM^étnemêuy «^diM«n.MC««£^t&^«nf ^i/ii\ MOt 
• o. o o 

Een fraai kleedingstak wordt vermeld; dat niet iedereen mag dragen; 
het wordt om de middel gedaan. De naam bestaat nit vijf lettergrepen. 

De eerste drie lettergrepen vormen een kawi woord ; het is de tegenstel- 
ling van langit, en ook een uitgestrekt stuk land^ dat door water omgeven is. 

De laatste twee lettergrepen vormen (ook) een kawi-woord, dat de naam 
is van een hoog begroeid stuk land. 

Oplossing: mandela giri=seen oejét van gele zijde, die alleen door prin- 
sessen gedragen wordt. 

Toelichting: êJi&êAM^\ = alledaagsch. 









(S£fL «Ji^A'nM4n»t'fta«i^^(m(mi> guM^^j*jt^^'un&MJtarm\ •JnimA(mtM»mjA'nm»n\ mm« 
•n^jtêJt^êntwiA^iBtMJUÊnjix nip%iutfUia»iLa(pin^A»»nj\ oarm«9«^(mt«amtMi4tOtfn|> witnmHi&êfm 

De letters van den naam van een groote deur en van eene melodie van de 
gamelan en (ook) van een fraai batikpatroon vormen vier lettergrepen. Als 
de voorste twee afgescheiden worden, zijn zij de naam van een aardvracht 
en van eene bladsoort. 

De twee overblijvende lettergrepen zijn de naam van een witte bloem, 
die een aangenamen genr verspreidt en waar vrouwen en mannen zich mede 
tooien. 

Oplossing: gadoeng mlati (naam van de derde achterpoort van de 
kraton te Soerakarta). 

Toelichting: wfojnens = c|«m{% 

£r is een zoete vmcht ; de naam bestaat uit slechts vier lettergrepen. Ala 



— 56 — 

de voorste twee afgescheiden worden^ zijn zij de naam van een werktuig om 
. , het haar in orde te brengen, alsmede van een weversgercedschap en van de 
haren aan den hals van een paard. 

De laatste twee lettergrepen beteekcnen hetzelfde als mèmha (gelijken). 

Oplossing: soerikaja of srikaja. 

Toelichting: ojt^^. = 1« een haarkam, 2« een weverskam, 3« de manen vau 

een paard. 

Gewoonlijk bedoelt men met «^-^x een tljne kam om het haar van bees- 
tjes te zuiveren, terwijl af?»o}«9i^x meer een kam tot sieraad is. 

De dichter heeft in dit raadsel het woord i^oA^ gekozen voor den schijn ; 
in proza zou hij -rvf «^^ gebruikt hebben. 4^»^^ is het meest bekend in 
de beteekenis van xm^^têi = de haren op de slapen van het hoofd 



CK. 



M£l««\ ^= Wt€/» fAUl\ 



c}A f o 0.O0.00 o •V'o. ö o/_ o 

v3IML *^^*^'^*^-^"^y'7*-*''^*^^ »Ji^9^êO'Yi^a/naci9Sn9ruam\ ntAJÊ9n^jiêjt^ên9nA^ast%:Mqên\ en 

y Q % O o. o a y o Q 00. r 

De letters van den naam eener melodie van de gamelan vormen vier 
lettergrepen. 

Als de voorste twee worden afgescheiden, is de beteekenis gelijk aan béreg 
(voortdrijven) en, als het ecu kawi-woord is, ann pcksa (iemand geweld aandoen). 

De twee overblijvende lettergrepen (zijn de naam) van een werktuig, dat 
dient om het vaartuig te besturen en de richting aan te geven om voortdu- 
rend te (kunnen) varen. 

Oplossing: soeroeng-dajoeng. 

o o o. o. o o Q O . o» ^.« 

Er wórdt een waterplant vermeld, waarvan de letters vier lettergrepen vor- 
men. Als de voorste twee genomen worden, is het de naam van iets, waar- 
van men gereedschappen en huizen maakt en dat men ook verbrandt met 
eeu zeker doel. 

De laatste twee lettergrepen beteekenen een ingrediënt voor dé betelkanwers. 

Oplossing: kajoe-apoe (een soort livierkroos). 



26. 



— 5? — 

Toelichting : tft^ot^^ Deze pass. vorm wordt ook wel in gewoon Javaansch 
gebroikt; doch luidt dan meestal «j«nit^> = «^fmto^i^f^ 

0|M0fênmn^ De «»\ dient hier alleen om het aantal lettergrepen voltallig te 
maken. 

t>»8i«2i' kf- ^^^ A/n«a' = bestanddeel. 



f/gêê &&nji^AMjtê£C0sn&M&\ MJt^t^Tiêjf^^jtéiSbftms 9fUMên3êJt^êmA^ovAtiên\ vfAi 

Het ontstaat uit staal en ijzer ; de letters van den naam vormen vier letter- 
grepen. Als de voorste twee afgescheiden worden, beteekenen ze hetzelfde als 
mofujsa en ook nalika en wantji of ook den naam van een werktuig om vogels 
te vangen 

De overblgvende twee lettergrepen noemen het stggen uit eene rivier (na 
een bad). 

Oplossing: kala-méntas = zware roest. 

Toelichting: »mrus = l^ tijd; 2« strik om kleine dieren te vangen. 

Er wordt een kérisvorm vermeld ; de letters van den naam vormen zes letter- 
grepen. 

De voorste twee zgn de naam van een vogel. De twee daaropvolgende 
lettergrepen zijn de naam van alles, wat men in den vreemde nóódig heeft. 

De twee overblijvende lettergrepen zgn de naam van (een hoop) rijst in den 
vorm van de tjitakan (hier een koekoesan). 

Oplossing: cy^lak^sangoe-toempéng. 

Toelichting: i^^bo-nioix «s op reis. 

*a(raw^ ™ *5f»^J2l^ = de vorm. 

|C»4&iS«|i2|f 9f9ji90iamtio»^Atruji% 

Ymk. Btt^ Gen., OmI XUX. S. 



28. 



— 58 — 

Een dier, dat in het water leeft en tot de onbeduidende (dieren) belioort, 
heeft een naam van vier lettergrepen. De voorste twee lettergrepen beteekenen 
hetzelfde ale djodjah (een stok om te steken). 

De laatste twee lettergrepen zijn iets, hetgeen alleen de vrouwen hebben; 
de plaats er van wordt zeer geheim gehouden, zoo slim, dat het niet gezien 
kan worden. 

Oplossing: sogok-itil. 

Toelichting: Volgens het Wdb. is vi%jt%iifm%êmS»An*Bs een kruipend water- 
insect; dit is onjuist, het is een klein vischje. 

Het woord tun£,u*M is plat. Ook in deze samenstelling gebruikt men in 

fatsoenlijke kringen liever (««kyi 

o o. Q O. «o/noo. ^A • o. . 

o o. o. r>.. /^ a. * o o . f 



De letters van den naam eener vrucht, waarvan vele soorten bestaan, 
vormen vier lettergrepen. De voorste twee lettergrepen zijn de naam van iets, 
dat gebruikt wordt om allerlei dingen vast te binden. 

De overblijvende twee lettergrepen zijn de naam van iets, dat zich in het 
lichaam bevindt en oorzaak is, (dat de menschen zich) kunnen bewegen en 
spreken. 

Oplossing: tali-djiwa. 

Toelichting: Deze vrucht is eene weinig voorkomende, doch bijzonder lekkere 
manggasoort, welke dikwijls nj*Zi^*j»s genoemd wordt en als zoodanig ook 
in het Wdb. voorkomt, 
cjen-h» verkorting van •^^tai'hi 

ci«o\ voor mfSt% 



o 



ySUL 7'**S'.S^**'^*"'^***^^* to«o|o#A/mn^»ftrni»j»rt\ «^^i^t>n^t«j£«&«f«m\ 

Er is weer een woord van vier lettergrepen. (Het is de naam van iets), 
dat behoort tot de kleedingstukken ; mannen en vrouwen gebruiken het; diïe 
voni ia vierkant» 



— 59 — 

Als de voorste twee lettergrepen afgescheiden worden, beteekenen ze het- 
zelfde als eloes. 

De bciie overblijvende lettergrepen zijn de naam van iets, dat dient als 
middel om kwaad te doen en iets aan te vatten. 

Oplossing: oesap-tangan = zakdoek. 

Toelichting: ê/n^^muiÊ gewoonlijk verkort tot «^^o*^^ is een witte zak* 

doek; Een gekleurde heet •ai«a% 

Een lekkernij; die van iets zoets gemaakt is, wordt vermeld ; de letters vor* 
men drie lettergrepen. 

De voorste twee lettergrepen (noemen) het voortbrengsel van een gewas; 
het heeft een aangenamen smaak en is de grondstof van de bedoelde lek- 
kernij. 

As de voorste lettergreep weggelaten wordt, is de beteekenis gelijk aan 
tan jafna (niet herinneren). 

Oplossing; goelali 

Toelichting »o^?»% =^iets zoets. 

a«y»i4>n A4«f «»t^ i|f/9j> fviijfM^otAitynrCTvi^ftifCv^ éjêt^uêituMênênMên»^ nunnxH'i'êmêm^^o^s 
00.0. 0.« . oou rtf)'">o / 

. o 

Er is iets, dat tot de geneesmiddelen behoort; de letters er van vormen 
slechts vier lettergrepen. De voorste twee (noemen iets), dat in de keuken 
gebruikt wordt om spijzen gaar te maken; het wordt ook gebruikt voor 
werktuigen. 

De laatste twee lettergrepen zijn een kawi-woord, dat beteekent: bojongan 
(dat gene, wat overgebracht wordt) of aking (zeer droog). 

Oplossing: kajoe-anjang. 

Toelichting: De 4y^i'];«n^r^x is een boom; het aftreksel van de wortels 

wordt gedronken ais koortswerend middel 



— 60 — 

Het woord i}c»ti}a«fft»K>|x wordt gebruikt io de volgende beieekenissen : 
Ie met zijn velen verhuizen; bijv. A/ii«mtjMit>9»o4^«üi«}tiiicim% 

2e datgene, wat overgebracht wordt bij bet verhuizen; 

3» mensehen^ die in den oorlog gevangen genomen zijn en weggevoerd worden. 

In de laatste beteekenis treft men het aan in de wajangverhalen en de ba- 
bads. Ak bijv. een vorst in een vreemd land een overwinning behaalt, brengt 
hij de vrouwen naar zgn eigen land over. Die vrouwen noemt men dan 

De active vorm Aju^*MtëfêMM$^ eischt een object, bijv. ^«^(t^n^Mii^tiiitAva^M» 
«ntrufx = de vijanden voeren de overwonnenen weg. 

êJt.:M'rt9jtêA Matte \ ên»8itmtSt^tsnêJHtnÊm»0iêOtmém&\ «rc|«^.ai'nt>vi«jairt (fgÊê 
gtsnén&éJiHiÊt oftui^m 

Er is een witte^ welriekende bloem; de letters van den naam vormen drie 
lettergrepen. 

Als het (woord) in zijn geheel gelaten wordt, beteekent het een bedekking 
van de tanden hebben. 

Als de voorste letter weggelaten wordt, is de beteekenis een bedekking van 
de tanden: en ten tweede is het een kr&m&-woord voor het zwartmaken van 
de tanden. 

Oplossing: malati. 

Toelichting: njt^\ EI van #l«i^««% 

ggnn^s =s lippen hebben. 
2<» gu^y Ej*. van &&imji% 

oaiC\ KI van »jnfn\ 

34. O^ÊÊ nMnjuük^Sh^mtmA&in^fnts utf^êS'y^êJt^^Jteln^Sitmy «sn»/>^«^a^o|n^e»f^Mi\ A 
ên»êm^^&iaaAMiOji\ •Jtêjt&^iênêatsnên^êJtfSx tmtsn&tsnta^^^Êsntjn^ ^fêjntjênAtfmtmfaênjf^ 
êfnêota&^tbÊtmAtCkfgtaiiji'^ {^&êm^AnÊmÊM^^cmêmtsn^tsn&\ c|Mi%^ciA«n\ fai| 
flKntfnÊS9éM90Èi «JMOfni 

Een toespgs bij het eten wordt vermeld; de naam bestaat uit vier letter- 
grepen, waarvan de letters alle zonder sandangan's zijn. 

De twee voorste beteekenen hetzelfde als datanpa sang li of tan pnd^éda (geen 
verschil, gelgk). 



— 61 - 

De overblgvende twee lettei^repen (beteekenen) naderhmen en de tegen- 
stelling U moendoer (achteruitgaan). 

Oplossing: pada^mara, naam van een gerecht, dat uit een groot aantal 
ingrediënten bestaat 

Toelichting: Deze benaming is zeer gepast, omdat «4«jic««n% letterlijk be- 
teekent: alles komt bij elkaar. 



* \3tL ^^'^H^Sn'^^'^^'^^^^ £^é^*jm&êat^UMêmêjtw\ Mi^«u<m«>itam.at'ri^M«% «m 
n|\ êht9twA^AmftAtük^mmÊ\ •JtAêJt»mMt^A^êumimim»2Ê\ Zut^Amuêcn-nmttj^ ktïÊ 

De letters van den naam van eene bladsoort, welke dikwgis als genees- 
middel gebmikt wordt, vormen vier lettei^repen. 

De voorste twee lettergrepen zgn een. kawi- woord, dat beteekent: wangi 
(welriekend); ten tweede Aon/oA (Kr. van borèh), en ten derde: (^ècfóf fmoskns). 
De laatste twee lettergrepen (beteekenen iets), dat voortkomt nit bloemen; 
dikwgls dient het als geneesmiddel en het wordt ook gebmikt voor boerat 
(boréh). 

Oplossing: vnda-sari (naam van een kruipplant). 

Toelichting: •^•X> = 1^ stuifmeel; 2« de bloem van den M»<m«^-^% 

•a»êmA^€uamc»ÊAAinjiy &ut^iSlhêfm9n»A^&tUk^\ êJt9Q9Kên3fS9êJt^*M\ êjtmifmndn»jt.a0ij^9nji\ 
• o 

Er is weer eene bladsoort, welke ook dikwijls als geneesmiddel gebruikt 
wordt. De letters vormen vier lettergrepen. 

Al worden de voorste twee lettergrepen van de laatste twee gescheiden, 
toch is de beteekenis (der beide deelen) gelijk, (nl.) het woord, (dat gebruikt 
wordt) door menschen, die iets vragen. 

Als de vier lettergrepen in hun geheel gelaten worden, is de beteekenis: 
barang-barang (het een of ander). 

Oplossing: apa-apa (naam van een lagen heester). 

Toelichting: Deze plant is vrij algemeen bekend. Als men op reis gaat, 
steekt men een blaadje achter het oor, als voorbehoedmiddel om niet een 
of ander ongeval (apa-apa) te krggen. 
stam^ix Kr. vaQ£/lfi 



— 62 — 

Een pasanggrahan onder Soerakarta wordt vermeld; de naam bestaat nit 
vier lettergrepen. De twee voorste lettergrepen (beteekenen) de plaats^ waar 
de wilde dieren en de vogels zijn. De twee laatste lettergrepen vormen een 
kawi-woord, dat dikwijls gebruikt wordt; het beteekent: een overal dicht 
begroeid stuk grond; dat uit de verte zichtbaar is. 

Oplossing: Wanagiri. 

Toelichting: In dit en het volgende raadsel bedoelt men met pasanggra- 
han een luslverblijf van den vorsl, zooals er in vroegeren tijd te Wanagiri een 
was en ook te Karangpandan. Tegenwoordig heeft de Soesoehoenan een 
lusthnis te ^S«o^«c« aan den Bangawan, terwijl dat van Mangkoe Nagara 

te tui§a»mMjÊ\ is. 

Ofjfl^ <t >.»f j^ff»/>^ioti<mt>ny»<yng>trL»^^ t>»iyii(trw<m/tMty«k»>|TT«»itgi\ 9Jt*>H»utmkjn9mj*'y*9fUi\ 

Er is nog een pasanggrahan^ ook eene onderhoorigheid van Soerakarta. 
De letters (van den naam) vormen vier lettergrepen. 

De voorste twee (beteekenen) een groote rots in zee. De overblijvende twee 
lettergrepen zijn de naam van eene bladsoort^ welke als mengsel bij ver- 
schillende bloemsoorten gebruikt wordt en een eenigszins aangenamen geur 
heeft. 

Oplossing: Karangpandan. 

Toelichting: ^7*^^ voor^«c«5i% 

•MAjicrms = <»a?nAi^n\ = vcrschillende soorten. 

mé9p\ 01 n&têps =^1*01 



— 63 — 

De letters van den naam van een desa onder Soerakarta vormen slechts 
drie lettergrepen. 

De twee voorste lettergrepen zijn een Javaansch ngoko-woord en de naam 
van een boom, die in het bosch groeit. Hij (de boom) bewijst vele diensten 
en wordt door de bevolking van bet geheele land gebruikt. 

Wat de laatste lettergreep betreft, zij is de tegenstelling van sepoeh (ouA). 

Oplossing: djatinom. 

Toelichting: é»rn^\ = M»ên% 

-^^--O— o o. ./^o o. o ^.o o.oOOo f ^ 

• o 

Er is weer eene desa; de letters van den naam vormen vier lettergrepen. 

De twee voorste (beteekenen) een nuttige vloeistof, die door alle menschen 
gebruikt wordt. 

De twee laatste lettergrepen beteekenen wèvcèh (geven). Als men de voorste 
en de laatste letter (van het woord) wegneemt, is de beteekenis (van het 
overblijvende) ngiratigi (verminderen). 

Oplossing: Banjoedana. 

A'X f C^ » /^ o. o o. o o r% Q. o. • o c 

.V' . y^ o. O * • ^ o « o o. e% , /^ o /^ 

êo tüi 4SH t/n nrrt* éA Kmji 94 uêji arm fj ét/n ta\ nutnio KJt*<r*^fii-n\ «o «Ljrmc/if tif n> mtiMfhint/utsn 

O n ri / o. o: O ' 00/ 

•ji^tnfMX Msn(m»Ji.iMt»MiAMntanênijnHnun4j»ên9\ êjÊnrtêjntsn-DKUtpMy f CTj fl 

o o 

Weer een woord van vier lettergrepen en ook de naam van een desa. 

De twee voorste (beteekenen) eene plaats met eene groote hoeveelheid water, 
dat afkomstig is van bronnen en bergen. 

De twee overblijvende lettergrepen beteekenen als kr&mS- woord kar ja 
(maken) en als kawi-woord perang (oorlog) of wisma (huis). 

Oplossing: Ealijasa. 

Toelichting: Omtrent het gebruik van ^••Jt\ in hedendaagsch Javaansch 

moet worden opgemerkt, dat het als krhmh van «m «^ o ^ alleen gebruikt wordt, 
als men spreekt van groote voorwerpen maken '^ anders gebruikt men tn£itu|t 
Het wordt echter steeds als ELI. van a*»f o% gebruikt. 



— 64 — 

VStL ^**^S'^lX*^^*'^<'^^^V ^•^^«9cvic««A0üfijtaio«x9% êjtwf^t^9^Sên^ên^ifMM\ 

• o 

Er is weer een woord van vier lettergrepen. Alleen de menschen hebben 
het en het bevindt zich onder aan den arm. 

Als de voorste twee lettergrepen van de laatste twee gescheiden worden, 
is er geen verschil in beteekeuis (tnsschen de beide deelen), nl. ietS; dat be- 
hoort tot de mans-kleedingstukken en dat om den middel gedragen wordt, 
op den houvast (de saboek) van de kain. 

Oplossing: èpèk-èpèk = de handpalm. 

Toelichting: <}t/»«^o«oif. == de riem, die op den bnikband gedragen wordt. 

Ajfonffm&nnoN VOOr utxrmtéi&nr^&is 
ucnmncttjiariÊw ê/ni» arn ^ii tn»Ê% 

Weer een woord van vier lettergrepen. Als de voorste twee lettergrepen 
afgescheiden worden, is er geen verschil in beteekenis met de laatste twee, 
(nl.) de naam van alles, wat gebruikt wordt als roerwerktuig om iets te mengen. 

Als het woord van vier lettergrepen niet gescheiden wordt, noemt het de 
afstamming in den zesden graad, gerekend van het kind. 

Oplossing: oedég-oedëg. 

Toelichting: êjÊ^taa^x «= onverschillig wat; bgv. •jifuii»(M«3bi\s=seenmensch, 
onverschillig wie. 



POETJOENO. 



1. /gMjff •*'» & êqtjki^x êJt^êAMem&»U9sMmM»n\ kntan^êm&ctMtoji^ ^lutênSitsn^ajÊêMMMM&y tjn 
ycntanÊStiJtêOjn tüÊtst§»gut90ê\ 

Hetgeen vermeld wordt^ heeft een schitterenden, stralenden glans; in de verte 
is het zichtbaar. Als men dicht bij komt, wordt het hoe langer hoe mooier. 
Het kan opheldering geven omtrent een geheim, dat niet te zien is. 

Oplossing: een spiegel. 

Toelichting: m<|«^> M^^'^f^'^Si^ 

• o 

Het wordt hoe langer hoe grooter, als er iets afgenomen wordt. Als er 
iets bijgevoegd wordt, wordt het hoe langer hoe kleiner.. Waarlijk! het 
schijnt onmogelijk, maar het is (toch) werkelijk zoo. 

Oplossing: een gat. 

Toelichting: 9jtê/iênfÊs = •:»êJiuM% 



\3UL ^*'^*^'^^'^^ « «Ji f 8 «^ ^ f nviu^an «IJ \ <|«AtM>ts»^«Sc»n^\ amajuméütafnnvnitn 



o 



t::ft9nnvkêMiun»a»êjt§omt»n^tiên*Jt\ l^Ê9 



Als het er juist is, veroorzaakt het onduidelijkheid bg het zien. Als het 
niet te zien is, (kan men) duidelijk zien. Baad nu dat, waarvan de naam 
geheim gehouden wordt. 

Oplossing: duisternis. 

vSêJt t^St^^/t^fni^y ÊatêA9^tru^*J»90êAênÊ\ mtMÊfndênjïAun.M9n\ ■isni»i|A/n«^49it<]m*fiAAiiu|\ 
C> O o . f 






Vech. Bit Gtfi., (bel XLIX* )». 



— 66 — 

Zelden heeft een samenkomst plaats van Ki Poetjoeng en zijne vrouw. Als hij 
een smachtend verlangen heeft, maakt hij het dadelyk bekend aan al zijne 
buren en schreeuwt aanhoudend, opdat zij „het paren'' zullen zien. 

Oplossing: een krolsche kat. 

Toelichting: «>mi^\ = iSi^j^ Ax voor i^«%% 

0f^9tmS»iLM0f'n9s = de naaste en meer verwyderde buren. 
miMttmpjtnix = paren 

5# U^WI itjum «sn 07 M tin •nèn n fp tarnt »n .jn r^ ma ^i^j^ éntumjurmmjurms A9JttmMfiêJtêwntJnêmJi% 
aji(nnaniêmwum9néjneM&0fiM99Jt\ UglJ^ 
HÊsnvntaiLtênjjt MM^ 

Groote bergen worden omwonden en omhuld met verschillende bladeren. 
Alleen een klein gedeelte van den voet (der bergen) is te zien. Hunne 
bronnen vloeien op bepaalde tijden. 

Oplossing: de borsten. 

Toelichting: De bladeren doelen op het patroon van de «Sfitots^ borst- 
doek. 

6 f . a/ooo oO o/^oOOo* o 

. o (^ 

Bapa Poetjoeng is stom geboren. Als men zich met hem bemoeit en hem 
ijverig beoefent, verstaat men zijn taal door hem slechts aan te zien. 
Oplossing: bet schrift. 

vStJL *^^^^^ 9J[i9sn§n»m»nêjnS^êAênjk\ êJi\»Am*pnênMrk(nty •tnnfmShntjttéJtSiaji&s A 
•tn»m9SnarnM%n*rrn»mnjtannèO'r%\ [t^Xjl 

Bapa Poetjoen heeft geen waarde; evenwel wordt hij toch door alle men* 
schen gebruikt. Datgene, waar bij bijgevoegd wordt, vermeerdert in waarde. 

Oplossing: een nul. 

Toelichting: Zij, die de inlandsche scholen niet bezocht hebben en de cij- 
fers door den omgang met Europeanen leerden kennen^ zeggen altgd ênnMês 
In de Javaaogche scholen hoort men gteeds êa^% 



— 67 — 

Alleen 's nachts komt Bapa Poetjoeng te voorschijn, met het doel om voed- 
sel op te sporen. Over dag verbergt hij zich om te slapen. Zijne wijze van 
slapen is zoO; dat hg zijne voeten naar de zon richt. 

Oplossing: een kalong. 

Toelichting: De laatste zin doelt er op, dat de kalong aan de achterpooten 
en dus met den kop naar beneden hangt. 
4n«4« verkorting van xr^^uM^ 

9/ . o o o/O^ o. * o 0.O0 

«rL§wivtnji{€Jt*j»»JiKnj^9Jtax9fnrhiKt»nÊ fayfl 
nKnêan xniJtMjit »Jin^EA^ZMt\ 

De macht van Bapa Poetjoeng is verwonderlijk; hij kan dichtbij brengen, 
hetgeen in de verte te zien is. Het is dan zoo duidelijk zichtbaar, alsof 
men er mede in gezelschap was. 

Oplossing: een verrekijker. 

NntA M«j»f«vi€jc»f > tTtv^imiLA^'t^ajitati^tnnMx ésn»aiêJit^^*%i^7t»JtriAÊ\ ijn'ry0^êanüin»acm(njt^\ 

o • o / .0 / 

tsn»onéJiajUêm§tn»*t9.uêJtêJi^ién€M§ojÊ\ i^Q9B 

De levenden verlangen er naar om het te krijgen en zij, die het hebben, 
zijn zelden vroolijk en tevreden van hart. Raad nu, hetgeen met het raadsel 
bedoeld wordt. 

Oplossing: een hooge leeftijd. 

Toelichting : aj^M\ voor êJênSh\ 



CF) n 







ƒƒ tm «>#) c;! «j ffOJs '*^1£)«^'^*^^ 



Over dag doet bij uitsterst weinig dienst. Als de zon onder is^ gaat hij 



— 68 — 

dadeiyk aan het werk. Hij spert den mond wijd open en schept er beha- 
gen in vnur in te slikken. 

Oplossing: een kaarsen-snuiter. 

Toelichting: ut^Mt^n = in«B« 

BtsnKnÊatLMifttt /orn«c« 

Bapa Poetjoeng heeft puntige; scherpe tanden. Hij snijdt hout en steen, 
maar hij moet geholpen worden. 
De uitwerking is niet noemenswaard, als er geen kracht uitgeoefend wordt. 
Oplossing: een zaag. 
Toelichting: o«^{x heeft hier de beteekenis Ysmsfiij (/eii; zooals men het in het 

dagelijksche leven meermalen hoort gebruiken, bijv. «u&f%#mi^t>ni'no«.»<«aiM|x 
= met dit mes kan men geen hout snijden. 
èis voor •/>&« 

KnÊjuy = kracht; bijv. 9f^9'r}tnwf<u^cnaAA^ =(hij) heeft geen kracht (in den zin 

van spierkracht). 

Als het gezocht wordt, heeft het een bepaalden naam; als het reeds gevon- 
den is, verandert zijn naam. 

Komt vrienden! raadt gij (dit) raadsel. 

Oplossing: een raadsel. 

Toelichting: Waarschijnlijk is hier de bedoeling aldus: zoolang het raad- 
sel gezocht wordt, spreekt men van tjangkriman en nadat het gevonden is, 
noemt men de aplomng. 

O 

«?tt^ti|«nt| K.I. van tüi'nisnji\ 

(sul *^**t'^*^'i' «^«9*^t*.ntJi«oc|Uf«\ M cji ff ^^nmiM«j» «91 N &t3t^Ai»4n GtnnêrnS\\ §%£»Sk'r% 



— 69 — 

Een vooniame doos dient als bewaarder van woorden. Er zijn er, die een 
witte en ook die een gele kleur hebben. Niemand begeert den inhoud. 

Oplossing: een kwispedoor. 

Toelichiing: Het woord fémboefig is hier figuurlijk gebruikt voor datgene, 
wat de lippen verlaat, nl. het speeksel. 

In den tweeden zin bedoelt men, dat de paketjohan gemaakt is van zilver 
of koper; in de desa gebruikt men echter bamboekokers voor dat doel. 



Rëtna ning Roem ligt voorover en is in hout gevat. Er zijn vijf, die ach- 
ter haar de wacht houden. Als Sang R^tna loopt, braakt zij bloed. 

Oplossing: het kannetje van de batikster, (waarmede zij de wasfiguren 
op het doek brengt). 

Toelichting: De tjanting wordt hier bij eene lieve vrouw vergeleken. Met 
vijf bedoeld men de vijf vingers, die het houten handvat van de kleine tjan- 
ting vasthouden. 

Met bloed bedoelt men het vloeibare was, dat uit de tuit van de tjanfing komt. 



AJ#9j> = êJt&% 



SI 

o O o ^ 

iKiM«m«\ K.I. van ^A^\ 

Er zijn er, die wit, en er zijn er, die zwart zijn; zij loopen zonder voeten. 
De zwarte doen vermoeden, dat zij na korten tijd tranen zullen storten. 

Oplossing: lichte en donkere wolken. 

Toelichting: «riM-n^x van «m^-n^ In het dagelijksche leven zegt men mees- 
tal êfnttsnm^ 

Knc|<A\ = uitstorten. 
MJtjjf^s KI. van nA^\ 



— 70 — 

Hij heeft geene bepaalde plaatS; geene klenrengeen vorm; alleen maakt hij 
geluid. 

Als hij boos iS; verwekt hij vrees en veroorzaakt ongelukken. Zelden is 
dan iets in staat hem tegenstand te bieden. 

Oplossing: de wind. 

Toelichting: ^jq-nx = ij«j-a|ik% 

«Ai\ verkorting van «%4>u% 

Als hij slaapt; ligt hij voorover en bevindt zich in de hoogte. Vele kin- 
deren zoeken naar hem; als ze hem zien^ naderen ze hem. 
Wanneer hij gevat wordt, beeft hij, zonder te jammeren. 
Oplossing: een këndëla (een soort kindjëng of glazenmaker). 
Toelichting: ong^«oi|x = fm£inMÊ\ 

V3fÈ *^^<^^*^^ axim«ai4sii«m«t«{«o»<nn|« nujt»n^nên^»mêAM\ •J»ê<%inmtA,\fsnn§nên9 9u^\ 
9fUMê{n9Jt'y* AniaAiêSi tin ma gaarne ^\ foffl 

Alleen de mond en de beide oogen worden gezien. Als hij opgenomen 
wordt door dengene, die hem gebruikt, worden zijne beide oogen geprikt. 
Dat is het middel om voortdurend te kunnen knabbelen. 

Oplossing: een schaar. 

Bapa Poetjoeng zit opgesloten in de hoogte. Als iemand hem komt con* 
doleeren (met het verlies van zijne vrijheid), overkomt dezen (den bezoeker) 
iets kwaads; wellicht loopt het op zijn dood uit. 

Oplossing: lokvogel. 

loeltChtxng : kmncnên^mnKn*nÊ\ = ^M^M*^i^ ^^ Welllcht. ^jnjntKns = •Jt&\ 



23. 



— 71 — 

Nadat Retna ning Roem gedronken heeft, bestggt zi} den brandstapel, zon* 
der te spreken en zonder zich te verroeren. Na eenigen tijd weent zy luid. 

Oplossing: een ketel of een ander voorwerp, dat, met water gevold, op 
het vuur gezet wordt. 

Toelichting: •ft^k^o^S'^^ ^^ «jfcaif«y».j!«% 

t^njifoix brandstapel. 

HKmiAi&tAMit ii ijnctinên a^ênj% 

Een groote tëla met vuil water zonder visschen; en de dingen, die er zich 
in baden, veranderen stellig oogenblikkelijk van kleur, als ze er uitkomen. 
Oplossing: een blanwververskuip. 

Toelichting: ^unÊa§m\ = cnon^ 
ng|A asn*MtA(ijk\ ^f&«u9«i|t>»f^i'nM« «ii«o«^<^mt«j»«^cs»to\ ÊMÊaêAfMÊsn^uMnri^&s Êiêimêjn 

ö«t««(«5<vs«i#'*" dm 

Bapa Poetjoeng bevindt zich boven het water en draagt onafgebroken, dag 
nacht. 

Zijne lasten zgn bijzonder zwaar, zooals deze gewoonlgk niet voorkomen 
(tan kaprah). 

Oplossing: eene brug. 



ASM ARA DANA. 

!• «3ien«fi^Kn«&{^«m&«uM\ tmêJi»mêJUê/nnÊsni^*JÊf^ t>nci«t^»{9#<]««'^4|«n»v tru^êf^^^^J» 

Zij heeft twee eigenschappen; zij kan iets hard maken en ook iets zacht 
of vloeibaar doen worden. Des nachts versehnilt zij zich. Haar invloed is 
zeer groot. AlleS; wat broeit, ondervindt geregeld haar invloed. 

Oplossing: de zon. 

Toelichting: £nm»^fnÊ\ = zacht. 
«>ni}^% SS vloeibaar. 
t^^^ voor #i|A(% 

2 0/'oo o (?) • o.O(?) o o 

At^s & tsn ên .Jt êa nj tM êmênês •<nanmênncnimêmiêaÊêjnnji\ nrtmêêmtsn^êJt'ri^MAêMê^ uojjê 



}cnA&tüiênÊt 0jivu«n% 



Er is een gestalte zonder hoofd en zonder hals ; slechts den vorm van den 
bnik (heeft zij;. Ook heeft zij twee beenen, maar geen voeten. De vorm van 
de billen is te zien. Zij bevindt zich bij de mannen. 

Oplossing: een broek. 

Toelichting : ^fn9rm^ = vorm. 

fay£*^fOJ?M*^<y*^^*3<^^ êjnSêtnfmêsnêO^ÊS'ri^ oS'n^Inêni^^t^êotKnins StoêiMêiMfkam 

Sang Djah heeft slecht één voet; zg heeft een hals en geen hoofd. Als 
kenteeken heeft zg een spleet in de borst. Haar hals wordt met touw om* 
wonden. Met de linkerhand wordt (aan het toaw) gerakt. (Dan begint zg) 
Inid te weenen en trippelend gilt zij het nit. 

Oplossing: een bromtol. 

Toelichting: ^ên»K\ ^= •»u»\ 



— 73 — 



tSntffpnijy «b 6611 FUk d06II. 



9<i&\ SS 9Jttsn% 



t:nf*^ = een koker van bamboe. Uit de naam gangringan boemboeng btykt dus 

reeds, dat de bromtollen van bamboe gemaakt worden. De gewone tollen, 
die veel kleiner zijn, worden in Kedoe van hoorn vervaardigd. 

'^* vË^l it<Jit|OMi.ati«^u«^MC«3x tunêmtSt^tSifitfnionis êjnSnêjnnjiêjmMnMnfi^\ énnmuMtsnm»^ 
ffKJténistêJiênêi amt^^ik 

Er is een edelman op Java gekomen, afkomstig uit een verafgelegen land. 
Hij is groot en hoog van gestalte. Zijn baitengewone macht is ongeëve- 
naard. Hij draagt twee krissen en is in dienst van den vorst. Hij wordt 
alleen door mannen bediend. 

Oplossing: een olifant. 

*^* (SM^ ^m^nnnirLiênaêJiJniiniS\ •Jnatsn'r%étKMtMKA\ tnvi^T^eiiMi^Mi^fox cn^t|f«k4^9ncmè/ 

ff KM 4Sn (Cl iAêOêt 9tAMM»ÊSt»inMMêJb»p0È'n9nê% 



Sang Déwi draagt een schietboog op het hoofd. Zij wacht een poosje op 
de komst van Batara Bajoe (de wind). Als hij komt, vliegt zg dadelgk 
we;^ en doorklieft het la:/htruim. Zij weent dan aanhoudend en hoadt eerst 
op, als zij neergedaald is. 

Oplossing: een vlieger met een söndarén. 

Toelichfing: Een sëndarèn is een instrumentje in den vorm van een seg- 
ment; de boog is van bamboe en do koorde van een gébang-blad gemaakt. 
Het wordt geplaatst op vliegers, die meestal den vorm van een vogel hebben. 
Het gonzend geluid ontstaat, door dat de wind de snaar in trilling brengt. 
êMfttmy == op het hoofd dragen. 

•jtffM&\ = de godin (hier: de vlieger). 

_ o 
vêMMfsn — - (unist§/»ji% 

ê0 9Jtêa»Ê\ s^ c3/«(% 



€t% 



o" 



imSnêMê\ = aanhoudend. 

V«]u Bat GeiL, deel XLIX. 10. 



— 74 — 

(StlL *^VGr'^*7''"'id*^i^^ •Mfrfm^QêoA^MUMs ^emffêniSut^QmffMx t53'n{«2i«f<m 

Sang Rëtna Ajoe loopt nusteloos heen en weer en schgnt in verlegenheid 
te zijn wegens hare zwangerschap. Zg zoekt een geschikte plaats om te 
kannen bevallen. Zoodra hetgeen verborgen was te voorschyn is geko- 
men, gilt zij het uit om de buren kennis te geven. 

Oplossing: een kip, die bezig is een ei te leggen. 

Toelichting: ^c^^mj\ voor éiêêJÊ^vnu»% 

êjntjt\ voor Êynêjêfêy = Agu schgu hebben. 

iiftO«3'^«3«> voor M «0^11 t>ii dm 

unfA «nirmi^Aii^fmntyntm^x 4>ntac;ito«»iM|-Jt£M<vn«ni|\ A«ié|«m«m#u{»^tn|4|f/»\ «tjfo^ 

De vorm van zijn hoofd is te zien, maar hij heeft geen hals. Hg heeft 
slechts twee styve beenen, zonder voeten. Als men hem laat werken, dan 
stapt hij. Soms beschrgft hy met één been een kring. 

Oplossing: een passer. 

KNfS»{«%'n\ ««»««s»fU«CAfM|-/nan«u9\ iBntt&Sh&AêJtSitJkêOJ^s KV&%tnmMtn3ii&Mkm\ fagff 

Het wordt tweemaal geboren. Bg de eerste geboorte lijkt het er niet naar, 
dat het leven heeft. Als het voor de tweede maal (geboren wordt), is het 
dnidelijk, dat het leeft. Ook is dan de soort bekend, hetgeen vroeger nog 
verborgen was. 

Oplossing: alles, wat eieren legt. 

Toelichting: •fttmnj^ = i&«fi«&«m« 

«nijAof^x = er niet naar Igken; er niets van hebben. 

Kitts °^ «^>Mt«mj« 



— 75-- 



@£1 tfl|«»tn»|ei£^C0i&Q%«tJ|% tm^fnfto«ii«o^i^Mi^\ 4l|rn^eiii|t>ii^cAf«Mi\ QG^t 



Zijn mond is naar boven gericht; hij heeft een neus en geen oogen. Het 
doet niets dan eten ; wat hij eet, is van waarde, maar het is leelgk van smaak. 
Als bij reeds verzadigd is, wordt zgn maag bestormd. 

Oplossing: een aarden spaarpot. 

Toelichting: £t^> = met zorg vasthouden; 

QQ^iaênji^ » zaken, die men met zorg vasthoudt en niet Ucht van de hand 
doet. 

§ni»jtmiM\ voor «ojA«jiA% 
^«XfkJ\ sas ANCt^fi 

Ug[f£ ut êsn fn 90 n ia 9n.jnmtiM 9 'S ^ MMÊsn»otSjS9nvk^êMinÊ\ A«t>iit&iifcin«»««>««9«<ji\ WWci 
^Kn«'MMfai{A%'n\ êiên^^truJi^^êJUMs «f»^to«u9«uc4«»i&|«0|« êjnui$m ^mtuütMJi^êjn'ns fagê 

Er kan niets afgenomen of bijgevoegd worden. 

leder heeft zijn eigen getal. Die reeds een groot aantal bezitten, kannen 
nooit ingehaald worden, met het doel om gelijk te komen; want de ver* 
meerdering is (bij allen) gelijk. 

Oplossing: de ouderdom. 

Toebchling: «n^«o0ut«Lt&&c|«n«\ «nooit kunnen. 

(StA. '^fki^^^'^^'Sl^fnJix i^i&i|#o«r«nS««m«i\ ^êMêOiSên»jt^êJi*Mêp0f9n\ i3ii&ei«tff4^ 
aptTts a/ii«aiM9#«^«cAftivn> êfn9mA\A<ïïn&i9Jk^n\ utf^nêO»hnSntnÊ^^jèkMj^\ \3tJL 

Er wordt een woord van drie lettergrepen vermeld; het beteekent: een 
slecht mensch. 

Als de voorste lettergreep wordt afgescheiden, beteekent zg het tegen- 
gestelde van hetgeen men prajoga (best) noemt. 

De laatste twee lettergrepen zijn de naam van iets, dat kan spreken. 

Oplossing: doerdjana. 

Toelichting: mnm»x verk. van !>»«»«•% 



— 76 — 

^^* fetftf £n?^^nJiemMJt^A\ mtfnt^entangt^'ris ^'nMcnwftmSéinwft^s «^CAff^MiOMtf |^ 
iufu% 4|ftoi|#ofls»iUAyi|«:iiau»> •ni^^«(0uft>n'nfoc|«A|% 0f^9M»AAta&4jtMJt fafff 

Een woord van twee lettergrepen is de naam van een dier, dat kan vlie- 
gen. Alleen 's nachts komt het naar buiten ; over dag verbergt bet zich. 

Het bedoelde woord wordt dagelijks gebruikt als tegenstelling van wewah 
(vermeerdering). 

Oplossing: kalong. 

Toelichting: ^un^^ = &§n% 

Een woord van drie lettergrepen is de naam van een fraaie welriekende bloem. 

Als de voorste twee afgescheiden worden, zijn zij de tegenstelling van 
djoewëh (praatziek). De laatste lettergreep is het geluid van iemand^ die 
roept; een ook de naam van een vrucht. 

Oplossing: rëgoelo = roos. 

Toelikhling: «^ijmtjp^ &= welriekend. 

^tms SS niet spraakzaam, stiU 
^M^9tjt9mji\ (stamw. werkw.) =z roepen. 

dSIL ^*^*'^^'*^*^^'S^'''^^ 9J»«ifiSbÊtm*MM9o'n\ 9f9A»»n3nên»^<ntÊaón9n\ «Ji»««^t4«n«% 
êhna^y «it#a«y»(i^i^«f«Jutornx êhidsntfnttJÊtmiuntA^s ast€»êhi*n»»Sn^f&ua\ feif| 



Een groote deur wordt vermeld; de naam bestaat uit vier lettergrepen. 
Als men de voorste neemt, is het de naam van iemand, die de oppermacht 
alleen in handen heeft. 

De laatste drie lettergrepen beteekenen: het doel hebben iemand op te 
wachten. 

Oplossing: sri-manganti (naam van een der poorten van de kraton). 

Toelichting; «r^% of êJ^Êf:tm^ =^ &&% •oimi«^^> voor êm&^S!»% c»«J.WW«niA 

?iC&*^^ B= «iemand opwachten" is, hetgeen gedacht wordt in het hart = het 
doel hebben iemand op te wachten. 



— 77 — 

(SU. i^tonntin^tUM^imê^jty MJt9^9*fJiy*,t»t'n^tm\ «/f<au»u^<imt/nd4>ii^K)> hn^thitiuntsnéctÊen 

Ik word gebruikt als geneesmiddel; mijn naam bestaat uit slechts drie 
lettergrepen. 

De voorste beteekent gërbong (een voertuig met een gordijn omhangen) of 
baïta (een vaartuig) 

De laatste twee lettergrepen zijn de tegenstelling van kogoeg (een tegenzin 
in iets hebben). 

Oplossing: djong-raHb (naam van eene specerg). 

Toelichting: «^ikt% = een jonk. 



-ni/ncnü^ e=s lust in iets hebben. 



o o. o. n. . • o o f 

»»w»TM^^#n«\ •n9nj{«c«amt/niu^«v»^\ «jij»n*o<tjit«r«#*i«kj#Q* ^A«€i«i0u«akJ«wf«/*«n'n« i*c?WL 

Er is weer iets, dat als geneesmiddel dient: de nanm bestaat uit vier 
lettergrepen. De voorste twee beteekenen (zegt men van) alles, wat wer- 
kelijk plaats heeft. 

De laatste twee lettergrepen zijn de naam van een poetraning soenoe (kinds- 
kind) en beteekenen ook hetzelfde als mongsa (tijd). 

Oplossing: sida-wajah (naam van een weinig bekende, welriekende 
houtsoort). 

Toelichting: 9mnjtêenj§nÊy in plaats van êatn^iw^untaoj^ niet alleen voor den 

rijm, maar ook omdat het deftiger is. 

o o o. o C^ rt • . O o. o / 

Ik ben een waterdier; mijn naam bestaat uit vier lettergrepen. 

Wanneer ik van een geseheiden wordt in deelen, elk van twee lettergrepen, 
dan hebben het voorste en het laatste deel dezelfde beteekenis: (nl.) hout, 
dat wat veel met het vuur in aanraking geweest en tot in zijn binnenste 
zwart gebrand is. 

Oplossing: arëng-aréng (naam van een visch). 

Toelichting: tAtl»^ =1/1147^1. 

i}t4ti|n^i SS door branden zwart geworden. 



— 78 — 

(fËJÊ *n4^«ji^«A^arr>c«7L«(> éMÊSninM^nmtm»pt^\ i^^«t*nmj{<Ji^itt/i% êfmtsnmfOêmJ^A 
HKnéhtaAJtênÊt mêjimMUê^ 

Er is weer een woord van vier lettergrepen; (het beteekent iets), dat be- 
hoort tot de reakgevende stoffen. 

De voorste twee zijn de naam van iets, dat niet te aden is en slechts 
waargenomen wordt door de punt van de tong. 

De overblijvende twee lettergrepen (beteekenen) milara (pijnigen) en lalara 
(ziekte). 

Oplossing: rasa-mala (naam van eene welriekende gomsoort). 

Toelichting: «iru^ in de beteekenis van een kwaal hebben wordt alleen ge- 
bruikt voor uitwendige kwalen, bijv. huidziekten of steenpuisten, 

&| KI ^« c I en 'n « •/nÊ^nêOêtênthiLÊ'riêna^ kjn»cn^j»9t.9(miunCkmn\ mngjiênHtusn^Ui^^^ vSÊÉ 

Mijn naam bestaat slechts uit drie lettergrepen en beteekent hetgeen 
voortkomt uit het lichaam. 

Als de twee voorste afgescheiden worden, zegt men dat van"^ alles, wat 
op reis wordt achtergelaten. 

De laatste lettergreep (beteekent) een schadelijk insect in het papier en 
in de kleeren. 

Oplossing: karingët = zweet. 

Toelichting; In verschillende streken wordt het in den laatsten zin be- 
doelde insect verschillend genoemd; in de noordelijke gewesten hoort men 
StS^y of ib»ap»J|^ elders QQ^t en het meest «^i^^« 

Sis voor êJt^m% 

anms êtm^ftufmkmtJÊ^êsnêx m»^A»Jt»at^^^tL^^\ êmênmnfJv^mê.,mMêiÊan\ VgÈÉ 

Ik ben (een zangwijze, behoorende tot) middel témbang; mijn naam be- 
staat uit vier lettergrepen. De voorste is de naam van een delfstof, die er 
fraai uitziet. 

De laatste drie lettergrepen, zegt men van alles, wat niet zinkt in bet water. 

Oplossing: mas-koemambang. 



— 79 ~ 

Toelichting: Deze zangwyze wordt hier middel-tëmbang genoemd, doeh is 
in Winter; samenspraken I, No. 70 als cütjicj^^ opgegeven en is als zoo- 
danig algemeen bekend in Midden-Java. 

OMVM^ verk. van êM»jt9mji% 

4M«o\ 9iên9i'^t£t3trn§!iKn\ t'ftêottSuJtiomiSbtJiftns Ê&AdjtÊaSjÊsn'ntitsfaêa 

• o 

De letters van den naam van een vogel vormen vier lettergrepen. 

Wanneer ze in deelen, elk van twee lettergrepen, gescheiden worden, zgn 
de voorste twee de naam van een mensch (joogeling), die nog niet bg een 
vroaw geslapen heeft. 

De laatste twee lettergrepen zgn de tegenstelling van taroena (jong). 

Oplossing: ^aka-toewa =s een papegaai. 

Toelichting: S^^s — cm^\ 

Er is een dier, waarvan de naam nit drie lettergrepen bestaat. Als het 
eene wonde toebrengt, is het erg venijnig. 

De voorste twee lettergrepen beteekenen hetzefde als nalika (tijd). De 
laatste lettergreep is de naam van de kleur van het bloed. 

Oplossing: kalabang = een duizendpoot. 

Toelichting: ^aggütny = ^ucuM4^.»n% 

^9KUM\ van ^iit«At« «^ tSiéUi»jÊÊ% 
êjn^^^s = krachtig werkend, venijnig. 

(SIÊL '^^-'{^'^f'^*^^'^' éMêhnma^^^M^ffthiimy tA»tmA^9UtmécirMnin\ &|«J?«nt«ji|Mf%A> 



• o o • 

cnêMÊatAêOêt $nttM»tüi% 



Een woord van drie lettergrepen is de naam van iets, dat tot de gamelan 
behoort. De voorste twee lettergrepen zijn de naam van een gewicht. 

De overblijvende lettergrep, achter, is de naam van een boom, die in 
het wild groeit. 



— 80 — 
Oplos si Dg: katipoeng = een kleine këndang. 

De naam van een geslacht van kleine kruipende insecten bestaat uit vier 
lettergrepen. 

De voorste twee lettergrepen zijn een kawiwoord, dat de tegenstelling is 
van kita en sira. 

De laatste twee lettergrepen beteekenen hetzelfde als santosa (hecht). 
Oplossing: kami-tötép = een klein insect in een ruitvormig omhulsel, 
dat dikwijls scuade aanricht in de bewaarplaatsen van boeken en kleeren. 
Toelichting: tny^^$»jK = gich kruipende bewegen (van insecten). 

^Siêsnx in poëzie door goden gebruikt als voorn. w. van de 2de pers. 
•&-»>% id. door vorsten. 

Een kërisvorm wordt vermeld ; de letters vormen vijf lettergrepen. 

De voorste twee zijn de naam der tegenstelling van djaka (jongeling). 

De laatste drie lettergrepen (beteekenen) de wijze van doen van iemand, 
die (op den grond) zit en tevens op de handen steunt (zooals bijv. een 
kikvorsch). 

Oplossing: rara-sadoewa. 



26. 



ff m tin Cl €A §01% Si&% 

De letters van den naam eener zoete lekkernij vormen twee lettergrepen. 

Als ze gescheiden worden, hebben het voorste en het laatste deel dezelfde 
beteekeniS; (nl.) iets, dat gebruikt wordt bij het loopen in den nacht om 
het zien gemakkelijker to maken. 

Oplossing: ting-ting. 



— 81 — 

Toelichting: &,\ (Chin) = een lantaarn. 
&&\ =8 eene lekkerng, van katjang, suiker en een weinig meel gemaakt. 

Bezigt men kanari in plaats van katjang, dan is de smaak nog aangenamer^ 
doch de prgs iets hooger. 

xSÊi. ^'^i^^ffnéut^Mh êJÊiuêfniUKmf^ënJOi^ «3«|«g«sn.M&amc»|3i^«0\ «jiM4^f^«A}^^4ff 

tx\ «cn|«j0uif«^amuif nêJUMêJinJ$amSh£ÊM»y •nfifmu«ni^Ai^*Jitni|^ fa|J 
o 

Een woord van drie lettergrepen is de naam van een aardvracht. 

Als de eerste lettergreep weggelaten wordt, is het de naam van iets, dat 
op de borst (mm« = boezem) is; mannen en vronwen hebben het. 

Als de laatste lettergrepen weggelaten wordt, is het een kawi-woord, dat 
een geslacht van hagedissen beteekent. 

Oplossing: basoesoe == een saprgke aardvracht. 

Toelichting: tcn^jts = ^titmêma^ 

•riAêhttci^s êJtQ»JÊtfh^mtJunttm\ êmêniA^A(mi^Êjk/m\ •jf'rt^A(tMun.^A9ÊCttKny M9|J 

Ër is een zekere vracht ; de letters (van den naam) vormen vier letteigrepen. 

Als de twee voorste afgescheiden worden, vormen zij de naam van hem, 
die de oppermacht alleen in handen heeft. 

De twee laatste lettergrepen beteekenen het overblgfsel van verbrand 
hoat. 

Oplossing: racya^awoe = eene weinig bekende pisangsoort. 



Verh. Bat. G«ii., deel XLIX. II 



MIDJIL. 



o O o o • / 

De lieve >touw zit gemakkelijk eu houdt een uitstekenden schietboog in 
de hand. Aanhoudend schiet zij hare pijlen af, zonder gevolg, en bet ge- 
luid (er van) ven'ult de lucht. Niettegenstaande dat, stuiven hare vijanden 
uit elkaar. 

Oplossing: iemand; die kapoek of kapas zuivert met de woesoe. 

Toelichting: Dit zuiveren geschiedt altijd door vrouwen. De woesoe ge- 
lijkt op een schietboog; doch is veel kleiner. 

0fnB^€MUM\ voor 0m*jÊmMêmaM% 

o Q /^ Q /o o / 

iKsnt^*Muii\^»%jinjHHaitn\ «ni kü io «wt o cii \ êot (ut »jt aj» êttrjn ri»Ê\ JQÊQ 

• o O » 

Uëtna ning Djah verblijft lang in afzondering in de slaapplaats. Wegens hare 
zware boetedoening wordt zij beloond en verandert spoedig van gedaante. 
Al hare kleederen zijn fraai eu zij is zeer machtig. 

Oplossing: de pop van een rups. 

Toelichting: De laatste uitdrukking: ;yzij is zeer machtig;'' doelt op het 
vermogen van te kunnen vliegen. 






ici«M«ai\ =s mtKiMijtx s= c^<$n«ji\ 



tM 



têA-Jim. = boete doen. Deze uitdrukking wordt ook inhet dagelgksche 
leven gebruikt voor: „weinig eten en weinig slapeU;*' van iemand; die 
bedroefd is. Da handeling geschiedt dus niet wegens godsdienstige beweeg- 
redenen. 

M«jl«0> voor «y»tJI«/llcS% 



— 83 — 



\3tJL ^*^*^^'^^'^*^^^'^'' ''^^'0'^^^^'V^'v ^^''^^'^^'^'f'*^*^ 

£r is een naam van een zekeren smaak. (Het bier bedoelde kan) moeielijk 
gegeten worden ; werkelijk heeft het klenr^ noch vorm. Het heeft vier broe- 
ders; zij worden allen gebruikt en vormen eene zeer noodzakelijke regeling. 

Oplossing: de pasardag lëgi. 

Toelichiing: Met „de vier broeders'' worden de andere pasardagen bedoeld. 

^•jtSs of MS^ Het eerste is deftiger. 






(f3êJl *^*£i/H ^^'H^^*^^'l*^* ^^*^*iS^ mntÈêom^ tjiê/n0i*Ji9 §ni\ »ni»nvmnrtShêJi»mtn\9SMm9Q\ 

Sang Djah Ajoe heeft werkelijk geen schuld en ondervindt iets slechts. 
Eiken nacht wordt zg in de gevangenis gezet. Over dag bindt men haar met 
een touw vast om haar te laten vliegen en dadelijk weer terug te trekken. 

Oplossing: een glatik op de knik. 

Toelichiing: cjflufnx ^=^ «sn^% 

• r> o o o 

Men kan het vergelijken met een mooi huis^ van steen gebouwd. Die het 
bewonen^ zijn vijf in aantal. Zij zijn onaanzienlijk en van verschillende soor- 
ten. Als er één uitkomt^ blijven de andere vier niet achter. 

Oplossing: een sirihdoos met den inhoud == een gevulde sirihdoos. 

Toelichting: wfüJlnJ^anJ|^ = «^«yn^^x Dit woord staat in het Wdb. van G-R-V. 

verkeerdelijk als KN. opgegeven; het wordt alleen in poëzie gebruikt. 
Het woord -n^^x wordt in het Wdb. als kawi opgegeven; het is echter 

gewoon Javaansch en wordt dagelijks gebruikt in de beteekenis van onaan- 
zienlgk, van geringe waarde, bgv.: 
i^-niwMifx = boeken van weinig waarde; 



— 84 — 



4^,A«»^»a|x =klecren van geringe waarde: 

i|«!bfi]K><^ = geringe mensehen: 

oiju-n«o><% = poppen, die geen hoofdrol vervullen. 



MA8-KOEMAMBANG. 






\tsntsn&éMi4iêt «Sffi^ 



«ij gaat bniteDgewoon snel; er is nietS; dat haar evenaart. Een kogel 
wordt door haar overtroffen. Waar zg wezen wil^ komt z^ in een oogenblik. 
Oplossing: de gedachte. 
I Toelichting: «S^i^^x voor «S^m/^m 

«jiA«4«}i^^> = een oogenblik. 

Een krijgsman daalt een zekeren berg af en wil zich met zijne stamge- 
nooten vereenigen. Wegens zgn buitengewone dapperheid voegen zich, overal 
waar hij gaat, makkers bij hem. 

Oplossing: eene rivier. 

Toelichting: S^f-ntmm^Ay voor éS-rnu^^nmaAf^ 

Mgne stamgenooten zijn verschillend van kleur, (nl.) zwart, gestreept of 
rood. Als mijn hoofd door het vuur getroffen wordt, springt mgn lichaam 
uit elkaar en verspreidt zich naar alle richtingen. 

Oplossing: een mërljon. 

Toelichting: ^ffhs — AÊf% 

0u^\ BS dwars gestreept. 



— 86 — 

i^iy«Aak|K)|\ voor éiênAiêJÈêOji% 

£i^êh^ voor £iêoA% 

MMtms sas «ti{«o% 

A>svoor o&% 

Er zgn prinsessen; die er zeer ieelijk uitzien; zij zijn met bun velen. Zij 
leven in afzondering in den grond; als ze er uitkomen, zien ze er goed uit. 

Oplossing: vruchten, die door broeiing in den grond rijp gemaakt 
worden. 

Toelichlitig: Het is bekend, dat men dikwijls onrijp geplukte vruchten rijp 
maakt door ze eenige dagen, bijv. een week, in den grond te bewaren. 



EGATROEH. 



Er zijn gedaanten, die, paarsgewijze, rechtop in de hoogte gezet worden. 
Zij gebruiken een witte, een roode en een zwarte (donkerblauwe) sampoer 
en gelijken op een regenboog. 

Werkelijk ziet men ze zelden; die ze er op nahouden, zijn deregenten. 

Oplossing: oemboel-oemboel. 

Toelkhling: Een oemboel-oemboel is een stuk vlaggedoek van ongeveer 
10 meter lang, beneden ruim Vj meter breed en boven in een punt uitloopende. 
Aan een bamboe bevestigd, worden ze, altgd paarsgewijze, rechtop gezet en bij 
feestelgke gelegenheden aan den ingang van de kaboepatun geplaatst. Wegens 
den gebogen vorm van de bamboe spreekt de dichter van een regenboog. 

/ 

Er zijn roovers op rijen geschaard in de grot ; zg vormen twee rijen. Wat 
binnen komt, sterft zeker, overweldigd door de strgders. De lijken verdwgnen, 
zonder dat men het ziet. 

Oplossing: de tanden. 

Toelichling: 4»^« ^=^ ^^hk^ 



— 88 — 

Wel, hoe is de ware naam van de gedragslgn, die voor alle mensehen in 
deze wereld; onverschillig van welken landaard en van waar zij afkomstig 
mogen zijn^ goed en passend is om gevolgd te worden? 

Oplossing: edelmoedigheid. 

Toelichting: munj- = atcfmanai, 



Uieê\' ^ KnêSêotMti 



4 f % o Q o. y^ o Oo. OO C^ O 

(«Mfl t m €ê 4X9 UI 9Jk 0^ 9\jt ^ un HU tAM§n»A»OÊ ^ ÊJ^ *Jt Ktt t/t» tê •p êAêp\ 9*1 MS jQêSft êmi^ "wn^x *7^"S^ 

. o o ^ / / 

.o n o CV 

uKnêsntn telnat «^ ^n «sn ^* i^ii % 

Plaatsvervanger te zijn is zijn eenig werk. Hij gaat overal heen^ ofschoon 
hij blind; doof en stom is. Als hij gezien wordt door iemand, die kundig is,, 
behoeft deze hem slechts aan te kg ken om hem te begrijpen. 

Oplossing: een brief. 

Toelichting: Men spreekt van rutitiSi^^ in tegenstelling met rua«ufo»#n|% 

= een boek. 

o 

A^<sn\ — iL49Jifr9t§% 

^^^j, = kundig, bedreven. 

• o CL O 

II rm mn tot tAMjt isn9m»OÈ% 

Dikwijls word ik als kinderspeelgoed gebnükt en dikwijls help ik menschen, 
als zij bezig zgn zich boos te maken. 

Ook treed ik in de plaats van hen, die trachten hulp te verleeneu aan 
gebrekkigen. 

Oplossing: een wandelstok. 

Toelichting : tau»9§»\ = ^ff^n^^ = (zelf) uitvoeren. 



CAMBOEH. 



Er is een groote berg met twee grotteu uaast elkander. Inwendig zijn ze 
(licht begroeid met onkruid. Onafgebroken waait een sterke wind, (die de 
grotten) vult. 

Ook is er een bron, die slijk afvoert: ails het stormt, komt er een vorm 
{hé\) te voorschijn. 

Oplossing: de neus. 

Toelichting: De derde zin doelt op de ademhaling. 

QQuatji^ = aanhoudend wnaien. 

«mf^N = een bron. 

«Lt«A\ =^ slijk. 



9 /• <5) x' o iT") o • ^ o. , o o 

QtmiisnKnêAênÈt uiijn\ 

Groot en hoog is zijn lichaamsbouw. Hij heeft zijden^ ma^ir hij draagt 
nooit een buikband. Hij heeft voeten, maar hij kan niet loopen. Uit de 
verte ziet hij er voornaam uit; als men naderbij komt, wordt hij leelijk. 

Oplossing: een berg. 

'!/ /o .o, .00/ o 

.0 O o o . 

Hun werk is vliegen, in troepen vereenigd, overal heen. Hun gamelan 
laat zich op een afstand hooren: zonder afwisseling is de melodie. Het ge- 
luid houdt op; als zij rusten. 

Oplossing: opvliegende duiven, voorzien van sawangan's. 

Toelichting : tmiLMiniMês in troepen, troepsgewijze ; v.an «^t^iynu 

Verh. Bat. Gca., deel XLIX. li. 



— 90 — 

.o a 

ffÊntÊot ast a^êOÈt nmtctênÈ^ 

Vier broeders worden vermeld. Zij hebben er alleen plezier in om elkan- 
der na te jagen^ maar zij vangen elkander den gelieelen dag niet. Daarbij 
is het, alsof zij allen aaneengeschakeld zijn. Zij roeien zich volstrekt uiet 
vermoeid. 

Oplossing: de wind. 

MfiUMtanji\ = amtuuasrii% 

nM^tsnêaêx = njt 0ÈêJi.jn 9 Ttx^ in het geheel niet; bijv. iUênêJi^mt'rivnêonKn»*an9n\ 

= er is in het geheel geen verschil. 

Ër wordt vermeld, dat het zes beenen^ drie hoofden en zes armen heeft. 
Slechts vier beenen loopen: de andere twee liggen uitgestrekt. Overal blijft 
het onder dak. 

Oplossing: iemand, die in een hangende tandoe zit en door twee 
menschen gedragen wordt. 

Toelichting : «jiijoii^n — aft;nfc«{% 

Zij wonen in het water. Dag en nacht is dansen hun werk. Hun aantal 
is ontelbaar. Na eenigen tijd veranderen zij van gedaante: dan vliegen en 
zingen zij en veroorzaken den menschen last. 

Oplossing: de larven van de muskieten. 

Toelichting: ^mnj\ = c«ru{ KN. 

s#ofi«Lic5Krm\ =3van gedaante veranderen. 



DJOEROE-DEMOENG. 



^im'n\ ÊJHi^fmtMMtSi9jn$M\ &ên9nA^iMtn»MM»jnn4\ &^&»Jkên9êJÈm»atimt^\ qfj> 
ffcnénasnAênêt ^'^^ 

Het heeft geene armen en geeue beenen en één groot oog is te zien. 

Zijn geluid dient als een voorteeken en voorspelt drie zaken: l^ een goed 
werk; 2® een slecht werk en ten 3^ vroolijkheid. 

Oplossing: een langwerpig rijstblok. 

Toelichtitu) : Een lësoeng is een zeer lang rijstblok met een langwerpige 
opening; waarin de padi tot gabah^ en een ronde opening, waarin de gabah 
tot bëras gestampt wordt. Het in het raadsel genoemd oog doelt op deze 
ronde opening. 

De bekende loempang heeft alleen een ronde opening en dient dns alleen 
voor de laatstgenoemde bewerking en tevens om bëras wit te maken. 

Omtrent de drie zaken moet het volgende worden opgemerkt. 

Het Ie doelt op het rijststampen; het 2^ op het slaan op de lësoeng bij 
groote ongelukkeu. 

Het 3« doelt op de gewoonte, dat bij maneschijn de lësoeng dikwijls de 

verzamelplaats is van de vrouwen van de desa. Zij slaan dan op eene bepaalde 

plaats van de lësoeng (want deze geeft niet overal hetzelfde geluid) om, als 

het ware, wat muziek te maken. Het is dus eene aangename bijeenkomst; 

welke tot vroolykheid stemt. 



MJiéLn\ 



êj^9(n\ 



/ o 

•x|MWri\ ^ voor «^«oicmm 



vSML '^|^f'?*^f''<i*5*^'^''^ titètn.iM^0fmMJtrum»hMiun\ «»» «n^^ en «^«i t/n aSM«•|^ «^««^t 



9^gnnj9ê£n€a€9Hn 



kaib9HnÈ nêjiffuf^mTitJiamfémcktnax »JinHn?êainta9nJn»(ig»^.(ni\ iSfi tn vn t ê/n §fh 



»^^«i9fn9| nêjittLt^tm'nitii<m^éi»Mtaa\ »Jintai^§aintjnio.jnêngê.^^(n%\ Mttnen^ê/n 



»n.iAêa' 






— 02 — 

lljl betreedt den gnmd niet, ninar is steeds in de hoogte. Hij eet nieten 
drinkt alleen. 

Als hij dorst lieet't, begeeft hij zich naar beneden. Hij manoeuvreert op 
en neer. Al hetgeen door hem gedronken w(>rdt, braakt hij dadelijk weer uit. 

Oplossing: een emmer aan een hefboom. 

ToeUvh ting : ^ «$» #u > = «S tS % 

. o ^ 

ff tm nsn KI IA êoat »<4tuunêm9rmt\ 

Het is doorzichtig. Kr zijn kleine en er zijn groote. liet hectt geenc 
armen en gecne beenen en ook geen hoofd. 

Des nachts verliest het zijn macht; over dag is het ontzagwekkend. 
Zijn werk is iets in brand te steken. 
Oplossing: een brandglas. 
Toeliclifitig : «,>»** ».i«.un = doorschijnend. 

o • o o. 

€JHrtêJI§Qn'Tri\ C4 «3 «Jl «o *>! A/n % 

4/" Oogo. . o., o » Q 

o, o o y o * 00.0 o .o f ^ 

. Q CY o . 

Twee en vijftig dingen vormen bij berekening ecne hoeveelheid van drie 
honderd tachtig. Zij kunnen genoegen verschat!*en, maar ook onrust ver- 
wekken. 

Zij. die aan hen gehecht zijn, ondervinden zelden voorspoed. 

Oplossing: een spel Europeesche kaarten. 

Toelirhiing: Men heeft hier het oog op die spelen, waarbij elke kaart de 
waarde heeft van het aantal tiguurtjes, dat zij bevat: met uitzondering van 
het aas = lij terwijl heer, vrouw en boer ieder lo tellen. 

_.<>i.oO o/ . o. .o. /L.^^ 

• o o 

lfmÊ>n»:tÊji»njlt ajn»nmjtênÊ\ 

Zij hebben verschillende kleuren, rood, wit, geel en eenigszins paars. 
Steeds zijn zij op verschillende plaatsen (in verschillende tleHschen). 



— 93 — 

Ts nicD een weioig niet hen bevriend, dan ondervindt men liun wcldadigen 
invloed. 

Als men de maat niet in acht neemt (ze onmatig gebruikt), raakt men in 
liet verderf. 

Oplossing: (geestrijke) dranken. 
Toeltchiiftg:S^y = k»^% 

De kleur is eenigszins zwart. Keeds toen zij bewerkt werden, heeft men 
den vorm verschillend gemaakt. Zij scheiden niet van elkaar, als zij werken. 
Vóór- en achteruitgaan is de beweging en zij maken alles, wat (door de 
gandik) betreden wordt, fijn. 

Ken gedeelte komt er viVór te liggen (valt van de pipisan af). 

Oplossing: pipisan en gandik. 

Toelicblinfj: Een pipisan is een langwerpig, vierkante steen om medicijnen 
op fijn te wrijven met de daarbij behoorende gandik (rolsteen). 

4/»»gj<w:€|j^. = eenigszins zwart. 

KiijêmfUMs = bewerken. 

v^ifL ^''J*^*^**'**^*^''^»^"^ a^*>*«$n*o,jnto«rTi#nn«ap ««|«>ic^AO«$nfa^'>l'^^^ ^Ma»«»ci'>>€|'r» 
• o. 

Het zijn vier goeroes, die vermeld worden. 

Zij bezitten geen wetenschap; daarom geven zij geen onderwijs aan al 
hunne leerlingen. Hun Averk is iets op het hoofd te dragen en al hunne leer- 
lingen doen ook zoo; steeds dragen zij iets op hunne hoofden. 

Oplossing: de (vier) hoofdpilaren van een huis. 

Toclichliiig: Met de „leerlingen'' worden de overige stijlen bedoeld. 

iTTnrrn^ = Op het hOOfd dnigCU. t^a^iy^mjo^x Obj. dcU. 
o __ o 



i« =£> 



ajtÊ\ 



•i^i^ — «*«3j»j| 



— 94 — 

£r ziju vijftieu broeders; ieder heeft eene afzoüderli|ke wouiug; maar onder 
hetzelfde dak. Zij zijn afkomstig van eeu overzeesch land. 

Velen vatten hen bij de hand als broeders^ om plezier te maken. £n toch 
is het niet goed, als men aan hun vriendschap gehecht is. 

Oplossing: een kist jenever. 

Toeliclitiuff : nwuitu^ = als broeders beschouwen. 

• ^ vSfJL *^*^*^*^**''^'*^'^'^^ ^^vf'rlt4i^MntJnagJj90»n^ wfnjfmuiÈgÉMên»SaAa4yi\ aSên^ÊMé&am 



Het heeft eene groene ot roode kleeding: het heeft tot makkers iets uit 
het water — en iets van visch afkomstig. 

Alle drie worden opgenomen en in een gevangenis geplaatst. Vervolgens 
worden zij tot kleine stukjes geslagen; zij worden fijn en vermengen zich 
met elkander, zonder wederstand te kunnen bieden. 

Oplossing: lombok, trasi en zout tot sambél gemaakt. 

Toelichting: tJS*^^«^x = Si^tK%\ 

ic*£t^nj^s = tot kleine stukjes slaan. 



ncmSncttAênMt •v» tlt »jê x:i êonji'K 

Er is een woord van vier lettergrepen; het is de naam van een voor de 
rijstplant schadelijk insect. Als de voorste twee genomen worden, zijn zij 
de naam van het geslacht van die schadelijke insecten. 

Diï twee laatste lettergrepen zijn de naam van een geur en van een smaak, 
tlie onaangenaam is door (de werking van) het vuur. 

( ^) 1 o s s i n g : walang-sangit. 

Toelichting: «ji(^asi»|x = rookerig. 



— 95 — 

Mijn naam bestaat uit vier lettergrepen. (Ik ben) eene plaats ten zuiden 
en ten noorden van de kadaton gelegen. 

Als de twee voorste lettergrepen van de twee laatste gescheiden worden, 
is er geen verschil in de beteekenis, (nl.) wild rollend Avater. 

Oplossing: aloen-aloen. 

Toelichting: De dichter heeft hier het oog op de kadaton te Soerakarta, 
welke zoowel aan de zuid-, als aan de noordzijde aan een aloen-aloen grenst. 

iunnA»oa\ = golf. 

10 / o Q, Z' Q, % O O O. O .00. 

\SUL ^^'^i^^*^^^^^'^'^'^^'^ iunê<n»s»'-n»n(tsn9nêaMji\ 0iiU9an»unmut^êo»A»nÊ\ «oiMH^Ltf «M^n 

njncuL^s -UI »/> «sn »oi «n T) |0 >ó| N nnxi»fn^i9u<trtiLfiiiCk*nê^\ tunt:n»AJi»jt9j»tt,iMtjÊaniy («JJ 

Een in kleuren geweven stof; de naam bestaat uit vijf lettergrepen. De 

twee voorste lettergrepen (beteekenen) eene vrouw, die haar man verloren 

heeft. De laatste drie lettergrepen beteekenen hetzelfde als oebaja (beloftel. 

Oplossing: ronda-samaja (naam van een gestreept weefpatroon). 

Toelichting: In den eersten zin is de duidelijkheid aan de poëzie opge- 
offerd. Er staat woordelijk : „eene stof, gepractiseerd (uitgedacht) met kleuren, 
door middel van weven." Uet woord *^#/n. is ingelascht voor de maat. 

Hier volgen een paar voorbeelden, hoe het woord wf'n»,n^ gebruikt wordt. 

1« 0f^un\ = iets zoo maken, dat het de gedaante heeft van het een of 

ander; bgv. êaiÊju^ni-nfftnioiu^tus = een groot stuk hout, gefatsoeneerd tot 

een mensch. 

2^ 0^^im\ = iets practiseeren, uitdenken; bijv. •^«^•oiA/wflyi^imtAfnjv = wie 

heeft dat uitgedacht V 

• o 

ffÊsnKruatAênjji êjniuÊêjt'n\ 

De naam van de onderscheidings-teekenen van hooge personen bestaat 
uit vier lettergrepen. 
Als de twee voorste lettergrepen worden afgescheiden^ zijn ze de naam 



— 96 — 

van rijst in afzonderlijke korrels. De twee overblijvende beteekenen betzelfde 
als tata en lakoo. 

Oplossing: oepa-tjara = de waardigbeids-teekenen, die personen van 
boogen rang worden voor- en nagedragen. 

Toeliclitiuff: Voor alle inlandsebe ambtenaren zijn de oepa-tjara en het 
aantal dragers er van bij voorsebrift geregeld. Het voeren van deze staatsie 
geraakt eebter meer en meer in onbruik, altbans in de Gou vernemen tslandeu. 
Met uitzondering van de staat^fie-pajoeng bezitten vele Hoofden niet eens de 
bun toekomende oepa-tjara. Zij zeggen, dat bet bun te lastig en te kostbaar 
is om er dragers op na te bonden. Het is dan ook een gebruik uit een 
vroeger tijdperk, toen de toestanden gebeel anders waren. 

Alleen de regenten bonden er nog de band aan, nl. voor zoover hun eigen 
l)ersoon betreft. Bij elke oftieieele gelegenbeid versebijnen zij gaarne met al 
bunne waardigbeids-teek enen. 



.3^ o O o _ 

n xm tin Kn tA tojtt aai9i.ima^'ytêji^\ 

Ik ben een kërisvorm; mijn naam bestaat uit vier lettergrepen. De voorste 
twee vormen een kawi-woord, dat beteekent: „de plaats, waar bet liehaam 

rust geniet. ' 

De overblijvende (^beteekenen) de bedekking van een Idoem: de vrucht er 
van dient slechts om gekauwd te worden. 

Oplossing: tilam-oepib. 

Toelichting: Soi?*fi|N iw plaats van P«^«»fnj^^ 

«.-rï^fjl. (Ar.) = beteekenis. 

«-ij«3<> = de bladscbeede van den pinangboom. 



o. 

ênêAKm 



Weer een këris-vorm; de naam bestaat uit vier lettergrepen. De voorste 
twee zijn de naam van den tegenbouder van bet kleed (om bet afzakken te 

beletten). 
De twee overblijvende lettergrepen zijn de naam van een edelgesteente van 

buitengewone schoonheid. 

Oplossing: saboek-intën. 



— 97 — 



^^^* (SWL ^*^**^**g^"'^^^ ift»<m^*>ïjrm«34j«^t^x ♦^•^?«^«^gfeJ»S«j*2|* '"73*10*^ •^'11 



• o o 

il \m asn crv t^ mtas cm c« n ••ni f iji ik 



De letters vormen vier lettergrepen eu beteekenen ook een këris-vorm. 
De twee voorste -zijn de naam van een der zonen van Pandoe. De twee 
laatste lettergrepen vormen een kawi-woord, dat beteekent: eene onstuimige 
gemoedsbeweging. 

Oplossing: bima-kroda. 

Toelichting: De woordschikking in den vierden regel, waarbij eerst het 
bepalend woord genoemd wordt, noemt men trwA^n^x In gewoon Javaansch 
zou men zeggen: •^m^»,f«S^;^ij^^<y^t^,jpji, 

nmMtuks = mt 9n »Jtji'»^ 

17/ C) o /^ /^o. *o .oo. o. 

\!3êJl V'^*Sy]'^^^^^*^*^mi^ »Jt*^nnjKntajtM»otAêna\ tnioi9ut^»utm£mÊj>aAMiriÊ\ tt^^nêoêm 

o. o • o . oo. «oOOO 

"^*<ïïf* dm 

Ër is weer een këris-vorm; de naam bestaat uit vier lettergrepen. 

De twee voorste zijn de naam van een dier, dat op de sawah's en in de 
rivieren zijn voedsel zoekt. 

De twee overblgvende lettergrepen beteekenen gowang (een stukje eruit) 
en sëmpal (afgebroken). 

Oplossing: joejoe-roempoeng. 

Toelichting: «^i^xfnx = ».ic»«SrW 

oAAtjus = een kleine krab. 

«yuaju-ncjjflx == ceu krab, die een of beide scharen verloren heeft. 

UBMiA iEM(nji^9Jtêjt'rio^'yiam\ a;xisn9unmiiJ»^9^AAinji\ 9ht ton ru ^ tLKm t/A ten tAAMê\ vt ^^a »fnêat nj 

Om * » o o m . O O. O. o. /^oO»A 

tunê<n\ «m ffn ^ «o «Il c/n C| Cl X4A \ »inêm9tji^tu(mtjnUÈMÊsnÊ\ 'r^pÊêjmejt'Uji'yiamnAs *^ÈÈ 

Weer een këris-vorm; de naam bestaat uit vier lettergrepen. De twee 
voorste zyn de naam van een vogel, dien men kan leeren spreken. De twee 
laatste lettergrepen zgn de naam van het losmaken van de haarwrong. 
Oplossing: djalak-ngoré. 

Vcili. Ikt. r.cn., deel XLI.\'. 13. 



-- 98 - 

Toelichting: By het pass. van ciri»^ in den vgfden regel had de dichter 
niet enAêoijf =^ ia»»n^ maar ênêjts moeten gebruiken. 

ettui'^\ van êM»>»^ 

fetil f '<'t&fg«^-s<*'^'*^«S'v>^ ^fot^^^arnfmnjf^KiiN SioêJÊ^Jl^imtaêMMêajis «x£^4^/^«4 

Er is een spijs; de naam bestaat slechts uit vier lettergrepen. Als de 
twee voorste worden afgescheiden, zyn zij de naam van een buitengewoon 
groeten slang. De twee laatste lettergrepen zijn de naam van een bloem, die 
dikwijls als geneesmiddel en voor welriekende borèh gebruikt wordt. 

Oplossing: naga-sari = een lekkernij van pisang, meel en suiker (^in 
een pisangblad gewikkeld). 

Toelichting: Met ^'fix in de beteekenis van bloem, bedoelt men de bloem 

van den boom §nmêji'fis 7Ae ook: Dandang-goela, no. 35. 

* (SIL <tu»m^^f tJUci«aMt|> 9Jtm ébttm^jt^tl^éjitojix éaO'^T^tmtSêJifj^* mtAêtnJiOêJÊ^ta 
ÊL4^wi0(m\ Mtat:i»mMMJt^Sl^tjÊMt isn my ^i» en «n «n cm «ji.^« 'T) \ êsn êjê^ê t/n ^m mt 90 êm §nj\ uaÊê 
ffcnéntaÊAênjÊt « t/n i^rmitfyi* f flrm% 

Er is nog een lekkernij in den vorm van een kogel; de naam bestaat uit 
vier lettergrepen. Als de twee voorste van de twee laatste gescheiden wor- 
den, zijn de beide deelen gelijk in beteekenis, (nl.) tépa (maat, monster) en 
oepami (voorbeeld). 

Oplossing: ondé-ondé = een lekkernij van këtan, doch het binnenste 
bestaat uit geraspte kokosnoot met suiker of ook wel een stulge manisan. 

Toelichting: In den laatstcn regel is achter «>no^3« nog tSic|«o«\ evoegd 
om het aantal lettergrepen voltallig te krijgen. 

tetfl ^^'Sgl^'^^'^^f^^ tJnmAamtaMHéjiinÊS êf»êmA^Jtiam£hiaÊMênê\ St£^mBS^ 



— 99 — 

Ér ié een gëndingan; de naam bestaat uit vier lettergrepen. 
De twee voorste lettergrepen bèteekenen : steeds bet beeld van eene vrouw 
voor zich hebben. 
De twee overblijvende lettergrepen zijn de naam van een heerlyke smaak. 
Oplossing: gandroeng-manis (naam van eene melodie van de gamelan). 

Ër is weer een gëndingan ; de miam bestaat uit vier lettergrepen. Als de 
voorste twee worden afgescheiden^ zegt men dat van een lichaam, hetgeen de 
gezondheid verloren heeft. 

De twee overblgvende lettergrepen bèteekenen een geluid, als uiting van 
verdnet. 

• * * ■ 

Oplossing: lara-nangis (naam van eene melodie van de gamelan). 
23. 




i«iM»wt<ttC'm4?^Arm\ ^f«Mi«Sf<vno^«nc|io|\ •A»9m»u^4iA<nt&ÊaaMênj\ fjtSn99Jf£A^ 



Een stad wordt vermeld; de naam bestaat slechts uit drie lèttér^pen. 
De twee voorste bèteekenen een zeer nöodige vloeistof, die gebruiÜ wordt 
door alles, wat leeft. 

De laatste lettergreep is de naam van een kostbaar metaal. 

Oplossing: Banjoemas. 

Toelichting : omdat de Javanen geen woord voor ^metalen" hebben, worden 
goud, enz. aangeduid met GAtff^^^ 

vStt£ »»^9S'riêjnsn»bKm\ «ji«i^ary)«^Mf«n|<A|<m«iJ|\ 9fêMên3nênêa»jitS&tm*::t(UA9nÊ\ &£nm 
fl9Jt.s*trumt^^^&MSuMÊat>ji\ fitaêaiA^Atmunêm^ênjx A«|'n«A«i>Mir«^«c:nfta\ êfnÊS*»Mjn£l 

De naam bestaat uit vier lettergrepen en het behoort tot de vlaggen. 
Als de twee voorste lettergrepen genomen worden, is de beteekenis: opstijgen. 
De twee overblgvende lettergrepen hebben dezelfde beteektsnis. 
Oplossing: oemboel-oemboel. 
Toelichting: zie Mégatroeh, no. 1. 

&êMMtmM\ SBB 0uSmnÈ\ ■ ^ 



— 100 — 

o o, /^ o o ' o a. et, Q. . f 

Er is een woord van vier lettergrepen; het is de naam van een kleur van 
banen. 

Als de twee voorste lettergrepen worden afgescheiden, zijn zij de naam 
van een in kleuren geweven stof. 

De twee laatste lettergrepen (beteekenenj een zeer uoodig voedsel. 

Oplossing: loerik-sëkoel (zwart met witte stippen). 

v3SA <^<i^^'*71*^'^*l*^*^y9« »Jiénnjiam»Jii^êotLJt»na\ «yn*^Mii«i^^#Lt<mit7ifl;t|fO| ft/n«QU|ft#M 
•o.MCJicft'nx 9jt9UJ&Sn»»Sfê»sn'n\ iSh»htM»^*Q^9S'rt\ injt^fnitsneAM^n'nên^ fa|j 
misnaht&iAênÉi ^g*^JBm^i^\ 

De kleur van een paard wordt vermeld; de letters vormen vier lettergrepen. 

De twee voorste lettergrepen (beteekenen iets); door welks invloed alle 
zadeu; wortels en bladeren groeien. 

De overblijvende (twee lettergrepen) zegt men. als iets door water aan- 
geraakt is. 

Oplossing: lémah-tëlës (donkervaal). 

Toelichting: ^«.^^ = grond; 8»^»^^ = "a^- 

êjfMJt^\ (Ar.) = invloed. 

tsn€ê\ = ifn§(f\ 

Wéér een'^kleur van een paard; de letters vormen vier lettergrepen. 
Als de twee voorste genomen worden^ is het een voortbrengsel uit het 
plantenrgk; het heeft een beerlgken smaak. 

De twee laatste lettergrepen (beteekenen) zwart door het vuur. 
Oplossing: goela-gésëng (zwart bruin). 
Toelichting: *f^£lx = geschroeid. 
cm0uf^£l\ — aangebrande suiker. 



— 101 — 



<»n.jnisn§OiAênÈ\ •uci«o.£««t4(vn 



fSniUkMÊOtjix tSi89^^njiiu»^ctiAA»njj\ AJi^*otj«<;^«jtsni«;i*n\ M»}^<7n«^i:i40i«>;g^«|f \ ^i^ 

Ëen geslacht van kruipende dieren en ook een doos, welke alleen gebruikt 
Avordt om geld te verzamelen. 

Als de laatste lettergreep van de twee voorste wordt afgescheiden (wordt 
weggelaten); is het de naam van een wild dier; dat de gewassen vernielt. 

Oplossing: tjèlèngan == 1*^ een kruipend insect: 2« een spaarpot^ 

Toelichting : ^Kn^»Uy voor ^tmxv^^i^ 

29. uQÊÊ nt^tfnênêjtwikAt'tnfnSjomy ë»txi99Upïpj''nn'nMaAinÊ\ "TrimniéSAtn^tnêMAêOÊs' êOèanêQÊ 

Er is een woord van vijf lettergrepen ; het is de naam van een stuk kin- 
derspeelgoed. 

De twee voorste lettergrepen beteekenen het voortbrengsel van vleeschelgke 
gemeenschap. 

Als de twee voorste weggenomen worden^ is het (overblijvende) de naam 
van het loon van menscheu; die geld uitzetten. 

Oplossing: anak-anakan = een pop. 

loehchling: «|«if'n'>i*4j\ ^ akj(»j|c«»n% 

«j«5» A"^)0^ ^^^ loon. 

nj^te/H&^»mkjnjiêmÈ\ »Jt tutistii»n^§ptpj(LjiêOê\ •oi«3«ji&(mi%ci^«avj\ •^a4J45i«^^«n*S«4 

Er is een woord van twee lettergrepen; het heeft twee beteekenissen; 
ten Ie kinderspeelgoed, en ten 2^ trachten nader te komen bij alles, waarvan 
men de plaats niet weet. 

De laatste lettergreep is een kawi-woord; dat het tegengestelde beteekent 
van soerja (zon). 

Oplossing: golek = 1» een pop; 2« zoeken. • 



32. 



0-é 

ca 



— 102 — 

lOeflCniiny: *,ntM*mêni\ = &&ênn\ 
0«.>Wif|\ of Q'n»nitjf% 

Eeu kleur vhd Ludcu wordt vöhneld: de letters vormen drie tettergrepeu. 

De twee voorste lettergrepen zijn de tegenstelling van andika (ps. vnw. van 
den 2«n ps.). 

Als de voorste weggelaten wordt^ is bet de naam van een groeten berg, 
ten oosten van Soerakarta. 

Oplossing: koelawoe = grauw. 

An«A tJ^t3'r»A«nc|f«>n«n|% i& flrb & ory» Swt m^«S «| «aj «A «te •n»fni«& f Aan «M«aÉ% «StSnjtjMtik 

•^ijsi^ (sa 

De letters van den naam van een gewas vormen drie lettergrepen. 

De twee voorste (noemen iets), dat voortkomt uit vmebten en bestemd is 
om er vogels mee te vangen. 

De laatste lettergreep beteekent bet zelfde als ora. 

Oplossing: poeloetan =^ een in H wild groeiende beester. 

Toelichting: t|^«»»f« = ^^^ soort gétab, een kleverig sap uit sommige 
vmebten^ dat als vogellijm dienst doet. 



UgÉÊ tt**^^isnfy&(9n»9jtvn\ «»«tAqffM|j^^«att3«Q^ êfnfnA^njÊam^tauAênÈ\ «^^"la' 

«« «o nrk \ te «M fo ^ « fO «ai .at t% rrn i:>c«|in|j^.t:»^ «o oi«jt« «IC f Mt&ii^\ êaèft»&Uim»yi^»M»n»\ \fgÊÊ 

Weer een woord van drie lettergrepen. Niemand wil er meê begiftigd worden. 
De twee voorste lettergrepen beteekenen betzelfde als pikantoek (ontvangen). 
Als de voorste lettergreep weg^laten wordt, is het de naam van eeu 
oorlogswapen uit den ouden tijd. 
Oplossing: tampiling = een klap tegen den slaap van bet boofd. 
Toelichting: Jiêhx van fl:|^ == tmiyufm 



niöj' ^ *i«»é»' 



— 193 - 

De schryfwyze ^^mêiéns heeft eigenlgk geen reden ?an bestaaUi want dan 
/OU men ook v^êjn^»^ in plaats van êjt&ix (»jnmêii ) en «|a>iiti|f/M in plaats van 
êfnwfêb^ («>it#o^O moeten schrijven [1]. Het doel van dien taling-taroeng is 
om aan te geven^ dat men sandjafèng en niet sandjatèng wil laten hooren. 

Men heeft een reeks van woorden om de verschillende w{|zen van staan uit 
te drukken. Behalve êom»3têu\ zijn de voornaamste: 

4.1 tj 1011% == op de wang slaan. 

MiifCFit«ai|% -^ op het hoofd slaan. 
M9<m^^tmji\ ^^- op den rag slaan. 
QêM9mj\ = op de borst slaan. 
vm^i^lfêmjis = op de billen slatin. 

' SSIL ^^^i^^'^"^^*^'^'^^ êJiéikSji<mêJi\%AMêA9nji^ (i^Lj4«o.J^«o^tni^f taM|«a|\ «>i|K*^ 
&§hi<mStafÊ\ ajfJfiéat/tji^Sntafjnühx iAfnnA^niarnShMJkfgimfs &J^€uSk§mmn^H9^êJiÊji 

Ër is een versiersel voor het lichaam; de letters vormen vier lettergrepen. 
Als de twee voorste genomen worden, is het een licht, dat slechts voor 
een oogenblik schittert. 
De twee I^tste lettergrepen (noemen iets), dat zich boven den elleboog bevindt. 
Oplossing: kilat-baoe. 
Toelichting: Een #/&#Lf«»t«>n. is een bo ven-armband; dien men tegenwoordig 

nog door bruid en bruidegom ziet dragen Meestal is zulk een armband ver- 
sierd met een vogel, die iets in den bek heeft, dat onafgebroken in trillende 
beweging is. 

Anjumjiy = weerlicht. 
tSêf^mji^ = de elleboog. 
cn^M^ = de bovenarm. 

^» ^V^i^^^'^^tm^ «j€iffoJj#o«»-a*«ij«n^«. ^l&9^'^'^'^H{3f' Gun 

Weer een lichaamsH9ieraad ; de letters vormen slechts drie .l^ttjergrepen. 



[1] D»t de woeloe ia *jA% Iwhonden bl^ft, is mh mtsondenng. 



— 104 — 

Als men de Ikatste lettergreep weglaat^ is het de naam van iets^ dat zich 
altijd op de borst van mannen en vrouwen bevindt (de boezem). 

Als de voorste lettergreep weggenomen wordt, is de beteekenis gelijk aan 
tanjatna (niet herinneren). 

Oplossing: soesoepé = een vingerring. 

Groote balken^ bestemd om te ondersteunen. De letters vormen drie let- 
tergrepen. Als de laatste weggelaten wordt, (is de beteekenis) de tegenstelling 
van siang (dag). 

Als de voorste weggenomen wordt, zijn de twee overblijvende de naam 

van hetgeen men bij het loopen te volgen heeft. 

Oplossing: daloeroeng = de steunbalken, dwarsliggers van een dak 
of een bnig. 

MSnvncA&unKy MAonflO«D«&07i«^«o}M*o|\ njt^§}tiA9nj*n»snf*Jtên\ AnrueniSliatMAtiSKtsfnêf 
» o 

Het wordt gevonden aan een këris; de letters vormen vier lettergrepen. 
Als de twee voorste genomen worden, zyn zg het gordijn van de tanden. 
En de twee overblijvende lettergrepen zgn de naam van wild dier, dat 
slechts door vorsten er op nagehonden wordt. 
Oplossing: lambé = ga^jah. 
Toeliehting: jQ^s = gordijn^ scherm. 

iru€fgi^tm9Kf\ noemt men het dikke uiteinde van de t^fmt»n\ omdat het eenigs- 

zins gelijkt op de lip van een olifant. De gondja is het breede bovenstuk 
van het lemmer van een këris. 

Dr. Palmer van den Broek heeft terecht in zgn voorbericht op de Sérat 
kantjil opgemerkt, dat de olifant, hoewel niet op Java voorkomende, toch 
bekend is bij het volk, omdat deze dieren er door de Javaansche vorsten 
op worden nagehonden. 

Ik teeken hierbij aan, dat de tegenwoordige Soesoehoenan van Soerakarta 
drie olifanten heeft. Als het garëbëg is, worden deze dieren, de koppen met 
borèh besmeerd, de aloen-aloen rondgeleid. 



— 105 — 

' o 

De naam van een desa; de letters, alle zonder sandangan*8; vormen vier 
lettergrepen. De twee voorste beteekenen een onbeduidende vrucht met een 
lekkeren geur. 

De twee laatste (beteekenen) een getal beneden tien. 

Oplossing: Madjasanga. 

(SU. ^•^^{•^•"l'^Ö'ï*^*^* *iC'^5*^''^*^it54*^*^'!2^^ «i«Ai»nj»^tii»»**o'>J€f*^ §AnSêO»^^t/n 
o Ci (P) a o/ Q. o. O o • o / 

. o . 

Weer de naam van een desa; de letters vormen slechts drie lettergrepen. 
Men zegt het ook van alles, wat door den vorst verboden wotdt. 
Als de laatste lettergreep weggelaten wordt is het de tegenstelling van 
moerah (goepkoop). 
Oplossing: Larangan . 
Toelwhlifig: o^Q»n|v of o^^-tjkï^n van 8»^\ 

In den vierden regel is ^fM^-n^ gebruikt in plaats van ^wSi\ Dit is eeu 
dichterlijke vrijheid, want het suffix «^-nx vertegenwoordigt het suffix «^«ynx 
of jdfty In ninM\ is de laatste lettergreep een deel van het woord en geen 
affix» Het daarop\^lgendc «.t#3iScii3-n. in plaats van «^ri?i^o^\ is goed. 

Ook in het Kawi-Jav. Wdb. van Winter staat achter vf»jnS'r^\ verkeerde- 
lijk 0|<ln(Ki^ opgegeven naast de juiste beteekenis: «yw iS -iix (of '^*njafl)== ^Siy /mi 

• o O . . 

Er is een gëndingan ; de letters vormen vier lettergrepen. De twee voorste 
zijn de naam van eene bamboesoort. 

De twee laatste lettergrepen beteekenen hetzelfde als de kleuren tjömëng, 
langking en djamoes. 

Oplossing: pëtoeng-woeloeng (naam van eene melodie van de gamelan). 

Verh. Bat. Gen., deel XLIX. 14. 



— 106 — 

Toelichting: SÉl^ Er. van «JB^' 

0i»&\ en «c«««>«x beteekenen hetzelfde als «jRa^^ doch worden alleen in 
témbang gebruikt. 
c|«i|^ s=s blanwzwart. 



De letters van den naam van een batikpatroon vormen vier lettergrepen. 
De twee voorste vormen een ngoko-woord, de twee laatste lettergrepen 
een kawi-woord ; maar de beteekenis is gelijk, nl. water, dat van boven komt. 
Oplossing: oedan-riris. 



Weer een batikpatroon; de letters vormen vier lettergrepen. 
De twee voorste (beteekenen) een groeten steen (rots) in de zee. De twee 
laatste lettergrepen zegt men van alles, wat niet goed meer is. 
Oplossing : parang-roesak. 
Toelichting: mjtJif^s ^s •uiiniift9ifif«>*»% 

De letters van den naam van een desa vormen vier lettergrepen. 
De twee voorste beteekenen hetzelfde als het woord raab (lust in iets hebben; . 
De overblijvende twee beteekenen zooveel als madjéng (voorwaarts gaan) 
en de tegenstelling is moendoer (achteruitgaan). 
Oplossing: Soedi-mara. 



LIJST 



TM n pofiiE fimnuiE mm. die in deze vebzaiieidi6 tooriom 



m POËZIE 


BETF.F.KENIS. 


m poiiSziK 


BETEEKKNIS. 


t/v» 




afT 


a&#it 


tum^êot 


tuA 


iftQi«n 


i^tiiii'v» 


•Mdi 


•i«ni3» 


•fi-nf 


cm -rif 


t>8*r» 


«Afft 


•«•y-^^g 


«nifll 


o 


cS«n 


MAülA 


nrttm 








tmA 

Cf «BI 


ft/non 


Tl 


^«.^ 


AmitfAnii 


êMUtêJU 


AAI A 


1« 


«|i|a^»t 


mnmi 


"•V*3I 


•o«» 


«ui e» 


untÊC 


se^-w 


ênnj 


•mSt 


9Ètm§mJi 


«•«n 


1^ 


•afCt 


«Lfnutêo 


-ö-ï» 


•10** 


«itAifft 


êMMêJt 


«oiSaji 


êr»<nj«it 


f^*»«l 


cunuaêfn 


tatcnj 


M^ 


^•»tfl 


mniQ 


cm4j» 


JO 








o 








Mim 


•^S# 


^«1 


•W«j5*y 


•n 


«S«3«ni« 


o>)n|«o| 


•m«i>