Historic, Archive Document
Do not assume content reflects current scientific knowledge, policies, or practices.
Harvey Seed Co.
Montgomery, _-Mabama.
OUR SPECIAL GRASS MIXTURES.
FINE LAWNS
Can only be made by using the best grade of grasses. The proper blending to give satisfactory results needs the study of years. Our well known reputation gives assurance to the buyer of our grass mixtures that much care is used in their preparation.
OUR STANDARD LAWN GRASS.
For quickly producing a permanent, thick and vel- vety sward of grass, this brand of Lawn Grass cannot be excelled. It isthe best mixture of grasses we sell for lawn making. and will give satisfaction wherever sown, Lb. 35c, 3 Ibs. $1.00, postpaid. Sold over our counters or sent by express or freight at buyer’s expense, lb. 25c, 5 Ibs. $1.00, 10 Ibs. $1.85, 100 Ibs. $16.00.
CHICAGO PARKS MIXTURE.
This popular Mixture in all cases gives good satis- faction. A pound of seed will sow about twenty feet square. Price, perlb. 30c., 3% Ibs., $1.00, postpaid. Sold over our counters or sent by express or freight at buyer’s expense, lb. 20c., 6 lbs. $1.00, 10 Ibs. $1.75, 100 Ibs. $15.00.
EVERGREEN LAWN GRASS.
This Mixture contains many grasses which are not in the Chicagag Parks Lawn Grass, and although the latter is well and favorably known this will be founda much better one.
With slight variations, it can be prepared to suit light, medium or heavy soils, and when wanted for Croquet Ground or Tennis Court those grasses which produce a firm turf can be used more liberally. Ib. 35e, 3 Ibs. $1.00, postpaid. Sold over our counters or sent by express or freight atbuyer’s expense, Ib. 25c, 5 lbs. $1.00, 10 Ibs. $1.85, 100 ibs. $16.00.
Our Vegetable and Lawn Fertilizer, The Best for Lawns, See prices and description on page 31,
Sawai
Our Standard Brand assures an enduring velvety turf.
Satisfaction assured under trees with our “Mixture
3g
ase Aaeocas Feat
Erre
MIXTURE FOR SHADED SPOTS.
Usually it is quite difficuit to obtain a satisfactory growth of grass under trees and in shady places, for sowing in such places we recommend the use of this special mixture. It will quickly produce an abundant and even growth of beautiful green grass. Ib. 30¢, 3% lbs $1.00, postpaid. Sold over our counters or sent by express or freight, at buyer’s expense, lb. 29c, 6 ibs. $1.00, 10 Ibs. $1.75, 100 Ibs. $15.00.
GOLF LINKS MIXTURES.
There is no use to which a grass mixture is put that is so exacting as that used for pleasure grounds, golf links, etc. No other turf is required to stand such wear and rough usage, Hence the necessity of sowing such grasses as will produce a thick and healthy growth, and withstand the tramping of many feet.
FOR THE PUTTING GREEN.
Specially prepared. Sold over our counters or by express or freight at buyer’s expense, lb. 20c, : Ibs. 90c, 10 Ibs. $1.75, 25 Ibs. $4.00, 100 Ibs,
15.00.
FOR THE LINKS.
Specially prepared. Sold over our connters or sent by express or freight at buyer’s expense, Ib.
or 20c, 5 Ibs. 90c, 10 lbs. $1.75, 25 Ibs. $4.00, 100
lbs. $16.00.
SPECIAL PRICES GIVEN TO GOLF CLUBS, ATHLETIC ASSOCIATIONS AND OTHERS USING QUANTITIES.
Directions for . First get the ground in the desired shape
theLawn. 21d grade, drain it where necessary, and
. pulverize the soil, removing roots, stones, etc.,
so as to have an even, smooth surface. To secure the best
results use our seed liberally, (1 1b. to about 300square feet.)
Let the grass geta start of three or four inches before cutting
asthe growth is retarded by too early cutting. After thisit should
be cut with a lawn mower every 10 days,and rolled whenever the ground is soft enough for the roller to make an impression,
Grass Seed Mixtures for We mix grasses for hay or per-
Meadow and Pasture. manent pastures, suitable for any
soil. The difference of location
and the needs of the land to be sown make a special mixture for
each individual case necessary. Name your wants as to soil
and purpose and we will prepare you a mixture at $12 per 100 lbs. Or we will name you prices at any time.
For General List of Grass and Clover Seed, See page 28.
E take great pleasure in handing you our catalogue of seeds. In it we have endeavored to offer everything of merit that is best adapted to this locality, and have omitted those varieties which repeated tests have shown to. possess little or no value.
Our Stocks have been secured from a reliable source, and under proper conditions will pro-
— duce the best of results; we do not, however, guarantee the seed or crop in any respect, as some
times climatic conditions as well as other things occur which spoil or change either the seed or crop, or both.
DO NOT SEND AWAY FOR YOUR SEEDS. ‘It is expensive and takes time as well as money. Encourage home enterprises and save freight.
We solicit your patronage feeling sure that we can save you time, money and annoyance. Our seed is not the cheapest. but it is the best to be had.
BUY AT HOME and be satisfied.
These prices are Net, delivered at any Express or Freight Depot, and are subject to change as season advances, depending on shortage or surplus of stock. If to go by mail, add 8c. per ib., and 15c. for each quart, for postage. Two bu. Cotton Grain Bags, 20c. each.
PRICES ON LARGER QUANTITIES THAN HERE QUOTED ARE GIVEN
~ ASPARAGUS.
Fr., Asperge. GER., Spargel.
* Sow one ounce for sixty feet of drill. Sow in March or April, in rows one foot apart. When two years old transplant into permanent beds, which should be well and deeply manured, and trenched to the depth of two feet. Set the plants (in rows) from three to four feet apart, and twe feet in the rows, spreading out the roots, and covering from six to eight inches. On the approach of winter cover with manure or compost; fork the beds early in the spring, and apply a dressing of salt. Cut for use the second year after planting in permanent bed.
ASPARAGUS SEED.
COLUMBIAN MAMMOTH WHITE.—A new and entirely distinct variety, that produces shoots that are white, and remain white as long as fitforuse. In addition to this advantage it is more robust and vigorous in habit, and throws up larger shoots and fully as many of them as Conover’s Colossal and requires no earthing up, as in the green sorts, in order to furnish the white shoots so much sought after. This grand result in producing a white asparagus did not come by chance, but was the outcome of years of patient work and careful selection by the originator. Pkt. 5c.; oz. 10c.; %{ Ib. 25c.
CONOVER’S COLOSSAL.—The standard variety; of large size, tender and of excellent quality. Pkt. 5c.3; oz. 10c.; % Ib. 25c.
_ PALMETTO.—It is of very large size, even and regular in growth and appearance. Itisa very early sort, and immensely productive and of the best quality. Pkt. 5c.; oz. !0c.; 4 1b. 20c.
ASPARAGUS ROOTS.
These prices do not include postage. Ifto go by mail, add at the rate of 50c. per 100 for the 2-year-old plants.
COLUMBIAN MAMMOTH WHITE.—2-year.old roots.
CONOVER’S COLOSSAL.—2-year-old roots.
BARR’S MAIMMMOTH.—2-year-old roots,
PALMETTO.—2-year-old roots.
PRICES ON ANY VARIETY OF 2-YEAR-OLD ROOTS: PER 100, 75c.; PER 1000, $6.00.
POOR SEED Invariably Causes Loss and Disappointment, | The cheapest is NEVER the best.
The BEST is ALWAYS the CHEAPEST. Bought of US they are the BEST.
ASPARAGUS. CONOVER’S COLOSSAL.
BRUSSELS SPROUTS.
One Ounce of Seed to 100 Yards of Row.
A variety of the Cabbage family, possessing the peculiarity of bearing upon its stem or stalk from 50 to 100 buds resembling miniature Cabbage heads. The leaves composing these heads resemble Savoy Cabbage in their crumpled texture and also in their color. The heads or buds, from 1 to 2 inches in diameter, form one of the most delicious garden vegetables, only equaled by the Cauliflower. Treat same as Cabbage Autumn-grown Sprouts, drilled in May and transplanted in July, generally do best, asthe plants are quite hardy and the buds mellow
BROCCOLI.
One Ounce of Seed to 100 Yards of Row.
A plant much resembling the Cauliflower, and like it derived from the wild Cabbage. Broccoli requires a longer season to develop than Cauliflower. It has more numerous and stiffer leaves, and the heads are smaller. The seed is best sown in Midsummer and Autumn, and the plants carried over Winter for cutting in the Spring. :
LARGE EARLY WHITE.—Large white head, resembling Cauliflower. We offer an especially fine strain of Early White Broccoli, and strongly recommend its more general oon culture. Pkt. 10c.3 oz. 50c. =
PURPLE CAPE.—Head purpleincolor. Superseded by superior varieties. Pkt. 10c.; oz. 5Uc. BRUSSELS SPROUTS,
Tits
2 7 GARDEN, FIELD AND FLOWER SEEDS.
Timbo] BUSH BEANS ae ca ntlsal tage Penasos merit e Do not fail to try our Prolific
for earliness, productiveness and
Black Wax Beans.
Green Pod Varieties.
Stringless Green Pod. This new bean produces a vine similar to Red Valentine, but develops pods to edible condition two to three days earlier than Valentine, that is to say in 30 to 31 days from germination, which extraordinary maturity for table at once advances the Stringless Green Pod to the first rank among table beans. The pods are green, not quite so round as Valentine and less curved. The pods are stringless—ab- solutely so—this quality at once placing the variety at the top of the list among table beans.
Extra Early Refugee. This isa great improvement on the old and well known Refugee, asitisa long way earlier, being fit to pick nearly as early as six weeks. It is more dwarf and compact in growth, while the pods are round, solid, tender, and of the most excellent quality when cooked for table use or for canning or pickling.
Refugee, or 1,000 to 1. The standard late pickling variety, matures two weeks later than the extra early kinds. Very valuable for pickling.
Early Mohawk. One of the oldest and best known sorts. It is the hardiest of any of the beans, resisting a slight degree of frost very suc- cessfully. The leaves and vine are large, coarse and straggling. It is early and very prolific, with pods of medium quality, broad, flat, nearly straight and very long.
Bountiful Beans. This new green podded bush bean is a heavy cropper and very early. It is a stringless variety and a careful selection from one of the standard sorts. Its hardiness and great productiveness make it one of the very best bush beans.
Long Yellow Six Weeks. Pods are long, flat, straight, green, edible STRINGLESS GREEN POD. at 30 days from planting.
a
Longfellow Beans. This new bean has long green pods, is exceedingly prolific, always solid, of delicious flavor, is tender and remarkably early. It ma- tures its crop very regularly and withstands adverse conditions well. A good bean for market or home use. 2
Extra Early Red Valentine. Pods develop to an edible condition in thirty- two days from germination. Color of pods, light green and semi-transparent. Form of pods, round and slightly curved. Succulent, prolific, and quite free from strings, continuing long in edible condition.
Dwarf Horticultural. The best shell bean for fine quality. Much esteemed by all who know it. Worthy ofa trial.
Pkt. Pt. Qt. Stringless Green Pod............ 2.0. cceeee renee $05 $015 $0 25 lieve TSzyehy INSEE. 555 send 55.00 beso IS Hede OuoK 5 15 25 Refugee, or 1,000 to 1....--. 0.2... eee eee ee eee 5 15 25 Barly Moh awiere. ca ocewedocce = senieienie==== +> ee 5 15 25 Extra Early Red Valentine...................--. 5 15 25 TOLER Sta GeSao paRddesuceMube sues oaec cooe ui ouerD 5 15 25 Long Vellow Six Weeks...... ...........-...... 5 5 25 Te SyaPOMN ON ecos escoss cacese. c4se co0s co5nod Coos ueBE 5 15 25 DwaniwhHorticnitutalesc-ceceeeeee seers ernie <- 5 15 25 NEMA bosnneso doce Spec aoc: Soode Se eat 15 25 Dre MS TRESS cos dsa cane sade SoamooO ne sass CoER BOBS 5 15 25
BOUNTIFUL BEAN.
Burpee’s Bush Lima. The only Bush form of the true large Lima. Bushes grow to 18 inches in height and always erect.
_. Dreer’s Bush Lima. The pods are heavy and thick. It is productive and of excellent quality.
Henderson’s Bush Lima. This isa bush form of the small Lima pole bean. It isa bean of great merit, the most productive of any.
BUSH LIMA.
Pkt. Pt. Ot. Burpee’s Bush Lima..... $05 $020 $0 35
Henderson-?ss. .\-seoee eee 5 20 35
OUR LEADERS IN BEANS:
EXTRA EARLY RED VALENTINE. STRINGLESS GREEN POD. PROLIFIC BLACK WAX.
We handle none but the Best Vegetable EXTRA EARLY RED VALENTINE. Seeds. You must have the Best.
EVERYTHING FOR THE GARDEN. 3
Currie’s Rust Proof Wax Bush B US Hi B EAN S ~ Do not overlook the Ken-
Wax Podded Varieties.
Beans have very tender pods.
tucky Wonder Pole Bean.
Wardwell’s Dwarf Kidney Wax Bean. Hardyand produc- tive, pods long, broad, flat, and of a delicate waxy yellow, brit- tle and entirely stringless. The yield considerably exceeds that of the common Golden Wax, and is equally as early.
Prolific Black Wax. The old standard Black Wax bush bean. It is so good that it is worthy of special notice. The pods are tound, brittle, of handsome golden yellow color, and of but- tery flavor when cooked. Do not forget the old meritorious kind when looking over the list, and include this in your orders.
Currie’s Rust Proof Wax. Seed black; a fine sort. Rust proof, tender thick fleshed pods, early and very productive.
Golden Wax.—The old stand- ard waxsort. It is productive, early, prolific, and on the whole is yet amoung the best for family use.
Improved Golden Wax. Rust proof. Animprovementon the old Golden Wax. The pod is somewhat round, meaty and entirely rust proof.
WARDWELL’S DWARHE KIDNEY WAX. Flageolet Wax. A large bush wax variety: seed large, pur-
plish red; excellent as a snap bean, and in great favor as a dry shell bean. ee: : Pencil Pod Black Wax. Growsa taller, stronger and more vigorous bush than the Prolific Black Wax, which is onecf its par- ents. Pods are long, slender, straight and shaped very much like a pencil.
Davis Kidney Wax.—A new variety introduced 1897 season. It is adapted alike for the canner, market gardener, shipper or amateur. The dry bean is iarge, kidney shaped and white in color, making it one of the best for cooking inthe dry state. The pods ate long, mealy, stringless, and of a beautiful yellow color. It stands shipping better than any other, and is one of the best of the - wax podded varieties.
BEAN PRICE LIST—Wax Pods.
Pkt. Pt. Gt. Wardwell’s Kidney Wax..-..............5- $010 $020 £ $0 30 Currie’s Rust Proof Wax......0c.20. 0e+0s é {0 20 30 Prolili@ Blacks Wiaxaec tere cites o ieineiet. siete aie 10 20 30 HIASEOLEL Wiaixapociets ae siecle «= octane cae ats {0 20 30 Golden) Wax Zescyreccnicsiec «(ss tieeen eines os 10 20 30 Improved Golden Wax............... ide a 10 20 30 Pencil Pod Black Wax. ................00--s 10 20 30 Davis Kad neyawaxeen cc. ac-: soso ccc id 20 30 Keeney’s Rustless Golden Wax............ {0 20 30
Pole or Running Varieties.
Large Wisite Lima. Very productive, of good flavor. Qt., 30c.; Pk., $1.50.
King of the Garden Lima.—Very iarge. Qt., 30c.; Pk., $1.50.
Extra Early Jersey Lima.—Early and productive. Qt., 30c.; Pk., $1.50.
White Crease Back. Veryearly. Qt., 30c.; Pk., $1.50.
Dutch Case Knife. Long green flat pods, early and prolific. Qt., 30c.; Pk,, $1.25.
Dreer’s Improved Lima. A late Lima of fine flavor. Qt., 30c.; Pk., $1.75.
Lazy Wife. Exceedingly productive and easily gathered. Qt., 30c.; Pk., $1.75.
Early Golden Cluster Wax. The finest wax pole bean. Qt., 30c.; Pk., $1.75.
Red Speckled Cut Short or Corn Hill. Qt., 30c.; Pk., $1.50. =
Kentuckey Wonder or Old Homestead. Qt., 30c.; Pk., $2.00. EXTRA EARLY JERSEY LIMA.
White Runner Bean. Cultivated chiefly for its flowers, though the large, white beans are of fair quality either green shelled or
dry. Vines and leaves large and coarse; blossoms in long racemes, large, pure white; pods large, broad, coarse; beans large, kidney- shaped, thick. Pkt., 10c.; Pt., 20c.: Qt., 30c. ;
Scarlet Runner Bean. Similar to the last, but with scarlet blossoms, and the beans are lilac-purple, variegated with black. Pkt., 10c.; Pt , 20c.; Ot., 30c.
For the home garden there is no better Snap Pole Bean than the Kentucky Wonder, or Old Homestead.
Don’t miss it.
2 GARDEN, FIELD AND FLOWER SEEDS.
flat, quality excellent.
and South. Color light.
flesh, quality fine.
lighter color.
root. Very popular with market men.
Detroit Dark Red Turnip.—Quality good,
a =e sweet and tender ; col- : SELON GLOBE. or deep red ; roots are turnip shaped, with small tap roots
Dewing’s Early Blood Turnip.—A good variety for main crop. Keeps well. Like Edmand’s, but lighter color.
Lentz Turnip.—Of similar size and shape to the Bastian Turnip; top small. Early and profitable.
CROSBY’S EGYPTIAN BEET.
A selection from that old market beet, Early Fgyptian, which retains the earliness of the parent stock, and has added thickness, giving it a more de- sirable shape. It is the deepest red, almost black in color, and is of finer guality than the Egyptian, being sweeter and even more tender and smoother. A very desirable sort for small beets for early market, as it is in presentable market shape quicker than any variety. It is a very rapid grower, and can be sown outside as late as July.
surface ; color light red ; flesh white and rose colored. Very nutritious and a good keeper.
white. Unequaled for feeding stock.
harvest.
SUGAR BEETS.
Five Pounds Will Sow One Acre.
Vilmorin’s Improved Sugar.—In general the most desirable beet tor the factory is the one con- taining the largest percentage of sugar. In this variety we have one of the richest beets in cultiva- tion ; not only that, but it will do better on new lands, suffer less from an exess of nitrogen, and will keep the best ofany. In size it is medium or little
from 16 to 18 per cent. of sugar.
Ss TAD OO BCCE Sinica sia rw cil emeeteiarg 6 oe ey aretares ocl Selaisiecieesiies Cue Pkt., 5c.; Oz., (0c. S IANS ElSioayocn sia <\c « Sem eisisedoinct evan stro ewicelt 0z., 5c.3 14 Ib., 10c. GOLDEN TANKARD MANGEL. Susan Beets .e:<o ceeeptticce 5 catutentes ae oo bee cunaes Oz., 5c.; % tb., 10c.
} }
below, yielding from ten to sixteen tons per acre, and containing
Klein Wanzleben. A little larger than Vilmorin’s Improved, yielding from twelve to eighteen tons per acre, and containing about the same amountof sugar. It grows below the surface, and the green leaves are rather large and spreading, with wavy edges. A little hardier, and easier grown than Vilmorin’s Improved.
Sugar Beets, as well as Mangels, are most valuable for stock feeding. There is no better
| paying root crop than either. They keep well, and, as a change of food, are excellent.
TABLE BEETS.
Crimson Globe.—This is one of the finest beets yet introduced. Roots are not large, but very handsome. Round, and a clean, smooth surface. Leaves very small, with slender stems. Wecan recommend this beet for bunching, as its color and shape make them quick sellers.
Early Egyptian.—The well-known early variety. Color extra dark, shape Bastians.—An extra early variety, much esteemed by market men East
Half Long Blood.—One of the best for winter use. The roots are only half as long as the Long Blood, but weigh as much on account of their thickness. They are always smooth and handsome, and their rich, dark'red flesh is very sweet, crisp and tender, never becoming woody, even in the exposed portions.
Long Smooth Blood.—The standard long late sort. Wery dark blood-red Early Bassano.—A good early variety, similar to Egyptian in shape, but of Swiss Chard, or Silver.—Used for its leaves.
Edmand’s Early Blood Turnip.—The best sort for general crop. In qual-
ity one of the finest, exceedingly dark, shape globular, having only one tap
Improved Blood Turnip.—An improved variety of the Early Blood turnip; of deep, blood-red color; fine form and flavor. An excellent market sort.
CROSBY EGYPTIAN.
CATTLE BEETS OR MANGELS.
Long Red.—A large, long variety grown for stock feeding. It stands up well above the Yellow Giobe.—Globular shaped roots. More productive than Long Red in shallow soil. Goiden Tankard.—Shape cylindrical, color deep rich yellow, flesh yellow circled with
Orange Globe.—We think this one of the best varieties of mangel wurzel grown for stock feeding. It has exceedingly small tops and few leaves; leaf stalks and blades green; roots medium sized, uniformly globe shaped, having a very small tap and few side roots; color of skin deep orange yellow; flesh white and of excellent quality. The roots grow almost en- tirely above ground, making them admirably adapted to shallow ground and very easy to
\y
EVERYTHING FOR THE GARDEN. 5
- CABBAGE.
—- ———
EARLY JERSEY WAKEFIELD.
Sure Head. A fine variety for main crop. A good shipper and sure header. Pkt., 5c.; oz., 20c.
Holland. The favorite winter cabbage with market garden- ers. It is as hard as a rock, and asmall head will weigh as much as a large head of any other variety. The leaves lap over and make a head in which there is no waste. Pkt., 5c¢.; 0Z., 30c.
Premium Fiat Dutch. This variety of late cabbage is a standard in all sections for winter use. Our selected stock is unsurpassed. It makes a large solid head which keeps long without bursting, and is adapted to a more varied climate than probably any other variety we grow. :
Our stock of Premium Flat Dutch has given excellent satis-
‘faction both north and south for many years, and its great pop-
ularity at home puts its merit beyond question. Pkt. 5c.;
0z., 20c. Large Late Drumhead. 5e.; oz., 1dc.
a
A late variety of large size. Pkt,
Start the children right. Set apart space in the yard for a garden. No matter how small a piece of ground, the child will derive both pleasure and profit from it. The patience and care which must be exercised is an education in itself while the nature study and good wholesome exercise are bound to be a benefit and create ambition.
PREMIUM FLAT DUTCH.
Early Jersey Wakefield Cabbage. Ourselect stock. This is one of the most important varieties in the list. Great care must be exercised in the growing of the seed to have it pure and true totype. We give especial attention to the growing of our Wakefield stock, and its uniform excellence is a source of grati- fication tous. Pkt., 5c.; oz., 25c.
Early Spring Cabbage. The earliest flat head. As early as Jersey Wakefield. Yields one-third more than the early pointed heads. Solid, uniform and finely grained heads. Stem is skort and extends but little into the head. Entirely free from any rankness of flavor. Pkt., 5c.; oz., 25c.
Early Winningstadt. An early variety of excellent qua) ity, not as early asthe Wakefield. Pkt., 5c.; oz., [5c.
Henderson's Early Summer. A standard summer variety We have the true stcck. Pkt., 5c.; oz., 20c.
Fottler’s Early Brunswick. An early fall variety, well known and popular. Pkt., 5c.; oz., 20c.
All Head Early. One of the finest early flat-head cabbages Pkt., 5c.: oz., 20c.
Early York. A standard pointed head variety, seconde early. Pkt., 5c.; oz., (Sc.
Early Dwarf Flat Dutch. An early cabbage of good size Heads are flat and very solid. Oz., 20c.; %ib., 75c.: Ib., $2.00.
Mammoth Rock Red. The largest heading of any of the red sorts, of deep rich color and excellent quality Pkt,, 5c.; oz. 25c.
HOLLAND CABBAGE.
Danish Ball Head. A good main crop vari ety: popular with many of the gardeners. Simi. lar to our Holland. but not so uniform in head ing. Oz., 20c.; % Ib., 75c.; Ib., $2.50.
Savoy Green Globe. Deep green. Pkt., 5c.: 0z., 20c.; Y% Ib., 75e.
Savoy Im. American. The finest flavored of all the cabbage family, large and solid. Pkt. 5¢.; 0z., 20c.; Y% lb., 75c.
NOTE THIS :
We exercise exceptional care in grow- ing and selecting our Cabbage seed. Not only are the plants grown from the best stock, but they are also inspected carefully before being put away for the winter. We can assure our customers thatit is impos sible to get better seed.
For the earliest supply, seed may be sown in September and the plants win- tered in cold-frames, or seed started in hot-beds or cold-frames early in the spring. For the fall crop the seed should be sown early in June, and the young plants trans- planted to the rows during the latter pari of July. One ounce of seed will sow 300 feet of drill; two ounces sown thinly should provide plants enough for one acre,
GARDEN, FIELD AND FLOWER SEEDS.
CARROTS.
Chantenay. Tops medium size; necks small; roots tapering slightly but uni- formly stump rooted and smooth; color, deep orange red; flesh very crisp and tender. Although this 1s a medium early sort, it furnishes roots of usable size as early as any, is a heavy cropper, and is undoubtedly one of the best for both the market and pri- vate garden, while its great productiveness makes it very desirable as a field sort.
Pkt., 5c.3 oz., 10c.
mellow soil.
the crop will be greater.
__St. Valery. a wide shoulder to a point.
oz., (0c. Early Short Horn.
tap root. CHANTENAY CARROT.
Danvers. Grown largely on account of its great productiveness and adaptability to all classes of soil. Tops medium sized, coarsely divided. The smooth and handsome roots are deep orange, of medium length, tapering uni- formly toa blunt point; flesh sweet, crisp, tender and of a deep orange color. This is a popular field variety, and although the roots are shorter they produce as large a bulk as the longer field sorts and are more easily harvested. Pkt., Sc.$ 0Z., 10c.
CARROTS—for Stock Feeding.
These are esteemed highly as a wholesome and nutritious addition to the winter feeding of stock when dependent on grain and dry forage. They are easily raised and keep in excellent condition when properly stored.
The most popular Improved Short White is thick at the shoulder, and tapers rather quickly, being from six to eight inches in length.
The Large White and Yellow Belgian are long and slender; as fully one-third to one-half of the root grows above the surface, they are, however, esaily pulled. They differ only in color of the flesh, as indicated by their respective names, ~°
Long Orange and St. Vallery (offered above) are aiso very productive in deep soils.
All Varieties of Field Carrot, Pkt., 5c.; &% Ib., 15c.; Ib., 50c.
CAULIFLOWER.
LEONARD’S SNOWBALL CAULIFLOWER.
A good late variety. Pkt., 5c.; oz., 0c.
- Large White Belgian. Grows one-third out of the ground. Root pure white, green above ground, with small top. Flesh rather coarse. ground, grow toa large size, and are extensively grown for stock feeding. Pkt., 5c.;
A fine early variety, good for home use. gardeners use this sort for bunching. Pkt., 5c.3 oz, 0c.
Guerande, or.0x Heart. Tops small forthe size of the roots, which are compar- atively short, but often reach a diameter of 7 inches, terminating abruptly in a small Flesh, bright orange, fine grained and sweet. S 1s aC for soil so hard and stiff that longer growing sorts would not thrive in it. When young, excellent for table use, and when mature equally good for stock. Pkt., Sc.; oz., (0c.
Improved Long Orange. The most popular of the older sorts for farm use on An improvement obtained by yearsof careful selection of the best formed and deepest colored roots of the old Long Orange. shorter than the Long Orange and smoother, but so uniform and true tnat the bulk of Pkt., 5c.3 0z., [0c.
Roots comparativel
It grows long, shape uniform, tapering from
The roots, on light, rich
Eastern market
This is a desirable variety
DANVERS CARROT.
Leonard’s Snowball. The leading cauli- flower among cauliflower growers, and un- questionably the purest strain of ‘‘ Snowball”
cauliflower seed to be had. Heads uniform, ~
of desirable market size and of snowy white- ness.
After seven years’ competitive tests it is pronounced by expert cauliflower growers to be the best for both early and late planting. Successful frame growers of cauliflower say that under glass culture our Snowball out- classes any strain of cauliflower seed known tothem. This strain of ours is their favorite for early, for late and for forcing. Stron recommendations, surely. Pkt., (5c; oz.. $2 25.
Large Algiers. A valuable late sort, sure to head, of the best quality, and very popular with market gardeners everywhere. Plant
large, but of upright growth, the leaves pro- —
tecting the heads so that they will endure un- injured a frost that would ruin other sorts. One of the very best of the late sorts. Pkt., 5c.5 oz., 80c.
Superior stocks are necessary to the prosperity of the market plant- er. The inferior article may be more attractive at the beginning,
because it costs less, but the supe- rior seed gives the more valuable
product. You cannot afford to do without the best.
EVERYTHING FOR THE GARDEN. T
CELERY.
Golden Self-Blanching. The best self-blanching sort. It acquires a handsome golden color without having to be hilled up, whic. makesita valuable market sort. Pkt. 5c.; oz. 25c.
White Plume. A good self-blanching sort, good for fall use, but does not keep well. Pkt. 5c.; oz. 25c.
Giant Golden Heart. This variety attains a large size, but still remairs crisp and tender. Itis a fine keeper and is the favorite on the Chicago mar- ket. Pkt. 5c.; oz. 25c.
Kalamazoo. This is the variety used by the celebrated celery grow- ers of Kaiamazoo, Mich., and is of great merit. Pkt. 5c.3 oz. 25c.
Perfection Heartwell. A finely flavored, good keeping sort, hardy and solid. Pkt. 5c.; oz. 25c.
Crawford’s Half Dwarf. The favorite variety in eastern markets, a good keeper of vigorous growth. Pkt. 5c.; oz. 25c.
Rose Ribbed Paris Self-Blanching or Golden Rose. This is a sport of the Golden Self-Blanching celery and possesses all the good qualities for which that variety has become so famous. It has the same beautiful rich gol- den yellow color, is self-blanching to the same remarkable degree, and differs only in color of the ribs. These area very attractive shade of rose, which deepens as the season advances. This ornamental feature gives the whole plant a most pleasing appearance that cannot fail to make it of great value for market, while no celery could be of finer quality. Pkt. 5c.; oz. 25c.
Pink Plume. Similar to White Plume, but having stalks suffused with pink. Pkt., 5c. ; 0z., 25e.
Giant Pascal. This is the best keeper of all the late sorts, very solid and crisp. This variety is unsurpassed for market garden. Pkt. 5c.; oz. 25c.
WINTER QUEEN. Most popular of all Celeries for winter.
It has the strong robust growth of the Giant Pascal, but the plants, being only of medium height, are of better length for bunching for market as well as more desirable for serving on the table. Their compact habit makes con- siderably less labor in earthing up the plants to blanch, and the rows can be planted more closely in the field. Of vigorous growth, each plant makes a large number of fine stalks (magnificent large heart of rich golden yellow) which are broad, thick and heavily ribbed. Stored for winter it isan excellent keeper. and when taken out the blanched stalks are firm and crisp; entirely free from stings, brittle and of sweet flavor. Most highly recommended, Pkt., 5¢.3; 0z., 25c.
GERMAN CELERY OR CELERIAC.
Large Smooth Prague. Has a large smooth root, and is the finest of all celeriac. Apple Shaped. Not assmooth as the above. but of good form. Pkt. 5c.; oz. 20c. 5 ; Turnip Rooted. This is the ordinary and well known variety. Pkt. 5c.3; oz. 20c.
CELERY PLANTS.
We are prepared to quote Celery Plants at the proper time. We arrange to have all the standard varieties. WRITE FOR
CUCUMBER.
Early Cluster. Vines vigorous, producing the bulk of the crop near the root and in clusters. Fruit short, uniformly thick end, dark green, mee a oe ES but paler at blussom end. A very productive sort. Pkt. 5c.; oz. 20c. CELERIAC.
Nichol’s Medium Green. A valuable and handsome variety, in shape between White Spine and Long Green. An excellent sort for pickles and useful for forcing. Very prolific. Fruit straight and smooth; color dark green, flesh tenderand crisp. Pkt. 5c.; oz., 20c.
Early Frame or Short Green. An excellent sort both for table use and for pickling. Fruit straight, handsome, smaller at each end, bright green; flesh tender and crisp, and makes fine pickles, Pkt, 5c., oz. 20c.
Jersey Pickle. Sixty days to make pickles. It is productiveand is Said to ‘‘green” better than any other variety, and to ‘‘hold color.” Over one hundred and fifty thousand bushels of small fruit of this va- riety are picked annually in Burlington county, New Jersey. No other sort is used, no other kind of seed could be given away. Early spring sowings will develop fruit of pickling size, two to three inches long, in sixty days. Early summer sowingsin thirty days. Pkt. 5c., oz. 20c.
Improved Long Green. Not so abundant a bearer as the preced- ing sorts, though recommended to all who put up their own pickles. Fruit long and slim, not surpassed in quality by any variety. Thisis not the ordinary Long Green but a much superior sort, being twiceas long and of hetter proportion. Pkt. 5c, oz. 20c.
Chicago or Westerfield Pickling. A variety much esteemed above all others by Chicago market gardeners, and grown extensively forthe large pickling establishments in this vicinity. Fruit medium length, pointed at each end, with large and prominent spines. Colora deep green. It combuie all the good qualities of an early cucumber. Pkt. 5c., oz. 20c.
Evergreen White Spine. Is the most profitable cucumber for the market gardener. Best for the greenhouse, hot bed or for outdoor culture. The earliest and most productive variety. Long, straight, and of rich deep green color throughout, brings more money per dozen on the street than any other variety. Pkt. 5c.; oz. 20c.
Arlington. A selection from the White Spine, being more point- edateachend. The young fruits are unusually crisp and tender, and are of very dark green color, so that the variety is considered by many
CHICAGO OR WESTEREFIELD’S PICKLING. to bethe best for small pickles. Pkt. 5c.; oz. 20c.
GARDEN, FIELD AND FLOWER SEEDS. __ ee 3
Send the address of your friends who are interested in a good garden and they will receive a copy of this Catalogue.
a TN \!
CORN.
Sweet or Sugar.
Culture. A rich, warm, alluvial soil is best, but excellent sweet corn can be raised on any good, ordinary soil if it is deeply and. thoroughly worked before planting. Give frequent and thorough but shallow cultiva- tion until the tassels appear.
Early Cory. This variety is the favorite for first early, and no other variety has Proved earlier. Pkt., 10c.3; % Pt., 5c.; Pt., 25c.; Ot., 30c.
White Cob Cory. This is an improvement over the Early Cory, as the cob is white, which gives it a finer appearance. It is as early as the Early Cory, and of excellent quality. Pkt., 10c.; 44 Pt., 15c.; Pt., 25c,; Qt., 30c.
Mammoth White Cory. The ears are twelve rowed, fully twice the sizeof the old Cory, white cobbed, and covered with very large white grains of good quality. No other sweet corn will find ready sale in a market which is supplied with Mammoth White Cory, and the gardener who wishes to get the cream of the trade should make his plant- ings of thissplendid novelty. Pkt., [0c.3 1% Pt., 15c.; Pt., 25c.; Qt., 30c.
Premo Sweet Corn, Earlier than Dwarf Extra Early Adams. No-corn was ever in- troduced that gave such general satisfaction as PREMO. It is acknowledged by expert corn growers to be the earliest pure Sweet Corn under culture. Notwithstanding the extreme unfavorable growing conditions this season Premo produced a good yield. It not only cambines all the merits of the leading early varieties, but it is also really superior to them allin size, qualityand yield. Premo can be planted fully as early as the Adams, for the young plants withstand slight frost, while other varieties are tender and the seeds will rot if planted before the soil becomes warm. ‘The stalks grow about five feet high, and are very vigorous, generally bearing two well developed ears to the staJk. Pkt., 10c.; % Pt., 15c.; Pt., 25c.3 Qt., 30c.
Extra Early Adams. This is an extra early field variety, but is much used as an early market variety, being sweet and juicy. Pkt., 10c.; % Pt., 15c., Pt., 25c.: Qt., 30c.
Early Minnesota. One of the standard early sorts. Ready for market two weeks later than Cory or Chicago Market. Pkt., 10c.; % Pt., 15c.; Pt., 25c.; QOt., 30c.
Chicago Market or Ballard. This is the largest and best early corn in existence, twelve rowed, white cobbed ‘and of exceed- ingly fine quality. Pkt., 10c.; 14 Pt., (5c.; Pt., 25c.; QOt., 30c.
Crosby’s Early.. An early corn of large size and choice quality. It has long been a standard variety. Pkt., 10c.; % Pt., 15c.; Pt., 25c.; Qt., 3Gc. :
Moore’s Early Concord. A well known early variety of large size, twelve rowed and of excellent quality. This makesa finemarketcorn. Pkt., 10c.; 4% Pt., i5c.; Pt., 25c., Qt., 30c. rae
Zigzag Evergreen. This fine new strain possesses the distinct characteristics which have made Stowell’s Evergreen so deservedly the favorite for main crop, but produces ears fit to use from one week to ten daysearlier, Pkt., 10c.; % Pt., 15c.; Pt., 25c ; Qt., 30c. ;
Old Colony. This variety is two weeks earlier than the Evergreen, and almost as large. It is considered the best and sweetest by canning factories. A fine paying variety for market, Pkt., 10c.; % Pt., 15c.; Pt., 25c.; Qt., 30c.
Stowell’s Evergreen. The best late corn for all purposes. It hasbeen a leader
»
fit a
ie
‘mn Q YN et)
EARLY MINNESOTA.
for many years as a main crop variety, and is unexcelled asa market corn. Pkt.,
10c.; % Pt., 15c.; Pt., 25c.; Qt., 30c, oe ae
untry Gentleman. This is the finest of the medium late varieties. © rows a Bese with a long slender kernel of delicious flavor. Thiscorn is bound to sell when properly known, as its quality is the best of all. Pkt., 0c. %Pt., 15c. Pt., 25c.; Qt., 30c.
Mammoth Sugar, A large late variety having ears of mammoth size, 14 to 20
i cellent, not exceeded by any variety. A good canners’ variety, ee Siite eaihed and very uniform. ne week later ae Stages HVGrEreen, Pkt., 10c.; % Pt.. 15c.; Pt., 25c.; Qt., 30c. i 3 me
i [ his corn, when in condition for the table, cooks remarkably ene sine orate is black or bluish-black. It is surpassed by none in tenderness. For family use it is considered by many the most desirable of the medium late sorts. It does especially well for second early in the south. Pkt., 10c.; % Pt., I5c.; Pt., 25c.; Qt., 30c.
NOTICE OUR FIELD CORN AND FOD- DER CORN PAGE 30; ALSO POP CORN,
BROOM CORN AND KAFFIR CORN.,
EVERYTHING FOR THE GARDEN.
Way why CORN SALAD.
CRESS.
Curled, or Pepper Grass. This small salad is much used with lettuce, to the flavor of which its warm, pungent taste makes a most agreeable ad- dition. The seed should be sown in drills about sixteen inches apart, on very rich ground, and the plants well cultivated. It may be planted very early, but repeated sowings are necessary to secure a Succession. Keep off insects by dusting with Pyrethrum Powder. Pkt., 5c.; oz., 10c.
True Water. This is quite distinct from the last, and only thrives when its roots and stems are submerged in water. It is one of the most delicious of stnall salads, and should be planted wherevera suitable place can be found. The seed should be sown and lightly covered in gravelly, mucky lands, along the borders of small, rapid streams. The plants will need no subsequent culture, as under favorable conditions they increase ve rapidly by self-sown Seed and extension of the roots. Pkt., 5c.; oz., 30c.
Try These Odd Varieties.
Large-Rooted, or Coffee. much larger, smoother, whiter and proportionately shorter roots than the old
CORN SALAD.
Fetticus, or Lamb’s Lettuce. : e spring months as a substitute for lettuce, and is also cooked and used like spinach. In warm weather the piants will mature in four to six weeks. low drills about one foot apart, during August and September. : should be firmly pressed over the seed in order to secure prompt germination. On the approach of severe cold weather, cover with straw or coarse litter. will also do wellif the seed is sown very early in the spring, and, like most salad plants, are greatly improved if sown On very rich soil; indeed, the ground can scarcely be made too rich forthem. Pkt., 5c.; oz., [0c.; 2 0z., [5c.
This small salad is used during the winter and
If the soil is dry it The plants
This page contains odd kinds. but each article makes a deli- cious vegetable.
: v 7 y) yar, Di Q ws
it TRUE WATER CRESS.
CHERVIL.
: A hardy annual, worthy of more general use for flavoring and garnish- ing. The curled variety is even more beautiful than parsley, and can he used to great advantage in beautifying dishes of meat and vegetables.
CULTURE. Sow in early spring in rich, well prepared soil, and when plants are well established transplant to about one foot apart.
Curled. Greatly superior to the old, plain variety, being earlier, more handsome, and having fully as fine perfume and flavor. Pkt., 5c.; 0z., 10c.
CHICORY.
Our stock is the improved type, with very
CHERVIL. kind, The dried and prepared roots are used quite extensively as a substitute
or adulterant for coffee. Sow the seed as early in the spring as the ground can be prepared, in rather light, moderately rich sox, in drills fifteen inches apart for garden, andtwototwoand one-half feet for field culture. When the plants are sufficiently large, thin to four to six inchesapart in the row. Keep clear of weeds, and in the fall dig the roots, slice them anddry in an apple evaporator or kiln constructed for the purpose. Where the roots are grown in quantity for the manufacturers of the “prepared” chicory, they are usually brought to the factory in the “green” state and there dried in kilns constructed for the purpose. Pkt., 5c.; 0z., 20c.
DANDELION.
“ The dandelion is a hardy perennial plant. resembling en- dive, and affords one of the earliest and most healthful spring greens or salads. Sow early in spring in drills 12 inches apart, and thin out to 6 inches in the drills; the following spring it will be fit for use.
Broad Leaved. Pkt., [0c.; oz., 40c.
§ Improved Thick Leaved. An improved thick-leaved va- . tiety. PkKt., 10c.; oz., 40c. 2
EGG PLANT.
Improved New York Purple Spineless. Very large and smooth, fine dark color. Ours is the Pricics: pian: aneet pre- ferred by our market gardeners, both east and west. Wehave % made the most careful selection possible of our stock plants, and know it to be unsurpassed for the market. Pkt., 5c.; 0z., 40c.
Black Pekin. A fine variety, bearing large, round, deep re fruits, fine grained, and of superior quality. Pkt., 5c.; 0z., 30c.
Early Long Purple. Early, hardy and productive; excel- lent forthe table. Pkt., 5c.; oz., 30c. _ e
Egg Piant is one of the best paying of all the garden crops. It is tender at the start, but anyone who will exercise care can grow it.
ee IMPROVED NEW YORK SPINELESS EGG PLANT.
Sow the seed in shal-
10 GARDEN, FIELD AND FLOWER SEEDS.
AROMATIC, MEDICINAL AND POT HERBS.
General Cultural Directions.
Most of the varieties thrive best on rich, sandy soil, which should be care- fully prepared and well cultivated, as the young plants are for the most part delicate and easily choked out by weeds. Sow as early as the ground can be - made ready, in drills sixteen to eighteen inches apart. taking pains that the soil is fine and pressed firmly over the seed ; or they may be planted as a sec- ond crop, the seeds sown in beds in April, and the plants set out in June. Most of them should be cut when in bloom, wilted in the sun and thoroughly dried in the shade.
Pkt. 0z. Lb. Annis..... Raietecreeerisaree Rana sR SE PINE $0 05 $0 15 (Cent W Eo 56000500 000000 Gund duno.peoO.nO00R 05 05 a (SoppehaG(Seynognosoad duo udne soso sao000 060 05 05 ee: IDM losess.goso bromaveya ee (aletenoveicte Tnicitne lars’ ole serslevetetmets 05 10 $1 00 Je (oswalaloyhilal aamoisdon Sond soaosdeodeod oa00dC 05 25 Rgee Sweet Marjoram..........-.. 20+ eee eee 05 15 Sage—Broad Leaf........--..---e eee eee 05 20 CE tiddo)s Mone sac a eeenodu nods Os boopmene us 05 15 Savory, Summier..........+00. 012 eee eee 05 25 cane TVA GG GoBsoaGDODODD Dood gbo0 Bbap HONE 05 20 Kens (CermborloSousoswinaboss socoodoouss done. sate écs0 40 GARLIC. Rorseradish Roots......:....-.+--+--++-* ahaa eon u she tee Per Doz, 25c
KALE.
One ounce of seed will sow a drillof about 200 feet.
Siberian Kale, or Winter Sprouts.—This is also called German Greens and is sometimes sold for Dwarf Green Curled Kale, but it is not as curly as the Dwarf Curled Kale and is different from it in color. The leaves are smooth in the center, having a fringed edge. Color hasa bluish tinge, not the deep green of the Dwarf Curled Kale. Pkt., 5c.; 0z., 10c.; Ib., 60c.
Dwarf Green Curled German.—Leaves yellowish green, very compact and beautifully curled; sow in September for winter and early spring use. Pkt., 3c.; % oz., 5c.; oz., 10c.; 4% Ib., 25c.; Ib., $1.00.
Dwarf Curled Scotch.—Leaves bright green, curled, very tender and fine flavored; an excellent sort for private gardens. 02z., 10c.
eee KOHL-RABI.
(it ANY ps y One ounce of seed will sow a drill of about 150 feet.
Earliest Erfurt.—A white tender variety, with a smooth root and very short top; the best variety for outdoor culture. PkE., [0c.; oz., 35c ; Y Ib., $1.00.
Early Short Leaved White Vienna.—The finest for market. Flesh white andtender. Oz., 20c.; ¥ Ib., 75c.
Early Purple Vienna.—Bluish purple; similar to the above, except in color. Pkt., 5c.; oz., I5c.
LEEK.
Large American Flag. Large, hardy and of excell- ent quality. Pkt., 5c.; oz., 15c.; % tb., 35c.; Ib., $1.50.
Giant Carentan.—The favorite market variety, large, thick stem, of mild flavor and attractive appear- ance. Pkt., 5c.; oz., 15c.; Y% Ib.. 35c.; Ib., $1.50.
Musselburgh.—Grows to a very large size, with broad leaves, spreading like a fan; hardy, of excellent
KOHL-RABI. quality. Pkt., 5c.; oz., 15c.
London Flag.—An old and popular sort; one of
the hardiest and best for winter use. Pkt., 5c.; oz., 15c.; 4% Ib., 35c.; tb., $1.50.
MARTYNIA.
The Martynia, or Unicorn Plant, is quite ornamental in growth, quickly forming large bushes and bearing handsome gloxinia-like flowers. When young and tender the seed pods make excellent pickles. and as they are produced in great abundance, three or four plants will suffice for an ordinary garden.
Martynia Proboscidea. The best variety for pickles. Pkt., [0c.; oz., 30c.
ENDIVE.
One of the most refreshing and attrative of all autumn and winter salads. Sow seed from the middle of June until the end of August.
GER., Hndivien. ER., Chicoree. Sp., Hndivia.
Green Curled. Beautifully curled, tender and crisp. Pkt., 5c.; oz., 15c.; Y Ib., 40c.; Ib., $1.00.
Moss Curled.—More finely curled, and a heavier and more dense plant than Green Curled. Pkt., 5c.; 0z., 15c.; 4% Ib., 40c.; Ib., $1.50.
White Curled.—Very tender when cut young; blanches readily. Pkt., 5c; oz.,15c.; 4% tb., 40c.; Ib., $1.00.
Broad=Leaved Batavian. (Escarrole.) This variety is chiefly used in soups and stews; requires to be tied upin blanching. Pkt., 5c.; oz., 13c.; 14 lb., 50c.
F gts
EVERYTHING FOR THE GARDEN. 11
LETTUCE.
Black Seeded Simpson. We havea finestrain of this lettuce carefully selected. This is the most popular sort on the market. Forms ijarge, loose heads. Leavesthin and exceedingly tender, of light green to golden yellow. Best sort for forcing or outdoor early planting. Pkt., 5c.; oz., 10c.
Early Curled Simpsen White Seed. Formsa close. compact mass of curly yellowish green leaves. Earlier than the head varieties. Good for cold frames or early planting for outdoors. Pkt., 5c.; 0z., 10c.
Grand Rapids Forcing. Preferred by a great many to the Black Seeded Simpson, on account of being a tougher leaved let- tuce. This makes ita fine sort for shipping, as it does not break so easily, and stands longer without wilting. Fine appearance and strong grower, and will not rot as quickly as other sorts. A quick grower. Pkt., 5c.; 92., f0c.
New York. Is of unusual size and solidity of head, with but little tendency to run to seed. We have had it, time and again, eighteen inches in diameter, and weighing nearly four pounds. with heads almost as solid asan Early Summer cabbage, which in = general form it somewhat resembles. The variety blanches itself
BLACK SEEDED SIMPSON LETTUCE. naturally, is crisp, tender and of excellent flavor. PKt., 5c.: oz., (0c. The Deacon. A magnificent butter head lettuce. It stands the hot weather without becoming bitter or running to seed, and
bears fine, large heads of superb quality. Light green outside, and, within, a beautiful cream yellow of delicious, rich, buttery flavor. Highly recom- mended for home or market use. Pkt., 5c.; 0z., 10c,
Prize Head. A good header. Solidand large. Pkt., 5c.; oz., 1Oc.
California Cream Butter. A grand, good butter lettuce. The heads are of good size, round and solid; outside, medium green; within, the leaves are a rich cream yellow color. Rich and buttery in taste. Pkt., 5c.; oz., lOc.
Big Boston. This variety is identical in color, shape and general appearance with the famous Boston Market lettuce, but is double the size. It is about one week later in maturing, but its solidity and greater size of head will make it a most valuable sort. A most desirable variety, either for forcing in cold frames or open ground planting. The Big Boston is sure to be wanted by market gardeners and trucksters, because it always produces large, solid, salable heads, and will commend itself to amateurs because it heads up well at all seasons of the year, and is of crisp, tender quality. Pkt., 5c.; oz., i0c.; Y-Ib., 40c.; Ib., $1.50.
__ Hanson. Heads very large, from two to three pounds each; hearts quickly and stands the summer well; quality excellent. Pkt., 5c.; 0z., 10c.
Wonderful. Introduced four years ago and continually growing in favor. The large, white heads resemble cabbage in their solidity, and frequently weigh two and three pounds each. The quality is superb, being crisp, rich and tender. It withstands the heat well, making a fine variety for all seasons. == SS SS
Pkt., 5c.; 0z., (0c. : PRIZE.HEAD,'
There is no green vegetable more beneficial for toneing up the entire system. Lettuce used as a salad either alone or as a mixed salad has no equal, Also for garnishing meats and side dishes there is nothing more effective. The ease with which it iscared for is also quite a consideration. Planted early and resown once or twice during the summer, one may have this excellent green vegetable through the entire season and at less trouble than almost any other variety.
Chartier. It makesa very large, firm head, almost as hard asa cabbage, is very tender and crisp, and has a peculiar, fine flavor. It is of a beautiful green color, and the outer edges of the leaves are tinged with brown. It withstands the summer heat well, and is slow to run toseed. Pkt., 5c.; oz., iOc.
Sys Early Tennis Bail, White Seed. A good early sort, and used ah KZ x largely by eastern gardeners for forcing. Pkt., 5c.; oz., (Oc.
Early Tennis Ball, Black Seed. A good lettuce forearly use. The heads are small, but are very crisp and solid. Pkt., 5c.; oz., (0c.
Early Curled Silesia. A very tender sort, with fine curled leaves. Pkt., 5c.; oz., (0c.
Boston Curled. Curled leaves of good quality, a popular variety among eastern growers. Pkt., 5c.; oz.,[Oc.
: Defiance. Of a light green color, with the outer edge of the leaf slightly curled. Makesa large head. Pkt.. 5c.; 0z., (0c.
: Hubbard Market. A large heading variety, good for either fore- ing or sowing in open ground. Pkt., 5c.; oz., {Oc.
Paris White Cos. The Cos lettuce differs entirely in shape from the other varieties, the head being elongated and of conical form. eight or nine inchesin height, and five or six inches in diameter. The outer coloring of this variety is yellowish green. To be had in perfection it requires to be tied up to insure blanching. Millions of this variety are annually grown to supply the marketsof London alone. Pkt., 5c.; oz., 10c.
All Seasons. One of the best all head lettuces, standing the hot sun better than any other sort. Slow toseed. Handsome; enormous size; color, light green.
Denver Market. This is a fine crisp, crimpled head variety. It : ee has a slight tinge of red at the edges of the leaves. The ribs area HANSON. waxy white, being tender and free from bitterness.
12 GARDEN, FIELD AND FLOWER SEEDS.
MUSK MELON.
_ Rocky Ford. This new musk melon is similar to the oval strain of Netted Gem. The strain here offered originated with the melou growers in the vicinity of Rocky Ford, Colorado, who have shipped this melon from that distant western point to eastern mar- kets. The melons grown by them are so fine in quality as to out- sell all others, and the demand for such melons has been far be- yond the supply. Pkt., 5c.; oz., (5c.
Skillman’s Netted. An excellent early melon, with fine ten- der flesh. Pkt., 5c.: oz.. 15c.
Bay View. A large, prolific and fine flavored green fleshed melon of recent introduction. and from all reports of great value, and likely to become a standard sort. It is stated that with ordi- nary cultivation this variety has produced melons weighing ten to fifteen pounds. Pkt., 5c.: oz., (5c.
Netted Gem. The best early melon known. Shipped to every market of note, in great quantities, every year. Medium size, but of excellent favor. Pkt.. 5c.: oz , 15c.
Jenny Lind. A goodearly melon. Pkt., 5c.: oz., 15c.
Green Fleshed Osage. Quality of the best; flesh a beautiful pea zreen; alsoa good shipper. Pkt., 5c.; oz., 15c.
Early Hackensack. A green fleshed nutmeg, of excellent form. A very early and splendid melon. Pkt., 5c.; oz., (5c.
Hackensack. A large. deeply netted melon, flattened at the ends, of most delicate flavor and very productive. Pkt., 5c.; oz., Sc.
Champion Market. Shape almost round, deeply /ribbed; skin heavily netted; flesh light green, rich and sweet. Very productive, and nearly as eatly as the Netted Gem. An excellent shipping variety. Pkt., 5c.; oz., (5c.
Chicago Market. Fruit large, round or slightly oval, with very shallow depressions and covered with dense netting. Flesh green, medium texture, very thick and sweet. The variety is an improvement on Montreal, and will suit those who like a large, sweet, green fleshed sort. Pkt.,5c.; oz., (5c.
Paul Rose. A new soft, possessing several characteristics of the Osage; form slightly oblong, distinctly ribbed, slightly netted; color, when unripe a deep green, turning a golden tint: flesh salmon, and so thick as to show an unusually small seed cavity; flavor like Osage. A showy variety. Pkt., 5c.: oz., (5c.
Banquet. A medium sized variety, nearly round, flattened at the ends, densely netted; flesh dark salmon, uniformly thick: flavor un- surpassed, rivaling the Netted Gem. Pkt., 5c.; oz., 15c.
CHICAGO MARKET MUSK MELON. Tip Top. A new melon of recent introduction and very de-
serving, All who have tried it have pronounced it one of the fin- est. Flesh yellow and sweet. Pkt., 5c.; oz., 15c.
Surprise. This old variety is still highly esteemed. Fruit nearly round. but slightly lobed and netted. Skin yellowish white. Flesh deep salmon color, very sweet and high flavored. Pkt . 5c.; 0z., (5c.
Delmonico Musk Melon. A new oval-shaped musk melon of large size, finely netted, and has beautiful orange-pink flesh, and is pronounced by connoisseurs to be a melon of par excellence. We offer the Delmonico to our customers with the full assurance that it will be found a most delicate variety. Pkt., 5c.; oz., I5c.
The Princess. This new melon is one of the best for the home garden. In shape it is nearly round, with heavy netted dark green skin. The flesh is salmon color, thick, sweet and luscious. The melons ripen early, grow to good size, often weighing eight toten pounds. The vines grow vigorously and are very productive. Wecan fully recommend The Princess to market gardeners who supply their home markets, and to all who desire to grow 2 good melon for their own use. Pkt. 5c.; 0oz., 5c.
Osage, or Miller’s Cream. A remarkably fine variety, and a very profit- able sort for market gardeners, as it is fully established as a standard sort and will ever remain so. It is of medium size, oval in form, dark green in color, handsomely netted and slightly ribbed. The flesh is extremely and uniformly thick, of firm texture, rich salmon in color: highly flavored and delicious to the rind. Cavity very small. It isa remarkable keeper anda good shipping melon. Pkt., 5c.; oz., 15c.
Emerald Gem Melon. The Emerald Gem is entirely unlike any other musk melon yet introduced. The melons are about the size of the Netted Gem, but, unlike that variety, the skin, while ribbed, is perfectly smooth, and of a very deep emerald green color. The flesh, which is thicker than any other native melon of the same size, is of a suffused salmon color, and ripens thoroughly to the thin green rind, which is distinctly defined. The flesh is peculiarly crys- taline in appearance, and so very juicy, sweet and rich that it almost drops to pieces. It matures very early, and is quite productive. Pkt., 5c.; oz., (5c.
MUSHROOM SPAWN. _
For the money invested, no more profitable crop. Once started, it is \ easy tocontinue. The supply never equals the demand, so that a market is easily secured.
“English. 1 1b. Bricks, 25c., 5 for $1.00. THE OSAGE MUSK MELON.
A a eae ee Te
EVERYTHING FOR THE GARDEN. 13
WATER MELON.
Gas i, << SWEETHEART WATER MELON. Mp diehl B\ SORA
This new melon is early, large, handsome, heavy and productive. The shape is oval and the color mottled light to very light green. Flesh bright red, solid, but tender and very sweet. We have a very fine stock grown from selected stock seed procured from the originator, hence it is as pure and true as the original. Pkt 5c., oz. 10c.
Black Spanish. Large, roundish, nearly black; dark red flesh; early. Pkt. 5c., oz. (0c.
Florida Favorite. A very large, long melon mottled dark green with stripes of lighter shade Rind thin but firm; flesh very bright, deep red very sweet, tender and excellent. A very popu: lar variety inthe south. Pkt. 5c., oz. {0c.
Cole’s Early. Very hardy, a sure cropper and extremely delicate in texture of flesh, which is of a dark red color; rind is thin and extremely brittle, hence not desirable for shipping pur- poses, but possessing all the other most desirable features. We highly recommend it for home use. Medium size, nearly round; rind green striped with lighter shades. Pkt. 5c., oz. (0c.
= Dixie. A popular market sort, vine vigorous
SSS large growingand hardy; fruit medium sized tc
SWEET HEART WATER MELON, large, about one-third longer than thick. Color
of skin dark green, striped with a lighter shade
rind thin but tough; flesh bright scarlet, ripens closely to the rind, is of the best quality and free from the hard, coarse center which is so objectionable a feature of many shipping melons. Pkt. 5c.,0z. (0c.
Phiuney’s Early. Few, if any, of the early sorts of recent introduction surpass this old favorite. Itis first to ripen, of good size and productive; shape oblong; rind a distinct mottled color; the fesh is a deep red; a first class early market melon. Pkt. 5c. 0z./0c.
Vick’s Early. This variety is prized for its earliness. It is oblong in shape, smooth, with a very dark skin, rather small in size flesh bright pink, solid and sweet. It makes a good extra early market or home garden melon. Pkt. 5c.; oz. [0c.
Seminole. An exceedingly productive, extra early variety, of large size. Fruit oblong in shape, flesh solid, ripening clear up to the rind, vivid crimson, crisp, sugary and of delicious flavor. Pkt. 5c.; oz. 10c.
Gypsy, or Georgia Rattlesnake. One of the largest varieties and stands shipment long distances. Fruit cylindrical, square at the ends, smooth, distinctly ee and auuried light and dark green. Flesh bright scarlet and very sweet. Pkt. 5c.; oz. 10c.
Triumph. A new southern variety. The fruit is uniformly large, nearly round, dark green. indistinctly striped with a lighter shade; rind thin and firm, ed itan excellent shipper. Flesh bright red and of good quality. Pkt. 5c.; oz. 10c.
Boss. Early and very large;a good shipper. Pkt. 5c.; oz. 0c.
Ice Cream. Medium sized with very sweet, scarlet flesh. A good variety for main crop. Pkt. 5c.; oz. 10c.
Kolb’s Gem. Vines of medium size, but remarkably vigorous and healthy. Leaves of medium size, deeply cut with a peculiar frilled edge. Fruit of the lar- gest size, round or slightly oval, marked with irregular mottled stripes of dark and light green. Outer rind or shell exceedingly hard and firm, making ita good sort for shipping long distances. Flesh bright red, solid, a little coarse, but sweet
Seiten Wee onic i eee
a
Pt Se01 Red Bottom Sets..$0 15 $0 25 White Bottom Sets. [5 25 Yellow BottomSets 15 25 Genuine Top Sets.. 20 35 Winter Top Sets... 15 25 Potato Onions...... 20
White Multipliers.. 20 35 Shallotsiss: sc. 0 a.e 15
Yellow Multipliers. 15 25
Onion Sets should be planted as early in the Spring as convenient, to obtain early green onions but they may be setat any time up to June Ist. Set in rows a foot apart and three to four inches be- tween them in the row. Any good soil will suit them. When grown in quantity, high cultivation is given in order to for ward the crop for an early market. They are ready for use as soon as ; SoS SES é the bulbs begin to be of
fair size. Those not used RED BOTTOM SETS. WHITE BOTTOM SETS. YELLOW BOTTOM SETS. in green condition will Z = ripen early in July and make nice Onions. Potato and Top Onions are grown from bulbs only, growing in clusters. These clusters are separated and the smaller ones kept for seed. There is no crop which pays better than the first load or so of green onions in the market. Onion Sets will make this crop for you. Why not grasp the opportunity offered? Our Sets are carefully grown and choice; they will give the largest returns for the money invested if the product is sold, or, excellent green onions for home use at a time when a fresh green vegetable is needed.
14 GARDEN, FIELD AND FLOWER SEEDS.
CHOICE ONION SEED. ae
FLAT YELLOW DANVERS.
Large Red Wethersfield. We have a very fine and select strain of this sort. Color is deep purplish red, flesh white, moderately grained and very firm. Yields an enormous amount per acre, and is one of the best
winter keeping onions.
Extra Early Flat Red. This variety matures from ten days to two weeks earlier than the Red Wethersfield. Thecoloris a deep rich red, fine grain and close. The onion is solid and heavy and isa fine sort where
the seasons are cold and short.
Southport Red Globe. Thisisa fine keeper. Large size and consid- ered one of the best red onions. Flesh is fine grained, very mild and
tender.
White Portugal. American Silver Skin. This is the best sort to sow —for onion sets or for pickling. When sown thickly for either it makesa small, round, tard bulb. When grown for large onions they are very flat in shape and mild and pleasant in flavor.
Philadelphia Silver Skin. Very desirable for family use. Flavor mild and pleasant. Skin silvery white.
best keepers.
Southport White Globe. This grows to a very large size andis a perfectly globe shaped onion. Color isa clear pure white. This variety is used by the Chicago market gardeners entirely for bunching. A fine
keeper.
WHITE PORTUGAL.
/
Early Flat Yellow Danvers. A good variety, but not as round or quite as early as the Yellow Globe Danvers. Very productive.
3 Yeliow Strasburg, or Dutch. One of the oldest varieties. Bulbs quite flat, of good size, skin yellow, flesh white, of mild flavor,and keeps well. This is the variety that formerly was used very extensively for growing yellow onion sets, and while still good for that purpose, it has of late years been nearly superseded by the Yellow Danvers.
Australian Brown Onion. Is of medium size, wonderfully hard and solid, and most attractive for market, both as to form and appearance. The color of the skin is a clear amber brown. So widely contrasted from any other onion is this color that it will be noticed on the market, and when once bought, purchasers will be likely to return and call again for ‘“‘those beautiful brown onions.”
Prizetaker. Grows to an immense size and for fall marketing is unexcelled. Hand- some bulbs of a rich yellow color and fine globe form.
Yellow Globe Danvers. This fine onion is of large size. An early and abundant cropper. Bulbs very thick, flat or slightly convex bottoms, full oval top with small neck and rich brownish yellow skin.
Southport Yellow Globe. A large, perfectly shaped Globe onion and an excellent onion for keeping throughout the winter. A very heavy cropper, handsome in appear- ance and good dark yellow color. ~
Sets grown from this sort are the
RED WETHERSFIELD.
Good Onion Seed costs more to grow than poor. Do not try and
save a few cents on the seed when the result to the crop may mean many dollars.
FOREIGN ONIONS.
Extra Early Pearl. A very fine, Italian variety that grows quickly to a good marketa- ble size. Very popular, particularly in the south. The bulbs are round, flattened, witha delicate, pure white skin. Flesh very mild and pleasant in flavor. It is claimed to excel most other onions of Italian origin in keeping qualities.
New White Queen is a fine early silver skinned variety, of beautiful form and rapid growth, and possessing fine keeping qualities. Seeds sown in early spriug will produce onions from one to two inches in diameter in early summer, or if sown in early summer will be fit for use by autumn.
White Victoria. A beautiful, large round variety with silver white skin, but sometimes of a delicate light rose color; flesh juicy, sweet and milky white. A good keeper.
White Barletta. When matured, the tops die down, leaving beautiful and perfect little bulbs. The color is pure white, flavor mild and delicate, perfectly adapted for pickling and table use, and makesa pretty bunch onion, especially if grown by the transplanting method.
Prices of Foreign Onions, Pkt., 5c; Oz., 10c; 14 Ib., 30c.
ONION PRICE LIST.
Pkt. Oz. 1 Ib. KY Australian Brown...... $005 $010 $030 Wi AW \\ Early Flat Yellow Dan- | WIS CH OBOREIBC Os So Gocone 5 10 25 | /
BUTE. 2)... eens 5 10 25 SOUTHPORT Prizetaker ...........-.. 5 i0 30 ELLOW GLOBE. Yellow Globe Danvers... 5 10 25 Southport Yellow Globe 5 10 30 Southport Red Globe.... 5 10 30 large Red Wethersfield 5 10 30 Extra Early Flat Red... 5 10 30 Southport White Globe. 5 15 50 White Portugal......... 5 15 50 Phila. Silver Skin....... 5 (5 50
EVERYTHING FOR THE GARDEN. 15
OKRA OR GUMBO.
This vegetable is too little grown, as its green pods impart a fine flavor and consistency to soups and stews; the pceds can also be dried for winter. It is universally used throughout the south, and is as easily raised in the north. So delicious is the flavor that when once used it will be grown every year.
Lady Finger. The plants are uniform in growth, and with their large hibiscus-like flowers make a pretty sight. The plants produce long, slender pods. PKt., 5c.; 0oz., 10c.
Dwarf Prolific, or Density. A fine new variety, much dwarfer than the ordinary dwarf okra, and much more productive. Short, thick pods. Pkt., 5c.; oz., 10c.
White Velvet Okra. The pods are perfectly round, smooth and of an attractive white vel- vet appearance; of superior flavor and tenderness. PkKt., 5c.; 0z., 15c.
Tall Green. A favorite at the south; called also Perkins Mammoth Long Pod. PkK*., 5c.; 07., 10c,
DO NOT FAIL TO TRY OUR FINE PEA, DUKE OF YORK, shown on next page. ONCE USED NO OTHER WILL SUFFICE.
FOR FLOWER
SEEDS SEE
PARSNI P. PAGES 24 to 27.
Long White Dutch, or Sugar. Roots very long, white, smooth, tender, sugary and of most excellent flavor Very hardy, and will keep through winter without protection. PEt, 5e.3 oz., 10c.3 2 0z., 15c.
Hollow Crown. Roots comparatively short, with a very smooth, clean skin. The variety is easily distinguished by the leaves arising from a depression on the top or crown of the root. Pkt., 5c.; oz., 10c.; 2 oz., 15¢.
Guernsey. The best sort for heavy, black soils. In the vicinity of Chicago, where the soil is exceedingly rich, this is the variety needed, as it makes a fine shaped root
which does not grow too long. PkKt., 5c.; oz., 10¢c. PARSLEY.
Fern Leavec. This sort has a peculiar, fern shaped leaf. It is not so desirable as the more curled sorts. Pkt., 5c.; 0z., 10c.
Hamburg Rooted. The stand- ard rooted sort. The leaves are used for soup greens, and the roots, when sliced, are much es- teemed. PkKt., 5c.; oz., 10c.
Double Curled. The standard sort for outdoor culture, also high- ly prized by.market gardeners for CHAMPION MOSS CURLED. fic greenhouse. PkKt.,5¢€.: 0z,,
c.
Champion Moss Curled. A very fine curled variety. One of the handsomest for garnishing purposes. The exceedingly curled leaves make it desirable. PkKt., 5c.; 02,
‘} PEPPER.
Sweet Mountain. Plants very vigor- ous and productive, growing upright, with moderately large leaves. Fruit very large, long, often 8 inches or more in length, bytwoin diameter, verysmooth and handsome, being, when unripe, ofa Cr bright, deep green color. entirely free YY NW \ from any purple tinge, and when mature, of arich red. Flesh very thick, sweet and mild flavored. Well suited to use as a stuffed pickle. PkKt., 5c.; % oz., 15c.; 0z., 25e.
Large Bell, or Bull Nose. A very large sort of inverted bell shape, suitable for. filling or: for a mixed pickle. Flesh thick, hard and less pungent than most other sorts. Pkt, 5c.; % 0z.,15¢.; 0z., 25c.
Procopp’s Giant. Very large, usually § to inches long and 3 inches thick. Bril- liant scarlet color, flesh thick, of pleasant favor. Pkt., 5c; %oz.,15c.; 0oz., 25c.
; Ruby King. An improved American sort, reaching the largest size, yet retain- ing the symmetrical shape of the smaller sorts. Pkt.,5e ; 4% 0z.,15c.; oz., 25e.
Large Squash. Fruit large, flat, tomato shaped, more or less ribbed, skin smooth and glossy, fiesh mild, thick meated and pleasant to the taste, although pos- sessing more pungency than the other large sorts. PkKt.,5c.; %o0z.,15c.; oz., 25c.
Golden Upright. The fruits are large and of a beautiful rich golden yellow,
tinged with a blush red. The peppers are mild and as pleasant to the taste as Ruby King. Pkt, 5c.; % 0z.,15c.; 0z., 25e¢.
Red Cherry. Plant tall, bearing a profusion of bright red, round fruit which is BELL, OR BULL NOSE. very pungent when ripe. The plant is very handsome and an ornament tothe garden. Pkt., 5c.; % oz., 15c.; 0Z., 25c.
Red Chili. Used in the manufacture of pepper sauce. Pods sharply conical, and exceedingly pungent when ripe. Requires a long, warm season. The plants should be started quite early in hot beds. PkKt., 5c.; % 0z., 15c.; 0z., 25e.
Yellow Chili. Similar in form to the Red Chili; more pungent, and of a very beautiful yellow color. Pkt., 5c.; %0z., 15c,; OZ,, Z25C.
Long Red Cayenne. A long, slim, pointed pod, and when ripe, of a bright red color. Extremely strong and pungent. Pkt, 5e.; % oz., 15c.; 0Z., 25¢.
Yl» Wh LY)
te YU Ul:
hl
“M/ Sf
N
Ss
i6— GARDEN, FIELD AND FLOWER SEEDS. ;
S 7 ~aZe LE... a Vy ep PEAS. D Seb y. y y Lei Ye TA SZ WS.)
Alaska.—The best early green seeded variety, The dark green color of the pods makes it an excellent pea for shipping long distances. Very early and uni- AW yew form grower. A popular sort with canners and shippers. First-class in every \\ \\ \\ respect. Height, 2% feet.
First and Best of All—Ahead of all others in earliness and productiveness. It has held the lead for many years on the Chicago market, and is the best first early variety forthe market gardener. It is very prolific, and ripens so uniformly that the vines can be cleaned at one picking. The most hardy.
Maud S.—A very fine extra early sort, hardy, produc- tive and of good flavor.
Tomb Thumb.—Early and prolific. An ex- cellent dwarf pea.
Duke of York.—A variety that excels all others for the market. This pea is not a novelty, but has been on the market for a number of years, although not as well known as some others. ~~ It can be classed with the Telephone, al- though it is
ay i
“|
uchearlier el more Gardeners dwarf who have
~ had both peas
say the Tele- phone is good, but late, and that the Duke of York fills a long-felt want in a medium early pea.
Advancer.—An old favorite with the market gardener. Quality _ excellent, very productive and easily picked.
_ Bliss Abundance.— Vigorous in growth, producing pods in great abundance, hence the name. Pods well filled with large peas of very fine quality.
ALASKA PEAS.
Heroine.—Vines are strong and vigorous and roduce an abundance of ne, large, well filled pods.
Horsford’s Market Garden.—A great favorite with the market garden- ers. Pods are large, well filled and of a very good color;anabundant yielder.
® Leonard’s Early Fa- vorite is somewhat taller in vine than American Wonder or Nott’s Excel- é sior, Consequently in the average garden it shows up better, making the grower feel that there will be some peas from the patch. It pods better than any of the real dwarf wrinkled sorts, and equals any of themin quality. We know of no early dwarf wrinkled pea that we can recom- mend so highly. It is our favorite in all par- ticulars as a dwarf early wrinkled pea.
Dwarf Telephone.—A splendid dwarf pea. The pods are very long, and are always well filled with peas of delicious flavor. Height of vine under high culture, 18 inches. It may be classed as a medium early pea.
PRICE LIST OF PEAS. Pkt. %Pt. Pt. Qt. Alaskan aceeiterticet $0 05 $010 $020 $0 30. First and Best of All 5 10 20 & Maid S::/--eenes s 5 10 20 Tom Thumb........ 5 10 20 Duke of York...... 5 10 20 30 Advancer. casi 5 10 20 30 Bliss Abundance..: 5 10 20 30 BIEKOINE:..).. scarce: 5 10 20 30 WoOrsfords (ceca wer ewe 5 10 :20 30 Leonard’s Har. Fav. 5 10 20 30 Dwarf Telephone.. 5 15 25 40 Champion of Engld 5 10 20 30 Duke of Albany.... 5 10 20 30 GradusorProsper’y 10 15 30 50 Everbearing........ 5 10 20 30 Shropshire Hero.... 5 10 20 30 English Wonder.... 5 10 20 30 American Wonder. 5 10 20 35 * i fbf Ex.Ey.Prem.Gem 5 10 20 35 ma 7, a VaittlerGeni.. ses 5 10 20 35 INI ith Nott’s Excelsior,... 5 10 20 35 Telephone... .......« 5 10 20 30 Telegraph.......... 5 10 20 30 Sharpe’s Queen .... 5 10 20 30 Black Eye Marrowfat 5 10 15 25 Large. White Mar’f. 5 10 15 25 Yorkshire Hero.... 5 10 20 30 Pride of Market.... 5 10 20 30 Stratagem.......... 5 10 20 30 Zs Imp. Sugar Marrow 5 10 15 25 Me, ‘sy LRA tishac sano cose 5 10 20 30 a: Long Isl. Mammoth 5 10 20 30 LEONARD'S EARLY FAVORITE.
4
Tee ee ee ea ee
EVERYTHING FOR THE GARDEN. 3 17
PEAS.— Continued.
CHAMPION OF ENGLAND.
Champion of England. For many years this has been one of the standard large late wrinkled sorts. In quality few varieties equalit. Its greatest drawback as a market variety is its tall vines, which invariably need brush, and gardeners find this too expen- sive. For home use, however, it is unexcelled.
Duke of Albany. Like Telephone but a better variety. Vines are dwarfer and stronger and pods are larger and better filled. Everbearing. Fine for family use. Peas large and sweet.
~ Shropshire Hero. Bearing a great abundance of large handsome pods makes this a most desirable sort. Pods long, well filled, and peas of fine flavor.
English Wonder. About ten days later than the American Wonder and much longer, straighter and broader pods. Peas large and of fine flavor. ;
Gradus or Prosperity Peas. This extra early pea is unsurpassed in quality, being the greatest advance yet made in the extra early peas, the pods very closely resembling the Telephone in size and shape, and containing from six to eight peas of excellent flavor. Ripening very quickly, the peas can be picked at one time. making it a valuable crop for the market gardener. In habit it is vigorous, very quick to germinate and push to maturity, foliage large, pale green in color; pods long, straight, slightly round at the point; seed large, wrinkled cream color; height, three feet.
American Wonder. Vigorous, productive, with dark, luxuriant foliage. The most desirable early pea for private gardens. Height, fourteen inches. Of very fine quality.
Extra Early Premium Gem. Extra early in season. The most productive of the dwarf wrinkled varieties, and for this reason is the best for market gardeners
Little Gem. Extra early, hardy and productive Pods not so well filled as Premium Gem.
Nott’s Excelsior. Pods fully one-third larger than American Wonder, containing six to eight large sweet peas.
Telephone True Stock, Gardeners prefer this pea to any other. Our stock this year has been carefully selected. Vines and leaves are large and coarse, Long, straight pods filled with large, tender, sweet peas of fine flavor.
Telegraph, Strong, hardy vines, and peas very large and sweet.
Sharp’s Queen, Large, handsome, delicious. Pods long slightly curved.
Black-Eyed Marrowfat. An old standard mar- ket variety. Not so sweet as the wrinkled peas but more hardy.
Large White Marrowfat. A fine variety for soups used in a dry state. Peas are large, smooth and light cream.
Yorkshire Hero. Similar to Champion of Eng- land but the vines are not sotall.
Pride of the Market. A good main crop variety. Peas are large and sweet.
Stratagem. Vigorous, habit luxuriant foliage. A heavy cropper. A general favorite not only in private gardens but also for gardeners. Large, handsome pods well filled. One of the most desirable sorts.
Improved Sugar Marrow. Much better than the old White Marrowfat. Pods larger, well filled and of the true marrow flavor. hy Juno. Pods large and well filled peas of a dark 3a EXg green color.
I ar ges 629 : Long Island Mammoth. Very popular with mar- ed - —————— —— ket gardeners who want a large, handsome pod of a AMERICAN WONDER. deep green color.
18 GARDEN, FIELD AND FLOWER SEEDS.
The Extra Early Ohio is the Leading Potato for Early. It outsells any other Early Potato two to one on every Western market.
Prices on _ Application
We
Barly Six Weeks. Claimed by some to be earlier than the old Ohio, and although we see very little difference, they are preferred by some of our gardeners.
Extra Early Ohio. Absolutely the First Early Potato on the market. No other potato is so profitable for early use and is the favorite of all Chicago market gardeners. A short, thick, round, oblong potato. In colorit isadull red. The flesh is solid, of extra good quality and flavor; very mealy even when ouly partially grown. Our stock is very pure and select.
Extra Ey. Pingree. A most desirable variety. Theshape is neither too long nor too round, very smooth and regular in form. Eyes shallow and a white skin. Top medium in’size, but strong and spreading. Tubers close together in a hill and very numerous About a week earlier than the Bovee and a twenty-per-cent heavier yielder.
The Most Popular Main Crop Potato and the Best Seller on all Western markets is the “RURAL.”
Do Not Send Away For High — Priced Novelties Buy the Old Reliables We Have Them. —
Bovee. Of fine quality, vigorous growth and high pro- ductiveness. Smooth and handsome tubers, pink or flesh colored.
Carman No.1. Intermediate in ripening and resembles the Rural New Yorker No. 2 in shape and also having very few and shallow eyes. The flesh is white and quality perfect. An enormous producer of very large handsome tubers.
Carman No. 3. Isone of the best late varieties, also one of the greatest yielders. Large, oblong, slightly flattened.
. Rural New Yorker No. 2. A valuable variety of large size very smooth and a great cropper. In quality it is unex- celled. It is the best late long keeper and is highly recom-
mended. More potatoes of this sort are shipped annually than any other sort, and their large handsome appearance make
Early Rose. This well-known variety is still very popu- them more profitable than any other sort.
lar. Pure seed ishard to get. Ours is as pure as any to be had.
PUMPKINS.
Connecticut Field. The common yellow variety usually grown for feeding stock. Good for canning and “or pies. Pkt., 5c.; oz., 10c.
Large Cheese. A very hardy and productive variety, the best for cooking purposes. PkKt., 5c.: 0z., 10c.
Cashaw. A favorite sort, closely resembling the Crookneck Winter Squash. Pkt., 5c.; oz., 10c.
Large Tours, or Mammoth. This variety grows to an immense Size, often weighing over 100 pounds. Pkt., 5c.; 0z.,10c.
New Pie, ‘‘Calhoun.’”’ It is medium in size, extraordinarily heavy quality. The outsideis a cream color, while the flesh, which is very thick and fine grained, is a salmon yellow and of superior quality. It is undoubtedly one of the best for pies. Pkt., 5c.; oz., 10c.
Golden Oblong. A very fine, new and productive variety, growing oblong to a length of sixteen to eighteen inches, and seven to eight inches in diameter, Flesh rich yellow, very sweet, dry and excellent for pies. A good keeper. Pkt., 5c.; oz., 10c.
Quaker Pie. It is ovalin shape, and tapers toward each end; of a creamy color, both inside and out. Being fine grained and rich flavored, it makes a superior quality of pies. Pkt., 5c.; 0z,,10c.
Winter Queen. This isan improvement of the old well liked sugar pumpkin, and is admitted by all who have grown it to be the very best pie pumpkin on the market. Its size is uniformly about nine to ten inches in diameter. In color, a beautiful deep orange yellow, with a very close net- ting, almost as russeted as a potato. Itisa good winter keeper and une- qualed as a cooking variety. Pkt., 5c.; 0z., 10c.
Jonathan. This is one of the finest varieties ever introduced. It is a good keeper, of large size, very prolific. smooth and even fleshed, being free from that coarse stringiness which many varieties have. The Jona- than is excellent for pies. Pkt., 5c.; 0z., 10c.
Mammoth Potiron. The flesh and skin are of a bright golden yellow color. Flesh, fine grained, and of excellent quality. Notwithstanding its enormous size, it is one of the very best pie pumpkins ever grown, and a splendid keeper. This enormous variety has been grown to weigh 200 pounds. Pkt., 5c.; 0z.,15c,. ; :
Tennessee Sweet Potato. There is no variety of pumpkin in culti- vation that has given as great satisfaction as this throughout the length and breadth of this country. Our sales of it have nearly doubled those of : other sorts, and we have never received a single complaint of its growth or se es quality. Pkt., 5c.;0z., 10. MAMMOTH POTIRON.
U7 va
EVERYTHING FOR THE GARDEN. 19
RADISH.
Early Scarlet Turnip, White Tipped. One of the handsomest cf the turnip radishes and a great favorite in many large markets, for early planting outdoors. It is but little later than the White Tipped Forcing, and will give entire satisfac- tion where extreme earliness is not the primary object. Roots slightly flattened on the under side; color, very deep scarlet with a white tip; flesh white and of the best quality. Pkt., 5c.; oz.,10c.; %Ib., 20c.
Non Plus Ultra. Thisis one of the finest forcing radishes introduced, and has already taken a leading place with our market gardeners. It will maturein eighteen to twenty days, and, owing to the extremely small tops, can be sown very thickly. The roots are round, with a deep scarlet colored skin, the flesh white, very crispandtender. Pkt., 5c.; oz., 10c.; % lb., 20c. f
Olive Shaped Bright Red Leafless Forcing. The extra early forcing radishes lately introduced are remarkable for the small size of their leaves. They develop their roots in so short a time that the latter are practically in advance of the leaves. Pkt., 5c.; 0z., 10c.; % Ib., 20c.
Early Scarlet Turnip. The standard early turnip radish. Fine flavored A and mild. Pkt., 5¢.; 0z., 10c.; % Ib., 20¢. WHITE TIPPED SCARLET TURNIP. Early Carmine. An extra early variety of turnip-shaped radish. It is very mild and crisp. The flesh is white. the color is car- mine, and the radish looks bright even when wilted. This is, therefore, very salable on the market, even on the hottest days, when other radishes look dulland dry. Pkt., 5c.; oz., 10c.; %1b., 20c.
New Deep Scarlet Turnip. This isa very bright colored scarlet turnip radish, very early and short leaf, well adapted to forcing under glass. Matures in fourteen to twenty-one days. and its appearance will sell itin any market. Pkt., 5c., oz., 10c.; %1b.. 20c.
___ Large White Summer Turnip. A very large turnip-shaped variety; white, very crisp and mild. Pkt., 5¢.; oz.,10c.; 4Ib., 20c.
Large Yellow Summer Turnip. Like the above, except in color. Pkt., 5c.; 0z., 10c.; % Ib., 20c.
Gray Summer Turnip. Popular for midsummer planting. Pkt., 5c.; oz., 10c.; %Ib., 20c.
Long Brightest Scarlet, White Tipped. This is the brightest and handsoniest colored scarlet radish known, and a decided improvement in earliness and color over other varieties of this class. It makes roots fit for use in about twenty-five days from time of planting, and they continue in good candition until they are full grown, when they are as large as the Wood's Early Frame. It hasasmalltop and does notruntoneck. Pkt., 5c.; oz.; 10c.; {%1lb., 20c.
French Breakfast. Olive-shaped, scarlet, with white tip; crisp and tender. Very early. A general favorite. Pkt., 5c.: oz.,10c.; %lb., 20c.
Long White Vienna, or Lady Finger. A very excellent white variety with long, very smooth white roots, which are crispand tender. It comes into use shortly after Wood’s Frame, and is one of the most desirable of the white summer sorts. Pkt., 5c.; oz., 10c.; 4 lb., 20c.
Chartier. Decidedly distinct in appearance from any radish in cultivation. Its form is well shown by our engraving, the color at the top being crimson, running into pink about the middle, and from thence downward it isa pure waxy white. It will attain a very large size be- fore it becomes unfit for the table. PKt., 5c.; oz., 10c.; %1b., 20c.
Early Long Scarlet, Short Top Improved. This bright scarlet, small topped sort is about six inches long, grows half out of the ground, is uniformly straight, smooth, brittle and crisp, and isa standard and excellent sort for private gardens or market use. Pkt., 5c.3 oz., 10c.; 2 oz., 15¢.; &% lb., 20c.; Ib., 50e.
Wood’s Early Frame. This is not only a good variety for forcing, being shorter and thicker than the old Long Scarlet Short Top, but is one of the very best sorts for first crop out of doors. It continues brittle and tender until July. Oneinch Jong. The roots are very uniform in shape, smooth and very bright red in color. The flesh is white and crisp. Pkt., 5c.; oz.,10c.; 4 Ub. 20c.
Early White, Olive Shaped. Like Scarlet Olive Shaped, except that the roots are clear white and a little longer. Pkt., 5c.; oz., 10c.; Y% lb., 20c.
White Strasburg, or Summer Hospital. Large, showy, half long, white sort. Grows with
great rapidity, sometimes producing a cropin six weeks. It will keepin eatable condition two CHARTIER. weeks before going into seed. Bestsummerradish grown. Pkt., 5c.; oz.,10c.; 4% Ib.. 20c.
Giant Stuttgart. A summer variety. Grows to an immense size. White flesh, very crisp and tender. Of good flavor and a good keeper. PkKt., 5c.; oz.,10c.; ¥{ Ib., 20c.
Early Scarlet Globe. A desirable sort for hotbed forcing and outdoors; very early; flavor mild; crisp, juicy and tender: top small; will stand heat without becoming pithy. One of the best selling and most attractive radishes, on account of its bright scarlet color and handsome shape. Is ready iniwenty-eight days. Pkt., 5c.; 0z., 10c.; % Ib., 20c.
WINTER RADISHES.
Sow about the same time as winter turnips, on light, rich soil, in drills eighteen inches apart;, give frequent cultivation, and thin two to six inches apart, according to size of the vari- . ety. For winter use pull before severe frost, and store in SQ damp sand in cellar. =
Scarlet China. Roots cylindrical, or largest at the bottom, = tapering abruptly to a small tap. Skin very smooth and of a ‘ bright rose color; flesh firm, crisp, tender and quite pungent. Pkt., 5c.; oz.,10¢.; 1% Ib., 20c.
Half Long Black Spanish. An American sort of the same general character as the Long Black Spanish, but by many con- sidered superior to either the Round or the Long Black Span- ish. Itis intermediate in shape between the two, and seems to combine the good qualities of both. Pkt., 5c¢.; oz., 10c.; ¥Y Ib., 20c.
_Long Black Spanish. One of the latest as well as the hardiest of the radishes. An excellent sort for winter use. Pkt., = 5c.; 0z., 10c.;% 1b., 20c. . SCARLET GLOBE.
DO NOT BE INFLUENCED BY THE BIG FLARING CATALOGUES AND DESCRIPTIONS SENT OUT BY SOME SEED HOUSES. THOSE WHO USE SUCH METHODS RELY ON NEW CUSTOMERS EACH YEAR, VERY SELDOM GETTING A SECOND ORDER. OUR AMBITION AND AIM IS TO INCREASE THE WELL SATISFIED TRADE WE NOW HAVE AND WHICH COMES BACK TO US EACH SUCCEEDING SEASON. YOU WOULD DO WELL TO JOIN THOSE WHO ARE SATISFIED.
20 GARDEN, FIELD AND FLOWER SEEDS.
RHUBARB.
(PIE PLANT.)
Rhubarb, familiarly known as Pie Plant, or Wine Plant, is cultivated in gardens for its leaf stalks, which are used for pies and tarts. Immense quantities are now annually sold in allthe large markets. No private garden should be without it.
_, Culture. Rhubarb succeeds best in deep, somewhat retentive scil. The richer itscon- dition and the deeper it is stirred the better. Sow in drills an inch deep, and thin out the plants to sixinches apart. In the fall transplant the young plants into very highly manured and deeply stirred soil, setting them four to six feet apart each way, and give a dressing of - coarse manure every spring. The stalks should not be plucked untii the second year, and the plant never allowed to exhaust itself by running to seed. Ourseed is saved from selected plants of the Linnzus, Victoria, Giant and other improved sorts, but like the seeds of fruit trees, rhubarb seed cannot be relied upon to reproduce the same varieties.
Rhubarb Seed. Pkt. 5c., oz. 15c.
Rhubarb Roots. By express, not prepaid, 20c each, $1.50 per dozen. B i prepaid, 25c each, $2.00 per dozen. P 3 z : ee
Prices on Large Lots of Rhubarb Roots on Application.
SALSIFY. a
(VEGETABLE OYSTER.)
The long, white tapering root of salsify resembles a small parsnip, and when cooked is a good substitute for oysters, having a very similar flavor.
Culture. It succeeds best ina light well-enriched soil, which should be stirred to a good depth. Coarse and fresh manure should be avoided. as it will surely cause the roots to grow uneven and ill-shaped. Sow early and quite deep, giving the general culture recom- mended for parsnip. The roots are perfectly hardy, and may remain out all winter, but should be dug early in spring, as they deteriorate rapidly after growth commences. Storea quantity for winter use ina pit, or in a cellar in damp earth or sand.
5 Earge White. The common variety; roots medium sized, smooth; flesh white. Pkt. ec; oz. 10¢c.
Mammoth Sandwich Island. This isin every way superior to the Large White, being larger, stronger growing and less liable to branch. Invaluable to market gardeners. Pkt. 5c; oz. 15e.
SPINACH.
Spinach is very hardy, extremely wholesome and palatable and maxes a delicious dish of greens, retaining its bright green color after cooking.
Culture. Should be planted in very rich ground, the richer the bet- ter. Sow in drills one foot apart and begin thinning out the plants when the leaves are an inch wide. All should be cut before hot weather or they will be tough and stringy. For early spring use, sow early in autumn and protect the plants with a slight covering of leaves or straw.
Victoria. Anexcellent sort, which forms a very large, exceedingly thick, dark green leaf, somewhat curledin the center. It becomes fit for use nearly as early as any, remaining so much longer than most kinds, and cannot fail to please, whether grown for the market or in the private gar- den. Pkt. 5c; 0z.10c.
Savoy Leaved. The earliest variety and one of the best to plant in autumn for early spring use. Plant of upright growth, with narrow, pointed leaves, which are curled like those of the Savoy cabbage. It grows quickly to a suitable size for use. but soon runs to seed, Pkt 5c; 0z. 10c.
Round Summer Broad Leaved. This variety is generally preferred FE mugen in the north for early spring sowing, and is the favorite with our market FENRS gardeners. The leaves are large, thick and fleshy. Though not quite as hardy as the Prickly Winter, it stands the winter very well. Pkt. 5c; ROUND LEAVED SPINACH. oz. 10c.
Improved Thick Leaved. A variety which grows very rapidly, forming a cluster of large, very thick, slightly wrinkled leaves of fine color aud quality when cooked. Especially recommended for market gardeners, Pkt. 5c; oz.10c: 2 oz. 15c.
Long Standing. Animproved, round seeded strain of excellent merit, having all the good qualities of other sorts and continuing in condition for use much longer. The leaves are smooth and very dark, rich green. Very popular with market garden- ers. Pkt. 5c; oz. 10c,.
Prickly Winter. A very hardy variety and will withstand the severest weather with only a slight protection of leaves or straw. The seed is prickly, leaves triangu- lar, oblong or arrow shaped. It is used for fall sowing,’ which in this latitude is about the firstofSeptember. Pkt. 5c; oz. 10c.
SUNFLOWER.
Everyone who keeps poultry should use sunflower seed liberally for feeding, as there is nothing more wholesome and nutritious, or which keeps hens in better con- dition for laying. Some species are largely planted in the flower garden for ornament. (See Flower Seeds.)
LONG STANDING SPINACH. Large Russian. This variety has large heads, borne at top of a single un-
branched stem, and having much more and larger seed than the common sort. Sow
the seed as soon as the ground is fit for corn, in rows five feet apart, and ten inches apart in the row. Cultivate same as corn. When
the seed is ripe and hard cut off the heads and pile loosely in a rail pen having a solid floor orin acorn crib. After curing sufficiently,
so that they will thresh easily, flail out or run through a threshing machine, and clean with an ordinary fanning mill. This variety will yield nine hundred to twelve hundred pounds of seed per acre ordinarily. Oz., 5c.; Y% lb., 10c.; 1b., 20c., postpaid.
Prices change with market. SORREL.
Those who think of sorrel as the starved looking weed of barren lands have little idea of the possible value of the plant. The improved varieties, when well grown and cooked like spinach, make a healthful and very palatable dish. Sow in drills early in spring, and thin the seedlings to six or eight inches apart in the row. One may commence cutting in about two months, and the plants will continue in full bearing from three to four years, ~
Large Leaved French. The best garden variety, having large pale green leaves of fine quality. Pkt. 5c; oz. 15e.
a =
EVERYTHING FOR THE GARDEN. 21
Giant Crook-Neck. This strain is a great improvement on the old variety of Crook. neck, Itis larger and better in every way.
Straight-Neck Summer Squash. Market gardeners who ship early squash to dis- tant markets know the diffi- culty of packing the crook- necked variety in boxes to good advantage. In our Straight-neck the bad feature of the crook has been over- come, and by continued selec: tion the size has been increas. ed, more uniformly in shape. improved quality.
Golden Custard Bush. Ex GIANT CROOK-NECK. ceeds in size any of the scal. loped sorts. A dark, rich
golden yellow. Quality excellent. It grows in bush form, wonderfully productive.
Delicata. Early and very prolific; of oblong shape. Ground color, orange yellow, splashed and striped with very dark green. Although of small size, the squashes are very solid and heavy, while the quality is rich and dry.
Early White Bush Scallop. Similar in form to the preceding, but with a cream white skin, and more tender and delicate flesh.
_ Mammoth White Bush. This has been obtained by years of careful se- lection. Although we have sold this squash for a number of years, we again call special attention to it.
Mammoth Chili. The largest of all squashes, growing to an immense size, often weighing over two hundred. pounds, while its rich, fine-flavored flesh insures its value for all purposes.
Orange Marrow. A variety developed by selection from the Boston Mar- ; row and not so large but much earlier, and the earliest of the winter varieties. Fruit deep orange color netted with cream; shape similar to Boston Marrow; flesh thick, deep yellow, of fine quality.
Essex Hytrid. This is not only one of the richest flavored, finest grain and sweetest of all squashes, but it is also one of the very best keepers that we know of. Short cylindrical shape, having on the blossom end a small cap shaped enlargement. The flesh is dry, sweet and thick, andof a bright orange color. ORANGE MARROW.
t}
Boston Marrow. Second early, coming in about ten days after the Bush and Crook-neck sorts. Skin yellowish, very thin; the flesh dry and fine grained, and of unsurpassed flavor.
Hubbard. A general favorite and more largely grown asa late sort than any other; it is of large size, often weighing from nine to ten pounds. Color, bluish green, occasionally marked with brownish orange or yellow. Flesh fine grained, dry, and of excellent flavor. It can be had in use from September to May.
Warty Hubbard. Also called Chicago Warted Hubbard. This strain of squash was introduced by S. F. Leonard-in 1894. It originated with John Oly, an old-time Chicago market gardener, and for years previous to its general introduc- tion to the trade was known at Chicago as Leonard’s Warty Hubbard, which is its Proper name. Ours is headquarters seed.
Best for Baking —Best for Pies—the Best Keeping Winter Squash is the Warty Hubbard
For Pumpkin Pies use
the Winter Queen. See WARTY HUBBARD. Page 18.
SQUASH PRICE LIST.
Pkt. Oz. Pkt. 0z. Giant Straight-neck...... $005 $015 Mammoth Chili............ $0 10 $0 25 Golden Custard............ 05 15 Orange Marrow........... 05 15 PVENI CATH fecpice ss ees acess 05 OS eH Ssexely briGaccecsieci =.) 05 15 Giant Crook-neck......... 05 15 Boston Marrow............. 05 15 White Bush... 6.2.0... 0s. 05 [Sees ubbatdestcsrenescca ss «= 05 15 Mammoth White Bush.... 05 15 Warty Hubbard........... 05 (5
TOBACCO.
Pennsylvania Seed Leaf. This isthe variety mostly grown for cigars, andis of fine quality and excellent flavor. Pkt., 5ce.: oz., 20c.
Persian Rose. A fine brand forcigars. Sells well. Pkt., 5¢.; 0z., 20c. NEE
Za Yellow Pryor. A fine yellow sort, and succeeds well where others fail. Pkt., gl Be.; 0z., 20c. ap
Blue Pryor. This is the genuine article and a good sort. Pkt., 5¢.; 0z., 20c. General Grant. Very eariy, anda good yielder. Pkt., 5c.; 0z., 20c.
: Bp cet Seed Leaf. The best sort for cigar wrappers. Tryit. Pkt., dc.; 0z,, 20c.
Havana. This is the genuine.article, and is first-class. Pkt., 5c¢.; oz., 20c. Ohio. White leaved. A large yielder. Pkt., 5c.; oz., 20c. CONNECTICUT SEED LEAF TOBACCO.
22 GARDEN, FIELD AND FLOWER SEEDS.
TOMATO.
This is a very important vegetable for a market gardener. Bach Market demands its own special favorite, and market gardeners must look out and get the proper kind, which the market they supply needs. Unless you are sure that a new variety is all right, stick to the old one.
Beauty. A decided favorite for either home market or shipping purposes, being early, hardy, a strong grower, productive, large size, always smooth, perfect in shape, and excellent in quality. The coloris a very glossy crimson, with a tinge of purple. It grows in clusters of four to six large fruit, retaining its large size late in the season. Itripens with Acme and Perfection, and is entirely free from ribbed and elongated fruit. Pkt., 5¢.; oz., 25c.
Essex Hybrid. This variety we consider the best market sort. Itis like Acme in color and general appearance, but runs larger, smoother and, asarule, better. Pkt., 5c.; oz., 25c.; % Ib., 65c.
Magnus. A new variety. It is very distinct, having the color of Livingston’s Beauty and Acme, but thicker, heavier and more solid than either. The form is uniformly perfect, large and attractive, very deep from blossom to stem end, and almost globe shaped. Fruit in clusters, ripening evenly and maturing quickly enough for early market. Flesh is firm and flavor most desirable. Pkt., 5c.; oz., 30c.; Y% Ib., $1.00.
Mikado, or Turner’s Hybrid. One of the latest of the good market varieties The vines are very distinct. Have a potato leaf appearance. In color, this sort is like the Acme, fine, large, smooth fruit. Pkt., 5c.; oz., 30c., % Ib., $1.00.
Ponderosa. This variety when conditions are favorable, grows to an immense size and makes the heaviest fruit of any in the list. Ourstock is from the original strain. None better.. Pkt., 5¢.; 0z.,30c.; % 1b., $1.00.
Buckeye State. A mammoth growirg tomato of Smooth form and
extra quality. The largest fruited variety yet introduced, Pkt., 5c.; 0z,, 30c, 4 Ib., $1.00. -
MAGNUS.
Sparks’ Earliana. Said to be the earliest large tomato in the world. This tomato is not only remarkable for its earliness. but forits very large size, handsome shape and bright, red color. Its solidity and fine quality are quite equal to the best medium and late sorts. _ From less than 4,000 hills the originator realized from his first pickings $725.00 clear of freight and commission, being in the market fully a week before all others.
The New Imperial. Without doubt, this is the best main crop tomato now in cultivation. It is large, solid and smooth; has the right color forthe Chicago market, and makes the evenest, handsomiest show in the tomato box of any we have. We think it better than Acme, Essex Hybrid or Beauty; and that is as much as we need say ofany tomato. Pkt., 5c.; % oz., 10¢.; 0z., 20e.3 XY Ib., '75e.
Livingston’s Favorite. A well known red variety, smooth and solid. PkKt., 5¢.; 0z., 25c.; % Ib. 60c.
. Optimus. One of the best table tomatoes. Vine medium sized, vigorous and strong. While not classed asa first early, it is reported by growers to ripen fully as early as many of the earliest, making an excellent forcing variety. The fruit is medium sized, oval, very smooth, and of a very bright crimson-scarlet color. Pkt., 5c.; oz., 30c.; ¥/ Ib., $1.00.
Perfection. A splendid red variety, hardy, productive, and good bearer. PKt., 5c.; oz., 25c.; Y% Ib., 6Oc.
Atlantic Prize. A very early variety, fairly smooth; good for firstcrop. Pkt., 5¢.; 0oz., 25c.; Y% Ib., 60e.
Trophy. A good main crop sort. Color, red, fruit large. Pkt., 5c.; 0z., 25c.; 14 Ib., 60e.
; — The Honor Bright. This isa remarkable red variety. The SPARKS’ EARLIANA TOMATO. color of the fruit, when fully ripe, isa rich, bright red; but, before ; 2 i reaching this stage, it undergoes several interesting changes.
__ Ponderosa. A very large fairly smooth. Pkt., 6e.; 0Z, irst, if is a light green: fen an attractive, waxy wei then 25e.; \ Ib., 75e. k é lemon, changing tored. Pkt., 5¢.; oz., 25c. ¥% Ib., 75e.
Dwarf Champion, Thisis a purple fruited variety, which forms very strong plants about two feet high. The branches are short, making a bushy plant that stands quite erect without stakes. This sortis often sold as Tree Tomato. Fruit smooth, medium sized, color purplish pink, fairly solid, but has no hard core, and is of good flavor. About as early as any purple fruited tomato, and is quite popular in some localities, both for market and home use. PkKt., 5c.; 0z., 50c. : BZ B= tf = =>
fz = New Stone. A fine new, red variety, very solid and smooth; Py ——
SSS a splendid main crop sort. Pkt., 5c.; 0z., 25c.; 4 Ib., 65c. Uy Z = \ Matchless. A good canning and all purpose tomato; splen- : yy y ‘a “ \ did for kitchen. Pkt., 5e.; 0z., 25¢c.3 &% lb., 65c. Y Y j l ~\ \\ Royal Red. A new sort, of considerable merit. Vines vig- Yi
orous; fruit smooth. Very productive. Pkt., 5c.; 0z., 25c.; Y Ib., 65e,
Yellow Plum. A small, yellow variety, of handsome appearance and fair quality. Pkt., 5¢.; 02z., 25c¢.; Y% lb., 75c.
Husk, or Ground Cherry. This is a small sized fruit grown within a husk. Itis valuable for preserving, for making into pies, or for eating fromthehand, Pkt., 5c.; 0z., 20c.
Acme. Oneof the best standard sorts. Of a fine crimson purplish color. Shape is smooth, size large and uniform. For the market or home garden no sort is better. HUSK TOMATO. Pkt., 5¢.; 0z., 30e.
‘ EVERYTHING FOR THE GARDEN. 23
TURNIP.
Extra Early White Milan Turnip.—The Purple Top Milan is one of our most popular turnips for spring sowing, butin this new sort we have a splendid extra early turnip in which the extreme earliness, small top and tap root of the Purple Top Milan is united with clear white skin and flesh. It will undoubtedly find a welcome in our markets, as, in addition to the heavy crop assured by its adapta- bility for close planting, it will be found to be fit for use at least a week earlier than any other pure white variety incultivation. Pkt.,5c.; 0z.,10c.; % Ib., 20c.
Pomeranean White Globe.—This is one of the most productive kinds, and in good, rich soil roots will frequently grow to tweive pounds in weight. Itis of perfect globe shape; skin white and smooth ; leaves large and dark green. Pkt., 5ce.; 0z., 10¢.; 4% Ib., 20c. : =
Purple Top White Globe.—An early variety. Globe shaped; heavy cropper. t > In other respects similar to the Red Top Strap Leaf. A handsome fooaie Pap: HXTRA EARLY PURPLE TOP MILAN. and is rapidly taking the lead of all other varieties of early turnips for market garden purposes. Pkt., 5c.; oz., 10c.; 4% Ib., 20c.
Extra Early Purple Top [lilan.—The earliest in cultivation, two weeks earlier than Purple Top Strap Leaf. The bulb is flat, of medium size, quite smooth, with a purple top. Flesh, white, hard and of finest quality. It isan extra good keeper. Pkt., 5c.; oz.,10c.; % 1b., 20ce.
_ Large White Norfolk.—The standard variety for field culture for feeding stock. Very largesize. Pkt., 5c.; oz.,10c.; ¥% Ib., 20c.
Cow Horn.—This variety is pure white, except a little shade of green at the top, and is carrot-like in form, growing nearly half out of the ground, and slightly crooked. It is delicate and well flavored, of very rapid growth, aud has obtained considerable favor as a market sort for falland early winter use. Pkt., 5c.; oz., 10c.; ¥ Ib., 20c.
Early Snowball-—A perfectly globe-shaped, white-skinned turnip. It isexceedingly productive. The flesh is fine grained, firm and of very delicate flavor. It is one of the best keeping of the white-fleshed sorts, Very early and particularly adapted for family or market use. Werecom- mend it to market gardeners because its earliness and fine appearance make it a very profitable variety of turnip. Pkt., 5c.; 0z., 10c.; 4 Ib., 20c.
, Early White Flat Dutch.—An excellent garden variety. The best ees : for spring sowing. Pkt., 5c.; oz.,10c.; ¥ Ib., 20e. EXTRA EARLY WHITE MILAN. White Egg.—Belongs to the class of quick growing fall turnips, and for this purpose should be sown, in this latitude, between August 10th and 2th. Its shape is nearly oval or egg, as its name wouldindicate. PkKt., 5c.; 0z., 10c.; % lb., 20c.
Sweet German.—This variety is very popular in many sections, notably so in the New England States. It partakes largely of the nature of the rutabaga, and should be sown a nionth earlier than the flat turnips. The flesh is white, hard, firm and sweet; keeps nearly as well as the rutabaga. Highly recom- mended for winter and spring use. Pkt., 5c.; oz., 10c.; 144 Ib., 20c.
Seven Top.—Cultivated extensively in the south for the tops, which are used for greens. Itis very hardy and will grow all winter, but does not produce a good reot, and is only recommended forthetops. Pkt., 5c.; oz., 10c.; 4 Ib., 20c.
Purple Top Munich.—The earliest variety after the Red Top Milan. Color white, with purplish whitetop. Pkt., 5¢.; oz.,10c.; % Ib., 20¢.
Purple Top Strap Leaf.—Rapid grower and mild flavor. The most popular variety for early use, either forthetableorstock. Pkt., 5¢c.;0z., 10c.; % lb., 20e.
Scarlet Kashmyr.—A most distinct novelty; of such peculiar color that it has a striking resemblance to a large radish. ‘‘Unwarned judges would, no doubt, pronounce it one of those radishes so persistently complained of as tasting like turnips.” However, itisa turnip, and of most excellent flavor: of a deeprich crimson above, shading to a soft crimson rose below. Pkt., 5c.; oz., 10c.; -44tb., 20c.
Yellow Aberdeen.—Very hardy and EARLY SNOWBALL. productive; a good keeper; globe shaped. Color pale yellow, with purple top Very firmin texture, and closely resembling the Ruta- MO, baga in good keeping qualities. Good either fortable orstock. Pkt..5c.; 0z.,10c.; 41b., 20c-
Ry Large Amber Globe.— One of the best varieties for a field crop fer stock. Flesh yellow, 3) fine grained and sweet ; color of skin yellow, top green. Hardy, keeps well, a good cropper- - Very popular inthe South. Pkt., 5c.; oz., 10c.; ¥% Ib., 20c.
Our reputation has been built up by furnishing seeds of the best quality as to purity and germination, and we shall always endeavor to furnish THE BEST SEEDS that can be procured and make prices as reasonable as possible.
RUTABAGA.
Swedish Turnip.
Improved American.—The best yellow fleshed, purple top variety grown for stock or table, Pkt., 5c.; oz.,10c.; 4% 1b., 20c.
Budlong’s White Rock.—Though sometimes called a turnip, this is more like a ruta- baga. The root is large, both skin and flesh very white, and it is one of the best varieties we have for table use. An excellent keeper anda desirable sort for market gardeners. Pkt., 5c.; oz.,10c.; 4% Ib., 20c.
White Rutabaga.—This variety is now extensively cultivated, and preferred in many sections for its white flesh. It is very hardy and productive, keeps well until late in the spring, and is highly esteemed for its sweet, delicate flavor. Pkt., 5¢.;0z.,10c.; %1b., 20c.
Laing’s Improved. One of the earliest of the rutabagas. Forms a handsome bulb of good quality. Keeps well; good for table use. Pkt., 5e.; oz., 10c.: 4% Ib., 20c.
Long White French.—A very delicate flavored variety. An excellent keeper and fine fortable. Pkt., 5¢.; oz.,10c.; 14 Ib., 20c.
Skirving’s Purple Top.—A very heavy cropper. One of the best for field culture. Pkt., 5c.; oz., 10c.; ¥% Ib., 20c.
Carter’s Imperial Hardy.—An English variety resembling the preceding. Very pro- RUTABAGA. ductive and of fine quality. Pkt., 5c.; oz., 10c.; % Ib., 20c.
24 GARDEN, FIELD AND FLOWER SEEDS. OUR SPECIAL STRAINS OF POPULAR FLOWERS.
PANSY (MASTERPIECE.)
Giant Curled.
Our seed is true and pure from the originator. This strain comes nearer to Double Pansies than anything ever introduced under that name. In reality the number of petals is the same as that in other pansy flowers, but they are crimped and curled in sucha fashion that the flowers appear double. The flowers are of enormous size, often three inches across, and the color varia- tions and combinations are odd and striking. Pkt., 10c.
SUPERB NASTURTIUMS.
For ease of culture, duration of bloom, brilliancy of coloring and general excellence, nothing excels Nasturtiums. Allthey need is a moderately good soil in a well drained, sunny position, and from within a few weeks from the time they are sown until hard frost comes there is an endless profusion of their gorgeous blossoms.
The identical colors can be had in either the Tall, or Climbing, or Dwarf, or Tom Thumb types. The former grow 5 to 6 feet high; and are unexcelled for growing on fences, trellis; or trailing over rocks and rough ground, etc., while the Tom Thumbs are leading subjects for beds or borders, and both are largely in demand for use in hanging-bas- kets, vases, window: : boxes, etc., etc., es
PANSY.—Masterpiece.
Either Dwarf or Tall Varieties.
In Ordering State Whether You Want Dwarf or Tall.
Dwarf or Tall Spotted. Rich Orange-Yellow, spotted crimson.
st wi a Prince Henry. Creamy White, spotted and tipped with scarlet.
e a yy Chamelon. This variety bears-different colored © flowers on the same plant; the flower shown is one of the most frequently seen combinations,
Ke 33 as Chocolate. A unique color, Odd.
<! ss SS Crimson. _ Rich and velvety.
fe se s Orange. Pure & orange, with- out markings of any kind.
oe o ue Pearl. Creamy white.
Oo sf “ King Theodore.
Deep crimson-maroon, with black shadings Dwarf or Tall Spotted. Vesuvius. Salmony-rose; an exquisite shade. Dwarf or Tall Spotted. Rose. A lovely deep shade. Price: Any of the above 5c. per pkt., 10c. per oz.
ll
$0 30
SUPERB COLLECTION® OF NASTURTIUMS.
‘¢Incomparable’’ Collection of
Sweet Peas
This collection is made up of very choice sorts—varieties that have the endorsement of the leading American and European specialists—and it would be impossible to select another similar collection out of the vast t1umber of sorts now in commerce that would combine, in the same degree, all the qualities which go to make up first-class varieties.
America. Bright, blood-red striped on a white ground. Blanche Ferry Extra Early. The popular pink and white. Coccinea. Rich, brilliant cerise.
Countess Cadogan. The brightest blue.
Dorothy Tennant. Deep mauve; a lovely shade.
Duke of Clarence. Dark claret; a fine dark sort. Gorgeous. Bright Orange, wings rose-tinged orange. Lady Grisel Hamilton. The finest pale lavender. Lady Mary Currie. Bright Crimson orange.
Lottie Eckford. White shaded and edged lavender-blue, Prince of Wales. The finest bright rose.
Queen Victoria. Primrose-Yellow.
Sadie Burpee. Very large pure white.
Salopian. Deep scarlet or cardinal; the finest red. Stella Morse. Primrose, tinged blush; effect a rich sreamcolor, Lovely. Soft shell-pink; an exquisite shade.
Modesty. The most delicate shade of all the pinks. Navy Blue. Deep indigo-blue.
Othello. Very dark maroon.
Prima Donna. A magnificent pure pink.
Prince Edward of York. Scarlet tinged crimson.
Prices: Any of the above, 5c. per pkt.; 10c. per oz.; 200. per 4 Ib.; 50c. per Ib. Collection of a packet each of any 21 “incomparable”’ varieties, 60c., or 1 oz. of each $1.00. postpaid.
- EVERYTHING FOR THE GARDEN. 25
Our Special Strains of Popular Flowers.
PETUNIAS.
; For outdoor decoration or house culture, few plants are equal to this class. They commence to bloom early, and continue to flower through the summer. Give them rich soil and a sunny place.
3 Single Varieties.
Single Large Flowering, mixed, all colors........ scssseeee ... Pkt. 10c Eystem ree dal COLOESawrsisinikc ciety cntoiesto eters ies terete since wale TLS be
Large Flowering Double Petunias.
Grand, rich, velvety flowers of the largest size. All colors and shades, beautifully veined. Most of the flowers are fringed, and our seed will produce a far greater per cent of double flowers than any other strain. Pkt., 25c.
It is well known that seed saved from the most carefully hybri- dized flowers produces but a small percentage of double flowers, the balance being singles of unusually fine quality. The weaker seedlings should be carefully saved, as these invariably produce the finest double flowers.
SWEET PEAS PAGE 24,
LARGE FLOWERING DOUBLE PETUNIA.
PHLOX DRUMMONDI.
Of all summer-flowering annuals the varieties of Phlox Drummondi are unquestionably one of the most brilliant and satisfactory. Seed may be sown in the open ground any time after danger from frost is past, and in a few weeks the beds or borders are aglow with their brilliant coloring, and remain so until cut down by frost. For early flowering they should be started indoors or in a hotbed.
Phlox Drummondi, mixed colors....Per 0z., 50c.; pkt., 5¢
Large-Flowering Phlox.
The largest flowering of the annual Phloxes. Nothing can compare with this indispensable summer flower for beds, massing, etc. Our strain is very select. Large perfect types of most beautiful colors, shadesand marking. Strong robust growers.
Large Flowering Phlox, mixed colors............Pkt., 10¢
NASTUR- TIUM PAGE 24.
LARGE FLOWERING PHLOX.
: SUPERB ASTERS.
Of the general beauty of these flowers it is unnecessary to speak; the immense world-wide demand for them shows their adaptability for any climate; and, coming into bioom, as they do, when most other flowers are fading away, enhances their value. For the best results the ground for the cultivation of Asters cannot be too richly prepared, although they will give satisfactory returns on any ordinary garden
J soil. Standardize MI tire, VictOLianesccts+.sscc cose ugecdewesees Pkt., 10c. a ts r Cometiitpandsc ss soc eee itesee (LOC: “ ki = Onibledremtern.. wine age one eke et “— 10e, ‘ Blan CHI ater ee aoe este a. s7e «a siobe ei 10c. us a PeOUYAHIOW ELE iis os oscceies elec see a 10c.
Christmas Tree Aster.
This Aster has a pyramidal branching form of growth, giving it the shape of a miniature tree. A very early profuse bloomer, growing about fifteen inches high, but covering an area of from twenty inches cee in diameter. Perfect double flowers, all colors, mixed.
ea c.
26 | GARDEN, FIELD AND FLOWER SEEDS.
CHOICE FLOWER SEEDS.
Standard Varieties.
a The following is a list of the leading flowers grown from seed. While they are not all annuals, they will bloom the first season, some, of course, being planted somewhat earlier than others. We have listed only those strains that are reliable, and are sure to sat- isfy our customers. Our prices will be found as low as any reliable house for quality and quantity given. These varieties are espec-
ially adapted for market gardeners. All flower seeds sent free by mail at catalogue prices. ey Per Pkt. ANS
A bronia, umbellata, mixed = sn. ces cei eee sles nisiele es o. eaaie emo e Nels xSP pan $0 05 Acroclinum,album......... lai sieiel sloretateloetevoreehcistavs/s iaie(sloraeeemeettemeterecie se Seereeae 05 ISXolYaibb a0 Wore oourn PURO eaE Horie Gre loca SAGaATO BASES Tc Gninots on OnoRGE AEB anD 05 Ageratum Mexicanum, light blue..... 2... 2... cece cece cece cece cose pees 0d NET OS CC TW Ay STE Coys oi ajo seis oi vic aval alors Siete arate ee mini cie ver sitin COTE OR Teieteierciaiomin ete 05 Ally Ssium, SweepinanitinntM.s jcc eset cil nivekiceeCniereiet cen recor 05 Little Gem, benthami, compactum, erectrum................ 22.00: 05 Amaranthus, Tricolor, Joseph’s Coatsce. 0-205... + sen ccewecccesceceersse 05 AM tiEr hint, mayjus: imtxedey-simcr ere eiee ein +) acter eisiecieeicics inc ae 05 Lomebnumbamnixed-stin eistraimsepriccn cecilia <oectien nie 05 AmErrenila smite diaen bls case se wleitacre seis teeliere Neeiein vs. snort iatee 2 enisiniee sie aloee 10 Bachelor’s Button, centaurea cyanuS ...... 0.2... cece cece cere ee we ceee eee 05 ) DXo} Flo) (aes cobb. do amar GR ISMN 5 his 40 eNOS UNSAID) CA COCA Tone 10 Balloon Vine, cardiospernum halicacabum.............. cece cee eeeeen cece 05 wWalsamy, Wiite: Perfection sar ieica sowie ieeio> ro cinta adore letstelebelereisvory ereteleeinie eats 1¢ Camellia, mixed............ FASO DOU GORD DIESER ro 10 Cheon END as Guae 10 bat GOR AA CH AR ARIMROa SOOO OdIH uF CHR AeR sob o ddbdodbaouubesesa 10 Striped heise itaeveseitle is ne eicleic roe Sameer icinwen Bengals 10 Rosefloweredsrmtxe die Foe aor oe nln bine © ona asta ole alatereleee iota 05
Brachycome Iberdifolia, Swan River Daisy, mixed................. con (05)
ALYSSUM. Per Pkt.
PoLOeMp DSO oUdDS Gmctoaneeoceds sodaee WE
BOscue ois)staRsje efor si's.<)is'ays Omens eee eee ane OD
skal n{l shay 'a/ axeieiSlarePafebayeteae tokeerefe\al she, Seer eRees emeteene 05
ae SUM amed is cincince icy sia oes cients coe Ae eee 05 Sey) Canna Indica, fine, mixed. ...... 0... 0.00. ce eecc pees ee neee 05 4 Crozy smixed 7225.75). cls corm eect e see aan eee 05 Canterbury Belle, campanula media, single, mixed...... 05 Double mixed i. 2 sccte eee eee 05 Carnations fines cess hes. juceeneeee wis aieve'e/ arava etereiere a eapielemiee 10 Marsaret finest: mixed nen emteetecseneneneeeemeee 10
Castor Beans). 2icciack ccs ochre Rote odoots Onas 05 Chrysanthemum Coronarium, double, mixed.......... 05 Double, white: one. 5.85 Sone ae oe ee 05 Cineraria Hybridia, large flowering, mixed.............. 25 CobeaScandensiyn.c cscs sece epee oe eneeeneeeniee 05 Cosmos, finest, mixed, mammoth.....................-eees 05 Cockscomb; mixed s 5 wiic. ce = ee eens «cee See 05 Coleus, large Jeaved, finest, mixed.........0.. 0.2... ...... 25 Convolvulus Minor, Dwarf Morning Glory.. ........... 05
All the Varieties of
Flower Seeds we list
are the kinds that
should be in every
garden.
=
CALLIOPSIS.
GY Press Vin eS; WEA. cr /aicess yeloie vreheiersielelennietolereta stele\s fole/ais) </>. clareienerctetsisiniteieteleve tannins ecateeteraisinhs 05 Dahhia, finest, Gowble; mies... nim. niece cielaisieiel=l=)sievelel «== «/svelfelalefoleighe/stu'eraiel slelstetaiete steams 05 Sin Glee y. VAL y wie ac cesercinre c iajole elotolleteieintele ss c/aye’s = oer enlamatalaitbehstels Meta ret eretare etme Renan 05
¥ Daisy, onest quality, double, ried ya aletejotleinyeletettetelslcls « «/o\ « clulefuteleferett) iio tens)e/aiel= nah teste sane 05 Eschscholtzia Californica, finest, mixed COlOTS......... cece cece cece cece eee eeeeeess O58 Forget-Me-Not, myosotis alpestris, DIUC...... 0... eee cece cece cee cece eee weet A Gucpee Site \t)5 Hour O’ Clock) Marvellof Pent, sixes scien series © « +s ciele cicteielenieineieias aluinlecverstersinleriate 05 Globe Amaranth, gomphrena globosa, mixed...............5 Teale earversic OO OUM HOD OG. = 05 Gourd, dish: CLOUGH. apeiic eve oc cyvinislel ojeie’eh aietejelee'ce wmiodwinsate) ovece leis, o/cejntafeinieietetctaliateleje lel sista intel ieeeh aim 05 JapaneSenNest Hee cians. ciun cic sieicisiellaciaincimelejs ctu » «\s\s\elnatelaaeleisial eles ave(aicieccnialehatcieaem 05 HerculesiGlirbis joie sneriarecstscheson slcielelesavulvic wie seis »)iaiviatbiuinietnts\eietv) wioraitte nraigiare Selena 05
Pear Shapedy we .csvcccccet vce ceccceccccecnnet soes eves creeds eves cons sa Seite sa ere 05
Sugar Trough, 2... .cccce cece ees eens cone const cece vane ere eve oy aiaiece oie. bbb einly DreisUINs 05
FOUR O’CLOCK, BW 6 6216 BS Seig SapioCaOISB GODS OAIGDOS OF D0 HUB DOOD JOUe OUURbO MiG Soman mcione dou", Ue elarete nee 05
EVERYTHING FOR THE GARDEN.
i D J Per Pkt Ou Ma), 1 / Geranium, mixed........... mlelaiatwendistrisyeysteis ete Matorerer re accel isle $0 10 a GAC if Gypsophilia, mixed eiae-c eset dese seen ceemocilatiine onbie es 05 : Ae hid, Goode tia mixed 4 streak nels hras Gelece ce cickolow SHC oa Nelate lacie 05 Helichrysum, largest, double, mixed ..................05 05
Heliotropes fine mixed oe. i'r ole Wutiey cls vtole cicie elejemisiesleele sie 10
Hollyhock, double, choicest mixed....... 0... e200. e ee eeee 05
Doubler purewvelliteaswecmneeaccicelseeefeceieieekoemeneniee 10
DOUDLe Me aieeiaateciesielesi= Sonddooooase oa Needed adonce cupe 10
IDOI OLS, SenwROOKeL Gdindadoodon honed ocoNNedmObLS Ludo cons 10
Hyacinth Bean, dolichos lablab, mixed, all colors ...... 05
Ipomea, bona nox (Good night) ............- eee ewe ee eee 05
Grandiflora alba, Moonflower, white seeded......... 05
Larkspur, Double Dwarf, mixed ..................... 000% 05
Lobelia Erinus, Crystal Palace ...... 0.0... cee eevee eee 05
Linum, grandiflorum rubrum. ............ 2-2. sees eee vere 05
Love Grove, nemophilia, mixed...... 2... 2... se eeee ee eee 05
Love-in-a-Mist, nigellia damascena, mixed............. 05
1 Dyn g oh op saobb-eerel ENN eolKoytS\n Ga Send odoo odor dood cody HODHaD poor 05
Marigold, African, double, mixed .............-e0ee sees 05
TeigSnS al, Clow Ss so btol 6 Sooo nonscdoaco ound Oneond eooBKe 05
3 IE GloVeKG()sSuuds Base sondedGuO OoSCOd Hbdo Soob0U dodo UlAe : 05
ier NOD, FEC 565 So cooa Donoso Code coo HDD DUNNOE 05
Mignonette, Sweet, 02., 10C......0 2. eee le cee wees eee eee 05
WEIN Gb5 chad doou Soon SgooRG O9002odsad0 Sdn DODO Oba 05
iy Wiis PPM ~
|
| '
GIANT FIVE-SPOTTED PANSY.
Per Pkt Mimulus Moschatus, Musk plant. ...... 0.02 eee cece cee eee ce enee teens ce ehclg Morning Glory, Convolvulus Major, mixed, % Ib., 15c.; oz., 10c........... A WissvtsS) cooduocpamcodgas S5ongo acde 06 dc5G.OddnOD Hoos CabDDO CogoOn DOG GOobAD OLS 154012 Sngoce wee ees asen cece veces cescee ooo bare DROREAD OOodEO Doo UU OOad onac Bdoooo Crimson ...... tele votetefeyaiccciste alolatetatsFatatatelarhnieteyenctelaitislelejersis lyoxeleicien cia onersiciomcticisorciaie epantese Mar pe tial eT e A sree eceheeisieretecie re ciciele cie/atels elsiaie?sjncieejaie ofe® avesiele eisite Mourning Bride, dwarf, double, mixed, Scabiosa....... aetelernicocre Disieisematles AIS Vg oP CHOC ULLA TIN. o.creicia sitters com eranchere osieielelereie alee aicisheeisicisreie\s dite cre scdieies sano King of Blacks........ soad04 araprimmetctetetsiaat'e sh coe wiinisiaisie scaie ic oxtae isle Seareetilenee Leonard’s Giant Five-Spotted, very fine ........... 0.0 cece cece cieeeees ) Nyy Giant Striped........... aiote SDT OILERS NERS e one alos 6 cue is Sree Gres naacareve ee olesbra. ior wlatestne ‘ AY} GS 4! Qube Jane Suzie sane geod dasc0 os dune ubobne Doeo beso OOneOG Metetsnudaterat te BIN Yj re RECSENO WELCORVAGCLOL Al creraiareloisiata eleinieltiotelaivie’e(cie.cia.s e¥eicisieieisloie cs elec, alcisieversjee eels BAN IRERRDEE ste oohcc Le pe RESDIODOn HasHinn 600000 BUDO VASE COGE SAE IGE nOSC ECR ae ar 3 i Large Flowered Parisian, very large stained................ cece cece cece QQ HZ, PU Neat hel CAT etererrictePefats(a e's, ciYore ns on Cinna ISTE sonics sal oe Anew bhae's ait cna cls couse te Oe 7 Extra choice, mixed................ Mielaronroneecicclons aie Seisinte Scie eines so1bbnd.o900 LZ SS Mine trie ee ehetae sa scjcs cece bote RRR aaNet Tere ciate batere tone tis aig Beeoreidese no Sf SWGDWUS Sg - \iiAr it ee ecpc eieteeaetetateyeicioiciaiek in roveretels sceo'oego0d ad0d CoDbED HALY DOod asagQgNeRE eee cS io. Pansy, Beaconsfield THIRD Ue Oath Caney eee ee 10 Cardinal ........... See LOU Ratmonon Booronds adouoonlcococbicadocnh moabe NIG TNGEZ TON laden bode DOB EOE a ee aE oaaneG 10 Blue ..... wrt J ancanbo cononaqons on ctopibGbe Coby occ Piciciclolerelsiieis|ol-aaTelfetsres« Poppy, Carnation, mixed........-+--2+ cece e eee e tenes eee eee eee e eee cence: SOWIE ccc cece cece cece ccee seer ece wees cscs ences eee eeecre eens seenes Mikado ..... Pedi ieee eh erat rarereiclamelelaiatrareleie verctots Urata devecaherainte lekesvokaretetaiere?s Siibba Sy? | soulcnce mobs Obl 40 cous bae0- bond code Sooo oUCucoo™ Cooded OLo0 DODDEG Portulacca, White .......... cece ee ttt eee eee cee e eee e ee eee s cece teenies eS Gon Lan Abbe Gore pane 656 000m 6600 0000. babe = Uddde HOoSTedG0 DooScDNaK000 Seagal? gage abde sods oboe a sodua odd cou Ud00 DUNedm0Ge0 7q0000 Dood0s COON0 GETS OT sess tee eee niclel oleleieiciai-cln o/e! ejalelvinisie [als] o\elciellejerelaceia e/e)eie\elnie\n)inle=\* Mixed ......... Ie Ghoo0 Dade HeBbadoU DOOD ONdTLOOOG 00000000 400s Hoacdaas Double, mixed............ Jen eens eens qoedtae pocbonodch pobeuOods aacppEe Primrose, choice mixed fimbriata ....--+- esse eee eres terete eres teen ee eres Passiflora ccerula..........---- Ecop gue 3059 8000 6868 Hogs: CGadt DOC CO SG pri aE Ricinus, (Castor Oil Plant), mixed, 0Z., LOC. 1.--.. ss ssee ee eees eee cece ees Zanzibarensis, mixed. immense foliage, 0z., INS Kadbos casn pop a cdDade Salpiglossis, extra fine, hybrid varieties, mixed ..-.. +--+ .ses+s sees eeeeee Salvia Splendens............ ceeee eee s cece cccploodd 008 Oood D000 0000.05 00nr Sensitive Plant, Mimosa pudica..... sb.ou a dop9 bac SS HUBRIOdEOdOE ob sco gate Snapdragon, Antirrhinum, finest, mixed.......---- tebe cen e ees eee eeeens Pinks, Dianthus, Chinensis, double China pinks, mixed..........+---.-++ Heddewig’s Double Diadem, mixed, very EOS) G Gade Hubo DObN boa DUOOOn
Heddewig’s Finest Single, mixed.. 05 Crimson Belle, double, crimson .... 10 Eastern Queen, double, white.....- 10
Petunia, fine, mixed...........e0eeeeee ee 05 Double Superb, mixed............-- 25 Phlox, Drummondi, Star...... Me cinch 10 Alba, pure white......... +>. 10 Carmine, red.......... AD OGOD- 10 Black Warrior .......2 .21-ee00 10 Splendid, mixed..........-+-- 05 Per Pkt Stocks, double German, ten weeks, mixed........ Bereietelsiere $0 05
Sweet William, single, mixed, fine.................. as 05 Notice our Sweet Peas dsic0 dic SGQGOCIE OD DOUOUU Ore a and Nasturtiums, oe ME. coeds. sccs 10 page 24, M i ibY6 fs BEOHICIC CERT COPRCEOE 10 é 2 Tine eed sae voce me SSO ean Soe 05 also the Special Strains of Wallflower, double, mixed, extra fine.../............6 10 Popular Flowers, Zinnia, Pompon, finest mixed............... 00 se eee eee eee 05 page 25. EHOICES EMER E Gicte toemsie ne «inte SME <2 S eieewiscie win eees 05
SWEET WILLIAM.
RSCAL Gta esos bis w aleide sictatureveuie osc Meee eeiheriwsrevissinhe s 6 sreveis 05
28 GARDEN, FIELD AND FLOWER SEEDS.
GRASS SEED
Red Top. (Agrostis Vul- garis.) A valuable grass for moist soils and low lands. It is a good, permanent grass, standing our climate as well as any other, and consequently well suited to our pastures, in which it should be fed close. Fourteen-pound bushel.
Solid Seed, Best Grade, 10 Ibs., $1.50; 100 Ibs., $8.50.
Chaff Seed, 10 Ibs., 75c.; 100 lIbs., $3.50.
Timothy. (Phleum Pra- tense.) This is decidedly the best grass for hay, making a large return on strong, rich clay, of medium state of mois- ture. 45 Ibs., $2.00; 100 Ibs., $3.25.
Italian Rye Grass. (Zol- ium TItalicum.) A valuable European variety, adapted to any climate, and produces large and nutritive crops. Eighteen-pound bushel. 100 Ibs., $6.50.
English Rye Grass. (Lolium Perenne.) A very nutritious rapid growing variety, valuable for meadows and pastures. Twenty-four-pound bushel. 100 Ibs., $5.50.
Se EF Tall Meadow Oat
? Grass. (Avena #la- tor.) This produces an abundant supply of foliage, and is valuable for pasturage on ac- count of its early and luxuriant growth. 10 Ibs., $2.25.
Sweet Vernal Grass. (Anthoxan- thum Odoratum.) Per- a | manent pastures N WWI LEY SV) .g should not be sown | Ni! without a portion of
i! this grass. Lhb., 35c. SON Hard Fescue. (f¢s-
Nad: tuca Duriuscula.) Sim- ilar to Sheep’s Fescue, but not so dense, and growing somewhat taller. This often will cover sandy soil under the shade of large trees where no other grass will grow; is a desirable addition to lawn grass. Sow thirty
Ze : = pounds peracre. Lb., = = 30c.; 100 Ibs., $15.00.
LD ==
ENGLISH RYE GRASS.
All Prices on Clover Seed Vary. Ask for Market Price
When
Ready to
\ Zs >
Red Clover.
Buy. Alsike, or Swe- dish Clover.
Medium RedorJune. (T77ifolium Pratense.) This is by far the most important of all varieties, for the practical purpose of agriculture. Sow inspring or fall, at the rate of eight or ten pounds per acre. 100 Ibs., $10.50.
Mammoth or Large Red. (Trifolium Pratense.) It grows five or six feethigh. By its judicious use lands which have been exhausted may be reclaimed. Sow at the rate of about eight pounds peracre. Sixty pounds per bushel. 100 ]bs., 10.50.
White Dutch. (Trifolium Ripens.) A small, creeping, spreading. perennial variety, valuable for pasture and lawns, In conjunction with Blue Grass it forms the most nutritious food for sheep ot cows. Lb., postpaid, 40c.; 3 lbs., $1.00; 100 Ibs., $16 00.
Alsike or Swedish. (Trifolium Hybridum.) This valuable variety is fast gaining great popularity. It is the most hearty of all the clovers; perennial. On rich, moist soils it yields an
CLOVER SEEDS.
White Dutch Scarlet Clover. Clover.
Tall Fescue. (Festuca £latior.) A valuable perennial grass, very productive and nutritious. It is native to moist, heavy soil, where it probably does best, but it succeeds well on any good soil, wet or dry. If used alone sow forty pounds peracre. 100 Ibs., $16.50.
Kentucky Blue Grass. (Poa Praten- sis.) This is known in some sections as “Green Meadow Grass” and ‘June Grass,’ but should not be confounded with ‘‘Poa Compressa,”’ called by some “June, or Wire Grass.’’ It isthe best pas- ture for our climate and soil, succeeding finely on hill lands and producing the ; most nourishing food for cattle, retains its qualities to a late period in winter, ° and, further south, affording abundant food throughout the winter. Sow early in the spring or during the months of October and November. Fancy clean seed. 100 Ibs., $9.00.
Orchard Grass or Rough Cocksfoot. (Dactylis Glomo- rata.) This is one of the most valuable and widely known of all pasture grasses, coming earlier in the spring and remaining laterin the autumn My = than any other. Blooms with red clover, 4 making with it an admirable hay. It is well adapted for sowing under trees or orchards. 100 1bs , $12.50. ¢
Meadow Fescue or English Bluew Grass. (Festuca Pratensis.) A perennial grass from two to four feet high, with flat, broad leaves. It needs rich ground, and succeeds well on prairie soil. Sow about twenty-five pounds per acre. 100 lbs., $11.00.
Wood Meadow Grass. (Poa Nemor- alis.) Grows from one and one-half tovg two feet high; has a perennial creeping root, and an erect, slender, smooth stem. & One of the best varieties to sow in shaded BA situations, such as orchards and parks, §% for either hay or pasturage. Sow aboutgis thirty pounds to the acre. Lb., 50c.;/¥ 100 Ibs., $30.00.
Creeping Bent, Grass. (Agrostis Stolonifera.) Particularly valuable for’ lawns that are to be used as croquet and tennis grounds, because it is benefited more than hurt by tramping, and by its &@ bright color adds to the beauty of the {j lawn. Lb., 40c., 100 Ibs., $20.00.
Meadow Foxtail. (Alopecurus Pra-f ¢ tensis.) An erect perennial, in appear- ance slightly resembling Timothy. Valu-S able for permanent pastures, and does’ best on good moderately moist soil. If KZ sown alone use twenty-five pounds pergy acre. Lb., 5@c.; 100 lbs., $30.00. Co,
KENTUCKY BLUE GRASS.
ORCHARD GR ASS
All Prices on Grass Seed Wary. Ask for Market Price When
Ready to
Buy.
Lucerne, or Alfalfa.
enormous quantity of hay or pasture, and may be cut several times inaseason. Lb., 35c.;31bs.,$1.00; 100 Ibs , $10.50. Alfalfa or Lucerne. (Medicago Sativa.) One of the best varieties, succeeding in almost every situation and bearing heavy crops of forage. Will bear cutting three or four times during the season. For bringing up poor land it is the best of the clovers, as it not only produces large masses of foliage, but forces its roots down fully three feet into the earth. Sow early in spring to secure a good stand before winter, if to be used for pasturage or for curing. 10 lbs., $1.50; 100 Ibs., $12.50 Crimson or Searlet Clover. It can be seeded at any time from June to October. at the rate of fifteen to twenty pounds per acre, and makes the earliest possible spring pasture, bloom- ing the latter part of April or May, and for feeding as hay should be cut just before coming into full bloom. 100 Ibs., vv.
Lincoln Oats. Introduced in 1892, and is one of the best for earliness and yield. Has stiff straw and does not lodge. A splendid feeding oat on account of thin hull, heavy ; meat and soft nib. Pk., 30c.; bu., 75c.;
10 bu., $6.50.
: Clydesdale Oats. A splendid variety of
3 Scotch oats, which have become very popular
in this country.
stiff; early, hardy and productive. 30c.; bu., 75c.; 10 bu., $6.50.
SEED WHEAT.
Grain heavy and straw Pk.,
All standard varieties quoted on application.
SEED RYE.
Spring. Straw very strong. Grain small, but
heavy. Pk., 30c.; bu., $1.00.
Winter. Pk., 30c.; bu., $1.00.
SEED BUCKWHEAT.
9 Common. PE., 30c.; bu., 75c.
Silver Hull. Seed very bright. Pk., 30c.; bu., 80c.
Japanese. Grain very large. In color a dark brown. About a week earlier than Silver Hull.
Very distinct. Pk., 30c.; bu. 85c.
plants.
WINTER OR SAND VETCH.
Grain larger than the spring sort.
We offer first-class recleaned seed.
Much nicer than the common.
Kaffir Corn. hums, valuable asa 100 lbs., $3.50. Yellow Milo Maze...... HIE Mal OMMAZen cro ccine selsicnsitc conc oi Lb., 15c.; 100 Ibs., $8.00
White Dhoura......... ......Lb., 10c.; 100 lbs., $7.50
on poor, arid, sandy soils.
The true biennial variety. Lb., 10c.
| ee EVERYTHING FOR THE GARDEN.
29
SEED OATS.
Royal Victoria. This variety is the best yielding of the plump, heavy grained sorts. It isan exceedingly early variety. For milling itis unsurpassed. The great weight of its grain makes its productive- ness one-fourth more than the ordinary kinds, even though it thresh out but the
ordinary quantity measured in bushels. Pk., 30c.; bu., 75c.; 10 bus., $6.50.
WHITE HULLESS BARLEY
This variety of Hulless Barley is the best. It is highly prized in the northwest, where it has been grown for a number of years, and is becoming very Lb., 15c.; 3% Lbs., 50c., pk., 60c.; bu., $1.75; 10 bus.,
popular everywhere. postpaid; $15.00.
BBY.
of the standard sorts.
A six-rowed Barley, Very productive, hardy, vigorous
bu., $1.00; 10 bus., $9.00.
SORGHUM CORN
date suet sees Lb., 15¢-;
VETCHES.
Sand, Winter or Hairy. (Vicia Villosa.) This variety thrives It is sown either in fall or in spring, and generally mixed with rye, which serves as a support tothe It grows to a height of from three to four feet, and can be cut twice for fodder, first as soon as the bloom appears, and then it can be again cut for the seed. The plant is perfectly hardy, and the produce is recommended as most nutritious. and perfectly round, and should be sown at the rate of one and one- half bushelstothe acre. Qt., 45c.; bu., $10.00.
SUGAR CANE.
Early Amben < iss «2 anise ossicientie as seinevecie Lb.. 10c.; Early Orange.............. Sacra: Satentee Roe Lb., 10c.;
FIELD PEAS.
Prices subject to Change.
White Canada. $1.25; 2 bu. or more, $1.00.
Blue or Green.
More used than any other.
green. Pk., 50c.; bu., $1.25; 2 bu. or more at $1.10.
DWARE ESSEX RAPE. THE BEST SHEEP FEED IN THE WORLD.
100 Ibs., $6.00.
HIGHLAND CHIEF BAR:\
This popular two-rowed Barley is one of the best It is very productive and the berry is large. Lb., 15c.; 3% Ibs., 50c., postpaid ; pk., 40c.; bu., $1.00; 10 bus., $10.00.
MANSHURY BARLEY.
well Known and popular.
Lb., 15¢c.3; 3% Ibs., 50c, postpaid; pk., 40c.;
The most popular of the non-saccharine sor- grain and also asa fodder plant. Lh., 10c.;
The seed is black
Like above, except that color is a bluish
We are headquarters for this. 1,000 Ibs,, $55.00.
Miscellaneous Grains and Forage Plants.
Changs Your Ott,
White Bonanza. A well known oat of great productiveness. Straw stiff and grain plump Pk., 30c.; bu., 75c.; 10 bu,, $6.50.
American Banner. A fine variety of long A goodyielder. Excellent for
Pk., 30c.; bu., 75c.;
grained oats.
feeding or milling. | 10 bu., $6.50.
and profitable.
100 Ibs., $8.00
100 Ibs., 100 Ibs.,
3.50 3.75
Pk., 40c.; bu.,
MANSHURY BARLEY.
30 GARDEN, FIELD AND FLOWER SEEDS.
Extra Early Huron Dent.
of the earliest Dent corns grown.
Pride of the North. This famous corn still retains its popularity; an exceedingly early and prolific variety, always maturing in ninety days; often shelling sixty-two pounds of grain from seventy pounds of ears. Kernels closely set, large, of deep orange color; cob very small and red; stalks about seven feet in height. ‘This is, probably, the best Dent corn for general cultivation in the north. Pk, 40c.; Bu., $1.25;
10 Bus., $10.00.
North Star Yellow Dent. Pk., 40c.; Bu., $1.25.
IOWA SILVER MINE.
FIELD CORN.
After several years’ trial on a large scale it is concluded that this is one Good-size stalk and ear, small red cob, long, deep grain, very rich in oil and starch, and is the only smooth, very early Dent cornknown. PK., 40c.; Bu., $1.25; 10 Bus.,$10.00.
One of the best early Dents. A safe variety to ripen in any locality.
Golden Beauty. A large, broad grained, handsome yellow corn, which is very popular in some sections of the country. Ears are of good size, color, bright golden yellow, cobs small. Pk., 40c.; Bu., $1.25. 10 Bus., $10.00.
_ Minnesota King. A very early variety, in great favor with our customers in Minnesota, Wisconsin and the Dako- tas, and it is considered there the most profitable and best yielding corn, no matter whether weather is favorable or not. It isa yellow half-Dent variety with broad rich, golden yellow kernels. Pk., 40c.; Bu., $1.25; 10 Bus., $10.00.
THE IMPROVED LEAMING.
The Improved Leaming Cornis a medium early yellow variety; large, slightly tapering ears, deep grain, and me- dium sized red cob. In favorable years there is much uniformity of both kernels and ears. Its numerous broad leaves not only encourage a healthy development but make it a valuable variety for feeding. It has been tested from the 38th to the 42d parallels of latitude, in the past ten years, and has proved satisfactory to growers in this wide range. It is one of the seven varieties recognized by the Illinois Experiment Station, where it has been first in yield more times than any other variety in “‘test of varieties.”’ Numer- ous tests at the Experiment Station show it high in protein and oil content, making it valuable to the live-stock grower and feeder. Pk., 40c.; Bu., $1.25; 10 Bus., $10.00.
Early Mastodon. A new yellow Dent, the largest and earliest in cultivation; has yielded 200 bushels to the acre. Pk., 40c.; Bu., $1.25; 10 Bus., $10.00.
Champion White Pearl. Originated in Illinois, and is enormously productive; a strong grower; matures in : about 100 days. The stalk is stout and thick, with large A ears setlow. Pk., 40c.; Bu., $1.25; 10 Bus., $10.00. IMP. LEAMING.
Towa Gold Mine. A splendid new yellow corn. Everyone who has tried it is enthusiastic in the praise of this splendid new variety which was introduced in 1892, | It has everywhere received the most cordial endorsement as one of the best and most profitable varieties ever grown. Pk., 40c.; Bu., $1.25.; 10 Bus., $10.00.
Iowa Silver Mine. The Iowa Silver Mine is a splendid new whitecorn. We believe that in its yield it will surpass all other varieties of any color. In 1894, the poor corn year, only three-fourths of an acre was planted, yet it yielded just seventy- three bushels, or at the rate of ninety-seven and one-third bushels to the acre. It has no barren stalks. The ears are very even in size, being but little smaller at the tip than at the butt, and corn is well filled out over the tip. Pk.,40c.; Bu., $1.25; 10 Bus., $10.00.
Longfellow Flint. This is an eight-rowed Yellow Flint variety, the result of careful selection. The ears are from ten to fifteen inches long, one and one-half to one and three-fourths inches in diameter, are well filled out to the extreme end of cob. Pk., 50c.; Bu., $1.50; 10 Bus., $12.50.
Canada Eight-Rowed Flint. This standard Flint corn is the earliest of all. It is a safe corn to plant where the season is short. It will mature in eighty-five days of good corn weather. Pk., 50c.; Bu. $1.50; 10 Bus,, $12.50.
POP-CORN.
Wisconsin Eight-Rowed,
Mapledale Prolific, Any variety of Pop-Corn: White Pearl, Lb., 30c.; 2% Ibs, 50e3 Queen’s Golden, 5 Ibs., $1.00, Postpaid.
White Rice.
ENSILAGE anpD FODDER CORN.
If planted in drills, which should be about three anda half feet apart, twelve to sixteen quarts per acre are required. If sown broadcast, two to two and a half bush- els are required to the acre. These prices include bags and delivery to depot.
Southern Large Ensilage. This variety gives a very heavy yield of fodder. Pk., 35e.; %-bu., 60c.; Bu., 90c.; 10 Bus., $11.50.
Yellow Dent Ensilage. The large growing Yellow Dent varieties make splen- did fodder. Pk., 35¢c.; Bu., $1.00.
Sweet Corn for Fodder. There is nothing better for green feed, or for curing for wernt than sweet corn. Sow in drills or broadcast. Pk., 75¢e ; %4-bu., $1.25; Bu., $2.00.
Red Cob Ensilage. A most desirable variety, adapted to all sections of the country. Pk., 40c.; Bu., $1.10.; 10 Bus , $10.00.
BROOM CORN.
Tennessee Evergreen. More largely grown in the western states than any other. It ripens early and yields heavy crops. Lb., 25c.; 3 Ibs., 65c.; 10 Ibs., $1.00; 100 Ibs., $4.75.
Missouri Evergreen. Has coarser brush then the Tennessee, and is therefore desirable for making heavy brooms. Lb., 25c.; 3 Ibs., 65c.; 10 Ibs., $1.00; 100
lbs., $4.75. FOR SWEET CORN SEE PAGE 8.
EVERYTHING FOR THE GARDEN. 31
SOUTHERN RAISED CORN —
JACKSON RED COB—Very Hard Corn, Almost Proof Against
Weavils, per Bushel ........-... 60.05 ee eee eee ees $1.25 MOSBY’S PROLIFiC— Makes From Two te Five Ears to the Stalk in Rich Land, per RT Ty eR? Se (I Sa SE St eS Beare ee $2.50 TENNESSEE RED COB—A Very Fine Producer, and Wakes the Best Corn That Can Be Planted Here: per Bushel.............. $1.25 BRONZE CORN—An Extra Fine Variety; per SUSIE. Oe ort ee ar See $2.00 EARLY GOLDEN DENT, per Bushel............... eign Se AE ENE $1.50 EARLY WHITE DENT, per Bushel.... $1.50 SNOW FLAKE, per Bushel.............--- 0-6. ee eee eee eee eee eee. $1.50 sT. CHARLES, per Bushel. 1.50
And All Kinds of GARDEN Jee
COTTON SEED
We Keep All Kinds of Cotton Seed, and Can Furnish You Special Prices on Quantities.
Trade:-Mark Regisiered. Thie Reoster will eppeas om each Bag in Red.
OFFICIAL FROM GEORGIA’S COMMISSIONER OF AGRICULTURE.
DAYBREAK FERTILIZERS, Montgomery, Ala.
The Fertilizer which you registered bere in this office iast season, made by the Federal Chem Co., has heen entirely satisfactory to this department. We have analyzed a number of your various brends and we have not yet found a single brand that ran below the gnarantee IT IS VERY GRATIFYING TO ME FO SEE YOU PEOPLE GIVING THE PLANTERS OF GEORGIA A FERTILIZER THATI BELIEVE THEY CAN RELY UPON FOR GOOD RESULTS I hope to see the analysis of yonr fertilizers this season come up to former years. If so I shall be perfectly satisfied.
Yours yery truly, O. B. STEVENS, Commissioner.
MARKS & GAYLE,
Unqualifiediy Throughout the South, and All Commissien- ers of Agriculture. No better Recommen- dations Than These Could Possibly
DAY BREAK
- CS Se ee
Endorsed by the Best Farmers
Be Obtained.
OFFICIAL.
ALABAMA’S DEPARTMENT OF AGRICULTURE. 3ULLETIN No 18,the latest issued by HON. R.R POOLE, Commissioner of Agricultureand Industries, shows the actual average analysis of all the Daybreak Fertilizers analyzed last season from saples gathered throughout the State by Agents of this Department to be 15.17 per cent. better than the guaranteed analysis of the same
Fertilizers.
‘lontgomery, Ala.
Resident Managers: EDERAL CHEMICAL Oe
HARVEY SEED CO., Montgomery, Ala.
32 GARDEN, FIELD AND FLOWER SEEDS.
of. OYSTER | SHELLS
5 to 10 ibs., per Ib.. erie ES coke Hee Qe EOD. Ibs. fer < =.6 <0: «PSR. oe Ra Satie ee ee $1.00 —
All of Lee’s Preparations at List Price. Write for anything you want 1n this line; we have it,
Harvey Seed Company, MONTGOMERY, ALA.
HIGH-GRADE POULTRY SUPPLIES BEEF SCRAPS
This is the best thing we know of mixed with Clover Meal to make Hiens lay in the winter.
Sto: 20 Ibs., per pound |... eee ee Se 1£OOulbs: for: .. 42>. Sees... .. Ee. eee Stee: eee eee $3.00 CLOVER MEAL, Best Quality
5 to 10 ibs., per ID. 228 :..« .. sco eeee e.g ae eee oe |
160 Ibs. for. .:.20.5 05-522... ee ee ee ae eee * HEN FOOD
Sto 10 bbs., per lb.co.7: :.... see. Se ie ae se
100 Ibs. for.... See eee ee
CHICK FOOD
o> to 10 Ibs., per ib.......... eer: ee Geeweeee ee Be 51 he ecm -cccelaiae Be -
100 lbs. For... 35-year MICA GRIT
6 to 10. Ibs., per Ib... . 6... 66. i el - er
1 OO: thisi. fore rth. oe TR eae Se eee eee § 1.25
AGENTS FOR [HE MODEL INCUBATORS AND Bie ea
Manufactured by CHARLES A. CYPHERS eo) Co aie
No
We sell at manufacturer's prices.
Incubator—120 Egg is the best bas which we sell at........... $20.00 — |
Double Out-Dovor Brooder. SPACERS het Pes. ee ean ts - a ees 2
Please Write for Special Prices.
HARVEY SEED COMPANY. Montgomery, Ala.
REFERENCE TABLES.
Quantity of Seed Requisite to Produce a Given Number of Plants and Sow an Acre. an oaty, per acre.
Artichoke, 1 oz. to 500 plants......... 6 . oz. Asparagus, 1 oz to 800 plants..... ...---. eel: Asparagus Roots.............-----+ ++: 1000 to°7250 IPOH | i Agoheeigocor 2% bu. Beans, Dwarf, | pint to 100 ft. of drill,.- ear oe Beans, pole, 1 pint to 100 hills......-..... y ‘ Beet, garden, 1 oz. to 100 ft. of drill...... 7 lbs: Beet, mangel, loz. to 100 ft. of drill...... Erin Yes Brocoli, 1 oz. to 5,000 plants .... ae OZ Brussels Sprouts, 1 oz. to 5,000 plants.. =P sy iG Se AlGeg Soonoae | BaQokouaandonD sAqdne % bu Cabbage, 1 oz. to 3,000 plants..... apAoRONS 2 OZ Carrot, { oz. to 100 feet of drill.......... 2% lbs Coulifiower, 1 oz. to 3,000 plants...... ... 2% oz Celery, 1 oz. to 15,000 plants...., ngcoo cod: 2 a SUNG donsse osasee pposes aposeo sa00 omBour 4 Ibs Clover, Alsike and White Dutch......... 6 os OTE EY beico ss so adne sano ocod 15 to 25 i <e Crimson treroil...-.-------- 10 to 15 ‘ «Large Red and Medium..... 8 to 12 a Collards, 1 oz. to 5,000 plants. ............ Bo Oy. €orn, rice, (shelled)..-. ......-......-.... 2 qts Corn, sweet, lf pint to 100 hills........... 6 oH Cress, % oz. to 100 feet of drill........... 12 Ibs Cucumber, 1 oz. to 100 hills.........-. 1to3 es Egg Plant, 1 oz, to 2,000 plants........... 4 oz. Endive, ¥Y% oz. to 100 feet of driller 4% lbs IPSS Inxs Ging once gues donde meicds oo 0eu0 % bu Garlic, bulbs, 1 lb. to 10 fect ofdrmilteees: Gourd, 2 oz. to 100 hills.................. Grass, Rives MenLuGky.. co stire. casera eae) | DU Blue, English................-20-5- 1 te ‘Hungarian and Millet............. ye * SVEN KEG a wile seen c = mn esi sate 3tod ss “Red Top, Fane Clean......- 8to10 Ibs ‘* Red Top, Chaff Seed eaten 20to 28 lbs 7 dhtiites s\/Schoe Scocam opcomancooe Y% bu. ‘“* Orchard, Perennial Rye, Fowl Meadow and Wood Meadow...... 2. bu BPOTED We cece winters . jeésnnd sods Sos0 bese Horse Radish Roots............ 5 “10, 000 to 15, 000 Kale, 1 oz. to 5.000 plants...... 52... 2.0006 ZeOZ: Kohl Rabi, ¥% oz. to 100 feet of drill...... 4 Ibs. Leek, % oz. to 100 feet of drill............ 4 oF Lettuce, 4% oz. to 100 feet of drill.......... 3 tf Martynia. 1 oz. to 100 feet of drill........ 5 “f Melon, Musk, 1 oz. to 100 hills........ 1to3 e "Water, 40z. 100 hills......... 1% to4 S Nasturtium, 2 oz. to 100 feet of drill..... 15 “t Okra, 1 oz. to 100 feet of drill .... ...... 8 3 : Onion Seed, 43 oz. to 100 feet of drill. 4to5 es ee tOTESeLS.. = .40 to 80 ss Onion Sets, 1 quart to 40 feet of drill..... 8 bu. Parsnip, % oz. to 100 feet of drill......... 3 Ibs Parsley, % oz. to 100 feet of drill........ 3 s Peas, gardens 2 1 pint to 100 ft. ofdrill,lto3 bu. x Gd. cede) 6 RES SS aeeneeomoeness 2 02 Pepper, 1 oz, to 1500 PPLAMIES ) ociese oie atieiste sess 3) (OZ: Pumpkin, % qt. to 100 hilis.......... 3to4 Ibs. Radish, 3% oz. to 100 feet of drill....10 to 12 i 2G eo SS Oe» Ge eee 1% bu. Salsify, ¥% oz. to 100 feet Giidrill is soos 8 Ibs Spinage, % oz. to 100 feet of drill......... 8 ‘ VIDA: 4: debe dondcs pons Goeenoeoso base 15 < RCT ESA VOLY caine Ciisiecicie «+ cies cccic sie eies ys RSVISTH © EL eee lciate cia cis So) cnt a sia eree qa ce 8 ss Squash, Summer, 40z. to 100 hills........ 2 Se : Winter, 8 oz, to 100 hills......... 2 of Tomato, 1 oz. to 4,500 plants ............. oz Tobacco, 1 oz. to 5,000 plants. ...... 2 ce Yurnip, 1 oz. to 250 feet of drill....... 251 to3 3) lbs (EERE GROSS AA SR ne eens Boeosa ard oye
Number of Plants or Trees to the Acre at
Given Distances. Dis. apart. No. plants.
22 oy hs Bee eee 522.720 36x36 in...
ZA is Re aaa 174,240 (Ad PCE Ss Aa HOSS eee eics oo 43,560 tO So): IS a eae i> ope hela ee 392,040 AIZBB TS eer .e ae BLS aes 348,480 ASA Qiks Sera. o8 1sx 8" ** -- 116,160 ASxIS Saeco 1 ticd Spe ese 29,040 48x24 ‘* PAS. ioe es 19,360 43x30 tienes Lice VO a ees 313.635 48x36 ‘‘
20x20 ‘‘ ~ 15,681 48x48 “*
JE OB 261,360 60x36 ‘‘
21 Sa NC eer nae «. 15.520 60x48 *‘ PARAS acini woe - 10.890 60x60 ‘*‘
vox S* --. 209 088 8x 1 ft
3h Re nee 34,848 8x0
Brg UAL ae 17,424 SxS
30x16 “‘ 13,068 Ox eLSes
MEK AN tees. oces 10,454 10x 6 ‘*
Sir oT ieee me VSIA S 10x10 ‘‘
EEPOO eis Son « 6,970 2x JF
BURG sc stcoe. 58,080 12x15
Boxee os cs. cee 14,520 12x12:**
Mei cee. 5 6 9 680 16x00
36: See cee bev 7,260 16x16 ‘
- Dis. apart) No. plants:
WEIGHT PER CUBIC FOOT.
Hay, well settled..... 41% lbs. Corn, on Cobin bin.. ..22 st ‘« shelled, ‘* 45 ate Wheat, ss 48 - ‘ ARTICLES. Oats, CO rete Gn ee Potatoes, = - 8% ‘
Apples, dried...... Apples, green.....
Average Time Required for ae pods B2bd S500 Garden Seeds to Germinate. Beane, “SAR. DAYS | Beans, Castor...... 1SEST LS G5050 saDoSa DOaGdE 5 to 10| Buckwheat...... Beater Gakeccn sosevoren 7 to 10} Broom Corn Seed.. Cabbage Hito0)|PRECES meee eee eei (CANEROL a S500 cosoaD O0OndE t2ton Si Carrots ees cece Ganlhiloweree-c. esc: SitodOiCharcoalseecess ccs A Celenyeecemeeeeisemec 10 to 20 | Coal, stone........ (Qoypeleuosooupono coop wSds 5to 8 Coke... g Cucumbpereerccceeee ee 6 to 10} Corn, shelled...... enGiviensccaccen. rere HitolOlpComiseatiee se LQ RHEE ao ocod bone aq0000 6to 8} Corn Meal. bee ayes tate Oniotee eee eto moNlGran berress.c..e POA eee ine oie Se cisisiaieets 6to1U0| Dried Peaches... Barsnipeeesciseristestae 10 to 20 “° FPREREGL 6 scuco0 INV ogodsan ssc O56 9 to 14} Flax Seed.......... RadiShh cece cmoseioccree 8to 6 Grass Seed, Blue.. SHIStN 50090 code 55006599 7 to lz Clover...... TROD) coo soodes pocess 6 t> 12 ‘Hungarian Turnip... 4to & OO NGI ers So 8 SeOrechard....- See Geno prc Time Required for Maturity e aS imetny ee: : erman Lupine... of Different Garden Crops manGee ae ae Reckoned from the
Day of Sowing
Mineral Coal..... eherSeed: pays | Middlings. fine.. Beans, String........ 45to 65 Middlings, coarse. Beans, Shell......... 6510 70} O2tS----------- BEGtS> MuTnip esses 65 | Onions ........---. Beets, Long Blood.... 150} Onions, tops....... Cabbage, Early...... 105 Onions, sets...... Cahages ater eres 150 | Osage Orange..... Cauliflower .......... 119} Parsnips....-.-.... Corn.. Shes Fe as Gee 75 Potatoes ...-.. Hegplant .j 240s... 150 to 160 | Potatoes. Sweet.. IpISethucespe cme erence 65 Peas, dried ....... Melon, Water........120 to 140 Peas, in pods... Melon, Musk......... 120 to 149} POP Corn ......-.. Onion 6555.2 s.sesseess 135 to 150 aoe Time....... IRE NS thgcgecoscds co08 TED) tx) SIRD)| | BASbococe GasoeD scse RentSn eae intel OC 30 to 45 Salt, coarse........ Squash, Summer..... 60 to 65 Salt, fine 2805 ee =< Squash, Winter...... j25 | Turnips, Rut’b’ga. (Tomatoes 150 | LUrnips, white.... AEM De cen Sees 60to 70| Wheat..---.-----
Hickory Nuts...... Malt, Barley.
Legal Weights and Measures. POUNDS PER BUSHEL.
Valuable Horticultural Books.
Sent Postpaid on
Receipt of Price.
Asparagus Culture, Flex, cloth. Barry’s Fruit Garden, New and Re- viSeds 2s. cce..: soose BEY) Bee Culture, A BC of, Root, PS 58 1.25 Bommer’s Method of Making
- $0.50
IW EWI Th Sin6 gOS OHURCOOOCOL ET enOS nace .25 Brits Caulahowe4rscc setae odes sueeee .20 Brill’s Farm Gardening and Seed
GROWATI Dyin nana ec isaisessdeunncne 1,00 Broom Corn and Brooms............. .00 Breck’s New Book of Flowers....... A Burr’s Vegetables of America........ 3.00 Bulbs and Tuberous Rooted Plants,
(Cr th, AUG andoandbe socogoesecoccndd 1.50 SGISRY GHEE 295 nocond poupeNecsoee 40 Dahlia, the Peacock, I, K............ .30 Downing’s Fruits and Fruit Trees of ;
America. New Edition ............ 5.00 Elliot’s Hand-Book for Fruit Grow-
ers, paper 60 cents; cloth........... 1 00 Egg Farm. New, Stoddard, H.H.... .50 Feathered Pets, on the Care of
Canaries setoneeccen man enecenobeens .25 Flower Garden, Beautiful, Mathews .40 Fitz’s Sweet Potato Culture......... .60 Fruit Growing, Se by S. B.
Green.. a 1.00 Grape Culturist, ‘by A. 'S. Fuller... 1.00 Grasses and Clovers, by Prof.
(EHOMmaS SHAW senctcavc «s\seee omen cs ve
Gregory on Cabbage.............00-- 0.30 Gregory on Carrots and Mangels.. .30 Gregory on Squashes. ... ea) Henderson’s Gardening for Profit... 1.50 Henderson’s Gardening for Pleasure 1.50 Henderson's Practical Floriculture.. 1.50 Henderson’s Hand-Book of Plants.. 3.00 Home F loneultures by Eben R. Rex- fordieece BOT Cr ACRE ene eter te a0) Hop Culture, ‘New and Revised
Editioncee ee .30 Horticulturist — Rule ‘Book, ‘Bailey.
1p 18 ir «9 House Plants—How to ‘Succeed, at
PSEA Ouse sa ee cles elactercine 1.00 Onions—How to Raise Them Profit-
ably... 25° Plums and. Plum Culture, Waugh,
Ea ee Ratan saan Gn. pataeben acmotoae 1.50 Pruning Book, The, Bailey, 1G, H. 1.50 Rose, The—Its Cultivation. Ellwan-
ger,H. B. 1.25 Small Fruit Culturist._ ‘Fuller, A.S. 1.00 Strawberry Culturist. Fuller, A.S. .25 Thomas’ American Fruit Culturist.. 2.00 Tobacco Culture, by fourteen exper-
ienced cultivators ...............-. Vegetable Gardening, by Prof. S. B.
Greentree oe anne wep adic oan 1.25 Window Flower Garden, Henrich’s. .50
At the prices above named, the books will be mailed, postage paid, on receipt of the money.
Harvey Seed Company
Garden, Field and Flower Seed Onion Sets
Incubators and Poultry Supplies
Wholesale and Retail
Special quantity prices made to market gardeners. Miail orders solicited.
Montgomery, Alabama.