Historic, Archive Document

Do not assume content reflects current
scientific knowledge, policies, or practices.

pre ena

\
7
; oy}
¥ a
> te i3
‘

Wevetace earns om oe TO 7
ah eat aot ak ie “PRUIT. TREES AND PLANTS
ee ORNAMENTAL TREES, SHRUBS.
rapa octane, ak ct ROSES, VINES, PERENNIALS.
Rei ea bet is aiken Ne PLANTS

i ‘ ‘ ¥ Cites ( ¥; : s j
hy i fy: ‘ ; , f : 7 : Ria A
+ + , we Bie i t . i

F 4 at

ae H J, . WEBER & SONS NURSERY CO.

WEBER NURSERIES

Capital, $50,000.00

FORTY-FIFTH YEAR.

“WEBER’S GUIDE” for 1912 is the title we- shave. given our new ‘Descriptive Catalog and
Price List, and we hope that it will guide you in making. your selections for the Orchard, Garden

and Lawn. 5

Previously we have issued our cateipe. in the fall, covering fall and spring business; this
new Catalog will cover the spring and fall seasons of the year in which same is issued.

We exterd to our many patrons our sincerethanks for tt-éir liberal patronage, and hope that
we may continue our pleasant business ‘Telations in the future. ‘=

To those receiving this Guide with whom we-haye:never had business relations, we suggest
a trial order; we aim to make our dealings with you satisfactory so as to number you among our
list of regular customers. ; f

Our Nurseries are located in St. Eouis County, one” ard jonentiarter miles from the city lim-
its of St. Louis, on Gravois Road, in-the heart of the truck ‘gardening section of St. Louis County.
Our soil is of the “Loess Formation,” and is especially’ adapted to the growing of strong, healthy
trees and plants, with plenty of fibrous roots. 3 :

Our packing facilities are the best of any hursery tiear st’ Louis; we have a. large frost-proof
concrete storage house, 80x120 feet, 14 feet high, eontai ning: over 100,000 cubic feet of storage
space; also storage cellar 25x50 for bulbous. stock, “All packing: and filling of orders is person-
ally superintended by members of the firm in- the best possible manner; no distance too great for
our mode of packing. For spring shipments. we carry. a complete line of steck in our storage
houses and can make shipments at any time~ “during the winter and up to May: ist, and later ac-
cording to weather conditions. Int the fall we begin Shipping about ‘Oct. 15th, Alb. HUES are
packed under. cover, avoiding exposure to sun, wind, frost, ete: ats

We extend acordial invitation to you to visit our Nurseries. ‘our office will Be open on
Sundays during the months of October, Noyemuer, March. Apu: gud a to accommodate cus-
tomers who cannot come on week days: * — =

Our plantings of ornamental stock are now the ‘largestein thé war “consisting” “oF over 800
varieties. We are also importers of special Ornamental ‘SbOCK * “from Holland; France, England
and Japan and will be glad to quote on any stock you may require, as we have close business
relations with reliable growers in these countries. You wilt find our liSt a very complete one.
If there are any varieties you desire, and we do not quote them, it a be well to write us about
them. ; : ; =
We make a specialty of supplying stock for parks, cemeteries, élub and institution grounds,
and private places, large and small. . : 55S

Soliciting your correspondence, inquiries and favors, we are,

Yours very truly,

H. J. WEBER & SONS NURSERY CO.

LOCATION—Nurseries and Office located on Gravois road, one and one-quarter miles west
of the St. Louis city limits. Nine miles southwest of the St. Louis Court House, and one and
one-half miles west of the terminus of the “Cherokee Street Car Line.” We are one-half mile
east of Gravois Station on the St. Louis, Cape Girardeau & Memphis branch of the Frisco R R.

1. H. J. WEBER, President

F. A. WEBER, Secretary and Treasurer

WM.

, Supt. Floral Department

W. T. WEBER

4.

2.

’t Gen’l Superintendent

G. A. WEBER, Ass

A. WEBER, Vice-Pres. & Gen’! Supt. De

a

SC }

— 2—a_)) WEBER & SONS NURSERY a ae

GA NURSERY, MO. (CO _) =

BEFORE MAKING UP YOUR ORDER PLEASE READ
CAREFULLY

Clause 1—Terms invariably cash.

Clause 2—Remit by Post Office or Express Money
Order on St. Louis, Mo.; Registered mail to Nur-
sey, Mo., or by Draft. Please do not send private
enecks unless drawn on some St. Louis Bank. <Ad-
dress all correspondence to H. J. Weber & Sons
Nursery Company, Nursery, Mo.

Cc. O. D. Orders must be accompanied by one-half
the amount in cash.

Clause 3—Quotations. Prices in this list are for
the quantities specified, except that 4 plants go at
the 10 rate, 40 plants at the 100 rate, 400 plants
at the 1,900 rate. Long lists of single varieties
will be figured at the single rate. All orders are
hooked with the understanding that same shall be
void should injury befall the stock from drouth,
fire, frost er other causes beyond our control.

Clause 4—Guarantee. We exercise the greatest
care to have every tree and plant true to name,
and are ready on proper proof, to replace anything
sent out by us that may prove untrue to label, free
of charge, ov refund the money paid for same. It
is understood between the purchaser and ourselves
that we are not to be held liable for any greater
sum than that paid us for said trees and plants
that prove untrue.

Clause 5—Free Packing. We pack free all orders
sold at Catalog prices, in the best possible man-
ner, in bales or boxes with moss or excelsior.

Clause 6—No Cartage to Freight Depots, Express
Offices or Wharfs in St. Louis.

Clause 7—City of St. Louis and Suburban Deliv-
eries. Our delivery wagons will make trips to the
various sections of St. Louis and Suburban points
during the seasons. Orders to go this way must
be left entirely with us as to the time of delivery.
We combine a number of orders for one section in
making these deliveries.

Clause 8—Special Deliveries. Parties desiring de-
livery on a certain day must order ‘‘Express Ship-
ment”’ of their order and must pay Express charges.
Order must be plainly marked ‘Special Delivery,”
and must give date on which delivery is to be made.

Clause 9—Railroad Facilities. We have the St.
Louis and Memphis R. R. branch of the Frisco
System within one-half mile of the office. Our
station is Gravois, Mo. United States Express and
ear-load shipments are loaded here. This with the
St. Louis facilities enables us to make prompt ship-
ments on direct Jines.

Clause 10—Early Orders. Customers should send
in orders as early as possible; do not wait until the
last minute and then expect to get immediate de-

livery. Wishing to serve our patrons in the best
possible manner is the reason we ask for early
orders.

Clause 11—Directions. Observe carefully that
your Name, Post Office, County and State are
plainly written on your order; also, state whether

__ TERMS, CONDITIONS AND GENERAL REMARKS

to be sent by freight or express, and by what route.
If no directions be given, we will use our best judg-
ment. Use order sheet enclosed.

Clause 12—Errors. <Any errors that may occur
in filling orders must be reported within five days
after receipt of goods. We will immediately correct
same. Complaints entered after the above stated
time will not be entertained.

Clause 13—Losses. All stock will be sent out in
good condition. We do not guarantee stock to live,
nor do we make up any loss whatever due to clim-
atic effects, or after culture on the part of the pur-
chaser. Immediately upon receipt of stock, open
ihe package and ascertain the condition of same;
eheck up the varieties, and compare with your
order and report to us at once any complaints that
are to be made, if any. If package has become
frosted or dry enroute, treat as per instructions
given under “Directions for Transplanting and Care
of Trees, Shrubs, etc.’

Clause 14—Replacing. We do not replace stock
that may die at the prices quoted in this list. Our
responsibility ceases upon the delivery of stock in
good condition. Complaints, if any, must be made
within five days after delivery, when we will at
once rectify or allow deductions. Hereafter, we will
not permit any deductions from invoices unless the
above conditions have been complied with.

Clause 15—Substitution. it is customary, should
the supply of a variety become exhausted (as will
occasionally oceur in all establishments), to sub-
stitute in its place a similar sort, if there is such.
Should it be desired for us not to do this, please
state on your order ‘‘No Substitution.’

Clause 16—Selections. Persons not acquainted
with the difterent varieties can leave the selection
to us, in which case we will select as if planting for
ourselves.

Clause 17—Transportation. Every care is taken
to secure safe and prompt transportation. The for-
warders alone must be held responsible for loss or
delay in transit.

Clause 18—-Inspection. Our nurseries are annual-
ly inspected by the State Entomologist, and have
been found free of San Jose Scale and other danger-
ous insects and diseases. <A copy of certificate of
inspection will be attached to every package that

leaves our establishment.
Clause 19—Fumigation. Having built our own
“Fumigatorium,’’ we will fumigate with ‘‘Hydro-

cyanie Acid Gas,’’ all stock sent to states where
same is required by law. Should any of our cus-
tomers request us to fumigate their stock we will
be pleased to do so free of extra charge. We are
not to be held liable on account of damage to stock
by fumigation.

Clause 20—-Notice. The prices in this list abro-
gate previous quotations and are made on stock to
be strietly first-class in the grades named. Please
do not compare our prices with firms quoting on
mailing size trees and plants only.

H. J. WEBER & SONS NURSERY CO.,

Nursery (St. Louis County), Mo.

NURSERY, MO.

GENERAL DIRECTIONS FOR TRANSPLANTING
TREES OR SHRUBS

Preparation of the Soi!.—For fruit trees the soil
should be dry, either natural, or made so by thor-
ough, drainage, as they will not live or thrive on a
soil constantly saturated with stagnant moisture.
The soil should be well prepared by plowing at least
twice beforehand, using a subsoil plow after the
common one at the second plowing. On new fresh
land, manuring will be unnecessary; but on lands
exhausted by cropping, fertilizers must be applied,
either by turning in heavy crops of clover, or well
decomposed manure or compost. To insure a good
growth of fruit trees, lands.should be in as good
condition as for a crop of wheat, corn or potatoes.

Preparation of the Trees Before Planting.—This
is one of the most important operations to be per-
formed, and one in which the most fatal errors are
liable to be committed. The object of pruning is
two-fold: First, to secure a head properly shaped
and sufficiently open to the sun and air for the
successful ripening of the fruit. Second, to prepare
the natural balance between the roots and branches
of the trees, that a healthy growth may be secured.

When young trees are removed from the nursery,
roots are often broken or bruised, as will be the
case however careful the digging, packing and
transportation may be performed, and it becomes
necessary that the balance should be preserved by
a proper and judicious pruning. This pruning should
be adapted to the size and condition of the tree,
and at the same time the form should not be for-
gotten. It should be so close as to enable the roots
to supply the demand for sap from the remaining
branches, and, at the same time, no growth already
secured should be wasted.

In both Standard and Dwarf Trees, it will be
usually found a safe rule to cut back, when prun-
ing at transplanting, one-half of the growth of the
previous season. The ends of the large roots should
be made smooth with a sharp knife, where they
have been roughly cut with the spade in digging,
always cutting from the bottom of the root with an
outward cut. New roots will form, and the injured
parts heal more readily with; this attention.

Planting.—The holes should be dug large enough
in the first place to receive the roots of the trees
without cramping or bending them from their nat-
ural position. The tree having been properly prun-
ed, should be held upright and the earth filled in
around the roots, the finest and best soil from the
surface being worked in among them, filling every
space and bringing every root fully in contact with
it. When the hole has been half filled, pour in a
pail or two of water; let this settle well, then finish
the planting by placing soil enough about the trees
to raise the surface somewhat higher than else-
where, and press the soil carefully down with the
foot. Care must be taken against planting too
deep; when the earth settles about the tree it
should stand at the same height as when in the
nursery. When set in Autumn, it is well to raise
a mound of earth about the trees a foot or more
in height. This will keep them from being swayed
by the winds or thrown out by the frost during the
winter. It should be removed in the spring. In
planting Dwarf trees, the stock on which they are
budded should be under ground.

Staking.—!f trees are tall or in exposed situa-
tions, they should be supported by stakes to prevent
injury from the action of the wind. Staking is done
in the best manner by driving two strong stakes
firmly in the ground, one on each side of the tree,
about a foot distant from it, and fastening the tree
between them with bands of straw or other soft
material, so that it may be kept in an upright posi-
tion without chafing until the roots obtain a firm
hold upon the soil.

Mulching.—This is properly done by placing a
layer of coarse manure or litter from three to six
inches deep about the tree, extending one to two
feet further in each direction than the roots. This

keeps the ground moist and of equal temperature,
rendering watering unnecessary, and is in all re-
spects preferable to it. Trees properly mulched are
more certain to live and make much greater growth
than those which are not so treated.

Cultivation After Planting.—Here is the grand
opportunity for the success of the skillful fruit-
grower. It is not enough for him that his trees
are of the choicest sorts, selected with regard to
the ‘climate and adaptation to the uses for which
they are designed; that they are properly pruned
and planted in dry, mellow soil, thoroughly enriched
and prepared for their reception; protected from
the winds by properly staking, and that they are
in perfect shape and thriftiness. He knows very
well that all this may be properly and well done,
at great expense, and without further care be fol-
lowed by an entire failure, so he watches their
growth and defends them from their enemies that
the cankerworm and caterpillar do not find safe
lodgment among the branches; or the borer cut
about them or the cattle obtain access to them by
neglected gates or fence, and break down the
branches. Ue is well repaid, for they thrive and
grow rapidly; the shoots are vigorous; the bark
clean and smooth, and soon a most abundant crop
of superior fruit testifies to his wisdom and care.
His neighbor, perhaps with better soil and equal
care and experience in planting, having at the out-
set neglected these apparently trivial but really im-
portant matters, sees, instead of thrifty trees load-
ed with luscious fruit, the wreck of his hopes in a
few mossy, scraggsy, mis-shaped specimens of what
he considers his ill-fortune, and hastens to remove.
He, too, is justly rewarded for his neglect, as is his
more prosperous neighbor for his care.

Those who are obliged to plant trees in a field of
grain or grass should see that all such are carefully
mulehed with rough manure, and that the ground
is kept loose and moist about the trees. A hoed
crop is greatly preferable in such plantation for the
first five years. After a growth for this time,
standard apple, pear, cherry and plum trees will
grow and produce fairly in turf. The dwarf trees
and peaches should be well mulched every year with
loose manure and the ground thoroughly cultivated.
They will amply repay for this attention in the in-
creased quantity and improved quality of the fruit.

Pruning.—Pruning after the first year should be
varied according to the purposes of the planter and
the variety of the tree. It should be trimmed as
early as possible up to the height it is intended the
future head should be, and the cutting off of large
iimbs may not in the future be necessary. The
removal of large branches should be avoided in all
cases whenever it is possible to do so, as decay is
hiable to commence at the point of separation and
extend into the trunk; whenever it is done the
wound should be carefully pared smooth and a
coating of paint or grafting wax applied to protect
it from the action of the weather. After the re-
moval of lower branches until the head has reached
the desired height, the only pruning needed is to
remove such branches as are crossing or interfer-
ing with each other; and keep the head in a sym-
metrical shape and well open to the sun and air.
Trees should receive proper shape by judicious
pruning and attention early in the spring of each
year while they are young, and very little pruning
will be needed afterward. When trees are to be
pruned and trained for specific purposes and in a
special manner, the orchardist will find full direc-
tions in the standard works on horticulture which
may be read with great benefit and followed with
success, but are beyond the scope of an ordinary
catalog.

Grape Vines require a dry, mellow, well-drained
soil, deeply worked and well enriched, with a warm,
sunny exposure. In planting, give the roots plenty
of room and settle the soil firmly about them. A
strong vine may be allowed to grow the first season

NURSERY, MO.

without pruning. In November or December fol-
lowing, the growth should be cut back to three or
four buds; the next season, allow but two buds to
2row, which should make canes seven to ten feet
jong and be cut back four to five feet the follow-
ing wiater, ready for fastening to the trellis. For
the subsequent pruning of vines as well as trees,
planters would do well to consult some practical
work on the subject.

Berries should have a strong soil and be kept
under constant cultivation. Mulching is of special
value. Raspberries and Blackberries should have
eld wood cut out each year, and new canes pinched
off when three feet high. Strawberries should be
mulched late in the fall; uncover the crown early
in spring; remove mulch after fruiting and spade
in light dressing of manure.

Currants and Gooseberries need heavy mulching
and pruning, so that new wood will have room to
Zrow.

Roses should have a deep, rich, well-drained soil,
and should be severely pruned every spring before
ihe buds start, cutting back all the last growth to
three or four buds, except climbing roses, which
may be first allowed to partly cover the space de-
sired. Old decayed branches should never remain.
Every autumn compost should be placed around the
stems of the plants and spaded into the ground in
the following spring.

Treatment of Trees That Have Been Frozen in
the Packages, Received During Frosty Weather, or
After Long Exposure. Place the package, unopen-
ed, in a cellar or some such place, cool, but free
from frost until perfectly thawed, when they can
be unpacked and either planted or placed in a
trench until convenient to plant. Treated thus,
they will not be injured by the freezing. If dried
from long exposure, bury entirely under the ground,
soaking well with water, or place in water from 12
to 24 hours, and prune more closely than ordinarily.

Wintering Nursery Stock Procured in
the Fall

In sections where the winters are very severe,
it is not advisable to set out young trees and plants
in the fall, but the practice of procuring them in
the fall, covering them with earth during the win-
ter and planting them in the spring is becoming
more and more popular, as experience has demon-
strated its advantages. In the fall, nurserymen
are not hurried in their own planting; the season
for shipping them is comparatively long, and the
weather not nearly so changeable as in the spring.
Railways are not so much hurried, and there is
much less chanee for injurious delays than in the
spring. It being practicable to plant trees so pro-

cured as soon as the frost is out, they become
thoroughly established the first season.

Some have an impression that trees dug in the
fall and trenched in over winter are worthless.
This is a great mistake. Peach and some other
young trees, if left standing during their first win-
ter are frequently killed or injured by frost, while,
if dug in the fall and treated as described below,
they come through bright and uninjured.

To insure success, select a spot where no water
will stand during the winter; have no grass near
to invite mice. Dig a trench deep enough to admit
one layer of roots, and sloping enough to allow the
trees to lie at an agle of not more than 30 degrees
with the ground.

Having placed one layer of the roots in this
trench, cover them with mellow earth, extending
well up on the bodies, and see that this is firmly
packed, then add another layer of trees, overlapping
the first until all are heeled in. As soon as this is
done, cover the tops with evergreen boughs, or corn
stalks that they will be thoroughly protected from
winds.

A Table Showing the Number of Trees
or Plants to the Acre

Distance No. of trees
Ifootapartimcachinwayielemistelerceielerciciseicrcinis 43,560
Teer anant each waymrernnicc crelelesctesiariciere 10,890
SPLC CLA PALE CACHRWAYs cites cnete cies) viele! oleleree 4,840
A teetrapantyecachwayie tice starieicie ona Seloente 2,702
DeLee tr apantseachimw a yeuercde lore cierencicictcvereeismencts 1,742
6hieetrapaniecachmwaysereieiveletrceiele tere cieinine 1,210
MeneetrapaLnty Ga Chi wayaresericice sicterstetore cleloiele 888
Sufeetiapart Cach swayit cece cscniee cae emails 680
Oeheeteanant ed cniawa Viewer cckeisinererclerelel sks 537

HORECLrapartecachewavariere cercclieete tte circle cine 434

iatcetranpant eachiwayennccn weenie one 360

WBteetianant.Cachiawavierisie sem uiciecie sre alee 302

13 feet apart each 257

14 feet apart each PH?)

15 feet apart each 193

16 feet apart each 170

17 feet apart each 150

18 feet apart each 134

19 feet apart each 120

20 feet apart each 108

25 feet apart each 69

30 feet apart each way 48

Rule—Multiply the distance in feet between the
rows by the distance the plants are apart in the
rows, and the product will be the number of square
feet for each plant or hill, which, divided into the
number of feet in an acre (43,560), will give the
number of plants or trees to the acre.

Distances for planting various fruits will be given
under respective headings in this catalogue.

FORMULAS

For Making Various Insecticides and Fungicides

Ammoniacal Copper Carbonate

6 ounces

Ammonia, 26 deg. Baume, enough

to dissolve copper, no more.

WiaitOr® vote c ofsietelefetans siscevelahare 40 to 50 gallons
_ Dissolve the copper carbonate in the ammonia
dit will take about three pints of the stronger grade)
and dilute with water to 40 or 50 gallons, for fun-
sous diseases. It does not discolor fruit and may
be applied even when the fruit is ripening. Often
used for apple bitter rot.

Arsenites

Paris green or London purple.... 1 pound

Fresh Lime 3 pounds

Wiateritrerssicitertiove sete ucla wanes 175 gallons
Make a paste of either Paris green or London
purple with a little water, gradually dilute it by
adding more water. When it is of liquid consis-
tency, pour it into the water. If the poison is put

dry into a barrel of water, it will collect in lumps
and cannot readily be stirred into the water. For
insects that chew, the Paris green is less liable to
burn foliage, so it is sometimes preferred to the
Lordon purple. The Lendon is more readily kept
in suspension in the water, however. In applying
either of these poisons, the liquid should be kept
stirred so they will not settle.

These poisons are generally applied in Bordeaux
mixture instead of water. c

Bordeaux Mixture

Copper Sulphate ...... eiovevanate) dere 4 pounds
Lime (unslacked) ........ +..... 6 pounds

Dissolve the copper sulphate by putting it in a
sack and suspending it over a tub of water (at least
4 gallons), so the bottom of the bag just touches
the water. When it is dissolved, dilute to 25 gal-
lons. Slack the lime and dilute to 15 or 20 gallons,
then pour these two together and add water to
make 50 gallons. Do not fail to dilute both lime

HS

and copper sulphate before they go together, or
chemical action will injure the solution.

The Bordeaux Mixture is used for most fungous
diseases, and is our best general fungicide. The
sediment from it remains on the plant for some
iime, so fruit should not be sprayed with it near
the time of ripening.

The amount of copper sulphate and lime may be
increased to 6 pounds each or diminished to 3, 2 or
even 1 pound each. (The weaker mixtures have
proven about as suecessful with us for everything,
except bitter roi, as the 6-pound solution.)

Heliebore

Fresh White Hellebore .......... 1 ounce
NACI Obs borate OOD OOo OOo eo OOS 3 gallons
Apply when thoroughly mixed. This poison is

_ not so energetic as the arsenites and may be used
a short time before the sprayed portions mature.
It is the best remedy for rose slugs.

Potassium Sulphide Solution

Potassium sulphide (liver of
UUM ol ahh 0d) eer ae eiuicinic oie cece 5 1% pounds
Waller ean cote eaen eaeeee 40 to 50 gallons
Dissolve the potassium sulphide in the water.
For bitter rot of apples and for currant and
gooseberry mildew.

Quassia and Tobacco Solution

ECR OIOIE oes CG 1% ounces
3 ounces

Quassia Chips
Tobacco Stems
Water

Soak the quassia chips and tobacco each in a
separate bucket, containing one gallon of water
over night. The next morning boil the quassia for
15 minutes in the water in which it has been soak-
ing. Pour the quassia and tobacco water together
and dilute to three gallons for plant lice. It has,
with us, given best satisfaction for plum aphis.

a—a_y 1) WEBER & SONS NURSERY ©
NURSERY, MoO.

WOKS

Kerosene Emulsion -|

Wiabalet@ilySoap Anica. ot eee % pound
OUI Wa teT wate iverecave atel eee 1 gallon
EX GHOSEM E15 5. reins. 'si c eues seehodereloper sere 2 gallons

Dissolve the soap in the water, add the kerosene,.
and churn with a pump for 10 minutes. Dilute with
10 gallons of water before applying. Use strong
emulsion for all scale insects. For insects which
suck, as plant lice, mealy bugs, red spider, thrips,
bark lice, cabbage worms, currant worms and all
insects which have soft bodies can be successfully
treated.

Lime-Sulphur Salt Solution

Stone meimies ee okcae ore rerers
Flower of Sulphur 15 pounds
Common Salt 15 pounds

Put the lime into the kettle and add three or four
buckets of hot water. While the lime is boiling,
add the sulphur and stir briskly. If the contents of
the kettle are now likely to boil over, add another
bucket of hot water. When the lime and sulphur
have boiled for a few minutes, add the salt, and
cook until the solution becomes dark amber in
color. Usually an hour is sufficiently long to cook
ihe mixture, but if it is not of the right color at
this time, the cooking should be continued. When
the mixture has been properly cooked, there ought
not to be more than a pint or so of residue left in
the kettle. At the beginning of the cooking, the
solution should be stirred continually, but after a
few minutes, oceasional stirrings will suffice. When
the cooking is completed, the solution should be
strained through a fine sieve, made for the pur-
pose, or through a gunny sack into the pumping
barrel or tank and made up to 50 gallons of hot
water. The mixture should be applied while hot
and preferably as socn after making as possible,
always bearing in mind to keep it well agitated
while the pump is in operation. All pumps and
accessories used in applying the mixture should be
well washed and cleaned after each time of using.

15 pounds

INSTRUCTIONS ON SPRAYING AND
WHEN TO APPLY
NEVER SPRAY TREES WHEN IN BLOOM

Scale Insects

on fruit trees, shrubs, vines, roses, ete: All trees

badly infested should be severely pruned before
spraying.

First Application—Scalecide 1 to 16; Kerosene
Emulsion. Use in fall as soon as the leaves drop;
we advocate fall spraying for scale insects where
ever possible.

Second Application—Repeat in spring if neces-
sary before leaves appear with Scalecide, Kerosene
or Lime Sulphur.

Third Application—If spraying has been neglect-
ed, trunks and limbs may be washed with 1 part
Scalecide to 16 parts water where there is no foli-
age. The foliage may be sprayed with 1 part
Sealecide to 35 parts water in the afternoon of
cool, cloudy days.

Nursery Stock

A safe rule would be to dip all trees before plant-
ing, in a solution*of one part Scalecide to 20 parts
water, to insure against Scale Insects. We use this
precaution on all stock purchased by us, from other
sources.

Apple Scab, Bitter Rot, Biting Insects

First Application—When buds begin to swell, sul-
focide or Bordeaux

Second Application—Just
Sulfocide or Bordeaux.

Third Application—As last flowers are falling,
Sulfocide or Bordeaux and Arsenites.

before flowers open.

Fourth Application—10 to 12 days later, Sulfo-

cide, Bordeaux and Arsenites.

Fifth Application—10 to 15 days later, Sulfocide
and Bordeaux.

If bitter rot appears, use Am. Copper Carbonate
or Potassium sulphide every 10 days until fruit is
picked.

Cabbage Worms, Aphis, Harlequin Bug

First Application—When insects are first seen,
Sealecide, 1 to 40.

Second Application—10 days later, repeat if not
heading.

Third Application—10 days later, hot water, 130
degrees, if heading.

Fourth Application—Repeat third when neces-

sary. Plant catch rows of- radish or mustard, and
spray with strong kerosene emulsion as insects
gather.

Currant, Gooseberry—Mildew, Worms,
Aphis

First Application—When leaves appear, Sulpho-
cide or Bordeaux.

Second Application—10 days later, Sulphocide or
Bordeaux; Hellebore for worms; Quassia and tobkac-
co for aphis.

Third Application—Repeat second when
sary.

Fourth Application—Ammonical copper carbonate
after fruit is one-half grown.

neces—

HS:

Evergreens—Bag Worms

First Application—When bag worms first appear,
arsenites, 1 lb. to 300 gallons water.
Second Application—Repeat first if necessary.
_ Third Application—If worms persist until wood is
ripe and weather is dry, add more arsenites.

Pick bags containing eggs in winter. To tell when
worms hatch, hang bags containing eggs in bottle,
with bits of colored cloth.

Grape—Fungous Diseases, Biting
Insects

First Applicat'ion—When buds begin to swell, Sul-
focide or Bordeaux.

Second Application—Before flowers open, Sulfo-
cide or Bordeaux and Arsenites.

Third Application—When flowers have fallen, re-
peat second.

Fourth Application—10 to 14 days later, Sulfo-
cide or Bordeaux.

If rot appears after fruit is half grown
Copper Carbonate.

Sacking bunches in manilla sacks gives
specimens for show table.

use Ain.

finer

Nursery Stock—Fungous Diseases, Bag
Worm and May Beetle

_ First Application—When buds begin 10 swell, Sul-
focide or Bordeaux,

Second Application—VWhen leaves appear, Sulfo-
cide or Bordeaux and Arsenites.

Repeat second every 14 days if necessary.
Cut out and burn fire blight if it appears.

Peach, Nectarine, Apricot—Fungous

Diseases
First Application—When buds begin to swell,
Sultocide or Bordeaux.
Second Application—Just before flowers onren,

Sulfoecide or Bordeaux.

Third Application—When flowers have fallen,
Sulfocide or Bordeaux. Arsenites may he added
to Bordeaux for curculio.

Ten days later repeat third. Am. Copper Carbon-
ate every 10 days for rot, after peaches are nearly
2rown. Jar trees for curculio during early morning
or evening after fruit sets.

Pear—Leaf Blight, Scab, Biting Insects

_ First Application—When buds begin to swell, Sul-
focide or Bordeaux.

_ Second Application—Just before flowers open,
Sulfocide or Bordeaux.

Third Application—When flowers
Sulfocide or Bordeaux and Arsenites

have fallen,

10 to 12 days later repeat third.
10 to 15 days later, Sulfocide or Bordeaux.
Cut out and burn fire blight if it appears.

Plum—Fungous Diseases and Curculio

_ First Application—When
Sulfoecide or Bordeaux.

_ Second Application—Just before flowers open,
Sulfocide or Bordeaux and Arsenites.

buds begin to swell,

“WEBER & SONS NURSERY ("~~
NURSERY,

Mo. CO.

_ Third Application—When flowers have fallen,
Sulfocide or Bordeaux and Arsenites.

Ten to 14 days later, repeat third.

Ten to 14 days later, repeat third.

Jar trees for curculio morning or evening after
fruit sets. Am. Copper Carbonate solution every
week from full size until gathered.

Potato—Scab, Blight, Beetles

First Application—Soak seed for scab in corrosive
sublimate solution, 2 oz. to 16 gals. water for Jl
hours.

Second Application—When beetles appear, arsen-
ites,

Third Application—-When vines are cne-half
grown, Sulfocide or Bordeaux; Arsenites for beetles.

Ten to 14 days later, repeat third.

Ten to 14 days later, repeat third.

Quince—Fungous Diseases, Biting
Insects

First Avplication—-When buds begin to swell, Sul-
focide or Bordeaux.

Second Anplication—When fruit has set, Sulfo-
cide or Bordeaux and Arsenites.

Two weeks later, Sulfocide or Bordeaux.
Two weeks later, Sulfocide or Bordeaux.
Repeat in two weeks, if necessary.

If rot appears at time of ripening, spray with Am.
Copper Carbonate solution. Destroy all decayed
fruit.

Raspberry, Blackberry, Dewberry—
Fungous Diseases

First Application—When, buds begin to swell
Sulfocide or Bordeaux.

Second Application—When leaves are opening,
Sulfocide or Bordeaux. Cut out all rusted leaves.

Third Application—Two weeks later, repeat sec-
ond application.

Fourth Application—Before fruit is full size, Am.
Copper Carbonate solution.

Fifth Application—After fruiting, Sulphocide or
Bordeaux.

Spray frequently with Sulfocide or Bordeaux for
fungous diseases that appear after fruit is gathered.

Rose—Fungous Diseases, Slugs

First Application—When leaves appear, Am. Cop-
per Carbonate.

Second Application—If slugs appear, Hellebore.

Third Application—If fungi appear, repeat first
application. If slugs appear, repeat second applica-
tion.

Strawberry Rust

First Application—When flowers first begin to
open, Sulfocide or Bordeaux.

Second Application—-When first fruit sets, repeat
first application.

Third Application—Before fruit ripens, Am
per Carbonate.

Fourth Application—When last fruit is harvested,
Sulfocide or Bordeaux.

Fifth Application—Repeat fourth application, if
necessary.

Cop-

L344 021x08 ‘ASNOH SADVYHOLS “OD AYSASHNN SNOS 8 H3E4M ‘f ‘H 40 M3IA LNOUS

ves aa

SE

¢ HJ

<—=2—2a_)) WEBER & SONS NURSERY (7 ~5" =>
i 7 y NURSERY, Mo.

CO. Wz

FRUIT DEPARTMENT
STANDARD APPLES

The culture of the apple has become one of the leading enterprises of the United States.
unlike that of other fruits, extends nearly through the year.
sion can be easily obtained of this indispensable fruit

Its period,
By planting judiciously, a constant succes-
for family use. and where ome has suitable land,

nothing pays better than a good apple orchard for commercial purposes.

Piant Standard Apple from 80 to 40 feet apart each way, according: to the nature of the soil.

feet apart it takes 48 trees per acre; 40 feet apart it takes 27 trees per acre.

Our Apples are all “crown grafted’’ on branched roots.

First class, 5 to 6 feet, 11-16 inch and up............

Medium class, 4 to 5 feet, 5g to 11-16 inch..........

54

Second class, 3 to 4 feet, % to % inch.............

Write us for prices on larger quantities.

Summer or Early Varieties

Benoni—A fine eating apple, striped and splashed
with red. Tree upright grower. [Early bearing; fine
for family orchard.

Carolina Red June—Medium size, red; flesh white,
tender, juicy, sub-acid; an abundant bearer. July.
Tree an upright grower.

Duchess of Oldenburg (Russian) — Medium _ to
large striped, mecstly red. Best summer cooking
apple; tree hardy, early and a good bearer. July
and August. Tree upright grower.

Early Harvest—Medium to large, flat, pale yel-
low; good. ‘Tree a fair grower and bearer. July

Fameuse (Snow Apple)—Medium to large, a
handsome deep crimson, white fleshed apple of high
flavor and of best quality; very productive. August
and September. Tree is a strong upright grower.

Red Astrachan—Medium size, round, dark red on
yellow ground; good market sort. Flavor fair. Good
for cooking. Tree upright in growth. August.

Yellow Transparent (Russian)—
Skin clear white, changing to pale
yellow when fully ripe; flesh white,

tender, sprightly sub-acid; good
early bearer. July. Tree an upright
zrower. .

Autumn Varieties

Fall Pippin—Large beautiful yel-
low when fully ripe. Flesh tender,

rich and of good quality. Tree
hardy, vigorous and _. long-lived.
September.

Maiden Blush—Large, flat, pale
yellow; beautiful blush, mild, sub-
acid, valuable for market, cooking
and drying. September.

Rambo—Size medium, oblate, skin
smooth, yellowish white in the
shade; streaked and marbled pale
yellow and red in the sun, and
speckled with large rough dots;
very tender, rich, juicy, mild, sub-
acid. Very good. Tree vigorous.
Tender in some localities. Septem-
ber.

Wealthy—Fruit medium, oblate,
skin smooth, whitish yellow, shad-
ed with deep red in the sun, splash-
ed and spotted in the shade. Flesh
white, tender, juicy, sub-acid, very
good. September and October. This
variety is, in our estimation, des-
tined to take the lead of all other fall apples; it is
par excellence. Should be in every orchard.

Wolf River—Large, greenish yellow, flushed with
crimson. Flesh white and rather coarse. Valuable
as a show apple on account of size. September.

. Early Winter Varieties

Grimes Golden—Medium to large, roundish oblate,
slightly conical, large specimens oblong. Skin yel-
lowish white with a mild sub-acid agreeable good
to best flavor. Tree a good grower and early an-
nual bearer. No orchard should omit this variety.
‘October.

Jonathan—Medium size, unless thinned on tree
when it becomes a fair size; form roundish conical;

Thirty

None better.
Each Peri10 Per 100
Michel aichenenetst Welaciaversioielletereletelczerci ond Ost D) $4.00 $32.00
etniolatatcnatelistslelciatsleleiaichsialiel sielstiel-t ey s 40 3.50 27.00
Sonor ondapoooaDOoontOoebOoODUS .380 2.50 18.00

skin thin and smooth, the ground clear light yel-
low, nearly covered with lively red stripes and
deepening into brilliant or dark red in the sun;
flesh white, rarely a little pinkish; very tender and
juicy; mild, sprightly vinous flavor. Tree slender
and spreading. October.

Northern Spy—Fruit large, roundish, oblate, con-
ical; greenish yellow, covered with light and dark
Stripes of purplish red; sub-acid, delicious flavor.
ance a strong, upright grower. September and Oc-
tober: es :

Talman Sweet—Medium or rather large, roundish
oblate, slightly conical. Color clear white yellow
with a clear brownish line from stem to apex; flesh
white, firm, rich very sweet. Tree vigorous, hardy
and productive. October.

Winter Varieties
Arkansas Black—Large, very dark red, smooth,

roundish flat, lightly dotted with white; flesh yel-
low, sub-acid; long keeper. November to April.

Duchess of Oldenburg

Baldwin—A celebrated winter variety in the East.
Large size; bright red; flesh yellow, juicy; very
productive where it thrives.

Ben Davis—Large, roundish oblong, red striped,
very handsome. Mild, sub-acid, not rich. Tree
very vigorous, hardy and productive. This is one
of the safest and most profitable market apples
grown in this country at present. October to March.

Gano—Tree very healthy, vigorous, hardy, having
stood 32 degrees below zero without injury. A
rapid grower, large and spreading in orchard. Color
bright red without stripes or blotches. Similar but
superior to Ben Davis. Large and even in size.
Peolutle bearer and a good keeper. October to
March.

valuable for both family and market. Tree
very hardy and an early and constant bearer.
December to April.

Yellow Belleflower—Large to very large, ob-
long, pale yellow, sometimes blushed; acid to
sub-acid, rich and good. Tree a fine, spread-
ing grower and hardy. October to January.

York Imperial—Medium to large, oblate;
color white, shaded with crimson; flesh firm,
crisp, juicy and sub-acid; a good bearer and
keeper; one of the best winter apples. No-
vember to April.

DWARF APPLES

For several years the demand has been in-
creasing for Dwarf Apples. These are espe-
cially adapted for small places; can be planted
6 to 8 feet apart and trained as espaliers or
grown in a bush form. We quote the follow-
ing varieties: Yellow Transparent, Duchess
of Oldenburg, Northwestern Greening, Baldwin
and Maiden Blush.

2=Vear tLECS) 2). ele ore ole $0.50 each; $4.50 per 10:
(For description of fruit, see Standard Apple.)

CRAB APPLE

Profitable for market, coming into bearing
quite early. Some of the varieties are not only
good for culinary purposes, but are especially
desirable for table use.

Wealthy

Gilpin or Little Red Romanite—Tree very vigor-
ous and fruitful. Fruit medium size. Roundish ob-
long; skin very smooth and handsome, richly cov-
ered with deep red and yellow. Flesh yellow. firm,
juicy and rich; good keeper. November to May.

Huntsman—Fruit large, flat, deep yellow; very
mild, sub-acid, fine grained. Very good. Valuable
for family and market. Tree fair grower and good
bearer, but does not bear heavily while young. Oc-
tober to April.

Ingram—Seedling of Rawles Jennett. Originated
with Martin Ingram of Green County, Missouri.
Fruit medium in size; dark and light red in stripes.
Flesh yellowish white; firm, crisp, very mild, sub-
acid, aromatic flavor. Tree upright, vigorous and
an abundant bearer. December to May.

Jennett (Rawles)—Medium to large where grown
on good soil and not allowed to overbear; flat, con-
ical, striped red, sub-acid; very good for market
and family use. Good cider apple. October to April.

Mammoth Black Twig—A_ seedling of
Winesap, which it resembles in every way
except that the tree is a better and much
more vigorous grower, more hardy, and the
fruit is much larger. Color dark red; flesh
firm; flavor mild. A good keeper. One of
the best. December to May.

Missouri Pippin— Large, oblong; color
bright red, with numerous gray dots; very
handsome and of fair quality; an early and
abundant bearer; profitable market fruit.
October to May.

Northwestern Greening—A Wisconsin seed-
ling of great promise, having taken first prize
at their state societies. Tree a good grower
and hardy. Fruit yellow, smooth, rich, of
good size, resembling Grimes Golden in shape
and color. Good quality. November to De-
cember.

Rome Beauty—Large, roundish flat; bright
red, mild, sub-acid, very good. A good grower
and early bearer. November to March.

Spitzenburg (EHsopus)—Large, round, bril-

liant red, with gray dots. Flesh firm, rich,
erisp, juicy, delicious. A fine apple where
it succeeds. October.

Stayman’s Winesap—Tree is a vigorous
grower, drooping in habit and adapts itself
to soils and situations; fruit large size, bright
red color and produced in large quantities.
A profitable market variety.

Wiresap—Medium, conical,
smooth

cal, dark red; very
Acid to sub-acid, juicy and rich, very

10

Price, first class, 5 to 6 tt., 11-16 inch and up:
tee DOA each $4.00 per 10 $32.00 per 100
Florence—Originated in Minnesota. Fruit
medium in size, color carmine when well color-
ed; flesh yellowish, fine, acid. Excellent for cooking
and for jelly. Valuable for early market. Tree hardy
and spreading; bears young and inclined to over-
bear.
General
grower; fruit large.
flesh white, tender,

Grant—Tree a vigorous and upright
Color red to very dark red;
mild, sub-acid. One of the

best. October.
Hyslop—Large size, beautiful dark crimson-
Hangs in clusters. Good. September.

Large Red Siberian—About an inch in diameter,
grows in clusters. Yellow, lively, scarlet cheek.
Bears young and abundantly. September.

Martha—Raised from the seed of the Duchess of
Oldenburg. A rapid grower, and a heavy bearer of
the most beautiful fruit. Color a bright glossy yel-
low, shaded with light, bright red. Mild, clear,
tart, surpassing all other Crabs for culinary pur-
poses, and fair to eat from the hand. October to
November.

Jonathan

— 2— 2) WEBER & SONS NURSERY 7 ~~"
Oo _ Bd NURSERY, MO. Oy

PEACHES

In order to preserve the continued healthy growth of the trees and the fine quality of the fruit, the
trees should have the shoots and branches shortened every few years, so as to preserve a round, vigor-
ous head with plenty of young wood, and the land should not be seeded to grass, but kept in constant
cultivation.

The following have been selected after an examination of many different sorts in bearing, and the
best only have been chosen. They furnish a succession for about three months, commencing the early
part of July. Plant 20 feet apart, or 109 trees to the acre.

\ Hach Peri10 Per 100
First class, 5 to 6 feet, 54 inch and up............ Oboe DODD ORO DOs 200,00 500 $0.30 $2.50 $20.00
Medium class, 4 to 5 feet, 9-16 to 5 inch. Rraiereietciaistatstarcratsiate 5000 125 2.00 15.00
Second class, 3 to 4 feet, 7-16 to $e inch........ ccc cee et eee eres ter cnrece sis sie .20 1.50 10.00
Write us for prices on larger quantities. $
+7 : 1 Carpenter Cling—Very large, white, rich, juicy.

First Ripening Wee cauds
Alexander — About medium in size; greenish Chinese Cling—Fruit very large, oblong; skin
white, nearly covered with deep red. Very juicy, clear straw color, almost transparent with deli-
and of good quality. Adheres to the stone. cately mottled red cheek. Flesh exceedingly juicy,

Apex—Ripeus same time as Alexander, but su- sweet and refreshing. Well known, and very pop-
perior in color, size and flavor. Color, skin yellow ular. : f
with mottled red cheek. Flesh yellow and of good Elberta—Supposed to be a seedling of Chinese
quality. Like all early sorts, it adheres somewhat Cling, but is entirely free. Very large, yellow, with
to the stone. Good early market sort. Leds Chee Hesh mellow, Hams, Jury, and ae nish

Arp Beauty—Color flesh yellow, mottled bright OMIT 5 OSEAN IKON Kes SUNS IEDM! Get an y-
crimson. Excellent flavor, juicy. Tree good grower Fitzgerald—Wruit large; brilliant color, bright
and productive yellow, suffused with red; flesh deep yellow; good

% % : quality. Harly September.

Mayftower—Originated in North Carolina; very aCe a _ ole A
early; color perfectly red; a valuable market sort. ale De ANG eu Ea a
Perfectly hardy in bud, and a heavy cropper. ing, juicy and rich: highly flavored! z

Waddelli—This variety is largely planted
commercially in the South. It is a good ship- — ne
per and of good quality. Color, creamy white : > :
with bright blush.

Second Ripening

Carman — Large, resembles Elberta in
shape: color creamy white, with deep blush:
skin very tough; flesh tender, fine flavor and
quite juicy. One of the hardiest in bud. In
shipping qualities and freedom from rot, it
is unsurpassed. Profitable market variety.

Greensboro—The largest and most beauti-
fully colored of the extra early peaches. A
freestone; flesh white, juicy and excellent.

Highley—Large white with red cheek on
sunny side. <A fine shipper. Hardy in bud;
a profitable sort.

Third Ripening

Belle of Georgia—Very large; skin white,
with red cheek; flesh white, firm and excel-
lent flavor; the fruit is uniformly large and
showy; a very prolific bearer.

Champion—Originated at Nokomis, MIIl.
Flavor delicious, sweet, rich, juicy, surpass-
ing all other early varieties. Skin creamy
white with red cheek. Early, productive and
large. Perfect freestone.

Crawford Early—This very beautiful and
best of yellow peaches is highly estimated
for market purposes. Fruit very large, ob-
long, shiny yellow, with fine red cheek; flesh

vellow, juicy and excellent. Tree very vig- : A
orous and productive. MELEE INGE
Family Favorite—Very large and a seedling of Old Mixon Free—Fruit large, skin pale yellow,
‘Chinese Cling, but a free-stone, earlier and of finer marbled with red, with deep red cheek. Flesh
color and quality; exceedingly vigorous and pro- white, but quite red at the stone; tender, with an
ductive. excellent, rich, sugary and vinous flavor.
Mamie Ross (Cling)—Very large, oblong; color E . 2
similar to Chinese Cling, but has more of a red Fifth Ripening
cheek. With us it is one of the best early cling- 2
stones. Crawford Late—Ripens from 14 to 20 days later
Mountain Rose—Large, white, washed with car- than the Crawford Early, and is larger in size,
amine; flesh tinged pink, juicy, vinous, sub-acid and color about the same, only a littie darker red and
good flavor. Very good. yellow. One of the best and finest yellow free-
Yellow St. John—Nearly the size of Barly Craw- Stone peaches; moderately productive. Ripens here
ford and equal to it in beauty. More productive in August.
and of better quality. Orange yellow with a deep Gold Dust Cling—A large, fine peach in every
red cheek. RESPECT, Brier dake yellow shaded with red; juicy,
r - . sweet; valuable for canning.
Fourth Ripening Lemon Cling—Large, pale yellow, dark red cheek.

Captain Ede—Large to very large; a rich orange Productive.
yellow; flesh yellow, small stone; melting, rich, Picquet Late Free—Very large, yellow with red
highly flavored. Free-stone. cheek; flesh yellow, rich, sweet and of the highest

11

¢_§>
NURSERY, MO. Coy

flavor. A most valuable acquisition. The
most profitable and desirable of all late yel-
low peaches.

Stump the World—vVery large, roundish;
skin white, with bright red cheek; flesh
white, juicy. One of the best late free-stones.

Sixth Ripening

Dulce—Free, large size, rich orange color
with dark red cheek; flesh of fine quality,
firm, buttery; a splendid shipper. Small seed.

Krummel’s Late—Found in an orchard on
property of Mr. Krummel of St. Louis. Color
a rich golden yellow, with bright red cheek;
round; free-stone; juicy. Ripens here about
October 5th, and is a good keeper.

Salway—Large, creamy yellow, with crim-
son cheek; flesh deep yellow, juicy, rich,
sweet.

White Heath Cling—One of the finest can-
ning peaches; good size, lemon shape; tree a
good grower and an excellent bearer.

PEARS

The cultivation of this noble fruit is ex-
tending as its value is appreciated. The pear,
like most things highly desirable and valu-
able, cannot be had without attention, labor
and skill. One of*the most impertant points
in the management of the pear is to gather
ppemein the prop ers Te Summer pees
shoul e gathered at least ten days before ,
they are ripe; and August pears at least a Krummel’s Late
fortnight. Winter varieties, if they will hang so long, may be left until there is danger of frost; gather
whenon gently lifting the fruit the stem will readily separate from the limbs. Place in a dark room
until fully matured..- The pear succeeds on most soils, but probably does better on rather loamy loam.

Dwarf pears must always be planted deep enough to cover the junction of pear and quince three or
four inches, and about one-half of the previous summer’s growth cut off each spring. The side branches
should not be removed higher than one foot from the ground in Dwarfs, while Standard Pear may be
trimmed to the height desired. :

(The letters ‘‘D’’ and ‘S” appended to the descriptions of varieties indicate favorable growth either

as Dwarfs or Standards, or both.) Hach Perio. ePertoo
Standard, first class, 5 to 6 feet, % imch...... PododnoSoDoNGoGD DOOD ODGOCdOGCD ae POL45 $4.00 $35.00
Standard, medium class, 4 to 5. feet, % to % inch -40 3.50 30.00
DWartetilcsteclass cA) LOmDeheeixes7aiNehineiarciemelsrs clcleenenneiele iene -40 3.50 30.00
Dwar medinimclass, 13) tol 4 teats tonsa inCh nr. selene ie nice cele a niete erereieicreane B35) 3.00 25.00

Write us for prices on larger quantities.

Early Varieties

Bartlett (S-D)—One of the most pop-
ular pears; large, buttery and melting.
with rich flavor. Tree a vigorous and
erect grower; bears young and abund-
antly.

Clapp’s Favorite (D-S)—Very large,
resembling Bartlett in shape; ripening &@
few days earlier; pale yellow, with brown
dots. Juicy, delicate flavor.

Koonce (S)—Very early, tree vigorous
upright grower; free from blight; mag-
nificent foliage. Fruit medium to large,
skin yellow.

Tyson (S)—Rather above medium in
size, melting and juicy, sweet and fine

- flavored; one of the finest summer vari-
eties. Tree vigorous and upright in
growth.

Vermont Beauty (S)—Tree a strong,
vigorous grower; productive. Fruit me-
dium size, roundish, skin yellow, nearly
covered with’ carmine; flesh melting,
sprightly, best quality; fine flavor and
juicy.

Autumn Varieties

Bartlett-Seckel or Columbia (S)——Good
size, hardy, vigorous and productive; of
highest quality, rich and well flavored;
highly colored.

Beurre d’Anjou (S-D)—A large, fine
pear, buttery and melting, with sprightly
vinous flavor. Tree a vigorous grower
and good bearer. Best on Quince.

Beurre d’Clairgeau (S)— Very large,
yellow and red. Flesh yellowish. Keeps ~

vole see el solid a long time after gathering. Free
Beurre d’Anjou grower and abundant bearer.
12

WJ

NY

Duchess d’Angouleme (D)—The largest of our
good pears; succeeds on pear, but attains its high-
est perfection on the quince, and is a beautiful and
vigorous tree. Most profitable for market.

Flemish Beauty (S)—A large, beautiful melting
sweet pear. Tree vigorous, fruitful and succeeds
well in most parts of the country.

Garber (S)—One of the Japan hybrids; the best
and handsomest of its class. Earlier than Kieffer,
larger and much better quality; free from blight;
very hardy. Immensely productive, bears young;
excellent for canning or preserving.

Howell (S-D)—One of the finest American pears.
Large, handsome, sweet and melting; tree very vig-
orous, hardy and productive.

Kieffer Hybrid (S)—This is a seedling raised
from the Chinese Sand Pear crossed with the Bart-
lett. Skin rather rough. Color yellow with red
cheek in the sun. Flesh white, juicy, buttery and
rich. Tree a very strong upright grower. Very
profitable for market.

Louis Bonne De Jersey (D)—A large, beautiful,
first rate pear. Yellow, with a dark red cheek;
melting, buttery and rich. Tree a vigorous grower,
and most abundant bearer.

Seckel (S)—-The standard of excellence in pears.
Small but of highest flavor. Tree a strong, slow
erect grower; very hardy and bears abundantly.

Sheldon (S)—Fruit medium; color greenish yel-
low, mostly covered with russet and a little brown-
ish erimson in the sun. Juicy, rich, aromatic and

sweet.
Worden-Seckel (S)—A seedling of the Seckel
which it much resembles in flavor; is equally as

luscious, more juicy, and fully as rich and imvit-
ing. -Is far superior in appearance, size, form and
eolor. Color bright red on one side and yellow on
the other. Hardy; bears young; prolific; good
keeper.

Winter Varieties

Lawrence (S)—Size medium to large; obovate;
color a golden yellow; flesh melting, with a-rich
aromatic flavor.
abundant bearer.

Tree a moderate grower and an

GQ = a_5 WEBER & SONS NURSERY (9 ~5
4 wi NURSERY, MO.

?

CO.-

Kieffer

CHERRY

The Cherry is one of the finest and most delicate
dessert fruits. The acid varieties are also highly
esteemed for preserving and cooking purposes. Al-

though a very perishable fruit, the period of its

use may be prolonged to six weeks by a proper
selection of varieties. The trees thrive well in any
soil which is sufficiently well drained, but will not
succeed a long time where the sub-soil is wet.

Our Cherry trees are all budded on Maha-
leb stock, which makes a healthy tree, and
does not sprout from the roots, which is a
nuisance when common Morello stocks are

~

used.

Plant 18 feet each way; 135 trees to the
acre.

Bach Peri0 Per 100

First class, 5 to 6 feet,

% inch and up .....: 45 $4.00 $35.00
Medium class, 4 to 5 ft., :

VA WayiGA Shadn oaadooue -40 3.50 30.00

Baldwin—vVery large, round; dark in color,
almost transparent; large medium length
stem. Flesh sub-acid and very good; fruits
early, is hardy and very productive.

_ Black Heart (Sweet)—-Very large, black,
juicy, rich, excellent and moderately pro-
ductive.

Black Tartarian (Sweet) — Very large,
black, juicy, rich, excellent; productive.

_Dyehouse—A very early and sure bearer.
Ripens a week before the Early Richmond.

Early Richmond—Medium size, light red;

melting, juicy, sprightly acid flavor. Tree
healthy and productive. One of the most
popular early cherries.

Elton (Sweet) —Large, rather pointed,

heart-shaped; pale yellow,
Sweet and very good.

i English Morello—F air size, very dark red;
rich, acid, juicy, good.

Governor Wood (Sweet)—Large, roundish
heart-shaped; light yellow shaded bright red;
very good. Tree vigorous and productive.

Late Duke—Fruit similar to May Duke,
but later and not so sweet.

with red cheek;

<2) WEBER & SONS NURSERY ©

aw 2 \ e fl
—\_ eds NURSERY, Mo. CO.

; May Duke—Medium, dark red, melting, rich,
juicy, excellent. A reliable early cherry, nearly
sweet. :

Montmorency Large —Large, round: slightly
heart-shaped; dark red, becoming nearly black
when fully ripe. A

Montmorency Ordinaire—Large red cherry, rip-
ening ten to fourteen days after Early Richmond.
Tree a slow but stiff grower: very prolific bearer,
valuable late sour cherry.

Napoleon (Sweet)—Of fine appearance and the
largest size; yellow and amber, with bright red
blush; flesh firm, juicy, delicious. July.

Ostheimer (Weichsel)—Large, heart-shaped, al-
most black when ripe; full of purple juice; exceed-
ingly rich, less acid than the English Morello; good
dessert and unsurpassed for kitchen uses. Very
hardy both in tree and fruit bud: blooms late, and
even young trees bend under their weight of fruit
with unfailing regularity.

Reine Hortense (Sweet)—Very large, fine, heart-

shaped; yellow with red cheek, juicy and delicious.
Tree a healthy and handsome grower; productive
and very desirable variety.
_. Royal Duke—Said to be more valuable than May
Duke; hardier and more fruitful; ripens evenly.
Large, roundish, oblate, pale amber mottled bright
red; tender,- juicy, rich, almost sweet.

Windsor (Sweet)—Large, dark red: late.

Wragg—Very hardy, vigorous and productive;
medium dark purple; fine quality.
Fs Yellow Spanish (SCN) ae Wey pale yellow,
: bore Irm, juicy and excellent. One of the best light-
Mentmorency Ordinaire colored cherries. Tree productive and fine eros

PLUMS

The Plum tree will accommodate itself to most situations not absolutely wet, but produces its fin-

est fruit and most certain crops on heavy, clayey soil. 3
The great enemy of this, as well as other smooth-skinned fruits, is the curculio, and as a knowledge
of a practical remedy for this pest is essential to the raising of good crops, a description of the only

method for its destruction yet known is here given. ri
Shortly after the blossoms fall, and as soon as the presence of the insect is ascertained by his
crescent-shaped mark upon the young fruit, procure a sheet large enough to spread over the Sinai
surface of the ground covered by the
branches of the trees; slit it in the middle
part way through to allow it to pass on each
side of the trunk of the tree; then jar the
tree thoroughly either by striking with a
heavy mallet upon the stump of a limb, or
by shaking suddenly all the larger branches.
The insects, which closely resemble pea bugs,
or dried buds, will fall upon the sheet and
remain dormant for some minutes; gather -
them up with the thumb and finger and de-
stroy them. This operation repeated every
morning for two or three weeks will save the
erop. All stung fruit must also be carefully
destroved to prevent increase of the insects,
and thus render the work of the season com-
paratively easy. This remedy is sure and
tar more feasible than is sometimes supposed.
Plant 18 feet apart; 135 trees to the acre.
Each Per10 Per 100

First class, 5 to 6 feet,

FA whaler Lieve 9) soosoo $0245 $4.00) $35.00
Medium class, 4 to 5 ft.,
52 incheanadmipe eee 40 3.50 30.00

Write for prices on larger quantities.

Foreign Varieties

Bradshaw—Large, dark red, flesh green,
juicy, productive, fine for market.

Coe’s Golden Drop—Large and handsome;
light yellow, firm, rich, sweet; one of the
best late plums. Middle of August.

Damson (Common Blue)—A valuable mar-
ket sort. It bears énormous crops. Thou-
sands of bushels are annually sold in our
markets. It is the best plum for preserving.
August and September.

German Prune—A _ large, oval variety;
much esteemed for drying; color dark purple;
a very agreeable flavor.

14

—

<2 2) WEBER & SONS NURSERY

CO. E

NURSERY, MO. a7
af

Geuii—Large bluish purple; flesh yellowish green, early annual bearer; fruit medium size; red; tree

rather coarse; sweet, pleasant. One of the best perfectly hardy, a strong, vigorous grower.
market varieties. September. ° 0

Imperial Gage—Fruit large, oval, skin pale green, Japan or Oriental Varieties

flesh juicy, sweet, rich and excellent. ‘Tree very Botan—Beautiful lemon-yellow ground, nearly

vigorous and productive. overspread with bright cherry, Large to very

large; oblong, tapering to a point like the Wild

Lombard—Medium, round, oval, violet red; juicy,
pleasant and good; adheres to the stone. Tree vig-
orous and productive. A valuable market variety;
one of the most hardy and popular. July.

Shropshire Damson—An English variety of great
merit for preserving. Tree very vigorous, hardy
and an abundant bearer.

Chickasaw Varieties

Wild Goose— Well known, large, deep red when
Good quality; one of the best native plums;

ripe. C
should be in every orchard. July.
Newman—Fruit medium, oblong; color bright

vermilion. Adheres to the stone. Tree vigorous,
foliage smaller than the Wild Goose. In fertility it
is truly astonishing; its fruit ripens about August
15th and lasts until September 15th.

Pottawattamie—Quality excellent;

QUINCE

The Quince is hardy and prolific,
bearing its crops with great regu-
larity. The fruit always commands
a good market, and with most fam-
ilies is considered indispensable for
canning and for jelly.

The trees or bushes should have
a good, rich soil, clean cultivation
and an annual dressing of well rot-
ted manure. Thinning out the twigs
so'as to keep the head open to the
sun and air, and removing dead or
decaying branches, is all the pirn-
ing that is required. Plant 10 feet
apart each way; 435 trees to the

an immense

acre.
Each Peri10 Per 100
First class,
4 to 5 ft. ..$0.50 $4.50 $40.00
Medium class,
3 to 4 ft. .40 3.50 80.00

Description of Varieties

Bourgeat— The strongest and
most distinct grower of all quinces,
with large foliage and very hand-
some fruit. Keeps longer than most
other sorts. Very promising.

Champion — Originated in Con-
necticut. The tree is a prolific and
eonstant bearer; fruit averaging
larger than the Orange, but not so
high colored; more oval in shape.
Quality equally as fine, and a good
keeper.

Meech—A vigorous grower and
immensely productive. The fruit is
large, lively orange yellow, of great
beauty and delightful fragrance; its
cooking qualities are unusurpassed.

Orange—Fruit large, bright yel- b
low color; a good bearer. The
standard variety in quince.

APRICOTS

There is no fruit more delicious or beautiful than
the Apricot, and its ripening between cherries and
peaches renders it especially valuable. Its chief
enemy is the eurculio, which can be kept in check

by the method suggested for plums. Plant the
same as plums.

Each Perid Peri100
First class, 4 to 5 feet...... $0.35 $3.00 $25.00

Early Golden—Size small ;, color pale orange yel-
low: juicy and sweet; exquisite flavor.

Moorpark—One of the largest; color orange yel-

15

yoose; flesh orange yellow, melting, rich and aro-
matic. August. |

Burbank—Large, nearly globular; clear cherry
red, with a thin lilac bloom; flesh a deep yellow,
very sweet and agreeable flavor. Hardy. One of
the best for both garden and market planting.
August.

Maynard—Introduced by Luther Burbank. Said
to be the nearest perfect Japan plum. Strong
sturdy grower, with heavy foliage; fruit large,

nearly round. Color deep dull red with white bloom.
Flesh firm, melting, juicy, rich and sweet. First
class, 5 to 6 ft., each 60c; per 10 $5.00.

Wickson—A sturdy, upright grower, productive,
almost to a fault; fruit remarkably handsome, deep
maroon; stone small; flesh fine texture, firm, sug-
ary and delicious. Excellent keeper and fine ship-
per.

Moorpark ;

low, with red cheek;
very productive.

Superb—Seedling from Kansas.
vored, most productive hardy
Quality is excellent.
color.

MULBERRIES (Morus)

Downing’s Everkearing—Very large, black, hand-
Some, sweet, rich and excellent.
NIC OM Shite rite isten na Each 60c Per 10 $5.00
White (Morus alba}—The common variety; val-
ued for feeding sillk worms.
Price Each 602

firm, juicy, with a rich flavor;

3 The best fla-
ly apricot yet produced.
Medium size; light salmon

Per 10 $5.00

NURSERY, Mo.

PERSIMMONS (American)

The Persimmon makes a very handsome orna-
mental tree, and is hardy in this section. The
fruit, although pungent when green, becomes sweet
and palatable if allowed to remain on the tree ex-
posed to the early frosts.

Price > euORoMiee beeietaereae Each 50e Per 10 $4.50

NUTS

The growing demand for nuts and the immense
quantities imperted annually is giving quite an im-
petus to the planting of nut-bearing trees in Amer-
ica. Many farms contain land that would be far
better planted to nut trees than in anything else,
and would pay better than farm crops, besides an-
nually growing more valuable as timber. In plant-
ing ordinary nut trees we would advise planting
the smaller size stock—say one or two year seed-
lings—for best results.

Almond (Hard Shell)—A fine hardy variety, with
large, plump kernel; exceedingly ornamental when
in bloom.

AM UOMO MLE Citeerener vette ticitnone Hach 50c Per 10 $4.50

American Sweet Chestnut

Chestnut (Japan or Giant)—A dwarf grower.
Very distinct from other kinds, the leaf being long
and narrow, of a dark green color. A fine orna-
mental tree in any situation. Commences bearing
very young; two-year trees in nursery row fre-
quently produce nuts. Nuts are of a good size.
The productiveness, early bearing and enormous
size render these of great value.

UO vk WEN o godaonooagooon Each 75e Per 10 $7.00
DKON HEOWa noo coadoolooGope Tach 50e Per 10 4.50

Chestnut (American Sweet)—A valuable native
tree, both useful and ornamental; timber is very
durable and possesses a fine grain for oil finish.
Nuts sweet and of delicate flavor, and a valuable
article of commerce. No farm should be without
a grove of these where the soil is adapted to their
growth.

B10) ( UOC nd oopecobnoobons Each 50e Per 10 $4.50
{4 AKO). IEG oid op ooeooscno.s Each 35c Per 10 — 3.00

Chestnut (Paragon) — Grafted. A magnificent
chestnut, formerly introduced under the name of
Great American, but changed later to Paragon. The
nuts are large, three or four in a burr, and in qual-
ity they are exceptionally sweet and rich. The
tree is a vigorous grower and an early and abund-
ant bearer.

Grated, 73) sto) 4) feeterprersrch-rciertereter eons Each $1.00
E 16

Filberts (European Varieties)—The Filbert suc-
ceeds- well in all soils where the common Hazel
grows: fine for planting along timber belts, ravines,
and can also be used in shrubbery groups in parks
and large grounds.

2 to 8 ft., strong bushes....Hach 50¢c Per 10 $4.00

Pecan—This species of the Hickory may well
rank first among our native nuts in value and cul-
tural importance. It is advisable to plant 1 or 2-
yvear seedlings.

LUG: tO MORE cine skereteusceeescvetevs Each 50c Per 10 $4.00

Pecan

Walnut (Japan Seiboldi)—From the mountains of
Northern Japan. Leaves of immense size; a charm-
ing shade of green. Nuts resemble pecans and are
produced in abundance, grow in clusters of ten to
fifteen. Shell a little thicker than the English
Walnut, but not so thick as the Black Walnut.

| Meat is sweet, flavored somewhat like a butternut,

but less oily. Tree vigorous; handsome form; bears
young, and very productive. Perfectly hardy in
this section. Valuable as a nut and ornamental
tree. Should be planted in all sections. Trees on
our grounds are bearing good crops of nuts an-
nually, ~

Oto" SAerasouacanesaved Bach $1.00 Per 10 $9.00
bh Woy MOM ema go db OH oD On Hach .75 Per 10 6.50
ASTON DL bts crore euersn neler Each 50 Per 10 4.50
SEO\ 4 OE beep ace erausterohemencyonen: Hach .45 Per 10 4.00
OVO NE) 1itAG aid 6.0 0 OO 4.010 00 Hach .39 Per 10°-2.00
IS Wo Be sbog4 gio. Goo onn0 000 Bach 22>, er dpm 7700
LOSLO MUS eon ran toekee Each pA) Tetere IN) 10)
Spoeobederl WSS whoodscosnc0cde $2.00 to $5.00 Hach

Walnut (Max Cordiformis) — Differs from the
Seiboldi chiefly in.the form of the nuts, which are
broad, pointed and somewhat flattened. The ker-
nels are large, sweet and easily removed from the
shell.

BELO UB Et oe pee eaves resis Each $0.50 Per 10 $4.50
Boone kita cls o oma ogoad 6 b Hach 45 Per 10 4.00
UO) 8) Its oeo ocean 6 odo OAS Each “ope er, 1 Ole s200

Wa!nut (American Black)—The large, oily nuts
are borne in heavy crops. They are much relished
and always bring a fair price in market. The tree
grows quite fast; its wood is exceedingly valuable.

Hut Oa Groner lerapeneteieorciersne ks Hach $0.50 Per 10 $4.50
NAO) BS iio obo ooo oKOGgoDODO Hach -40 Per. 2033.50
l-year seedlings ........ Hach ollby © etre NO 1A

Japan Walnut

RY (_5 ~

“WEBER & SONS NURSE are

; NURSERY, MO.

‘(GOOSEBERRIES

This fruit requires the same cultivation as the currant: The surest method to prevent mildew is
to plant thickly in the rows and mulch deeply six or more inches with straw, tan bark, coal ashes, ete.
Plantations thus treated have borne large crops for twenty years. The mulch retains moisture in the
driest weather; the few weeds that push up are easily pulled, and the fruit is large and more evenly
ripened. In mulching be sure that the ground is under-drained, or it is worse than useless. Good cul-
tivating is better than half mulehing. Put it on thick. In a dry season the extra amount of fruit will
double pay for the material used, not to speak of the saving of labor and cleanliness of the fruit. The
price is remunerative, and the demand is yearly increasing. The American varieties are not subject to
mildew. To prevent mildew, spray the bushes as soon as the leaves appear in the spring, and several
times during the summer, with potassium sulphide (liver of sulphur), one ounce to four gallons of water.

Plant in rows five feet apart, and the plants three feet apart in the rows—2,904 plants to the acre.
Write for prices on larger quantities than quoted.

Downing
Houghton Seedling—A vigorous grower; very Jcsselyn (Red Jacket) —Large berry, smooth;
productive; not subject to mildew. Flesh tender very prolific and hardy; quality and foliage is the
and very good. ae = best.
Each Peri10 Per 100 Each Per 10 > 100
2-yr. No; 1 plants: een.) Ea eeG 001 $8,001 9 a ants Psi eae Pee A
Downing—Size, medium to large, oval, greenish = . Ree Th Ce eee - G EE
white; plants vigorous, upright, very productive; Keepsake—Fruit very large; straw colored; of
excellent; never mildews. excellent flavor; carries well to market; bloom well
‘ Each Peri10 Per 100 protected by early foliage; one of the surest crop-
2-yr. Noy deplants: oes ete eee $0.15 $1.30 $12.00 pers.
Pearl—Has been thoroughly tested at nearly all DAA INO} i HENS. Slagcoos Each $0.25 Per-10 $2.00
the experimental stations in the United States, and : igaee
reports are unanimous in its favor. It is a won- Columbus—Fruit of largest size, oval; handsome
derful cropper, strong grower and free from mil- greenish yellow; finest quality. Plant a strong
as . robust grower. Foliage large and glossy. One of
drew. . a :
> Each. Perl0 Per100 the best for general cultivation.
2-97. Nos dplamtsiyecccta ere areata $0.15 $1.30 $12.00 Poway Into, al ith 6adoo Each $0.25 Per 10 $2.00

CURRANTS

Currants should ‘be planted in good, very fertile soil, with liberal manuring, and the tops should be
cut back mearly to the crown, allowing only three or four canes to grow the first year. Prune more or
less every year to get rid of the old wood and keep the bushes open. Currant worms can be destroyed
by white hellebore, one ounce to three gallons of water, and applied with a sprinkling can. Be sure
to use the remedy as.soon as, or before, the worms appear. Plant the same as Gooseberries. Write
for prices on larger quantities than quoted.

Black Champion — Very produc- -
tive, large bunch and berry; excel-
lent quality; strong grower. The
leading, well tested black sort.

Mach Peri0 Per 100
2=yr. INOS Te)... G0. Lomein 0 $7.00

Cherry—Very popular in market
and brings several cents more per
quart than any other old variety.

Each Perio Per 100
2-yr.-No: 1... . $0.12 9 $1.00 $6.00

Fay’s Prolific—The best currant:
yet introduced; berries are large,
uniform in size, with long stems,
good flavor, and is very productive
and easy to pick.

Each Perio Per 100 ° ae -
2-yr. No. 1....$0.12 $1.00 $7.00 Perfection

ie)

<>

La Versaiiles—Very large, red; bunch long, of
great beauty and excellent quality; one of the best
and finest; should be in every collection.

Each Peri10 Per100
D=VarneINOs Vero iiateecte re ticis aie eens $0.12 $1.00 $6.00

London Market—Largely planted in Michigan
and regarded there as one of the best market vari-
eties. Plant is extremely vigorous, with perfect
foliage, which it retains through the season; an
enormous cropper; ripens with Victoria; is large
in bunch and berry.

Each Per10 Per 100
2-yr. $0.12 $1.00 $6.00

Perfection—The color is a beautiful bright red.
Size as large or larger than the Fay, the clusters
averaging longer. The Perfection has a long stem
from the point of attachment to the bush to the
first berry, making it easy to pick without crush-
ing any of the berries. It is a great bearer, and
on account of its great productiveness the plants
should be kept well cultivated and fertilized, as
should all heavy bearers. The Perfection ripens
about the same time as the Fay. Quality rich,
mild, sub-acid; plenty of pulp, with few seed. Re-
ceived the ‘‘Barry Medal’ in July, 1901, the highest
award given to any new fruit at the Pan-American
Exposition. The Gold Medal was awarded this cur-
rant at the Louisiana Purchase Exposition in 1904.

Each Per10 Per 100
BR SEN Oe ao ae $0.25 $2.00 $15.00

NURSERY, MO.

Pomona—A red currant from Indiana. Claimed
to be more prolific, with fewer seeds and sweeter
than the common sorts. Color a beautiful clear
bright red, about the size of Victoria. Easily pick-
ed and hangs a long time after ripening.

Each Peri10 Per 100
No. 1 $0.12 $1.00 $7.50

President Wilder—Introducer says: ‘‘Wilder will
make twice as much wood as will Fay’s Prolific,
while setting as large fruit with double and triple
the quantity, combines more good qualities than
any red currant he has ever fruited.” It is large.
very productive, sweet and hangs a long time on
the bushes, in fine condition after fully ripe.
Each Peri10 Per 100
$0.12 $1.00 $7.50

excellent and well

2-yr

2-yr No. J

Red Dutch—An old variety,
known as the stand-by variety.
Each Perl10 Per 100
$0.12 $1.00 $7.00

with very long

Victoria—Large, bright red,
bunches; late; a good bearer.
Each Peri10 Per 100
$0.12 $1.00 $7.00

White Grape—An excellent and well known sort.
Each Perl10 Per 100
Q=yri) INOV eee closets eccussacchedo oneness $0.12 $1.00 $8.00

2-yr. No. 1

GRAPES

There is scarcely a yard so small, either in country or city, that room for one to a dozen or more

grape vines cannot be found.

garden fence, occupying but little room and furnishing an abundance of the healthiest of fruit.
the soil mellow, and plant the vines somewhat deeper than they stood L
eight feet apart, along the fence or building. For vineyard purposes make rows eight feet apart,

feet in rows.

To plant an acre, € by 8 feet, requires 908 plants.

Blue or Black Sorts

Campbell’s Early—The wonderful new seedling
of the distinguished horticulturist, George W.
Campbell of Ohio. Vine. healthy, hardy, vigorous
and a profuse bearer; bunch and berry large and
handsome; quality Al; ripens with Moore’s Early,
but Keeps either on the vine or in the house for

weeks. <A very great acquisition.

Each Peri10 Per 100
ZVI INO mlecnenepacet rater co rete re $0.25 $2.00 $15.00
beats INO theoéocmoudocdo scold -20 1.50 12.00

Concord—The old stand-by. A large, purplish-
black grape; vines remarkably hardy, vigorous and
productive. Very popular; best market sort.

Each Peri0 Peri00 Per 1000

ARMING S Ike aicis ac ou $0.10 $0.80 $5.00 $35.00

RE INGE. Wagoaso ao .08 60 4.00 30.00

Ive’s Seedling—Bunches medium to large, com-

pact, often shouldered; berries medium, slightly
oblong, of dark purple color. Early.

Each Peril10 Per 100

O Mir RSINIOM nltatee Santer teae ae $0.15 $1.00 $6.00

DS VAC SIN OH Ue sencrasterer el ouet eee uetarets -10 .80 5.00

King—Originated near Grand Rapids, Mich.

Hardy and as strong a grower as Concord; pro-
lifie; color same as Concord; berry much larger,
bunch more compact; pulp tender and sprightly;
ripens between Worden and Concord. Very fine
for home use or for local market.
2 yr. vines Each $0.50 Per 10 $4.50
Moore’s Early—Bunch medium, berry large, round
with heavy bloom; vine exceedingly hardy, entirely
exempt form mildew or disease. Its earliness makes
it desirable for an early market. Two weeks earlier
than Concord.

Hach Period Per 100
DT NEN RINIO Np lic vctausesoanal swelten renee teeens $0.15 $1.00 $8.00
syn: IN Otelitcceriaeeeee iene 2 -80 6.00

Norton’s Virginia—A most productive grape, both
for garden and vineyard, bearing large crops in all

seasons. Skin thin, flesh tender, with a brisk, re-
freshing flavor. Best for a dark wine and for can-
ning. Late.

Each Peri0 Per 100
Dev NOs, Loma csrescserinceein $0.20 $1.50 $12.00

Worden—A splendid, large grape, of the Concord

They do admirably trained up to the side of any building, or along the

Make
Plant about
six

in the nursery.

Write us for prices on larger quantities.

Norton’s Virginia

type, but earlier, and in every way as healthy.

Quality good to best.

Each Peril10 Peri109
DOV TIN On wlisetce ere greee nee eR ene $0.15 $1.00 $6.50
ibys INOW Whe S oetocde blo acs 6 rz .80 5.5.0:

\

~) ee ee A

‘WEBER. & SONS NURSERY 7S

Red or Amber Sorts

growth vigorous, wood short

Regal—Very hardy, ,
very productive. Bunch

jointed and ripens early;
medium to large, very compact and handsome.
Rerries large, translucent, dark red, juicy, with a
thin, tough skin; pulp tender. Fine for home or
market use.
DM AIIMETD LUNLUS pi atord calls atet ena) anette Bach $0.85 Per 10 $3.00
Agawam (Roger's No. 15)—Berries very large,
with thiek skin; pulp soft, sweet and sprightly;
very vigorous; ripens early.

Each
ici ubeletsioietalsseleiaiatat ane $0.15
hoe TO bs ol io Sreenioo nie OF liz

Brighton — Bunch large, well
above medium to large, round;
and quality; one of the earliest in

Each
INY EPL ofatiavet chee /atatoysya vanes cus $0.15
No. 1

P er 100
$6.00

5.00

Per 10
$1.00
.50
berries
flavor

formed;
excellent
ripening.
Per10 Per 100
$1.00 $7.00
Bi erthento coh Oa Otaoe .80 6.00

3uneches of good size, rather loose;
round; when fully ripe of a dark cop-

EV:
th yiaty

herries large,

per color, with a sweet, rich musky flavor.
Each Perl10 Per100
DAS REIN GY bist € coo Ok OF ENG DIO $0.15 $1.00 $5.00
VU ON Ost eter atevecnie chotat ede tereteuels aly -80 4.50
Delaware—Bunches small, compact, shouldered;
berries rather small, round; skin thin, light red;
flesh very juicy, without any hard pulp, with an
exceedingly sweet, spicy and delicious flavor.
Each Peri10 Per 100
PEN COE lh sccls te scr oiereke staicue els). $0.15 $1.00 $6.00
TERI N Otten ce letatn <tahe ical) s/c ee 12 .80 5.00

Perkins—Vine vigorous, productive; bunch com-

paet, shouldered; ripens before Isabella. Color light
red.
Each Perl0 Per100
DETEIN Oe lenis apevelcuctctoletel seleteneys $0.20 $1.50 $12.00
Tle Ware NN Gy, Us sda tecesoucloute 15 1.20 10.00
Woodruff—A large, handsome, red grape, sup-
posed to be a seedling of Concord; remarkably
showy, very large bunch and a profitable market
sort. The vine is a strong grower, with healthy

foliage and entirely hardy; ripens early.

Each Perl10 Per 100

Pease INdiana roe COC DOO MO $0.20 $1.50 $12.00

PA BRE IN oF al Helen Ooo AD cron 15 1.20 10.00
White Sorts

Elvira—A very vigorous, strong, healthy grower:

bunch and berries are medium size,

and productive, often growing four

ters on a single cane. Very hardy.
Each

a Ai PENIOL MM nnc Sc-cem coe le OIG $0.15

Moore’s Diamond—

tilized with Iona.

very compact
and five clus-

Perl10 Per 100
$1.00 $6.00

Grape from Concord seed, fer-
In vigor of growth, color and

2

texture of foliage and hardiness of vine it par-
takes of the nature of its parent Concord, while

in quality the fruit is equal to many of the hest

G pA Ss NURSERY, a CO

tender sorts, and ripens two weeks earlier than the

Concord,

Bach Perl10 Per 100
2 yr. No. } $1.00 $6.00
l yr. No. .80 5.00

Brighton

Niagara—Vine remarkably hardy, strong grower;
bunches very large and compact, sometimes should-

ered; berries large; light greenish white; semi-
transparent, slightly ambered in the sun; skin thin

but tough, and does not crack; quality good; very
little pulp, melting and sweet to the center.

Each Peril0 Per 100
Dries IOS dhom co ooo oo C000 ox $0.15 $1.00 $5.50
i Ain ING Abosnoeonodoan abo us sl? 80 4.50

BLACKBERRIES

Many kinds of Blackberries will succeed,

porous soil. They require the same treatment as

not only
recommended for

on good fruit land, but even on the

raspberries, but in

most sandy,
field culture

should be planted in rows seven feet apart and three feet distant in the rows; in garden culture plant

rows five feet apart and three feet distant in the rows.

of the cane and should be severe.
to throw out laterals.

Pinch back the canes in Summer when three feet high,

The pruning should be governed by the growth

causing them

When planting 7 by 3 feet apart it takes 2,078 plants for an acre.

When planting 5 by 3 feet apart it takes
Write us for prices on larger quantities.
Our Blackberry

One of the best of the ancient
varieties; very vigorous, healthy and hardy, pro-
ducing large fruit stems. loaded with good-sized
berries of fine quality, that carry well and bring
highest price in market. For general planting for
home or market in all sections subject to severe
winters the Ancient Briton is recommended as a
first-class variety.

Ancient Briton

Per10 Per100 Per 1000
No. 1 plants j $3.50 $28.00

Blower—Originated in Chautauqua County, New
York. Claimed to be the hardiest, most productive

2,904 plants for an

plants are all grown from root cuttings;

19

acre.
they are free from disease.
and the finest quality of all the blackberries.

size, jet black, good shipper.
riety has special merit.

: Large
We believe this va-

z Per 10 Per100 Per 1000
INT OME OL AICS Peron etancl's etal acre cies $0.75 $4.00 $35.00

Early Harvest—This is one of the earliest black-

berries in. cultivation ; a compact dwarf grower;
fruit medium size and fine quality; an enormous
bearer.

E Per10 Peri100 Per 1000
NOM plants ret ier an, an veeren: $0.50 $3.00 $25.00

Eldorado

ket and for canning. Bush a stronger grower, attaining a very large
size. One of the hardiest and wonderfully prolific. Unexcelled for
productiveness and stands at the head for canning, making jam, ete.
Tee UOMO 5 6 so0a06 $16.00

IAS MDs 6066000 $0.40

Red Sorts

Cuthbert—A remarkably strong, hardy variety; berries very large,
rich crimson, very handsome, sweet, rich and luscious; highly flavored.
PEI WOW). socodes $12.00

Eaton—A new red raspberry, distinct from other sorts. Strong,
Fruit of large size, rich red

ee IMs osocco $0.30

sturdy grower and an immense bearer.
color; firm; fine quality.
PeralOner cates $0.60

size; color, bright scarlet.
Per10 Per100 Per 1000
Fri Cewa ee trees reonatene $0.40 $2.50 $20.00
Ruby—Seedling of the Marlboro. Ripens
early and continues over a long season.
Fruit large, bright red, firm and of ex-
cellent quality; strong grower; large,

hardy canes.
Per10 Per100 Per 1000
IDA foacuceosb 0000 $0.50 $3.50 $30.00

Black Sorts

Cumberland—The largest of all black
eaps. A healthy, vigorous grower, throw-
ing up stout, stocky, well branched canes
that produce immense crops of. magnifi-
cent berries. Fruit very large, firm, qual-
ity about same as Gregg; keeps and ships
as well as any of the blacks. The most
profitable market variety.

Per10 Per100 Per 1000
PTICE: so) uss ccksinretepe olevele $0.40 $2.00 $15.00

NURSERY, MO.

lee OOS oo c109.0 0 $2.00

1250 Ws o oo ae co $1.75

IIe UMODs saccade $35.00

King—Said by many to be the best early red raspberry. Plant a
strong grower, hardy and productive. Berry firm; good shipper; large

IPE NOW ce coos $4.00

Eldorado—Very vigorous and hardy, enduring the win-
ters of the far Northwest without injury, and their yield
is enormous. The berries are large, jet black, borne in
clusters, and ripen well together; they are very sweet,
melting and pleasing to the taste, have no hard core.

Per10 Per100 Per 1000
INO; Lsplamntis eter ntevciossvn ci valveueveretenenans $0.60 $3.50 $30.00

Mersereau—A remarkably strong grower, upright, pro-
ducing stout, stocky canes. An enormous producer of
extra size berries, brilliant black, and retain their color
under all conditions; extra quality; sweet, rich and melt-
ing; without core. Ripens with Snyder.

Peri10 Peri00 Per 1000
INOs Sli IAMS eave rersieuetexersoskenststaleyenche ners $0.60 $3.50 $30.00

Snyder—Extremely hardy, enormously productive, me-
dium size, no hard, sour core. Easy to pick, fruit in
clusters, mostly on top like raspberries.

Per10 Peri00 Per 1000
NOM op lamtseey eee eee $0.50 $3.00 $25.00

Taylor—One of the blackest blackberries grown. Fruit
of the best quality, melting and without core; very pro-
ductive and as hardy as the Snyder, which renders it
very valuable. Late.

Peri0 Peri100 Per 1000
INGE UAOEnMES Joangaooboscocooseueds $0.50 $3.00 $25.00

RASPBERRIES

Will do well on any soil that will produce a good corn
crop. Land should be thoroughly prepared and well en-
riched; ground bone is one of the best fertilizers. Keep
well cultivated and tree from weeds and suckers. As soon
as they have done bearing, cut out the old wood to give
vigor to the young canes. Spring is the best season to
plant. Plant in rows six feet apart, three feet apart in
vows, 2,420 plants to the acre.

Write us for prices on larger quantities.

Purple Sorts

Columbian — An im-.
provement on Shaf-
fer’s, which it resem-
ples, but the berry is
firmer, adheres to the
bush much longer and
retains its shape bet-
ter, both on the mar-

Cumberland

20

& SONS NURSER
NURSERY, MO,

2 DS)

¥ ;

Gregg—A large, black raspberry, of ex-
eellent quality, wonderfully productive and
very hardy; best for evaporating.

Per 10 Per100 Per 1000
PICO etal tie sia e tsi clad visions $0.50 $2.50 $20.00

Kansas—A strong, vigorous grower, stand-
ing extremes of drought and cold and bear-
ing immense crops. Early, ripening just
after Souhegan. Berries size of Gregg, of
better color; jet black and almost free from
bloom; firm, of best quality; presents a
handsome appearance and brings highest

price in market.
Per10 Per100 Per 1000
POTRCE se sie iclsioicieivisreiareisiols $0.40 $2.00 $15.00

Yellow Sorts

Golden Queen—Large, beautiful fruits of a
pale amber color; firm and delicious. The
canes are hardy, of strong growth and very
productive. A superior dessert fruit. Suc-
ceeds in all sections.

HOT ls hola atava tee SOsn Otek Cle LO cierel oss) alarel « $3.00

DEWBERRIES

Lucretia—One of the low-growing, trail-
ing blackberries; in size and quality it equals
any of the tall growing sorts. Perfectly
hardy, healthy and remarkably productive,
with large, showy flowers. The fruit, which
ripens early, is often one and one-half inches
long by one inch in diameter; soft, sweet and
luscious throughout with no hard core; ripe
before late raspberries are gone. Should be
mulched to keep berries from the ground.

Gre Oniereveteiettes- SOro One Cr lO O)erotetstelalater= $3.00

STRAWBERRIES

Strawberries will succeed in any soil that
is adapted to ordinary farm or garden crops.
Soil should be thoroughly prepared at a good dood " 3 A
depth, well drained and enriched. Vegetable Cuthbert
manure (muck, rotten turf, wood soil, ashes, :,
ete.) is the best. For field culture set in rows four feet apart, 15 inches in°rows; for garden 15 inches
each way, leaving pathway every third row. To produce fine, large fruit, keep in hills, pinching runners
off as soon as they appear. Ground should always be kept clean and well cultivated. In winter a
covering of leaves, straw or some kind of litter will protect the plants. Do not cover them until the
ground is frozen, or so deep as to smother the plants, and remove covering before growth starts in
spring. Mulching will keep the fruit clean and the soil in good condition through the fruiting season.

The blossoms of those marked with (P) are destitute of stamens and are termed pistilate; those
marked (S) are staminate sorts or perfect flowering, and unless a row of perfect flowering variety is
planted at intervals, not exceeding about a rod, they will produce imperfect fruit and but little of it, but
when properly fertilized, as a rule, they produce more
fruit than those with perfect flowers. We advise
planting two rows of staminate to three rows of pis-
tilate sorts throughout the field.

On receipt of plants, dip roots only in water, bury
the roots in moist, shady ground until you are ready
to set them out. Never sprinkle the tops of the plants
or allow them to remain in the original package after
receipt. Neglect or improver treatment is always fatal.

Our plants are grown under contract by a reliable
grower in the State of Michigan, where plants are
grown to perfection. You can rest assured that our
plants will compare favorably with the best on the
market. We have discontinued growing strawberry
plants here owing to soil conditions.

Plants will be ready for shipment during the latter
part of March or early April, according to weather
conditions.

We prefer to ship strawberry plants by express or
mail and separate from fruit or ornamental tree orders.
If to be sent by mail add 10 cents for 25, and 25 cents
per 100 to price quoted.

Strawberry plants come tied in bundles of 25. Please
make your order in multiples of 25 of a kind; we
charge extra where bundles must be broken.

For field culture plant rows 4 feet apart, plants 18
aueues apart in the rows; requiring 7,260 plants to
the acre.

Our prices are for plants delivered to express office
in St. Louis, Mo.

Write us for prices on larger quantities than quoted.
21 ,

Aroma (S)—-A standard variety, continues to be
a favorite with many growers. Fruit large, bright
1ed in color to the center. Delicious flavor, very
productive and firm of texture; a good shipper and
has a long fruiting season. Plant robust, foliage
deep green. Price, 40c for 25; $1.00 per 100; $5.25
per 1000.

Bubach (P)—Of large and uniform size, fine form
and color, great vigor of plant and productive.
Leaves large, dark green and endures the hottest
sun perfectly. Price, 40e per 25; $1.00 per 100;
$5.25 per 1000.

as the nearest approach to the perfect berry. Plants
perfectly healthy, vigorous, with bright clean foli-
age and heavy root system; very productive; fruit
large, firm, never varies from its regular conical
shape; holds its size to the end of the season.
Color light searlet. Price, 40e per 25; $1.00 per 100;
$5.25 per 1000.

Crescent Seedling (P)—Medium size, bright light
searlet; plant very vigorous and hardy. <A great
cropper. Price, 40¢ per 25; $1.00 per 100; $4.50 per
1000.

Gandy (S)—A well known, large late variety;
berries bright crimson, uniform size and shape,
firm; plant healthy and vigorous, largely grown in
St. Louis County. Price, 40e per 25; $1.00 per 100;
$5.25 per 1000. ;

Senator Dunlap

Gibson (S)—New. Commences to ripen with
Dunlap and continues well into the season of the
later sorts. Fruit stems are large and strong and
the dark green foliage is an ample protection for
blossom and fruit. Fruit is large and regular in
shape, in color it is a rich red “all over, calyx is
large and green. \We will have only a limited num-
ber of plants to offer this season. Price, 60c per
25; $1.25 per 100; $6.00 per 1000.

Glen Mary (S)—Strong, vigorous, healthy plant.
The berry is so large and fine looking it always
commands the highest price in market. It requires
good soil, good culture and plenty of room in the
row. Price, 40e per 25; $1.00 per 100; $5.25 per 1000.

Haverland (P)—Plant large, healthy, vigorous
and ripens fruit evenly and early. Berries are fine,

a € 4, WEBER & SONS NURSERY “—_" ~« =
Wb" Nursery, mo SCO

uniform in shape, large, excellent flavor and bright
red color; exceedingly productive. Price, 40 per 25;
$1.00 per 100; $4.75 per 1000.

Heritage (S)—New. Plant very large, extremely
heavy texture, deep rooted and free in fruiting
ripens about mid-season and continues late, Berry
dark, shiny crimson to the center. Carries an un-
usually heavy green calyx, adding to its market
value. Extremely large and continues so through-
out the season. Price, 60c per 25; $1.25 per 100;
$6.00 per 1000.

Miller (S)—-Our grower regards this as one of the
best standard sorts. Is a heavy yielder of large,
bright red berries that bring the highest price in
mariet and their season is very long. Plant large
and stocky, foliage large and free from rust; sends
out plenty of strong runners. Price, 40c per 25;
$1.00 per 100; $4.75 per 1000.

Pocomoke (S)—Said to be nearly perfect from
the standpoint of the commercial grower. An
abundant bearer of large, firm, bright red berries,
foliage healthy and luxuriant, plant makes plenty
of runners and is an abundant bearer of large, firm
berries. Never misshapen and holds up well in
size. Is popular for canning purposes as it is some-
what tart. Said to be identical with Parsons Beauty
as offered by some growers. Price, 40e per 25;
$1.00 per 100; $4.75 per 1000.

Pride of Michigan (S)—Originated in Berrien
County, Michigan. Berry bright glossy red. large
and rather oblong; firm and of good quality. Ripens
with Senator Dunlap, productive plant maker and
a promising variety. Price, 60c per 25; $1.25 per
100; $6.00 per 1000.

Sample (P)—One of the very best berries. Plants
strong, large and healthy; fruit dark colored, uni-
form size and in great profusion and firm enough
to ship well. Price, 40c per 25; $1.00 per 100;
$5.25 per 1090.

Senator Dunlap (S) —Of pronounced Warfield
type. It is a favorite wherever it has keen tried.
It is a great plant maker and the plants are per-
feetly healthy and is an enormous bearer. Begins
to ripen soon after the earliest sorts and continues
until near the end of the season. Fruit is large,
eonical in form, color is a deep rich red, flesh red
and has a sprightly, delicious flavor. This is a
great commercial sort and is largely planted. Price,
40e per 25; $1.00 per 100; $4.50 per 1000.

Stevens Late Champion (S)—One of the best and
most popular late varieties grown. It makes strong,
vigorous plants, which produce an abundance of
fruit; an immense plant maker, should be restrain-
ed from covering too much ground. Fruit large,
long, and slightly flattened. Color and flesh deep
red, holds up well after picking, ripens with Gandy
and is a worthy rival of that grand sort. Price,
40c ver 25; $1.00 per 100; $5.25 per 1000. of

Uncle Jim (S)—-Plants large and stocky, well
spaced for fruiting. Fruit large, high colored, firm
and of good quality; a good drouth resisting va-

yiety. Price, 40c per 25; $1.00 per 100; $5.25 per
1000.

Warfield (P)—Plant a vigorous. grower, tough
and hardy, and astonishingly productive. Fruit

large, conical, always of regular form and slightly
necked. The color is dark glossy red; holds its
eolor a long time after being picked; excellent fla-
vor. Price, 40e per 25; $1.00 per 100; $4.50 per 1000.

We would appreciate it if customers would order
their spring wants soon after receiving this catalog
and if possible before Mareh Ist, so that we can
arrange for the digging as soon as the weather
opens. We do not dig plants unless ordered; we
aim to get plants to you as quickly as possible
after they. have been dug.

RHUBARB OR PIE PLANT

This deserves to be ranked among the best early fruits of the garden.
ial for pies and tarts, continues long in use and is valuable for canning.
Plant in rows four feet apart and the plants three feet distant.

deep.
are abcut an inch below the surface.

Linnaeus—Large, early,
Tea ree: ClUmips: iccicrave sree cas tena. ley cle veleie forebar st tetea wane canoe ties 0

ABE) tet ortot ol Stearn BLs,o OLS IO ini OIG GIOrtiD Din .od.cte 6.410 b10.00 010101 0

It affords the easiest mater-
Make the bed very rich and
Set the roots so that the crowns

tender and fine; the very best of all.

Per 100 $10.00
Per 100 6.00:

Each 25¢e
Hach 15¢

Per 10 $2.00
Per 10 1.00

7. VEBER. & SONS NURSERY (9) ~~ >
HJ: NURSERY, Mo. SO

ASPARAGUS

For garden culture dig a trench 18 inches wide and 12 inches deep, trenches 4 feet apart; fill in
some well rotted manure in bottom of trench; then cover same with top soil about 2 inches. Plant on
top of that, 18 inches apart in the row, and only cover the plant about 2 inches with good, fine soil,
filling in the balance by degrees as the plant grows up. Give them a top dressing of manure annually,
early in spring after loosening the beds on top, by forking them over.

Write us for prices on larger quantities.

Columbian Mammoth White—It produces shoots Giant Argenteuil—A fine and profitable variety:
Which are white and remain so as long as fit for stalks mammoth in size; attractive color, sweet and
use. In addition to the marvelous advantage of tender: an immense yielder and very early.
its white color, the Columbian Mammoth White Per 25 Per100 Per 1000
Asparagus is even more robust and vigorous in 2- 0.5 2195 7 5

- - Z=VOAT 2. cece ccc r esse ccnnss $0.50 $1.25 $7.50
habit, and throws larger shoots and fully as many fe ee : ‘
of them as the Conover’s Colossal. Palmetto—Of Southern origin. It is earlier, a

better yvyielder, more even and regular in its growth,

= 25 Per 100 r 1000 % : : ;
Per 25 Per Per 10 and in quality equal to that old favorite, Conover’s

ENCENO C&G ohoe0 0 SOGHO OM cts $0.40 $1.00 $6.50

Colossal.

*‘Conover’s Colossal—A mammoth variety of vig- Per 25 Per100 Per 1000
orous growth, an old and well tried sort; very pop- ZV Cai buaiaretarel sianerererstets aiee fevnactiees $0.40 $1.00 $6.00
ular. One-year-old plants at 10¢c less for 25 and 20c

Per 25 Per100 Per 1000 less per 100 and $1.00 less per 1000 on each variety
Vm VEAT a viet cisic raven tiarai suave ecaseliete use $0.40 $1.00 $6.00 quoted above.

A NEW DEPARTMENT

Landscape Designing, Architectural Designing for Summer Houses, Gateways,
Forestry, Etc.

Owing to the frequent requests we receive from our patrons for assistance along the above lines, we
have arranged with competent Landscape Designers and Foresters to take up any branch of work out-
lined above.

Under this arrangement, we are prepared to supply at reasonable rates the following:

(A) LANDSCAPE DES!IGNING—Preparing plans for parks, club grounds, cemeteries and private
places; location of buildings, gardens, driveways, ete.

(B) FORESTRY—Expert advice on the treatment of diseased trees, shrubs, ete.; the preservation
of existing trees; the supervision of planting; construction of driveways, formal gardens, etc., according

to plans.

(C) CONSULTATION—Frequently it is desired to secure competent advice regarding contemplated
improvements. This service can be supplied at reasonable expense.

(D) LANDSCAPE PLANS BY MAI!—For medium or small size places, plans can he developed by
furnishing photos and rough sketches showing location of present buildings, the position of existing trees
that it is desired to preserve, the exact dimensions of the grounds, ete. For large grounds, we advise
consultation.

Owing to the varied problems involved, it is impossible to give definite rates. We will, however,
gladly furnish same upon receipt of correspondence designating just what is desired.

All correspondence in reference to the above should be addressed to Department ‘‘L.’’

H. J. WEBER AND SONS NURSERY CO.,
Nursery, Missouri.

WJ WEBER & SONS NURSERY
KES: NURSERY, MoO.

ORNAMENTAL DEPARTMENT

Brief Suggestions to Planters

What to Plant—Impressed with the importance grounds hardy herbaceous border plants can be
of planting only the most hardy ornamental trees used with the most satisfactory results. A proper
and shrubs, and in order that our patrons may be selection will afford as much bloom as ordinary
Spared much disappointment and expense, we have, bedding plants, and at half the trouble and expense.
as far as possible, omitted from our catalogue any- When to Plant—Deciduous Trees, Shrubs and
thing that is liable to suffer from severe cold. We Vines can be planted either in Spring or Fall.
have with great pains secured, both at home and Spring is the best time for Evergreens generally.

abroad, all valuable hardy material, so as to ren-
der oun assonement of this ae as complete .as
possible. n examination o e catalogue shows Bir 54 A P =
what an extensive variety of stock is offered, en- sound woods Uns ee ea oa has
abling the planter by a judicious use of the same E z S = i

to accomplish any desired result with perfectly Preparation of the Top—This consists in cutting
hardy trees, shrubs and plants. For convenience ack the top and side branches in such a way as to
we have grouped the trees under the following correspond with the more or less mutilated roots

How to Plant—Preparation of the Roots: Cut off
smoothly all bruised or broken roots up to the

heads: Deciduous Trees, Weeping Deciduous Trees, as follows:
Ornamental Shrubs, Vines and Climbers, Hedge Trees with branching heads should have the small
Plants, Roses (Hybrid Perpetual, Everblooming, branches cut clean out, and the larger ones, in-

Climbing, Trailing, ete.), Evergreens, Evergreen tended for the framework of the tree, cut back
Shrubs, Perennials, Hardy Bulbs, Tender Bulbs and till within two or three buds of their base. In
Greenhouse Plants. cases where there is an abundant root, and small

For Parks and Extensive Grounds—No difficulty top or few branches, the pruning need be very
Gan be experienced by anyone in making selections ight; but where the roots are small and the top
for this purpose. But we cannot impress too heavy, Severe pruning will be necessary. These
strongly the importance and value of flowering remarks are applicable to all Deciduous Trees and
shrubs for effective masses and groups. There are ‘Shrubs. Hvergreens seldom require pruning, but
many who imagine that the Rhododendron and Arbor Vitae and other Evergreens planted in hedge

Azalea are indispensable. This is a great error. rows may be advantageously shorn immediately
In this latitude both Rhododendrons and Azaleas after planting.

require prepared soil and protection, while hardy Pruning, as practiced by some people, has the
shrubs like the Weigelia, Deutzia, Spirea, Hardy effect to render trees and shrubs unnatural and
Hydrangea, Japan Quince, Double-Flowering Al- inelegant. We refer to the custom of shearing

mond,:Lilac, Snow-Ball, Althea, Paeony, Phlox and trees, particularly Evergreens, into cones, pyra-
Japan Anemone, when planted in masses, produce mids and other unnatural shapes. Every tree, shrub

a magnificent effect, need no protection, and de- and plant has a habit of growth peculiar to itself,
mand little skill or care in their management. and this very peculiarity is one of its beauties. If
What grand masses of bloom can be had_through- we prune all trees into regular shapes, we destroy
out the season by proper use of the various fam- their identity. The pruning knife, therefore, should

ilies. Then the purple and variegated-leaved trees be used to assist nature, and handled with judg-
and shrubs may also be planted in such a manner ment and care; to top off straggling branches, to
as to afford a rich and striking contrast. Groups thin the head of a tree which has become too dense,

of flowering trees form superb objects at the blos- , and to remove dead wood. Sometimes it becomes
soming season, and it is strange that planters do necessary to prune severely to keep a tree from
not employ them more. attaining too great size.

Highly effective groups can be formed of trees Shearing may be practiced, on hedges, but never
and shrubs possessing bright-colored barkin winter. on trees or shrubs.

For Lawns and Small Places—Whatever speci- Pruning Shrubs—Many persons train and shear

mens are planted should be of the finest species, of | them into regular shapes, imagining that regular
moderate size, of graceful habit of growth and outline adds to their effect and beauty. While
handsome foliage. A pendulous tree or one with symmetry and regularity of form are to be ad-
variegated foliage may be occasionally introduced mired in a shrub, this quality should never be
and will add to the beauty of the grounds. Depend gained at the expense of health and natural grace.
mainly upon dwarf shrubs for small places, and in Each shrub has peculiarities of habit and foliage,
selecting, aim at securing a succession of bloom. and we should aim to preserve them as far as pos-
Dwarf evergreens are very useful, and in small sible. Judicious pruning to secure health and

24

ee \ WEBER, & SONS NURSERY “__

vigor is necessary, but trimming all kinds of shrubs
into one form shows a lack of appreciaticn for
natural beauty, to say the least. Weigelias, Deut-
zias, Forsythias and Mock Orange flower on the
wood of the preceding year’s growth, hence these
shrubs should not be pruned in winter or spring,
but in June, after they have finished flowering,
when the old wood should be shortened or cut out,
thus promoting the growth of the young wood
which is to flower the following season.

Spireas, Lilacs, Althaeas and Honeysuckles may
be trimmed during the winter or early in the
spring, but the branches should only be reduced
enough to keep them in good shape. The old

NURSERY,

Na

Mo.

growth should be occasionally thinned out and the
suckers and root sprouts removed when they ap-
pear. The best time, however, for pruning all
shrubs is when they have done flowering.

The Hydrangea Paniculata Grandiflora should be
severely cut back and thinned early in spring.

Pruning Evergreens—Use the knife occasionally
to thicken the growth and preserve the_ shape.
This can be done in April or May, just before the
trees start to grow.

Large Specimen Trees are planted with less risk
when dug with ball of earth. We make extra
charge for this, but where it is possible to do so,
it well repays the extra expense.

CLASSIFICATION OF ORNAMENTAL TREES

For the convenience of purchasers we have classified the various Ornamental Trees, as follows:

Class 1—Trees Suitable for Street and Avenue
Planting.
Acer Dasycarpum (Silver Leaved Maple).
Acer Platanoides (Norway Maple).
Acer Saccharinum (Sugar Maple).
Ailanthus Glandulosa (Tree of Heaven).
Celtis Oeccidentalis (Hackberry or Nettle Tree).
Fraxinus Alba (White Ash).
Leriodendron (Tulip Tree).
Platanus Oecidentalis (American Sycamore).
Plantanus Orientalis (European Sycamore).
Populus Fastigiata (Lombardy Poplar).
Populus Monolifera (Carolina Poplar).
Populus Nigra (Grecian Poplar).
Quercus Palustris (Pin Oak).
Quercus Rubra (Red Oak).
Salisburia (Maiden Hair).
Tilia Americana (American Linden).
Tilia Europaea (European Linden).
ae ee (Large Leaved Huropean Lin-
en).
Ulmus Americana (American Elm).
Class Il—Trees with Cut or Lanceolated Foliage:

Acer var. Wierri Lanciniatum (Wier's cut-leaved
Maple).
Acer Polymorphum (Japan Maple).
Agee I Atropurpureum (Purple Japan
aple).
Aeer Polymorphum Atropurpureum Dissectum
(Purple cut-leayed Japan Maple).
Alnus Glutinosa var. Laciniata Imperialis (Im-
perial cut-léaved Alder).
Betula Alba var. Laciniata Pendula (Cut-leaved
Weeping Birch).
Sorbus Quercifolia (Oak-leaved Mountain Ash).
Class |!I—Trees with Colored Foliage:

Acer Platanoides var. Reitenbachi (Reitenbach’s
Maple). Purple foliage in fall.
Acer Platanoides var. Schwedlerii

Maple). Purple foliage in spring.
Acer Polymorphum var. Atropurpureum (Japan
Maple). Purple foliage.

(Schwedler’s

Acer Polymorphum var. Atropurpureum Dissec-
tum (Japan Maple). Purple foliage.
Betula Alba var. Atropurpurea (Birch).
foliage.

Fagus Sylvatica var.
Purple foliage.

Fagus Sylvatica var. Purpurea Riversii (Beech),.
Purple foliage.

Prunus Pizzardi (Plum). Purple foliage. :

Populus Canadensis var. Aurea Van Geertii (Pop-
lar). Yellow foliage.

Populus Alba Bolleana (Poplar). Silver foliage.

Quercus Robur Pedunculata var. Concordia (Oak). °
Yellow foliage.

Salix Regalis (Silver Willow). Silver foliage.

Class 1V—-Trees Producing Conspicuous Flowers:

Aesculus (Horse Chestnut).

Aralia (Angelica Tree).

Catalpa Kaempferii and Speciosa.

Cercis (Red Bud).

Chionanthus (White Fringe).

Cornus (White and Red Flowering Dogwood).
Crataegus (Thorn). White and scarlet flowering-
Cytisus (Golden Chain).

Halesia (Silver Bell).

Koelreuteria (Varnish Tree).

Leriodendron (Tulip Tree).

Magnolia, in variety.

Persica (Peach). Double flowering.

Prunus Triloba (Plum). Double flowering.
Prunus Padus (Bird Cherry).

Pyrus (Crab in variety).

Purple

Purpurea Major (Beech).

Class V—Weeping Trees. See Weeping Trees ir
this Catalogue.
For descriptions, see under proper heading in

this catalogue.

For sizes larger or smaller than quoted herein,
write us. We frequently have specimen stock of
certain varieties and always have younger or
smaller stock than we quote. Describe the class
of stock desired and we will quote on such as we
can supply.

DECIDUOUS TREES

In order to make it easier for planters to select trees for particular purposes, we have adopted letter Ss

to denote the various classes, as follows:

T—Denotes trees that attain a height of 50 feet and over at maturity.
M—Denotes trees that attain a height of 25 to 40 feet at maturity.
S—Denotes trees that attain a height of 8 to 15 feet at maturity.
D—Denotes trees that attain a height of 2 to 8 feet at maturity.

ACER. Maple

A. Dasycarpum or Eriocarpum (Silver-leaved) T
—A, hardy, rapid-growing native tree of large size,
valuable for producing a quick shade. Excellent for
street planting. Our stock of these is very large in

all sizes. Specimen trees from 3 to 6 inches priced
upon application. Each Peri0 Per100
Tite StOuSeiny. Inia). eveiars $2.50 $22.50 $200.00
2 to 246 MI eA ais ae a rerer acre 20.00 180.00
DCA OPP ANS hCG Agee AeGED 14.00 120.00
1% to 1% in. in dia 10.00 90.00
1% to 1¥% in. in dia 6.00 50.00
8 to 10 f 5.00 40.00
6 to 8 ft 3.50 25.00
5 to 6 ft 2.50 20.00

A. Var. Wierii Laciniatum (Wier’s Cut-leaved) T
—One of the best cut or dissected-leaved trees;

25

being of rapid growth, it soon produces an effect.
Young shoots, slender and drooping.

Each Perio Per100
2 to 2% in. $27.50 $250.00
1% to 2 in. 22.50 200.00
1% to 1% in. i 17.50 150.00
14% to 1% in. i 12.50 100.00

A. Negundo (Ash Leaved Maple or Box Elder) M
—A fine, rapid growing variety, with handsome,
light green foliage and spreading head; very hardy;
desirable for street planting and succeeds in many
sections where other varieties do not thrive.

Each Peri10 Per100

1A To USA Tho, te) Cle ooaacdon $1.85 $11.00 $90.00
14% to 1% in. in dia 1.10 9.00 70.00

A. Platanoides (Norway) T—A native of Europe.
Its large, compact habit, broad, deep green shining

1)

foliage, render it one of the most desirable species
for streets, parks and lawns.

Each Perl10 Per 100

H- qeo) D5, Thay, win ClELS Soabodu $3.50 $32.50 $300.00
1% to 2 mas Wa CES oho mooLS 2.50 22.50 200.00
USS toy ale” iba, wba Chess oosonce 2.00 17.50 150.00
UA {io 1H Thay Ti Cle soacesoc 1.50 12.50 100.00
BHO ies WEN sooo cdc OoSS6oes -90 7.50 60.00
A. Platanoides Var. Reitenbachi (Reitenbach’s

Norway Maple) M—An excellent variety of pyra-
midal habit; foliage green in early spring, turning
purple during mid-summer and to purplish scarlet
in the autumn.

NOME ORD ‘Ltenererevcns tev) westotere ioe Each $2.75 Per 10 $25.00
ShtOPUOVLE Tay ca cece tenes Each 2.25 Peri0 20.00
GukOpSmeltveus shasychveueie ele Each 1.75 Perl10 15.00

A. Platanoides Var. Schwedleri (Purple Norway

M—tThe beautiful leaves attract attention
but are especially fine in spring,
when their gleaming red and purple contrasts
brightly with the delicate green of other trees. In
mid-summer they are purplish green, in autumn
golden yellow.

Maple)
at all seasons,

1% to 2 ayia ChE 5 osc Each $3.75 Per 10 $35.00
1% to 1% im. in dia...... Each 2.75 Perl10 25.00
1c) UN eS TIEN ao Gob ooo Each 1.75 Peri10 15.00
3) OHA, WENN G Sogou cooee Bach 1.35 Peri10 11.00

A. Saccharinum (Sugar) T—Avery popular Amer-
ican tree, and for its stately form and fine foliage
justly ranked among the very best, both for lawn
and avenue.

2 to 2% in. in dia...... Each $4.50 Per 10 $40.00
13%, to 2 ton rin ChE So ood6 Each 3.25 Peri10 30.00
1% to 1% in. in dia...... Hach 2.25 Peri10 20.00
A coy 2S she shor ClERS Geen Each 1.50 Peri10 14.00

A. Colchicum Var. Rubrum (Red Maple) M—A
rare, medium sized tree that is bright red in early
spring and again when young growth appears in

the late summer. A splendid small tree for the
lawn.

HWS 1s Jo Gocco oD a oN OO DaOTONOCDOS Each $1.50
Fil OnGetit Iie Mitatrevsponeh eto eueeetaGl koeeaerete es Wach 1.25

JAPANESE MAPLE

A. Polymorphum,. S—This is the normal form or
type; growth slow and shrubby; foliage small, five-
lobed, and of a bright, cheerful green in spring and
summer, changing to a lovely dark crimson in au-
tumn; perfectly hardy when well established. One
of the most beautiful and valuable of small-sized

trees.

SYM Coes JH ER OVI OD a cha LHoloIOOrOroLb oO Old oO.010 00-6 Each $2.50
A. Polymorphum Atropurpureum (Purple-leaved

Japan Maple) D—Forms a bushy shrub; foliage

dark purple and deeply cut; very ornamental. The

hardiest and altogether the best of the Japan
Maples.

By TKOy Ch We, OKOlMON SoeocongeusousDobnKe Each $6.00
DtORSELEMSDECIMENSH enter iae Each 4.00

A. Polymorphum Atropurpureum Dissectum (Cut-
leaved Purple Japan Maple) D—One of the most
striking and handsome varieties. Form dwarf and
weeping. Foliage beautiful rose color when young,
changing to deep purple as they become older, deep-
ly lanciolated. Growth slender and pendulous, and,
like the leaves, has a deep crimson hue.

2% to 3 EG A OMG CRU OO Coma UUe OOO ooOT Each $3.50
PHEW Over ees oes eter BaO I COLCA Se RELOR IORO ONO IS 6 Each 2.50

A. Polymorphum Palmatum (Palm-leaved Japan
Maple) D—lLeaves five to seven lobed, deep green,
changing to crimson in autumn; habit upright, very
compact.

2 tOS3) Lehigh py cstrnssvole ke hereneie tele erence: Bach $2.50

A. Polymorphum Sanguineum (Blood-leaved Japan
Maple) D—-Of dwarf habit and rounded form; foli-
age five-lobed and serrated; reddish crimson in
June. A charming variety and one of the best.

2 to 3 ft. high Hach $2.50

-AESCULUS. Chestnut

A. Hippocastanum Var. Rubicunda (Red-Flower-
ing Horse Chestnut) M—Flowers showy red. One
of the most valuable lawn trees. Forms a round
head and leaves are of a deeper green than the
white flowering sort.

Seco 40 rity elm POnted tim sida aerate Each $3.00
UO) ating, Wen KOH goosodcancavoooacoed Each 2.00
FUG). Wiese abeooacwlansoaoognobaudeocdooS Each 1.50

e i—) WEBER & SONS NURSERY
NURSERY, MO.

A. Hippocastanum (Horse) T—This magnificent,
large-sized tree has no superior on the lawn. In
the spring it is profusely covered with panicles of
white flowers dotted with red.

GeLOUSehGarsmioy rherckee WeLech ok rons Each $1.00 Per 10 $8.00
it OnG wh tries. (eheyaerresieteveys ausyerern Each .80 Perio 6.00
CUR BOM Gers Ob.o Un oa Gee le Each .60 Perl10 4.00

A. Hippocastanum Var. Alba Flore Plena (Dou-
ble White-Flowering Horse Chestnut) T—A splen-
did variety, with double white flowers, in large
panicles, and of fine pyramidal growth. This variety
bears no nuts to litter the lawn and is highly rec-
ommended on that account. One of the best orna-
mental trees.

6 to 8 ft., imported Each $2.00
5 to 6 ft., imported Each 1.50

For the Dwarf Horse Chestnut see Pavia, under
Shrubs.

AILANTHUS. Tree of Heaven

A. Glandulosa. T—A rapid growing, lofty tree,
long, elegant foliage. A distinct ornamental tree
with pinnate foliage, exempt from diseases and in-

sects. Useful in producing tropical effects.
8 to 10 A Diakeycteliche okey oie te Rokoitere Each $1.00 Per10 $8.00
Eisssks iene cremeeetenteneeere

6to 8 Each .75 Perillo 6.00

= *\ ‘
wieril (vvier’s Cut-Leaved Maple)

ALNUS. Alder

A. Glutinosa (European or Common Alder) M—
Foliage roundish, wedge-shaped; growth rapid.
8 to 10 ft Each $0.90 Per 10 $7.00
GUtOr Baits cpa neo eamiere Each .65 Peri0 5.00
A. Glutinosa Var. Laciniata Imperialis (Imperial
Cut-leaved) M—A very striking and beautiful tree,
with delicate and beautiful leaves; hardy and of
vigorous growth; one of the finest cut-leaved trees
in cultivation.
4 to 6 ft. high Each $1.00

AMALANCHIER. Mespilus

A. Botryapium (Service Tree or Shadblow) M—A
small, slender tree that bears a profusion of droop-

ee

A.

€ = 4 So —

> _\| WEBER & SONS NURSERY ~§

~_s: (a9) ——)
- ‘ DiS)
ees NURSERY, MO. y )
\ Ne
B. Alba (Muropean White Birch) T—of which
f ms Sere 1 Coleridge says: ‘“‘Most beautiful of forest trees,
; the lady of the woods.’’
- Bach Peril0 Per 100
RRC OMUORS Capes renin sweu at syerstinvepcre $1.25 $10.00 $80.00
ORUOret Sit Cree te rep ste rote ccd sks jai 1.00 8.00 60.00
ENG)” HOP Dil odo CO mao COCO 65 5.00 10.00

B. Alba Var. Atropurpurea (Purple Birch) \I—
A handsome, white-barked tree, with dark pur-
ple leaves which contrast beautifully with the

bark.
eb OnOrditasescre fete a etees ove a Each $1.75 Per 10 $15.00
MIG) DISK SOEO noo OO d Oe Each 1.50 Perl0 12.50

B. Alba Var. Fastigiata (Pyramidal Birch) M—
Of pyramidal habit, like the Lombardy Poplar.
Very useful in landscape work. Bark silvery
white. Very ornamental.

Each Peril0 Per 106
DwtOnGalbersrateteie seis: ose eoie tants $1.50 $12.50 $100.00
Aa TOM MULT Nr ete ote tarsi er ce 1.25 10.00 $0.00

B. Lutea (Yellow Pirch) M-— This variety
makes a shapely, handsome tree, with bronze-
colored bark. It will grow almost anywhere and
should be included in collections of desirable
trees.

GUO Btosagosccdeesoo Hach $1.25 Per 10 $10.00

B. Papyracea (Paper or Canoe Birch) T—Na-
tive of America, makes a large tree, foliage
large and handsome, bark brilliant white.
GHtOnSeLES.nensnepeurensierene Each $1.50 Per 10 $12.50

B. Populifolia (American White Birch) M—An
American species, with triangular, taper-pointed,
smooth, glossy leaves. Rapid grower.

Each Peri0 Per 100

TOMO UOMR UT em Bhat eiats ele $2.00 $17.50 $150.00
BeMcOnml Opstete ty mapeitersmeaevat shaderets 1.50 12.50 100.00
OG) ai ibe > Aap OOS ood EGU 1.25 10.00 30.00

B. Alba Var. Laciniata Pendula (Cut-leaved
Birch) T—See Weeping Trees.

CARPINUS. Hornbeam

A =e - Carpinus Betulus (European Hornbeam) S—
A. Platanoides (Norway Maple) This will make a good hedge or screen, bears

EGP a 0d

ing spikes of white flowers, rendering the
tree quite conspicuous about the time that
shad are running up the river. Also grown

for its fruit. Each Peril10 Per 100
S tO Ar EE se ete eee tee $0.35 $3.00 $25.00
2 AONB LET ree ee .80 2.50 20.00

AMYGDALUS. Almond

See Prunus in Deciduous Shrubs.

ARALIA. Angelica Tree

Very ornamental foliage, small tree, adapt-
ed to a variety of soils, but. thriving best in
well-drained situations. The immense finely
divided foliage, large, showy heads of white
flowers, followed by the showy-colored seed
clusters, render them very effective. As lawn
plants or for use in sub-tropical effects they
will be found very useful.

A Spinosa (Hercules Club) S—A_ very
showy sort, yet which produces suckers quite
freely. Immense clusters of small, white

flowers in July. Each Per10 Per 100
Extra specimens $2.00 to $3.00 a terta
Gito (8 fC. atte eevee 1.00 8.00 60.00
5 to: 6-fbrn sees een od wp 6.00 50.00

ARALIA PENTAPHYLLA
(Shrub Form)
See Deciduous Shrubs.

BETULA. Birch

The various varieties of Birches are con-
sidered among the most graceful of the de-
ciduous trees, and are almost indispensable
in producing decorative effects. The various Ma al RE BO

barks are always attractive. C. Bungei (Chinese Catalpa)

C. Florida (White-Flowering Dogwood)

pruning well, leaves remain on long after winter
sets in; fine shelter belts, as it endures rough and
windy situations and thrives well in common soils.
Foliage similar to the Beech, but thinner.

Each Peri0 Per 100
ACO UD yh bararevers isto evovsieneretere $1.00 $7.50 $60.00 _
StOu aul eayrast ide areehewanspere 75 6.00 40.00
DaLOmo liberate tcee avcrruetcre nate 60 4.50 30.00

CASTANEA. Chestnut

See Nut Trees.

CATALPA. Indian Bean

Cc. Bungei (Chinese Catalpa) D—A _ small
species that grows 8 to 10 feet high, as broad,
forming*a great bush clothed with a dense
mass, heart-shaped leaves. Among our hardy
shrubs there are but few, if any, that are
more effective as foliage plants for park or
lawn. When grafted on a stalk of one of the
tree species 5 or 6 feet high it makes a hand-
some standard tree. with a very dense and
symmetrical globular head.

Per 10
Select specimens ................ 2.50
Select specimens, 2-yr. heads.... 1.25 $10.00
Select specimens, 1-yr. heads.... 1.00 8.00
Select specimens (Dwarf) 3-4 ft. 1.00 7.50
Select specimens (Dwarf) 2-3 ft. ~.75 5.00

Cc. Kaempferii (Japan) M—Has large, Juxur-
jant foliage and large, handsome white flowers,
with purple dots and a touch of yellow around
-the throat, with a pleasant, delicate fragrance.

Each Peri10 Per100

1% to 2 in. in dia....... $1.50 $12.50 $100.00
8 se ID) Tie WEN A coo eon 1.10 9.00 70.00
6 to 8 ft. high sednon0D0 .75 6.00 50.00

C. Speciosa (Western) T—One of the most
rapid growers. Large heart-shaped, downy
leaves, and compound panicles of white flow-
ers, tinged with violet and dotted with purple
‘and yellow.

This is one of the most valuable of timber
trees, valuable for lumber, tie and fence posts.
Every farm should have from one to five acres
in timber belt of this valuable tree.

a ; Each Peri0 Peri100

1% to 2 wa, Wo} Clb oooacnos $1.25 $19.00 $90.00

IY 5 Wo) LEA thos shot ChE pon anoos 1.00 7.50 60.00

Siwy WO) sis WA oo on odode s -60 5.00 40.00
CELTIS. Hackberry or Nettle Tree

C. Occidentalis. M—A native tree that deserves

more general planting. Leaves are light green,

glossy, pointed. Not subject to insect pests.
Branches are slender and grow horizontally, form-
ing a wide-shaped head. Thrives in all soils.

Each Peri0 Peri100

(nwo) 1, JMO, soa codon eoc $0.75 $6.50 $50.00
BVO) Oat, MEIN ooogasacodeas -65 5.50 45.00
gE Ho) Gy Jie WWI Sooo no eamoU OS -55 5.00 40.00

CERASUS. Cherry

See Prunus in Deciduous Trees.

CERCIDIPHYLLUM.

C. Japonicum. S—ot rapid. ‘growth, erect, Gieuder
habit, with pretty, deeply © ‘veined, cordate leaves.
6 to Sifting tien eons ov. -HWach $1. 75 Per10 $15.00

‘CERSIS. Red Bud

C. Canadensis (American Judas) M—A small tree
of irregular rounded form, ‘with pretty foliage, and
very showy when in Bloom: the branches and twigs
are covered with a densé-mass of small pink flowers
in the fifth month before the leaveS expand.

Each Peri0 Peri00

@ wo Swit NAG cogsocooonades $1.00 $9.00 $80.00
EO & itt WEI, Googacaceodood -85 7.50 60.00
BIW) Ailes IMIG G Go coo oso aaG ay oe £05, 6.0.9 . 50.00

C. Japonica (Japan Judas) -D—Of medium size;
rounded form, foliage deep shining green and heart-
shaped; flowers larger than those of Canadensis,
and of a rich reddish purple color; a valuable small
tree
2 eo 3 ft. INF So agopcooCDDOOCdC QUOD ON SSS Hach $0.75
VB tOrQAa Ue ees ees onstiotatehecieneterenoheton meee renee Each .60

L. Tulipefera (Tulip Tree)

CHIONANTHUS. White Fringe

Cc. Virginica. S—A small native tree, with ash-
like leaves and clusters of snow-white flowers, re-

sembling an elegant fringe. Each Perl0 Per100
ML CKEEE RRR eretetcyat's,t ie alci vier, alate ierste'e $0.75 $6.50 $50.00
RU OTAMD Cote eis al oversuel one's arateraiwie are 55 5.00 40.00
PTURO a rer areola sen od, clu aksrela Ai teLe .40 3.50 380.00

CORNUS. Dogwood

C. Florida (White Flowering) M—An American
species, of spreading, irregular form. growing from
16 to 20 feet high. The flowers are produced in
spring before the leaves appear; they are white and

very showy. Popular. Each Peri10 Peri100
$1.30 $12.00 $100.00

1.10 10.00 80.00

.90 8.00 60.00

C. Florida Flora Rubra (Red Flowering) M—Re-
cently introduced. A variety producing flowers
suffused with bright red; blooms when quite young.
One of the finest flowering trees.

ASTON SEC 6! ahah eran scnel staketensiotereieie wlereraisteretexetete s Each $2.00
BRCOr Lali. fetus. cioi eines eed maivar ets etcretaterer esses) = Each 1.50
DE LOK BIEL Cie cosetave an raroeoe ev oie lendrele retain er ebere vie Each 1.00

| WEBER. & SONS NURSERY 5 >
NURSERY, MO. @

CoO.

Chain alludes to the length of the drooping recemes
of yellow flowers, which appear in June.
5 to 6 ft Each $1.00
4 to 5 ft Each .75

Per 10 $9.00
Peri10 6.00

EUONYMUS. Spindle Tree

See Deciduous Shrubs.

FAGUS. Beech

F. Ferruginea (American Beech) T—Our noble
native forest tree, with silvery bark, fine spreading
growth and symmetrically rounded head. Hspecial-
ly attractive in spring with the tender, delicate
green of its leaves and pendant flower. In this
section, like many of our hardwooded and valuable
trees, is rather hard to transplant, requires very
careful handling and care throughout the first sea-
son.

Gh io Maite GG aoeo CoN Como doman ducad de wood Each $1.25
F. Sylvatica Purpurea Riversii (Rivers Blood-

leaved Beech) M—Where a large tree with purple
foliage is wanted, nothing equals this. It is gener-

Chinese Magnolia

CRATAEGUS. Thorn

‘C. Coccinea (Scarlet-fruited Thorn) M—A fine
native variety. Single white flowers in spring, scar-
let fruit in autumn.

3 to 4 ft P Each $0.60 Per 10 $5.00

C. Crus-Galli (Cockspur Thorn) S—A well-known
native thorn; has long sharp spines or thorns; fruit
bright red; valuable for hedging.

3 to 4 ft Bach $0.60 Per 10 $5.00

C. Oxycantha Var. Flore Alba Plena (Double
White Thorn) S—Has small, double white flowers.
A highly ornamental variety, on account of both
foliage and flowers. Makes a striking contrast
when planted with the double scarlet.

4 to: Each $0.60 Per 10 $5.00

C. Oxycantha Var. Coccinea Flore Plena Paulii
(Paul's Double Searlet Thorn) S—Flowers bright
carmine red. Superior to any of its color.

4 to 5 Each $0.60 Per 10 $5.00

CYTISUS. Golden Chain

Cc. Laburnum. M—A native of Europe,
smooth and shining foliage. The name

with
Golden

went

ally conceded to be the finest of all purple-leaved
trees.

4 to 5 ft Each $2.00

FRAXINUS. Ash

A class of large ornamental trees, adapted to a
great variety of soils. Of quite rapid growth and
possessing many desirable characters for lawn,
street and park planting.

F. Alba (American White) M—A rapid growing
native tree, valuable for planting along streets or in
parks; may be extensively planted for timber;
largely used in the manufacture of agricultural im-

FonGas 3 to 4 ft......Each $1.50

plements. Bach Peri0 Peri100
1 %to 2 als 409 ChE So ocdGoe $1.50 $12.50 $100.00
WA que) aL4% Mita, sh0l ChElo op ood 12/5 10.00 80.00
GutorlOmithich ecco cceece sha 6.00 50.00

F, Excelsior (Huropean) M—A more rounded head
and darker foliage than the F. Alba.

Bach Period Per100
2 Ho) PAYS sha thel Cheb Goad doo $1.75 $15.00 $125.00
1% to 2 hot, thei Chee Coon ados 1.50 12.50 100.00
Ue aioy CA Shek, Ube ChEAan Seay o ab 125 10.00 80.00
Ae COML Ue IM Atle Cia ecre.e one. e 1.00 60.00

7.50

. {WEBER & SONS NURSERY (__5 ~«

Cu

F. Viridis (Green Ash) M—A pretty tree of me-
dium size, with leaves plain green on both sides.
8 to 10 ft Mach $0.75 Per 10 $6.00
For Weeping Ash see Weeping Trees.

GLEDITSCHIA. Honey Locust

G. Triacanthos. M—A rapid-growing native tree,
with powerful spines and delicate foliage.

4 to 6 ft SU OOO COO OOOO OOOO Each $0.45 Per 10 $4.00
GYMNOCLADUS. Kentucky Coffee
Tree
G. Canadensis. M—A strikingly ornamental, ir-
egular, open-topped tree, with peculiar rough-

barked and twigless branches and immense, broad,
double-compound foliage of a peculiar bluish-green
color. The flowers are white, in open racemes, fol-
lowed hy immense, long. brown pods. A picturesque

and desirable tree. Each Peri0 Per 100
G}igo ak) 1, ewes Gob aonoGoboo0 $1.00 $9.00 $75.00
Go ites Wiles ob oaoooonagnc 5 6.50 50.00
tO) BG Mit, WANG oaosgoaucdoec .60 5.00 40.00

HALESIA. Silver Bell

Brown light green foliage, dense growing trees of
small size and well adapted for lawn culture and
grouping with other plants. ‘Their chaste, pure
white flowers are produced in abundance along the
entire length of the branches as the leaves appear
in spring, and give a very charming picture. Best
grown in well-drained soil in somewhat sheltered

position.

KH. Tetraptera. S—-The hardiest species. Very
choice.
F WO) GF It, INEM G gob adonooodo Each $1.00 Per 10 $8.00
(UA) BIE TONEN Saeco em mb Each .80 Peri0 6.00
Simo tb ates ING soo GopoOD boo Each .50 Peril10 4.00

JUGLANS. Walnut

See Nut Trees.

KOELREUTERIA. Varnish Tree

K. Paniculata. M—A charming small tree, a na-
tive of China, with glossy, divided foliage and large,
terminal panicles of showy golden-vellow flowers in
July, followed by curious bladdery seed-vessels. Its
pleasingly colored foliage and neat habit of growth,
with its showy flowers, render it a very desirable

lawn tree. Each Peri0 Per100
c) WOY HOP te EINE yo ean oonopo dS $1.25 $11.00 $100.00
GitomeSrtt while hvrersrsseie centers 1.00 9.00 70.00
BFAKOI IGE JOVCVNG Bo odlo.o Obloceo 90 7.50 60.00
Mw) 6} tits JMENs.o Gono ob uoo BAO 56) 6.00 50.00

LARIX. Larch

L. Europaeus (Huropean) T—A beautiful. rapid-
growing pyramidal tree, with all the characteristics
of an evergreen, except that it drops its foliage in
the autumn.

NTIS By ti Jeuh IN aa GooouoAdac Each $0.75 Per 10 $6.50
Shtonsantwhiehinet ere Each .60 Peril0 5.00

LIQUIDAMBER. Sweet Gum

L. Styraciflua. T—A large native tree, with rough,
corky bark, and shining, deep lobed, star-shaped
leaves, changing to deep crimson in the autumn.

SHKGhwnlp cgrSoesbotouosuaccss Hach $10.00 to $25.00

Each Peri0 Per 100
Bio) 3 tes IONSING 6 Goo odoodoOUKKS $1.25 $10.00 $90.00
SutoOlGert-e ht Sheets reaners 1.00 9.00 70.00
4° tol =ft.nhnieh: c:peh ve svcuencrecieieie 75 6.00 50.00
Skto4 shtchigh seme erotcesee .60 5.00 40.00

LIRIODENDRON. Tulip Tree

L. Tulipefera. T—One of our very largest native
trees, with large, smooth, shining leaves, greenish-
yellow flowers and an umbrageous head.
Select specimens, 4 to 5 in. dia., Ea. $10.00 to $
Select specimens, 3 to 4 in. dia., Ea. 5.00 to

25.00
10.00

3 wm NURSERY, eel 74,

30

Each Peri0 Per100
2 to 2% in. in dia -$2.50 $22.50 $175.00
1% to 2 italy thay ChE Gb oben aon 7/5) 15.00 125.00
1%, to 1% in. in dia......... 1.50 12.50 100.00
Si CO PLOMC ea eusin sine ceuerahes seen 1.00 9.00 75.00
GAtO cus LCR aiceioneee che seme -90 7.59 60.00
DiitO pi GahtS Ait sce cjopetsia/s cuexsnave eke .75 6.00 50.00:

MAGNOLIA

M. Acuminata (Cucumber Tree) T—A beautiful
and symmetrical tall tree, with large leaves; excel-
lent for lawns and avenues.

DitO OtLGZ ec ccepaetete atteber ens Each $1.00 Per10 $9.00
AMbOMS Mite atsacts use wat este exciiete Each .75 Perl0 6.50

M. Glauca (Sweet Bay or Swamp Magnolia) S—
When planted in moist soil this makes a handsome

T. Europaea (European

Linden)

tree of medium size. Its leaves are glossy, laurel-

like, almost evergreen. In June its pure white
flower-cups are lovely and grand.
QitOnS out es eoitercss cornetesenerete Bach $1.50 Per 10 $12.50

M. Tripetela (Umbrella Tree) S—A hardy, me-
dium-sized tree, with immense leaves, and large
white flowers 4 to 6 inches in diameter, in June.

4 to 5 ft Each $1.00

MAGNOLIA. Chinese Species and
Their Hybrds

These sorts flower very early, even before the
leaves appear; many varieties are fragrant and the
display of color is grand. They are best transplanted
in spring.

All of our Magnolias of these varieties are im-
ported plants (Holland grown) and each tree has

ball of earth attached to roots and wrapped in bur-
lap, insuring safety in transplanting; and each tree
is well set with flower buds, giving a profusion of
flowers the first season.
M. Alba Superba. [—A very fine white variety.
4 to 5 ft., well set with buds............ Mach $3.00
Sette aat tr SOMO DUGS:. vuciets cin ie chelel& sis iatat sine Each 2.00
Magnolia Soulangeana Nigra (Imported)-—True
Purple, very rare.
2 to 3 ft: Each $3.00

M. Soulangeana (Soulange’s Magnolia) S—One of
the hardiest and finest of foreign Magnolias, resem-
bling Conspicua in flower and habit. Its flowers

are from 3 to 5 inehes across, cup-shaped, white
and rosy violet, opening a little later than Con-
spicua. (Imported.)

4 to 5 ft. specimens, well set with buds. . Hach $3.00
3 to 4 ft. specimens, Some buds.......... Each 2.00

Q. Rubra (American Red Oak)

M. Lennei (Lenne’s Hybrid) S—A _ variety of
great beauty. The large flowers are of deep rose
color, the foliage tropical and heavy, the tree vig-

orous and profuse blooming, frequently opening
flowers at intervals through the summer.

4 to 5 ft., well set with buds............ Each $3.00
3) one Wine CO) WOR orer oor rT domotooruld Each 2.90

M. Alexandrina (Alexander's Magnolia) S—Close-
ly resembling M. Soulangeana in color of flowers,
but a few days earlier.

4 tous ft., well setiwithubudSin <i. oc we o Each $3.00
Seto usuits, | SOMLCNDUGS: cramer dl oteteior caters Each 2.00

M. Purpurea (Syn. Abovata) (Purple Magnolia)
S—Deep purple, pink in throat; a dwarf, bushy va-
riety; blooms at intervals all summer.

PARLORS AN ter ERA ELEC O CROC rte O.C OTRO CRETE becoclenn Bach $1.50

M. Speciosa (Showy Magnolia) S—The flowers of
this species are a trifle smaller and lighter colored
than Soulangeana. They open about a week later
and remain perfect on the tree longer than those
of any other Chinese Magnolia. Very hardy.

NURSERY,

31

Mo.

4 to 5 ft., well set with buds............ Each $3.00
BRtOMAmtueeSOULGeD US aicksncye cresseucuener cleisieneie Each 2.00

M. Stellata (Syn. Halleana) S—A pretty dwarf
form that opens its snowy, semi-double flowers in
April, earlier than any other Magnolia; their frag-

rance is pronounced and delicate. Rare.
DEtOme pus VeLLESGUMULUNM OILS emrsryeierec: Each $3.00
PAULONIA. Empress Tree

P. Imperialis. S—-A magnificent tropical looking
tree from Japan; of extremely rapid growth and
surpassing all others in size of its leaves, which are
twelve to fourteen inches in diameter. Blossoms
trumpet-shaped, formed in large, upright panicles,
and appearing in May. Kills back during severe
winters, but sprouts from the roots again, it soon
regains its beauty.

GHUORSE RU peccrsieyercteverereys tcteheLelctenerstste’ sxevenehensisve Bach $1.25
DVO) OIWodads sop ocTo OMe CoD COU OCCUR OD OES Each 1.00

PERSICA. Peach

See Prunus in Deciduous Trees.

PLATANUS.

P. Occidentalis (American Plane)

Sycamore or Plane

T—A tree of

the largest size, growing rapid, very ornamental
and entirely hardy. Fine for street planting.

Pach Perl0Q Peri100
1% to 2 Win solo nea 7 o6dten $2.50 $22.50 $200.00
MA CO PMSZAITIN re geen aealivereceisre UA7/) 15.00 125.00
LEU O Mley GIN terete onsite aetevavauarers 1.50 12.50. 100.00

P. Orientalis (Muropean Plane) T—A lofty, wide-
spreading tree; large five-lobed leaves; valuable for
its handsome foliage and free growth; makes an
excellent street tree.

We have an exceptional fine lot of “EUROPEAN
SYCAMORE” of the 2 to 2'/2-inch and 1%4 to 2-inch
grades. This is the best tree for city street planting.

Each Per10 Per100
2) «Teo NORV ANT ale crates cca cr REET $3.00 $27.50 $250.00
1% to 2 INNS 5 FO ti COO aOO 2.50 22.50 200.00
SC LOm GSA AMI ercteronreuntene tie: siete 1.75 15.00 125.00
Se LO Lie eal rae: eae baitate ens ahor avetey ove 1.50 12.50 100.00
1 LOT otal Vere os GO CeO Oleh ro 1.00 8.00 60.00

POPULUS. Poplar

P. Fastigiata (Lombardy) T—This grows to an
immense height, and is remarkable for its columnar
growth.

Select specimens .............. Each $3.00 to $10.00

Each Peril0 Per 100
QW) DB’ thay, Weliisn cocnaooos $1.60 $14.00 $120.00
1% to 2 INGA a) .verenelene ao Ab?4) 10.0€ 90.00
EU aL Onli oae AN eta CL aetveyanerecteca le 1.00 9.00 75.00
UTA we. da bo Chee Goma poe oc 15 6.50 50.00

P. Monolifera (Carolina) M—A vigorous, healthy
native tree of rapid growth, pyramid in form, with

large, glossy leaves; valuable for park or street
planting.
Select specimens .............. Each $3.00 to $15.00
Each Perl10 Per100
2% to 3 os Cheb osahodnavd $1.50 $1306 $110.00
2 UO Oe iM es Layee tere scv cn ccereya 10.00 90.00
1% to 2 Me ChEhydocnd Hono Ao 8.00 70.00
UA i ACA Sho heban mao oben os 6.50 50.00
Ile yo) alae aholy Chiao adod olbac 4.00 30.00
GELOSSURD whieh eeneters cy simonerenere 2.50 20.00
DRCOLORUC MLS hee merete merce rene res 2.00 12.00
P. Alba Bolleana New, pyramidal

form, leaves dark green on upper side, brilliant sil-
ver underneath. Very beautiful.

1) 4a) UY) ties MEER A oodoOnCOS Each $1.00 Per 10 $9.00
G} ano) al) ite JONES 6 Gu doanoub Each .75 Perl0d 6.50
(ino) Glatte, INFN hoon Hoo DEK EG Tere) TASK)

P. Mon. Aurea (Golden) M—The golden yellow

foliage, retaining its brilliancy throughout the sea-
son,

8 to 10 ft. high -Bach $0.75 Per10 $6.50
6to 8 ft. high Each .60 Peril10 5.090

P. Nigra (Grecian) M—Leaves roundish-cordate,
with a short, sharp point, end small, somewhat reg-
ular teeth, smooth on both sides; tree spreading,
much more so than P. Monolifera, and we think

Gas

longer lived. A very pretty Poplar for street plant-

ing.

4 to 5 ANP OI syapoees a shee Mach $5.06 Perio ...
3 to 4 LTDA ae crete Each 3.00 Per10 $25. 00
21% to 3 thal, CUE GG eoodoG Each 2.00 Peri10 17.50
2 to 246 india wee Hach 1.50 Peri0 12.50
1% to 2 Wis ChE soococ0d Hach 1.25 Period 10.00
WOVE Rey ILA itols CHES one oa Ao Each 1.00 Perio 8.00
IEA oy I stin, CUE oo gcmus50 Each .75 Perl0 6.00
6 to 8 Lit JUN so pic ocdo Each .50 Period 4.00

PRUNUS

Comprises a large genus, including the Almond
(Amygdalus); Cherry (Cerasus); Peach (Persica);
Plum (Prunus). These contain many beautiful
double-flowering and bright-foliaged varieties.

Care should be taken to see that the borers do
not destroy the trees. Look for them near the
ground line during the summer months.

P. Japonica (Double-Flowering Almond)—See
Prunus under Deciduous Shrubs.

P. Avium Var. Flore Alba Plena (large
Double-Flowering Cherry) M—tThe double
white flowers, like little roses, cover the tree
completely, forming an object of rare beauty.

Fev OuOrd tavererecsters vance ve Each $1.00 Per10 $9.09
ABUOMOIL Lines eee Each .85 Perio 7.50
P. Rhexi fl. pl. (Double-Flowering Cherry)

S—A._ fine double white flowered variety, a
profuse bloomer, flowers rose-like.

By WO BO teooadoaosdoc Each $1.25 Per10 $10.00

P. Serotina (Wild Black Cherry) M—Our
native wild cherry, a most beautiful tree and
one that should be more largely planted. Fine
when in bloom and again when loaded with
fruit.

G1) Bist osoaougooe Each $0.75 Per10 $6.00
51) Otte se oonooo ...Hach .60 Peri10 5.00

P. Padus (Huropean Bird Cherry) M—A
rapid-growing, beautiful tree, with glossy fo-
ilage and long bunches of white, fragrant
flowers in May, succeeded by clusters of fruit
like black currants.

SubOwGutteeiam ict nasverts Each $0.60 Per 10 $5.00
42.60 to altairace sicko: Each .50 Peril10 4.50
P. Pizzardi (Purple-leaved Plum) S-—A

very remarkable and beautiful tree, with
black bark and dark purple leaves, remaining
so until late in the fall.

Histon hCatexstenseiever seers Fach $0.50 Per 10 $4.50
ASCORDELG A epeeincc te elon Hach .40 Perio 3.50
ButOrs EUs esverereieeieiehs Bach .35 Peri0 3.00

P. Triloba (Double-Flowering Plum) D—A
beautiful small tree or shrub of fine habit,
with elegant, double, rosy flowers, set very
closely on the slender branches.

Satoshi onan tet Redes Mach $0.50 Per 10 $4.50
PA NOY. BY BEE 3 Gio 6100.0 O1i0.0 Each 40 Perl19 3.50
P. Vulgaris Flore Alba Plena’ (Double

White-Flowering Peach) S—Very ornamen-

tal. Flowers pure white and double; superb.

ABE OMS ML Grate rch eva okalteketetetonetoke Each $0.45 Per 10 $4.00

GUO) 4b Wes oo Scoop ob ado ODI 505 Hach .35 Perl0 3.00
P, Vulgaris Flore Rosea Plena (Double Pink-

flowering Peach) S—Flowers pate rose color, dou-

ble, produced in great abundance and very hand-

some.

AZ COmD ULC aretemtetstecosnsetereeetekete Each $0.45 Per 10 $4.00

6) 10) Ze iteG ao donocoouuonGODO Hach .35 Perio 3.00
P. Vulgaris Flore Sanguinea Plena (Double Ked-

flowering Peach) S—Flowers semi-doukle, bright

red. Fine.

LIN0) BY Itong Goo moOObO COON OO Each $0.45 Per10 $4.00

BE} ud) ab sites SSoomocnDdeobooad Hach .35 Perilod 3.00

PYRUS. Crab

P. Malus Angustifolia Plena (Bechtel’s Double-
Flowering) S—The beauty and delicate fragrance
of the bloom of the sweet-scented crab is a theme
for poets, and this new variety is a gem among
hardy plants. The flowers are sometimes mis-
taken for small pink roses, and the perfume tends
to increase rather than correct the delusion.

4 WEBER. & SONS NURSERY <W_* i
NURSERY, Mo.

CO

rieahiCg. SQOM PSO OOS o Each $1.25

is) Per 10 $10.00
Onl wliterehaneh=rerthecte eres mci ach 1.00

Per 16 9.00

P. Malus Floribunda (Single-Flowering Crab) S
—Flowers beautiful carmine in bud; white when
open; May. Fruit very ornamental in autumn.

4! CO Dinbibrancte ee ayageretehe roe tore sects Each $0.75 Per10 $6.00

P. Malus Floribunda Atrosanguinea (Red-Flower-
ing Crab) S—Flowers crimson, in great profusion.
A very fine variety.

4 tol 5 ft. Semen ae Soudad Each $0.75 Per 10 $6.00

P. Malus Halleana, syn Parkmanni (Parkman’s
Crab) S—Dwarf habit, foliage dark green, hangs on
late. Flowers very double, drooping, dark rose, re-
taining their color until flowers drop. A very fine

variety.
Sto 4sft i secnis stoic Sie eres oraiwearetenta ee Each $1.00
PAB ONC IE MOPAR CNC tS Co CUO db gn a-a'e Each .80

U. Americana (American White Elm)

QUERCUS. Oak

Q. Alba (White Oak) T—One of the finest Amer-
ican trees, of large size and spreading branches;
leaves lobed, pale green above and glaucous be-
neath.

GUCOMS aL Watehene wmv eueus elenerenens Each $2.25 Per 10 $20.00

Q. Macrocarpa (Mossy Cup or Burr Oak) T—A
native tree of spreading form. Foliage deeply
lobed, and the largest and most beautiful among

oak leaves. Bark corky.
Stow OME Braasinscieets ....HMach $2.25 Per 10 $20.00

Q. Palustris (Pin Oak) M—Foliage deep green,
finely divided; assumes a drooping form when it
acquires age. One of the most valuable for street

planting.

1% to 2 thats Clb 6 6 .Hach $2.50 Per 10 $22.50
UBM USA Thal ChE ooo bono Hach 2.25 Period 20.00
Ey TOM Mnsteg ino bioin Oo ccoc Goou Bach 1.75 Period 16.00

Q. Robur (English Oak) M—A broad, spreading,
graceful tree, of slow growth and long lived.
SRO MlOMite rs -r ieietatoratsyorehe Hach $1.75 Peri0 $15.00

a a
HS:

Q. Robur Pedunculata Var. Concordia (Golden
Oak) M—A fine variety of medium growth, foliage

bright yellow during spring and early summer. Very
conspicuous.

PURUCLID GRU dal aac staralarater cvevevave: eretsve’s vereunitecanecs Bach $3.00
£8 LAY 5.6.05 2 CRCRCRD OLE ROR EEC EOC airpe oc DIO Dee Bach 2.50

Q@. Rubra (Red Oak) T—An American species, of
large size and rapid growth, foliage purplish red
in the fall.

SSRECHMUOUD Gevetel ars: ove¥e «cetarove eters Each $2.25 Per10 $20.00
GLOSS OUb Wares creyelere. cvecais tus Bach 1.75 Peri0d 15.00
ROBINIA. Acacia or Locust

R. Pseud-Acacia (Black Locust) M—A native
tree, of large size, rapid growth; is being largely
planted for timber; it is also quite ornamental. The

flowers are white

fragrant.
6 to § ft
5 to 6 ft

in long racemes, or

Blooms in June.

yellowish,

Each $0.60
Bach .50

Per 10 $5.00
Perl10 4.00

For Honey Locust see Gleditschia, under Decidu-
ous Trees.

Morus Var. Tartarica Pendula (Weeping Mulberry)

SALISBURIA. Maiden Hair

S. Adiantifolia. T—A native of China and Japan,

forming a medium or large tree; leaves fan shaped.
pre of a rapid growth and belonging to the Coni-
era

Each Peril0 Per 100
SUCOMUOME LS yeravetensnete ercever he takers $1.25 $11.00 $100.00
(by ASB io ouimeree oan aacol & 1.00 9.00 75.00
PAU OMG! Libemtern et ovatera eretinen tctenetans AD 6.00 50.00
AMON MS DPLEAS terre ionute wicmetne .60 5.00 40.00

SORBUS. Mountain Ash

S. Aucuparia (Mountain Ash) M—A small tree
with shining, pinnated leaves and large cymes of
SA flowers, followed by clusters of bright red
ruit.

Stones crac wea cteiere renters Hach $0.75 Per 10 $6.00
6HtOrs 8 LEM cee eteeetatele Each .60 Perl0 5.00
SRCOM GLE Matercyelcneeaatetetere cei Each .50 Perl0 4.00

WEBER & SONS NURSERY”
NURSERY, MO.

33

S. Quercifolia or Pinnatifida (Oak-Leaved Moun-
tain Ash) M—A hardy tree of pyramidal habit.
Foliage simple and deeply lobed, bright green above
and downy beneath. A fine lawn tree.
6 to 8 ft Bach $0.75
Siete cireteireicieebapsrencie Each .60

SALIX. Willow

S. Caprea (Goat Willow) S—AlIlso known as Pussy

Per 10 $6.00
Per10 5.00

Willow, catkins silky, preceding the leaves; very
useful for early effects.

SWLOMGSs hte cies ce cecr cma healer avers Each $0.50 Per 10 $4.00
S18) tee re ond Db.0 0.1m OCs Each .40 Perio 3.00

Ss. ana cote (Silver-Leaved Willow) S—Of spread-
ing habit, slender branches, foliage narrow, silvery

gray. We like it better than S. Alba.

AKON MES Bo. co Gta OOOO S Bach $0.60 Per 10 $5.00

ZENO) By 16. oorokeenra. hon. ooo Oa OO Mach .50 Peri10 4.00
S. Pentandra, syn. Laurifolia (Laurel-Leaved

Willow) M—A fine ornamental tree, with large,

shining leaves.

RAO US Site Aone ne oaD DOOD Bach $0.50 Per 10 $4.00

ENG) Bit ob oooeouUOKODOoNGO> Hach. .40 Peri0 3.00

S. Lutea (Golden Willow) S—A showy variety
with golden bark of high color, making it very con-
spicuous during winter.

MONG te Ae? cle cognn OOOO OO Each $0.50 Per 10 $4.00

EO NOV) lca chacthc OD OO CAC Guy'GIC Each .40 Perio 3.00

"Ss. Vitellina Britzensis. M—vVery attractive in

winter, when bark turns red.

BYNUM sith Scam ce Caicedo aro Bach $0.50 Per 10 $4.00
S. Alba syn. Regalis (Silver Willow) M—A large-

sized tree, with yellowish brown branches. The

foliage is ashy gray and silvery, giving the tree a

white appearance.
Each $0.60 Per 10 $5.00

5 to 6
4 to 5 Each .50 Perio 4.00

We can supply a number of other bright barked
Willows, such as S. Cardinalis, S. Wentworth, S.
Canescens, Scarlet and Japan Golden.

5 to 6 ft Each $0.50 Per 10 $4.00
4 to 5 Hach .40 Peri10 3.00

For the Weeping forms of Salix (Willow), see
Weeping Trees.

TAXODIUM. Cypress

T. Distichum (Deciduous) T—A _ distinet and
handsome tree of slender habit, with soft, feathery
foliage. The trunk is as straight as an arrow and
tapers regularly from base to tip,.as stiff and dig-
nified as a chureh spire. Although a native. of
Southern swamps, it does well in cities; it is a
favorite in our St. Louis parks, especially ‘‘Tower
Grove Park,’’ in which are some of the finest speci-

SUES: Our stock of these valuable trees is very
ine.
Select specimens, 2144-4 in. dia., Hach$5.00 to $15.00

Each $2.50 Per 10

Hach 1.75 Per10 $15. 00
Hach 1.25 Perio 10.00
Each 1.00 Per 10 8.00
Each .75 Peri0 6.00

TILIA. Linden

T. Americana (American )T—A fine pyramidal
tree, with large-sized leaves and fragrant flowers.

2 OD ome CE els che a cielele Each $3.50 Per 10 $30.00
USA, MOA. sal, ChE os Ab ooons Each 2.25 Period 20.00
LAC wCOMU Saker Lalery ery sreteioie Each 1.75 Peril10 15.00
Sato Omiteracrreccrsenrerepciete Each 1.25 Perio 10.00
Oey Eas Go GadudTe ON ooo Each .90 Perl10 7.50

T. Europaea (Muropean) M—A fine pyramidal
tree, with medium-sized leaves and fragrant flow-
ers.

SDECIMEMEGLEES st ctateleperatelchelstsieie's Bach $5.00 to $10.00
2 uo) VY} WV Shoy, (hEl5 ooaboUubS Each $3.50 Per 10 $30.00
1% to 2 ITN Chaka ehey severe Bach 2.25 Perl10 20.00
Ue SCOMUSZ In Gl ajereiencelaieine Each re 15 Peri10 15.00
fe} TOV) Ste 5 Gao no uD clad Each 1.25 Perl10 10.00
GRUOM CULES are eis oie teeor iene Each 80 Perl10 7.50

T. Var. Platiphylla. M—-A tree of about the same
size as T. Europaea, but readily distinguished from
it by its larger and rougher leaves.

NURSERY,

MoO.

Each $5.00 to $10.00

DA ay WD sok, CHA 4 eh Goace Hach $3.50 Per 10 $30.00
1% to 2 Ins iar tree Each 2.25 Peri0 20.00
bers oval Abs baly abl hs meni Or quate Bach 15 bers lon 15700
PAfS COSA abe ine Cal eee tapetet se Each 1.25 Perio 10.00
Gatospntehi sheer rcmrctters Each .90 Peri10 7.50

T. Var. Alba (Argentea) (White-Leaved Euro-

pean Linden) M—A vigorous tree, of medium size
and pyramidal form; foliage downy beneath and
smooth above. It is one of the finest of ornamental
trees.

& to 10 ft. high Each $1.75 Per 10 $15.00
6 to 8 ft. high Bach 1.25 Period 10.90

T. Dasystyla. M—A vigorous tree, dark, glossy

leaves, bright yellow bark in winter. One of the
finest Lindens.

io) UM) THE IME Gooclono oo ach $1.75 Per 10 $15.00
6Gutoee Sart. highest Each 1.25 Peri10 10.00

ULMUS. Elm

U. Americana (American) T—The noble, droop-

ing, spreading tree of our woods. One of the grand-
est of park and street trees. Select specimens:

Peri0 Per 100
2% to 3 in. dia $35.00 $300.00
2 to 2% in. dia 22.50 200.00
1% to 2 in. dia 17.50 150.00
1% to 1% in. dia 12.50 100.00
10 to 12 ft. high 9.00 80.00
8 to 10 ft. high 7.50 65.00

U. Campestre (English) M—A native of Europe;
a noble, rapid-growing tree, forming a dense head;
a desirable tree for streets, avenues, ete.

Select specimens, 3144-8 in. dia., Hach $5.00 to $25.00
IEW) BY thels Clon oo oocb0 Each $4.50 Per10 $40.00
to) DA st CN ogo saga5 Each 2.75 Perl0 25.00
WEA iO) Qos Shy CEL. 6 cog Gouo Each 2.50 Perl10 20.00
16) tontis, ins diaeeree Each 1.75 Perio 15.00
i eA Woy IVA has Ob Gao oc ob Each 1.25 Peri10 10.00
SitomlOs tah e Drewsanenenensiene Each 1.00 Perl10 7.50
Qo) ite MWA soo oooosEs Each .75 Period 6.00

For Weeping Elm, see Weeping Trees.

WEEPING DECIDUOUS TREES

ACER. Maple

Acer Wierii Laciniatum (Wier’s Cut-Leaved
Weeping Maple) T—See Deciduous Trees for de-
scription.

2 OY AWA shay Clie ba Piolo nce Hach $3.50 Per 10 $27.50
USA TO) Bi thals CVS oo Ab oo ao Each 2.50 Perlod 22.50
WA tie) TEAS bl, Cheb op o Gab co Each 2.00 Peril10 17.50
eA oy alee shy OUENS Go ouoaoo Each 1.50 Perl10 12.50
ALNUS. Alder
Alnus Laciniata Imperialis |

(Imperial Cut-Leaved Weeping
Alder) —A very striking and:
handsome tree, with delicate and
beautiful leaves; hardy and of
vigorous growth. One of the fin-
est cut-leaved trees.

4 to 5 ft Each $1.00
8 to 4 ft Each .75

BETULA. Birch

B. Alba Var. Laciniata Pen-
dula (Cut-Leaved Weeping) T-—
Trunk straight, slender, white as
snow; branches hanging in long,
pendulous threads from a great

height; leaves finely cut; a uni- |
versal favorite. |
Each Per10 ;}
3700) WM) Sioa an cos $1.50 $12.50
6HtOl Shitaecrscnimime 1.25 10.00
Wo) -B EG a oo boan0 1.00 7.50
B. Alba Var. Pendula. S—§&

Much more pendulous in habit
than the above; a swirling mass
of slender branches and delicate,
airy spray. We have this vari-
ety in high and low grafted
trees; an elegant tree for speci-
men planting or for grouping.

8-yr., grafted Each $2.50
J=vre. eratted: qos: Each 1.75

CERASUS. Cherry

C. Japonica Rosea Pendula (Japan Weeping Cher-
ry) S—Flowers single white; fruit red. One of the
finest of the small- ‘headed pendant cherries.

Venikeehou ecko Gy osanoodavogooGchsoaucuCEN Fach $1.75

FAGUS. Beech

F. Sylvatica Var. Pendula (Weeping Beech) M—
A large tree of curious, irregular growth: its long,
graceful, drooping branches produce a graceful ef-
fect.

Ibssnoyoymnrcl, GP UO4tS Wey oooscocoaoooUcoKpOO. Fach $2.50
Imported. 5 to 6 ft Bach 2.00

berry)

84

F. Sylvatica Var. Purpurea Pendula (Weeping
Purple Beech) M—A beautiful tree, of the same
habit of growth as the variety Pendula, only that
the foliage is purple.

Imported, 5 to 6 ft

FRAXINUS. Ash

F. Excelsior Var. Pendula (Weeping Ash) S—Is
a picturesque little tree for lawn specimens or for

Hach $2.50

U. Pendula (Camperdown Wesping Elm)

covering arbors. It has foliage and fruit like the

Sorbus or Mountain Ash.

2-year heads Hach $1.25
F. Excelsior Var. Aurea Pendula (Golden Weep-

ing Ash) S—Similar to the former, but with bright

yellow branches, which make it distinctly orna-

mental.

DVCAM ECAIGS oes ace rahe aleles ol ehetavsyobebetenete tae ietpuete Each $1.50

MORUS. Mulberry

M. Var. Tartarica Pendula (Tea’s Weeping Mul-
S—A graceful and beautful hardy tree,

forming a perfect umbrella-shaped head, with long,
slender, willowy branches, drooping to the ground
and gracefully swaying in the wind. Foliage small,
lobed and of a delightful, fresh, glossy green. Ad-
mirably adapted to cemetery planting.

Select 3-year heads...... Bach $2.00 Per 10 $17.50
Select 2-year heads...... Each 1.50 Perl10 12.50
Select 1-year heads...... Each 1.00 Perl0 9.00

SALIX. Willow

S. Babylonica (Babylonian Weeping Willow) M—
A well-known and most graceful tree of large size.
Its fresh, bright green tint and long, wavy branches
make it very attractive.

PMCS GE bare ater cidiviciesnvereteler oteleve Bach $0.50 Per 10 $4.00
MLE GRR Le rcynie: cr cvelet cater ecokovel crate Each 40 Peril10 3.00
UOMO RUC talercitalere arcs cle cn ole Each .30 Perlo 2.00

S. Babylonica Var. Ramulis Aureis (Golden-
Barked Babylonian Willow) T—A novel and distinct
variety of the well-known Babylonian Willow, with
bright golden bark in winter.

(DS) There cect aC OOOO EOE or oD Each $1.00

S. B. Var. Dolorosa (Wisconsin Weeping Willow)
M—Of drooping habit and beautiful form. The
most hardy of all our Weeping Willows.
GREOUS RLU yilet. praetor ctetercictete:s Hach $0.50
DELOUGRLL toed a ot aeraelo cies Each .40
ABCOU DELS mater vem teretets oie iarave’s Each .30

Per 10 $4.00
Perl10 3.00
Per 10 2.00

\) WEBER & SONS NURSERY “9 “5 >
NURSERY,

WS CO. ant
S. Purpurea Pendula (American Weeping Willow)

S—A slender branched species; grafted five or six

feet high, it makes one of the most ornamental of

small weeping trees.

= CODME GAC Sueraieelofatst otal steve evel chel«ieielsy o) exes) «).° Bach $1.00
S. Caprea Var. Pendula (Kilmarnock Weeping

Willow) D—An exceedingly graceful tree. Fine for
small ewe
Grafted, 2-year heads..... scdegaoocoDay Each $0.75

Ss. Se ane R AAP (Rosmary-Leaved Willow) D—
A very striking, pretty, round-headed smal] tree.
Branches feathery; foliage silvery.

Grafted, 2-year heads............+.200- Hach $1.00

S. Elegantissima (Thurlow’s Weeping Willow) M
—Larger, hardier and more spreading than the

Babylonian. A fine variety where a large-sized

tree is desired.

UOANS)-GIP) Sito en Ooooh Oe OLaOoO Each $0.75 Per 10 $6.50
3) io) MW) Wie Cao aoooonoCoDOC Each .60 Perl0 5.00
Gu Meonpoocondo ECO GaN Each .50 Perio 4.00

ULMUS. Elm
U. Var. Camperdown Pendula (Camperdown

Weeping Elm) S—One of the finest weeping trees
for the lawn. With broad foliage and branches
drooping gracefully to the ground.

Grafted, 2-year heads....Each $1.25 Per10 $10.00

CLASSIFICATION OF ORNAMENTAL SHRUBS

Shrubs Classified as to Height.

Arranged According to Color, Giving Time of

Blooming
Blooming
Name Height Color Time of
PR GASSES GILLI A arctan. cieie chepeh eter slatets o) overs MAW tee otgeoo6 MANOS SoncdcsnednoG0o5 600 C OOO na June
AIVOND UGE TUTI COSA ies oso. cierciaisvaye ae alstale a ofa WY TiC UG Reals era tia Gaon PAA N En CHAE CODO OOOO OODOODOOUODIOD June
Wxochorda Grandiflora ............csseeesee DUG UAW ccoedaoad WHILE 2.6. eee tees eee e eee ene May
ISIDEONS MSE shou obec odsu Cou DUGUnDOODOadoS Si tom QC sonererecs. chore WAMIID. clo camodcdooeusc Co codc Aug.-Sept
IBID SEWS digzist GMAUKet hon Bad Gac DODUUOOUGOOOOC GUO Hes ocanoodde White ....... crouslaie seetshceetoborers Aug.-Sept
muiniscus Wady Stanley...) ev ciicd cece thee here Sitio Ohi ee ee WAS oncocoegCoooe oN O00 D0C Aug.-Sept.
Hibiscus-Ranuneuloeflora, 3055p sii ek. SiUORL ZIRE siahe cys ere WV cooctuosmocodougcdcKuCN Aug.-Sept.
Binladelphussimi Variety: 2. 35... ciuepeieceie cs otetele Sto miQehtn See ives White
EECCA MI LOMAS ie eis eye! later Hohe clere cle mave gare SitomlOshue arom tiers White,
Eelanyinin Ss CALM ArTICU St ercreres seers ahets) Ccret hele ere ahs SHUOMIOET Ganteren steve White
Pee Aaehoreds White

PMO OLMPUS MCITOLILES:) sis cic cis cue, ccevevslalel bielePesavere S8tol
SEU UCUS MINI Sean ere televsiitemieinie ciel cioteteese ate
Sambucus Nigra Var.
Sambucus Racemosa
Viburnum Lantana ..
Viburnum Lentago ..
Viburnum Opulus
MiburniinrOpulas) Sterllis vse. .aorsee ons.
NAO NCATE) : aie eraveitire aietera a coerelotorleve
mamchocera SOrbifolia:’ . h6 eevee s sls'eb oe
EAR DIS GUS EUIUDT As. | sf 2,5 cccsors oe causa verehovern osheliete te ves
(CHIE FERIIG® Cicer skepicrear hve acre re FoCIE OS ar Cio EtO
(SONNE dein IBIS LA PO EOe oO OIC OD BS Oid MID. ICED
Yea emusrAT Se Mtea: Hei c olin hae y aie aroienete a raraseve
ERIDISGUSPATGCHS I 1 5.c clea sialcie ciate nie nietelota erevats
TUIDISCUSICOGLESTIS! Siiii os crete cle oro weet aieVele etane
Hibiscus Duchess de Brabrant .............
RbIiscusmbeurpureds sus sacs en . eee eno

Rhus Cotinus (hair-like flowers).. BEOO
FRAT AT ERAALEICAII evn cioie\ side weal clalelercle) ciginis erarenete
Hibiscus Boule de Mew oc. ccccccccccece
EMIDISCUSMMEODOIGIIG. 2 4...5,5.3.a0.5 eh wrn ere teletcr.
Fiipiscus PomiponVROuge) ee soso tieleicesicie cele
Tamarix Hispida Estavalis ..........-..00.
SHAM AT Ke Galli Cara hate Niel hate ch vel holel crctercherereiore
LPAI AVUXS UN ICA a ral nvorn cre crereneyerntory Me etetcleleeinhe
Tamarix Tetandra Purpurea..........e.c+0.
IBacenant Siriaas dct aiciere apni orecdeeirioicce
Cornus Alternifolia ..
Cornus Paniculata .. aroye
GORNUSECITGIn ata Pycrsteentcratelcinaleteleront ol aioieiererate
Conus Sane uinean we ae o/t ane nee aenenon
Cornus Alba Siberica .
Deutzia (in variety)
MiervillaeAmabiise Albay sclanyer cite acre 6 to
MLEnvillas Candida sw ay-rerater eee enero seis 6 to
DiSnvillaxCoOutuniermie.-) acts hep hel roe date et tenets 6 to
Hydrangea Paniculata Grand............... 6 to
Ligustrum (in the various forms)........... 6 to
Konicera “Lartarica, Alba e. 22.282 sii d..s: 6 to
Lonicera Bella Albida ....................- 6 to

wow PDNDDNDDDNDD
heh hh Ph eh eh Ph eh eb eh eh
Het emir echt ctetctet

oa

White

AWM ably Eig oS c coudceooD Bo gcd . April- AEs
NMOS ecu ecto Coon HoOoOOO DO Coble May
AWWaWeY Glo o con 9ond60 Ooomcood J April- May
PROGar ne oiercteic lari <teieishcteretaterenere Aug.-Sept.
Yellow ...... ooo0ddC aisietetone . April
Reddish Yellow | ceedooorccacacucao Ahy
Yellow adboOCO.000 July
Dark Violet Aug.-Sept.

Sky Blue
.. Lilac
Purple
Purple
ROSVar NICD] Owes crctcpetatecetateletenedchaterere April
IDE) AROSE) «ji hocuooeecadoonsad Aug.-Sept.
IDY==39) INOS een Go OOOO uO DUS DS Aug.-Sept.
DFISENROSC wenielobetensieyenererenate clots Aug.-Sept.
Carmine Pink SP vevadeleletaxterereratete tereltore July
Bis SCOR oGoACOOU OOOO NOD ON OK May
Iho es oeibo ce CIO GHC e odo.05,0 Dad Conn July
IDEbAK Sth 5 Gb oaub DOOD DOUUOOOOCO Oa July
MEUIG), doo anadocioureegoa +e... September
OOU00OD00 (OSKcehoahia \uiAobhic) pogacccbadoooduodoD dibbeve)
. .Grayish apace, hen HOdCOUdNoOUGaOdE Abia)
Anwavlies Co ooe
White
Gray-White
White
SVU Ciera ueerorsiers: Seetetayeta: eleitionee June-July
ppverevete (aver ove White
GOA cOeOoND White
ORTON, DIO White
plese Tesoro A White
Seas tavete so oke Creamy White .............. May-June
FORA E OD WRITS retire see see Lay. JUne
Scioto Pink-Wihite 2...2..0...00.0008 stay-June

Time of

Name Height Color Blooming
RanaayMaerosctachiy aenvelerieledelceletneitkeisiteiae its Buoy Chitlencogosdoss WAN aimod ood aGs 000 do00 «siete UNE
Philadelphus Lemoineii Erectus ............ OU EVaitos osocouK0 Creamy WIC -releetemtelele aieie (eile teresa June
Hpirea Chamalednritolianermcaeecreieieietere o BO) Bileonsonconns WASHES “3 ooo 0d50 iitke FobonAsocooo lubare
Splreae Mla ellitonrm 1 Seceree cient rome 6to 8 ft
Spirea Fontenayii Alba .......... abbot oooo SB 1KO) ane
SpireamWanceolataywerec eo ene 6to §£ft
Spireapuindleyanameneecennie eee 5 (Huey Gane
SplTeasOpulifoliaweriseevn cree tierra eLORtOMES) Li:

SpinearOpulitoliawAvinecamne usenet re nner 6to sft

Spineaserunitolaw. nee eee 6to 8 ft

Spinea-REEVESIU ois orto eee eee Oe on teens 6to sft

Sov IRCA WE TL soooonpsoso0000000000 » 6to 8ft

SDIKEaMSOLDILoOlia wee eee oe 6to 8 ft

yours Weel IONE Gooooodogduodacane G60 000 6to ft

Syninzea: MAlibaankarcom cmeraeeinn aes Neakavelevowes 6to Sst

Shirase, Heese, ANI, sacccecocuncooounooubne Gives (ute o.coadoone WHI Gono popmoooen ocNO Oooo April
Symineae JapOnicalecnr ere et eee non GitOmnGsntalerenerenenenens Creamy, Wihite see eens June
SVnRINeayeAllb aul Grandememymarnie minions OO. Biitoogodsso00 WAN ICOM regctecccieucrit tne OOD c April
Syninga; Mad .AN oD. Chatenalya-saeneimiiminre Gwe Lotitogsooso006 AMM PeS Spon doen e cob oc ececo : April
SyningapMadsCasimirm@eericraceceecenmen nen Biko) = Bio oooonocdn A SovhU Ree Oromo Acie OO Gb ca sc Apri
SNICKET: IMIG ILENOING Socaqooucono DO boUbE BiWwor Bitltooonsadcos WIDTES sia jes roeyecetereyeper steve once o ren emenagoRe April
Syringa Mad. Fernande Viger .............. Bw Silitoocoaod ocr ANAC eno a tigma Moo OlNId oalo-sccdn't 00 April
SyrinsasMarienweG raya eee ene (100) sto bo ooo cK NAO cu aint Roa Me roaIS Ondo 6 S50 April
Shane WabgaiTAliS Goo ocoucooccpapusoooobood GUO Wirtlasccoosccees NMIcuit eee eer at ooh 5 oelbd.50° April
MiburnumpAcerifolimm@permrennicneiierinnte Gio Bithoeooadgeac WIRTES Sratne id oi aie bateeien eee eee May
Valbiurn ume) enitatunnmeqneiey enna nerereme men rehire GytOreSifie aww Wintec. einacee 2 atedeen eee eee - May
Miburnumeomentosumunmmerere erin ier rts Oi© ilkovessooone WE GdcoooonpSsooodoe A made oS . May
CydoniagJaponicarsean cnn eee eionnnine BO Mimeoooocloovon VG. Gagersiev's sysuecive aisle ere eI Eee April
IDISMWINE, JOEY IRAUME soccongooodvadgunab000 Qi@ Owes coosadcss Grimson s,s teeedee June-July
DiervillaPswloribundape meee renee BUG Bittoooso00e50 IRC io OTOL OO O-00.0 June-July
Diervillay eres Duchantreleeetee eee eee Bi® Bitwsccenoococ BARC! wooon noe DODO SuoNO7 DONE June-July
IDOE, Suskwanrgat Gaseoucvevoepaodo coobec GUO Hse acgoovsac DarlkoRediiik Acasa one . June-July
Diervillay WanSHouttebaanirac es or sci reeen GUO. Hiloaacooovos CarMines srveseustels ctoeie euteueterae June-July
Lonicera Rubra Grandiflora ............... BU@ “Bitloodsoooc0s IRGC Gano do oooODDNOUZ DUST HOaSS ... June
Ralls}: Cromolonm@iebmutan sooascoancboongueuno+06 BtO- J Wocensodooa Orange dRed’ hkin eaten eb oboe May
IRM SENN boo II GoonogconaccouncuoS 63tOne Soltis case aes CrimSsons 3. eis sick anys ee ee eee May
SyvringayRubravdes Manrleya seen einen Oi@. Sioocnodocad Wi OleGtuRed: 2 oie Stem ae ee c April
Synineasludiwilspaechennee nici ieee: Quwey Shine co ao ol. os0.0 Dark “Red nie nek cee eee . April
Ipdaeels WWII: cocaconouubuead nosvoonde BWW Bitlbooocsccsdc VOMOW. Risse’ ie eles oiieusheiareimietcren aeons May
Cornuse Mas. cacao ee ine eietersionene aoe ire Baw Pasthoo so olcoo se ViGLlOW i siuse, deehisvercierons tee oat herent ere April
WOLSythian GDeVaAnTile ty) perce eeit eee GUO) Giese cssacsnc "YOM OW? 3icre Soar d Cocke ote esc neon April
TTAMAME)IS: <heijcteucesvssspemeretebenexcreneueheretevebarienensieen Gil Hits ooocacsos WellOw:s ..2 ss pasreva miei eneee October
RibesPAuUneumi ss s/s,.\s perekerseiole ev ieerciaiea ohare Qw® Biitrsoogosccos MeHWOW vs iosc7etaedale tr erenee ete Cee eneee May
Callycalnthus Ais shes negersieietes tones nei tice rccantonereieion: BuO Borbooodonon os IPUPDIe? can cre Ree er eae eae June
Dierwillawavielleiv ye ey acveis crereve reuse ceretoreteneiteae QW. Vitwasoacocaas Reddish’ Purplewnescieieeee nee July
EMIS! TICOMUIMOE) 6 oo506 S00002000000008 BitO. Sits oosacccow IOS IEWNAMIE, oo Saeo5cs0ncc08 Aug.-Sept.
SyringacMulearis Sas ayeaveaseveiisie eee eenen eae Gino Sibooe ono ooo Purples oi ono. ete eee eee ee April
Syringe ay WillOSacishsesrversien casera ee ee ree GitOur Satine iain Purple shaded to’ Whites...) May
SyminiearVOSeK Ga. i se eee le ee ae eee 6stornSuktenneeoe Purple ince ie slates ele tee June
Syringa Alphonse hawvellei nian avere BIO Bitlioonrocoosoo TNE OR mnie ONTO A o.O nO CO OD AO oo April
Sipuage, Cinmeiss Of cadocusdvoaneogooconced Gio MIs cos ocons.c ROSY Purple) : oe stent eee April
Syninea@olmaricnisismen eee eines Giwoy Byweob:6'6s b’ao'o. Pale @Blues ini: paar eaten Aprii
Syringa La Tour d’Auvergne .....-...-.0.. BUO.iwhoooosscc00 NAC Saniearreo moans cou Ob obo. e655 April
Synincanliemoinest plein ene neiier GStO Slane Carmine Violet seni April
Syiachayeeh JUGonn SrhaMWor shoqobuddoduos000 000 a OO) (Msiltooodacocns LSS ELS) Oemine eI AREA DG UO GO. nO UiciO 9.0.0 bo April
SvininSa ela Mare Kees eve oslo eehetaee Oe heels SB Bib oroc-o 60 on0.6 ROSY Wilac’ lure eye eae eaeeae ie eee April
Syringa Mad. M. de Dombasle ..:.......... Gitous SitiGercn-ceremerercle Carmine Wiolet 2) career April
Syringa-MichaelsBuchnercye cits: eich cneieteteneierens Qiier BitBsocaaocecs TAC ein er eceo mentee Ore ae . April
Syringa Pres. Carnot ...... Sufi teearcmenctrcrten Light: Gila: 2; oo i2s.8. eines Cerone April
SVTINGamiPresi Gren Vary valesecencietediehe toronto QA arisetien ers see Rosy DOCK eerie He io aod 0.5010 3 April
Syringa Rubella Plena Skt terctoewecres Alo) 2) Geer RI OIPEC RC Oro Coan tS <> May
WiniGs< AGUS CRISIS poGaco006060 Sao 0 0.0.0.0.00 Purple Aug.-Sept.
DienwillayAibels Carnieneier aiesicneere ius teense BE® Bioocaooo00c Rose Pink . June-July
IDNSAcHe,, Chit saocnscundsumuccsocuuosa Gio Bilkoosocasaan Flesh Pink June-July
IDNGTARNEY, IDES QVM Gonoodoo dco OnHo DD UMn OOOO BU@ GHiitecocaccoo IDV) ARKO. Gaocopoooooo oc co NG June-July
IDI MAINS Ghenady occoagooncusoocop0G0DGG @ioy Bitvoooaaoaone INESIo IETS Sh oeGooaaGacCObD DDO June-July
Diervilla) Gustav, Mallet 2.2... h.esesameee es @ Wo Biwtesoosdgesoon Deep Bink Wh Miadere ere dune-July
Diervilla Rosea Kosteriana ................ GUY Sitibo goo bau Iie Sosaocodvcoocoon IG CDA AS June-July
IDI WENOSE, SooncboonDOodoDDDDDOOe DONS 6to 8 ft June-July
IDTEANAMIEY Wee MEhiONG! poo ooagoonodDDDOODDN.S 6to sft June-July
ISMoylOMe Wee WL NesonocooovebobcanbDogo0On 6to sft Aug.-Sept.
MeSnedezamBiColormemntie veri rerdcnarhneislchere meee 6to 8 ft . September
boys WCRONAbl: RaaocnoaccnnosccDo0d00Es 6 tOy 7B ihtine ames eswte tI: 2 o.e) -sevleushonene ater dentin ioiseake mance cae May
ILO MICE INGE Goopcoaooadvos0000GD00NN0 (PM Ksieg BOARS Hl smodGaneodoMUaeoo Ud S feo o Sorc June
IDO MKEEY IRGIOIKOUEVIE, Go ooo0Gs5000000000000 Geto. (Su Ae ie, Sn, oo elie cerevewe ue cecal eele en ee June
Rohinia WHisnida Shae storeneveneis se OSC -y-lchnilereielelenckonelelo peices Negsren taiamerene June
Spineaw aul lalr dimer terete cvoneksy al tenner Renee Sih tarrmeieieeerciene ROS 6 i neice sche else cedagnltonenmenetore Mid-Summer
Snirea Collossa Sane aekegeene LEAD A Sere MCC OAL Oc oo one © July
Spirea Douglassi Chiba bo Bescon HROS GMa verevercunce pede eieh oper etai ie nent June-July
Snirea Fontenavii Rosea ...........+e-+0es GUO Hiesooaaco0s06 TROSGi25 ca iste one wiete nets tan caterer Summer
Sonne) SEINGWONWE ocsoaccp0coegyO0UUDCUODDOD Pwo “Dilesoooaosaos IRORE soangoodacac

Sapna Ikan) Ganson ocaonaacoddoun Gxt Sets Aare meevorere IRM Geo oa boosgonenons ses

Svrinea Rhotomagensis Rubra ......-...... wo) Giles oconoo00s INOS eo son08 50

SyninzapinecllekdemNamcynnmes saree iirers: 16.tOr Biktiec. aa soe les SEG eile Goooondacan vcs
SyminicabovenmiWereleereceriacecickernentennelen tare GillomsSaftiererneyteacmast EFM leAhaic Sagoono doo Ob Oooo ooo
SVAPIMZE), Tina! Oa voagsooccdcvo0cgo D005 (Haver as) Ie sa So reas IPM 1PAlinis: 5a a Gooobeonuces

Shenae IDEM ooooooucuodgnuodco00000 GilOmeGiite ween Miolet {Binks thier oo tase ene
SNAMINEEL UAOWHG IRIGIUAE po Gaooddood0aunDDD Ue ON B® Bile sccodaooe NSO AINE Soococooynsccnoguace

JANVAIGEN IELOIMUKE GoaBooooondonooDadD0GONoO DODD Sito OiiWoancdoaoes Various colors

Joo) PME Soo ooooD KOCH OOOH na0D0000 Bio) Giron ooonc00 MVM soscooudgoowuroe nse

AVENE, IESE W ME, po aoc sabe ancocs oo 00DGDD Sitom Gift nercreenerner Gray Wihite yy: sci-ttstereietekaeesieteier eee July

NURSERY, MO.

Time of
Name Height Color Blooming
GLSATI OMENS Na teieicreValaieleleleka elelelatlaeroyeretene Moceraiels he OVLOMNO, be . White
GAO ALAM EN US ee, a olercarccclanetelatetetateral beketebale. af clare 8to 6 ft White
KOTEEDIT le vetan lolelelelefereiciaisis ST OGOOUD DOCH OOOO 8to 6ft White
OLMUG MS OLICCE eral cletcleleisicicietain ajeleielt ela Ne MOICOHIG Lhe Gray-White
PICEA OKO 2), ejalelelaicioveleteiaiele.s cleisielelerelsie 8to 6 ft White
hiydraneea ArboreScens “silos cp ercieswisiele slelp 6to &ft SUVALIE Clete martcickensusteneteditelelcefctereisis June-July
Hydrangea Quercifolia ......... Os Mal ae Seem oncom arnt PAU TSTIAVVUINTL Obeevciteisis) clicie enstcl sy vverere August
MHESMVOLEITICAN cc ec cleielersiciclnielel sieve Scte-OuUd HOOMBE 3to 6ft VAIO Merri eierteiiictcleil cielsi-ress ob oto June
AS POI II OLICINAlISivavratelviercvarcielaistviviolelelotels} ene 8to éft \WWsihtGs Sooaccacoooehoond0ObOOMCOoo June
IPPiTOE! SG sca Atos On 4.0 UD OOOODOC OOD Ace O 8to 6ft VMINl(e%5%5 60 G06 00000 URC OODO M00 0 On June
FONT See OM GULL COlmrejarelefere yal crekaielelnisiaverdisve) elele els als 8to 6ft WHihiG acoownoot%obboas0o00oMaGouD Fall
Spirea Multiflora Arguta ...-....,.2.-e+00. 8to 6ft Woe oo Qo oHoopOODDoOCONnOuUbOUOOUS April
SplireamThunberzitier fico. aieiasecceee WMG 5 Sagoccooded OD Mod O00. O00 April
Stephanandra Flexuosa WIHliGy Sogou enowonbcooodobnOooOOD April
VP ZEUL CAL VLOLMI Sis ceavcue avoia wielorcls ure oPU ATM aie s ate Met afeie ne IRAE! ooti0 0.500.6.6 6 OO OO UD Os0 ONOCnC Oto 0d May
PUA LD SMES OTE erate) oveiat oils, crevetel sy eilei ever clairars cree! aie Betoun GuuGrrerreerecetic Omimnsoin conccansqconoenandces0 obo May
Buddleia Lindleyana ..........eeceesceeees SetomGnucorrereretererers PUI PLIST ELC Cle ereisichereistelsielelsieis Sseptembe
MOI CELAMMEGADOUMI ei aia¥- cralereioteielersivie ievene covet elec Sie) 9 Us coaodcaG INCC! SonanoocKD GOTO GDDD000N 5000-000 May
Mpneds COlOSSAN EP MOCHCIIO. -fanicte sistarcdeiensioloberelece « Bye (SM eG 5 Oo AS IVA OLEERECC Oercrerem a nicieteletsiniocnoioreteetereiens May
AVZALC Am LOUIS ete eter talc crerctctelstelate vere letelelreretete ters BPUGY GAG Goa OW Go de WACK ooncaobOeooOGOOCUCUOOOODO ALS May
ISAC a GB OC ACO 6 COICO OMINOOeE ah, BuO) Cats oda davsen WMO schoo Oc ito Otc HC O0O.00 0 doo UCD May
En DEMIS INE ALGIISIS in vatcleere nic cisins wiclercleleberevals BOs Guts ere eer NEMO aetro OOOO DIO OS DLUOD OO OOOO May
WOON ARIES eretstelelcte ters ichersietols’cleencke eterelars Reo). (itis sig omidaoe WMO cooovdDonDODGAaoDOOODCUenGOS May
Lee NLL SONNE RIVESiveretcveinioncieretetetatetars/e tame everevelcts SiLOmGrlisecrien ieee MGA a06 OOOO BOO ACODUCC OO oCODO May
Hypericeum Moserianum ..........s+e+cere By COMmOnuby ce teteleretene. Yaa 8 Golo elo o poe biromox0 Oe Casa June
Eerniano AVOMICA lb plete tciciele fesolerotaiotecleleleie teberees Bie) Dri swaoocotos iG OW aeepacloteiers Veh cscletereins .. Ali Summer
May nilEr Iq hikes AngoooucopoonudcoleonEace RO) Gites coo ooo.o00 WONOW oaooAodoendnocoud .... July-Aug.
RM SCL AMIE Sa ocaoonanD0< CODD DOD NOOO GOO BrcOmOmtemntervieretan Greenish Yellow ..--:......... August
LENGE! WITS. Ca accdbedcocobopsCuEenooeonDod Bue Gilby ca dao coud Purple, Lilac and Jiavender......... May
LVANIGE! THONLCE SS one AOC e DO O06 ON Deco OF Bo) Bites saoonddo6 Purple, Lilac and lLavender......... May
Reqd VEY (OYe AEA HVET: 4 ero cate Cae D OER DOD BO aio Bey Is 6 G0 daw 6 ROCA IWAN 546 S60 so caoodooodoudoS May
INV Sa Savile ROSCA) vatciel ess ereiefalelorsicnes siete BuLOMGEN Urey ereeleneee rs eth. noosadaooocoduMMoDoOOUGGOCDO May
AV ALGAE OMIS metesic craeiseicratclcie ciersisletelotehelatevere cl BreOmGihitheterarverercverete PHO Como ndooeCoCODOUOCOOUOOOD OnE May
Diervilla Rosea Nana Variegata............+. Sie). Bitbssoanciotoo WMATLEL alam binikaeercrrictdetelshotelerer June-July
SHIN PENAL Melts re iatecerctn craleressererece efarshecclavs Bio) ltigpadeoes] 6 ISOS EcoooceanoooNobuboL . Mid-Summer
Symphoricarpus RaceMosus .........+++e0e% BuO) HS se Goan once EVOSGartercyetererstvetsieleneteteheretetokersreits June-July
Symphoricanpus, MulZariS) .). ices oe os vee Bio “Ques gaoadao00 GEE) cHovaooonos0uU O85 HoGGGK0 vee. May;
DEAD Crone) bebo ak ocou DhOODD mA OnoOoe ORG) BIR e Ao OB Ob.66 WWE. Gogoncoomnannouenn OO neDan oo May
Shute: (C@UPESED METS 5g ooo Ab CB ODaCOCOOG Die Brite sooooooue Wate oosoctectoobnosyoooDOebOODS May
BEG HeMIS MM DOLL c. i clcictesld erelarel oie cicle etesarons DATOS Lblederoveresererenens SViCLO WETS ierciere chard colhcl taken ones avecenaenne May
CWaAMVODUeNI Same chetsvekeral shaven cer sterercrcrenel Sokeseterecetee.s ORE ORS Dt rctetolereicoie.s Shay Veieroo Gu binaor o nad -..- Aug.-Sept.
Desmodium Penduliflorum .... ............ Vio) BUSS oon00000 Iola Iebalis GanoocaoouuauD 000K September
SPILCA WAM UMON VA VVLLCRED eis cielnis cleicleieietee ciate ABEOMOtL Uy svstatsvercrerete: (Gr NS OA GacgadoadOeKncson sb 0 All Summer
. SHRUBS WITH COLORED FOLIAGE
Arranged According to Height at Maturity Golowet
Name Height Foliage
Eleagnus Angustifolia MORE OM ili trueyersweos ueconekeexskereteotevelcklleteseRenakch deren oie Purple
MLEASNUSMALSENUCA Gr teres tetectecinclarclloistesionnel: GUID ite osoasedecoo cuOO roo OUCECOb aHdGUD Silvery
IsliGE: UMMOIMME! “Cooncmon Oooo DO ODE DOODO Ro OGOObUUnO OOD AGU SHES we Soa olo OM DEp o con DadiC lodedcs Red in Fall
Rhuseovp hina ewiacinia tae se ver cicero eve cievern sieersnteoe a6 SiO UD iNis os coc baoudonodood Dono ood Searlet in Fall
IOAN ENE “See GkOsGORAAAO OOD DONO DoRECA oo OOS SUOUD WE 6 oonacboocK One bo00000000 Searlet in Fall
Sambucus Nigra VarevVariGLated! a). irises cicheieieleete rere Jie) SIPS choi mio oiend pat cileiccio White and Green
Sambucus eNisra svar AUneale ences ches ce eke a tin. SiG As Od Pint O DATO CIID OOOO Coola OmaaS Yellow
COLnuUS Mle SAantissinia wens cunavereiessreceied vel wen Oreteveueaeareie aves Gtoy “Mitts ao¢oeoaco0oonee *+,,,.. Variegated White
COrnus) -SPACUMIIM aie are tare crerepeverecnt con uve ovens shore eerie Gat Ore Sauven-pepieee sieletenorelalerereparoveneree Variegated Yellow
CoryluszAvel MAtroOpUNPUT CAI urcvers siolele ce. vrslsvele crave rele ols (HO) “ENE Go ooo noob OUND CO FON NOG OD Se en DLE
Diervilla Rosea Kosteriana Fol. Var..............0+2> (Fixe) GitessGoance pucUo OD COoD OOD Yellow and Green
TSE han thea) V eighth Cher COekO OIE CCE Oe A En a en (Siow ECE Anite oe ORO Geo mod ODOC Bright in Fall
EI DISGuS Warn MMPI e csc riscersislaeoisvorniecsioe arte foe sume sis Gun Oaitey sneer lord not cleraptens Fone be ... Variegated
TITS CHEN ich Hore coolou U OOO COME OOD OPC ODI tO ODO O or mee OptOun Sibitererterscvaserenedshetetecsvetote) «jes lovetetertie Red in Fall
RhuskiGlabrayipa cirietan rarer. setsaiclelaavetoeistencisisvevee layers tie. ClO) site ddoantocésgodoo0d s000nen0uO0O Red in Fall
SpineaROnulitolawAtineaws wetter on er siven nie ene. Bie sis ooootacboocascsooecovsacoccu0NC Yellow
Berbens (Purpured soe ls croc ciakiescule ete Percocet aaa abok rine. BELO nm ObLtrccmecteietolote te ecattaroneronala Weiser ieee en eiaremeiets Purple
Diervilla, Rosea Nama Varies cs ciem wereidiccsiexsteseateoss os BO) Birtley sodecdsoodd ogo oaoos White and Green
Bleagnus Longipes Gi teir a iealarcrcvaittemixomaretad horsketererer enters Silvery
Euonymus Alatus Be 6 ft .. Red in Fall
IRE, VOCE Gaogoood ODOD OU AOD ou DOUb OND CDH OONODE 6 6 ft .. Red in Fall
MUS COVA IMAL yemte ceressscel he eteorerie ricci: Din Oca 6 ft .. Red in Fall
Stephanandra Flexuosa ..... eae e iol el ot overeielere/ccelerarataleressirs But OMA OPEL er rtaioncrevetakatecoletercPolateveleheleceme nts Purple in Falt
SEIT a ADOUIGABMOLLIS VED iy wireverenueyerer olen bene roneeie tele DAD) Hila S66 OO MAOOODOO Ao UO0gD WO DOOod Variegated
Ehiladelphusmiollis!Anneisieytane treme ieee nee WAKO) BM coo coUDDOOUCOOODUCOUDUG DOO NCO 0 Golden
SHRUBS WITH CUT OR LANCEOLATED FOLIAGE
Rhus Glabra Laciniata ............ Piclen mL OnLOlGetts SambucussNieraVary Lacs cette <isisicece 8 to 12 ft.
' SHRUBS FOR SHADY LOCATIONS
Arranged According to Height at Maturity
_ Name 0 Height Name Height
Miburnum) entaso) <2 6.0. .....-. Stade ot 8 to 12 ft CormuspSaMeiin Gamera. svc aeireetere sierienas 6to 2 ft.
LBMNOVE! WEIN, oo ducoodoncocuunoooue 6to 8 ft. CommusPAl bar sibenicannenmemnnteiiecis sere 6to $3 ft.
‘Berberis Elegantissima ....... Meets AOLLON Sete. Cornissstolonitenay) iyi enone atciicc cities: 6to 8 ft.

37

MAOdspydoueh (Ghat VENA) Goo55cuc0cg00dD00 6tc sft OMe ogo POO ODEO OObe sup ODOGOD 3to € ft.
WISUStLUM (IN VaTIely) ue cicero cenit 6to sft Deutzia Hybrida Lemoinii.............. 8to 6 ft.
Ribes Sanguineum fl. pl. .............--. 6to 8 ft. ElypericumelViosenianUim: epee cnet 3to 6 ft.
Viburnum Acerifolium ................. 6to 6 ft Hydrangea Arborescens ........: ...+.- 8to 6 ft.
MiburnumeDentatumyr ict cicrciiereae -... 6 to Sift TUNIS PAROmMaALIGay eis s cies) clomienetereieieteietere 8to $ ft.
Wiburnum)Tomentosumecmascnicccm nee Gto 8 ft. RibUusKOdoratuswen a aieeeereeeee ORO 8to 46 ft.
A ZALeaIMIOILIS Betasansrna cre oucearciome rete ter 8to 6 ft. Symphoricarpus Racemosus ............ 3to 6ft_
AZ ALCAMPRONCICAM EIA erento icnenereree 3to 6 ft. Symphoricarpus Vulgaris .......... vee Sues She:
BerberiseNepalensism pice sient 8to 6 ft. BerberisieEnunbereila.. oo. «\ceuieteeietrceenee 2to 3ft
Ceanonthus Americanus .....-......-.. 3to 6 ft. IDYuAe), (Enz WIERS Gonbdcaonansoocoeoocn Qto: ‘Bete

SHRUBS WITH BERRIES IN FALL AND WINTER
Arranged According to Height at Maturity

Name Height
Euonymus Americanus 8 to 12 ft
Huonymus Furopaeus Sittodwshtae

Eleagnus Angustifolia 12 to 15 ft Yellow (Summer)
Riusehyphinawuaciniadtame syste irete ak ater ie nearer ne aus, RO EO SLLD ML nleatenemnns Wevetaueneoiate nate loka onnmeneers Scarlet Fruit
TRO AGI NADP MENTE “Se digo ne cooeouoondgonodaddcoboSNonDO SCONE Lt alae create ctciaieleneis loneiotenens . Seariet Fruit
SambucuseNionas cicero terete ictalreraieaenereer S) COCLDNG. Bictcaepers teispavevelic fa eveiale ce levelieetare emits . Black
Shan orn Onny IRE SNMOSE) Gancugononenenootooncanooons 6 Soe (& COMUZETOSE yyravevereues woeietaveva ieuetie levetetel seks teh eRe ee mee nee Rec
WMibunnumemantamn aparece ceatenerercteteticieteraeleloreneicrenraier: 8 COULD iEG Wrcpartepacedeseiaiielels elereleversue whe eteueee Dark Purple
AM oybarayoion Oye saadoosossno0ogcd00p0-o0o000000aGN005 8 -EOWUD ELE Weacrerertresccsneronoieresenewe ie kovekeis Gavoie ieee poor xe
BerperismviUleariSkeerwarcieweiteienreneiene tere ionsaaciN arene core enetencitellelene GAO) Gites eo ocoupeoooenoooDDOsO NAO S BOOS C4 . Red
Cornus Circinataeanmece ear DOG pao soW.cKOUO oe BOON S (Molar pena mami Aono ROE rune Sa Ga Gana ce Blue
CONIA AULI ee oe soope sno DolOLo oOo OUsOCC AOD OD DOD OS (Gikow Gsile on doa Goo De OOOD MO GOO Or O00000ND000 Searlet
Cornus Sanculneaee emitter oeriine i ier terer ete ieiereyeierene BU Bieocoosssoce hair. Veuesiclelte Reopens hee eon Ronen White
Ohya Ao. SIs Goecoc0nna00500d c00 000000050000 GUO, Gis osesoscos Wecggdaudooa: SR Be Yohite
Mtexqvier.ticillatalrs-reietereenenee teas FOoSenoAdodommoeoe ood 6: CO: SHE Ceeeateeaiewavencusteactae ccpete lou let rsnceetestee ke heim tee Rec
IDSA: AIDEN ooops codopoccngpodo0DO Ona nODOD REALS ECO TUIO CG AOS GO GOR Ea Ba OOH bteg a Black
MISUSE BUD OLAP rei cre roi ie ner enn ienen erence GTO eBtEee Raa acre eine oo Oe ae Blue Black
MILUSCHUMe CSS MANN sapiens Geko eusnene ee diced elena snoiatete (Powe layer AOA SPOS of Clo Sac. Black
iOS Hobo SINS IW, cosanconouanoonbbaGDeDonON GEO) SB Tcchccccecepenesctos al oat) CCRC IIE Rete Black
Lonicera Bella Albida ime ain acs OOO BOO OOS C006 wc jeyara se Rece
TONICeraAwMOLEO Wile erections eretete SoH src leteie revel lah oterorereterotelerel vere rerarntene Neeaeti .. Red
Rhus Glabra Laciniata BePb se Soe ane eye seale tea neheevoeeoeene meebene Searlet Fruit
Viburnum Acerifolium SEE Secreta gis g raters ee ORE eo eet idee aeks
Viburnum Dentatum Bi Bt soi sinctie sasereerreusualie we ieuake te sale tle oe nee eee Black
IBA NSS) WUIEENRIS: Gono oc oaubooU oO DOO OOOO ROD OOU GON Osienincamce sodamaces oO Oso 00d s5 50 . Violet
GOrLMUSPS CLICCA ere Rhee iencn Men RoR ner=n l= Milton boa Ho oOOOOooooUAnOr So so G0 anaes Black
DICE SMOG ILMONEMOIS GoocodsoocopooFccocoOADUOOONDe DON f peter iae ae Red
IDOermoanvg INENWES coodcndodocobonKD dO OnOOHdCOOUGOONN MUP O OT OS oe Tito pod oe ooo Oat MMeuE
oni CeramUcde DOME rire iene deesiareyclcrenetsveaciere hele [ oicrote. 8 oe Red
Woah Ih MAO MUNN, oacoococunDDbOnDODoQODoaSCO0D BO Bills oooscaboocconbooN OND NOSSO sob eee Red
IEwaningIe (CRYBVENAMOAUS Goonancogo0oc0cocbo00C00NSS mete Dette eleewieens 50 Black
elon) INOMMENICE do goaeotonoD OCS ODOUOCDOD ODDO DDOGODO . oo Scarlet Fruit
IBIAS. Choline cacceonoobooooonoobOn OKO SNODDUDOSOOD mc Searlet_Fruit
Sym phoricarpus RaAGeMOSUS <0 We cie cin > «eerie mieiel lel = = B tO) (Gib Rss s eisaene wiclcl ecole OEE Ieee . White
SumphoricaryuUs MV Saris cus cre erecuerenetele teteteneneverelclonsfere BW) QilooneconscosssoaomsgoA wasn geoocnece Red
BeLperisUM UND Srellan emia teem ievee even ietereicneneleieneieacionaietens DOS BE ea es ev ere. : Slace state ane ee Red
SHRUBS WITH COLORED BARK IN WINTER
Arranged According to Height at Maturity
Color of
Name Height Bark
HMleaenuSeAMNe iS biloliatencnachevsiensehcsletelotserelencletens hel Teie l= lellets bE en a 8 Ge een oy cree SG ARS S Silvery
IDES INEM oo Ooo C KOO OOOO dD oODDOUOuORUOOL OO Ghitowuiton sasomdooar OOOO DO oUedoon laos: Silvery”
Cornusmoansuineawe ict teierdlccliereienetie tetetelenereret Me fe MOM ORG Limeyenettenaiecctahehe eerie SUES Coenen _.. Deep Red
Chrnne JNleny SMEG saacobonesanscDe doe 2aG000g0050 ....-. Brilliant Red
Cornus Alba Hlegantissima 66 : o0 2 Red
Cornus Stolonifera Var. Flaviramea.......... street § 0 [0000 pote walet, DELO
Corsi Sackees). cscnawsanc0soddoon0cceaaoDO bdo GNooogCN Purple
INES ICME oocbonsocc0 oD bOD DOCU CoNSOUCONNNN 6 ... Reddish Brown
NIG VAIS PALA CUS espe tel tenetel olor csoieiel oielekel-eveloleotl-Rellsietetel leks Biidoael jo ude Ain ae aa a HO Od 4h Odi ol = Core Bark
I<eraoey, deyoovaukee) IM, Il soo5ooncosbodo0GD Od UONN A aeepe 8 LOy -: Oud tinge tate aa eee Sue ay setae F oleic oats SELECT:
SHRUBS WITH SPINES OR THORNS
Arranged According to Height at Maturity
Name Height Name Height.
Berberis Elegartissima ....... Dickies es OutOpeante Berneriss NGCDQIEHSIS meee ieeteeivelel ler nelensnetats 3 lo 6 it.
Berberis Vulgaris ............. eee eee OMT ORE C: Berberis Vulgaris Var. Eas a eileen 3 to G fit.
Arahaeeentaphivillamnicms-eeiek tain a arene 3 1o 6 ft. Berberis Thunbergii ........ ROE ea: cay 2 to 3 fit.
SHRUBS SUITABLE FOR HEDGING
BERBERIS—In the five different forms. LIGUSTRUM—In all the different varieties.
is ne different varieties. TAMARIDD different varieties.

38

WEBER & SONS NURSERY “

GX tes NURSERY, MO. CO,-

DECIDUOUS SHRUBS

Once carefully planted in suitable positions, they increase in size and beauty from year to year, and
require but little care. The time of bloom of the different sorts extends nearly over the whole season.

Our collection of Hardy Shrubs is one of the finest and most complete in the West. To parties
desiring to lay out new grounds, or to fil out missing sorts, we would kindly ask correspondence, or,
better, an inspection of our stock, which we will be pleased to show at all times.

To make it easier for planters to select shrubs for particular purposes, we have adopted letters to
denote the average height to which the various shrubs grow at maturity:

T—Denotes shrubs that grow 12 to 15 feet high.

L—Denotes shrubs that grow §& to 12 feet high.

M—Denotes shrubs that grow 6 to §8 feet high.

S—Denotes shrubs that grow 3 to 6 feet high.

D—Denotes shrubs that grow 2 to 8 feet high.

We frequently have larger shrubs than quoted in this list on which we will be pleased to quote
prices. Send us list and grades desired, for quotations.

i A. Pontica (Ghent) S—Flower in great profusion

AMORPHA. False Indigo in spring, literally covering twig and branch; the

A. Fruticosa. T—A large, spreading bush with colors range from white to deep crimson. Should

pinnate leaves and slender spikes of deep purple be treated same as Rhododendrons, and in this lat-
flowers, which bloom in June after most of the itude are improved by giving slight protection.

spring-flowering shrubs are over. Spring delivery only, 15 to 24 in........Each $1.25
Each Perit Per100 Azalea Amoena—See Evergreen Shrubs.
PLOY G) LOy re rascar rune tae ecohe s 30.45 $4.00 $35.00

ac Ie.s npr Ota ange g 2G a ea BACCHARIS. Groundsel Tree
giy Css opeceen ney Wile ele aaa B. Halimifolia. M—A pretty shrub with dark
AMYGDALUS. Almond green foliage; especially attractive in autumn, with

i its fluffy white seed pods.

See Prunus under Deciduous Shrubs. Each Perl0 Per100
= 3 COMMU tenenereraieve cketaistateter el cle $0. 35, $3.00 $25.00
Ke Ms odagaacoddaGs HOU 8} 2.50 20.00

2
We UO) 4 IRS sion DG aOOO OO OOOO 25 2.00 16.00

BERBERIS. Barberry

B. lIlicifolia (Holly-leaved Barberry) S—Resem-
bles a Mahonia in appearance. The attractive,
glossy, dark green, prickly foliage remains on well
into the winter.

DELOm cumliteatsrche level hatekererenscercns Each $0.60 Per10 $5.50

B. Elegantissima. M—A strong growing sort,
with large green leaves and with long, stiff spines;
quite ornamental.

BOMCONS Cmte PLACES ere eperenelers Fach $0.50 Per 10 $4.50
ZAT TOMS OMAN LATIUS erie aneeiere Nach .40 Perl10 3.50
WS to, 24 int splants sc... <= Hach .30 Perl0 2.50

B. Nepalensis (Nepaulese) S—Flowers yellow;
leaves 1 to 2 feet long; leaflets five to nine pairs,
with five to ten spiny teeth on each side. A very
handsome species.

2 iO) BW tit, WIENS. -ooo0od Tach $0.50 Per 10 $4.56
TSMCOMe Ae OLaTCSererrer ere Each .40 Period 3.50

B. Thunbergii. D—From Japan. A very pretty
species of dwart habit, small foliage, changing to
a beautiful coppery red in autumn. Valuable as an

ornamental hedge.
Bach Perl0 Peri100

Us ANabelonoakatomaaecouuas $0.40 $3.50 $30.00
ao) OL ESh eS en er see ericowes .30 2.50 20.00
POMC OL SRT Regie, srt aa ee 125 2.06 15.00

B. Vulgaris Var. Purpurea (Purple Leaved) S—A
fine shrub, growing three to five feet high, with
violet purple foliage and fruit; blossoms and fruit
; s : beautiful; very effective in groups, hedges or plant-

. = ed by itself
Calycanthus (Carolina Allspice) Fach Peril0 Per 100

: o° ectoseettt. oat epee $0.85 $3.00 $25.00
ARALIA. Angelica Tree O° Atoy Bt Elem eto coum 30. °2/80 20.00
Tig WoLOetes bac ae te van eee 25 2.00 15.00

A. Pentaphyla. S—A shrub with long, slender
branches and few spines. Fine for rocky slopes;
foliage bright green and shiny. Flowers green in
long umbels.

B. Vulgaris (Green Leaved) M—A handsome, de-
ciduous shrub; flowers yellow, berries dark red. Of
upright growth, with light green foliage.

Fach Peri0 Per 100 Hach Peri0 Per 100

FSIME Ora eeQiie eh hs os kota opchene rotate ro $0.85 $3.00 $25.00 3 EORANE Daystar ace rtvaresetetenccencisrere $0.35 $3.00 $25.00

MUON HOun Libis snevavatscemtce wie eit ceekaea's .30 2.50 20.00 2 LOTR) Ai oer Un emice S oie ite lann erty 3 2.50 20.00

See also Deciduous Trees. 135 Hi) ig oaesoosoaonneooos 25 2.09 15.00

AZALEA BUDDLELA

A. Mollis. S—A splendid, hardy species from B. Lindleyana. S, hairy;

Japan, and one of the most valuable flowering disposed in Ane eS racemose ane Fsententner:

plants. Flowers large and showy, yellow and dif- leaves ovate, shortly petiolate, serrate; branches
ferent shades of red, in trusses. angular, glabrous. Will sometimes freeze back.

Spring delivery only, 18 to 24 in........ Mach $1.25 OM ay Ri th Nhl egalbeh eis Ses eels Each $0.25 Per10 $3.00
39

Wade

oy

Deutzia Crenata

CALYCANTHUS. Carolina Allspice

C. Floridus. M—A well-known native bush,
bearing very double; purple, fragrant flowers.

Wach Perio Per 100

F Wortlants SaodouobdaosUDOdD ab $0.40 $3.50 $30.00

Wt) Pallas sonouomODoOOUO aU OO 35 3.00 25.00

1S} oy OE hh Sonat ooocemooGD sO 30 2.56 18.00
CARAGANA. Pea Shrub

C. Arborescens. I.—Flowers yellow in May;

leaves with two pairs of leaflets; petiole furnished
with a short spine at the apex.

Each Peri19 Per 100
SutOusettrervarrepuerer ror ietenemerens $0.35 $3.00 $25.00
PY MOBS tae CaSO O:010 CHO OIDIGO ULES .50 2.50 20.00

CARYOPTERIS

C. Mastacanthus (Blue Spiraea) D—A handsome,
hardy perennial plant recently introduced from
China. It is of a vigorous growth, producing flow-
ers in great profusion the whole length of its
branches, even young plants in smalJl pots flowering
freely. The color is of rich lavender or sky blue. A
valuable plant either for bedding or pot culture,
blooming continuously from midsummer until cut
by frost in the fall.

Fach Perl) Per 100
Ane) Ovs ie oogaosdoeas0 suo $0.30 $2.50 $20.00
Wino) BUMS aa ooo badd oadug 4 B45) 2.00 16.00

CEANOTHUS. New Jersey Tea

C. Americanus. S—A low bush, an early bloomer,
small white flowers in great profusion.

Hach Perl10 Per 100
Oe ie) 8) Hen pono oo Ce OO ROOD UOON $0.35 $3.00 $25.09
ils} 10) VCE hele Sau Godooodo0OOUS .30 2.50 20.00

CEPHALANTHUS. Button Bush

C. Occidentalis. S—A native shrub with globular
heads of white flowers in July.

Each Perl0 Per 100
G} (io) 7:83 WO meienneA aol ale.Gs0-0.0'0.0.6-0 $0.85 $3.00 $25.00
DG) 8 LUGreieono ho dood dud od 30 2.50 20.00

WEBER & SONS NURSERY
NURSERY, MO.

40

a
=
?

>

&

CLETHRA. Sweet Pepper Bush

C. Alnifolia. S—A pretty little shrub that blos-
soms freely for several weeks in summer; very fra-
grant white flowers, in slender racemes; an excel-

lent honey plant for bees. Each Peri10 Per 100
AO 8 iltscosooaascoagconds $0.35 $3.00 $25.06
als idoy VALE abel Soin op Ol DON OW OD -20 2.50 20.00:

COLUTEA. Bladder Senna

Fast growing shrub, thriving in any soil.

C. Arborescens (Tree Coluta) L—July. Foliage
compound, of a pleasing green; flowers pea-shaped,
yellow and brownish red, followed by showy, curi-
ously inflated, reddish seed pods. This is the shrub
which grows native en Mount Vesuvius, and the
last one seen in ascending to the crater.

Each Peri0 Per100
4 tO bil bac cee Dae $0.40 $3.50 $30.00
CPO? Maco ee Bi loca daioica HOOD oo) 3.00 25.06
PAK) B Hibs oo poo0GCaD as oU0DDD0S .380 2.56 20.00

CORNUS. Cornell or Dogwood

A valuable class of shrubs, with handsome varie-
gated foliage in some, ornamental bark in others,
and all with showy heads of flowers, followed by
ornamental fruits. All of easy culture in most
soils.

C. Alternifolia (Alternate-Leaved Dogwood) M—
Flowers creamy white, in large bunches, very fra-
grant; foliage large. - Distinct in habit of growth.
soaapoebaucnoboo0N Rach $0.45 Per 10 $4.00
Fach .35 Peri0 3.00

C. Circinata (Round-Leaved Dogwood) M—Flow-
ers white in flat cymes. June. Fruit light biue.
Leaves larger than in most other species.

Qe to BX Nah olga 0) | balitcteeeactere Giese Oruitie OOo chevo Do Each $0.50
Cc. Mas. (Cornelian Cherry) M—April, a small tree

or large shrub with showy, yellow flowers in early
spring, followed by deep scarlet fruit. ie

tat ae

~

(Weigelia)

Diervilla Eva Rathke

J

Euonymus Alatus (Spindle Tree)

C. Paniculata (Gray Dogwood) M—<Ash-colored
bark, leaves pointed, green above, whitish beneath;
flowers greenish-white; fruit white.

3 to 4 ft Each $0.35 Per 10 $3.00
2atouvs ett Each ..30 Peri10. 2.50

Cc. Sanguinea (Red Dogwood) M—June. Flowers
greenish white, in flat cymes, followed: by white
fruit; bark deep red and very attractive in winter.
When planted with other shrubs, the effect in win-
ter is very striking. As.a single lawn shrub it is
well adapted, owing to its low branching habit and
ornamental broad foliage. One of the best.

; gach Perl0 Per 100
UO ee imeem tarets eet: mers Ola $3.50 $25.00
mUOIE Hb Uereper OA eure nts -30 2.5") 20,00

C. Alba Var. Siberica (Siberian Red Dogwood) M
—A possible form of the Cornus Sanguinea, with
intensely colored bark of the deepest crimson. Fine.

Jach Perl0 Per100

SUTOVAGLE everctolelone ahevaias oiesctste le corkele $0.35 $3.00 $25.00
PASCO i oy ON ee cacti cit, HOE CR PHOTO 50) 2.50 20.00
Elegantissima Variegata (\Vhite

M-—Leaves white mar-

gined, turning to rose color in autumn. A fine

Bach $0.60 Per 16 $5.50
Eack .50 Per10 4.50

C. Sericea (Silky Dogwood) S— Varies in height
according to conditions, from 3 to 19 feet. Has pur-
plish branches and black fruit in winter. Flowers
in dense cymes, greenish white in early summer.

Bach Perl0 Per100
APCON Deb DIANES errs ta cael terete $9.40 $3.50 $30.00
3 to 4 ft. plants... 5 35 3.00 25.00
ANtOsseLta Planicserercaniem sie ore 20 2.50 20.00

C. Stolonifera Var. Flaviramea (Yellow- Branched
Dogwood) M—A very pretty shrub for winter color

effect, bark bright yellow. Mach Perla Per100
BS RLU 007 U5 tl PS ar em ON CONG CAGED $0.40 $2.50 $30.00
ZeCOno Lcmemerezd tpersieyeuiecckeyuss evsiths «35 3.60 25.00

= WEBER. & SONS NURSERY (2.9 —~5

NURSERY, MO.

41

CO. >

C. Stolonifera (Wild Red Dogwood) M—A native
Species, with smooth, slender branches, which are

usually red in winter. Bach Perl0 Per 100
Cite) 8A SG Gone .Ol Cee DCO S $0.35 $3.00 $25.00
Seto! Its <6 sre Che NCIC ELC Rt i COONS .30 2.50 20.00

CORONILLA. Scorpion Senna

A showy plant, succeeding hbesi in light,
drained soil.

Cc. Emerus.
deep, glossy green,
yellow flowers, conspicuously tipped with red.
choice shrub, blooming freely in May and June.
24 to 30 in ach $0.85 Per 10 $3.00

CORYLUS. Hazel or Filbert

Cc. Americana (American Flazel) M—The common
American Hazel. i

well
S—A dense, symmetrical shrub with

compound foliage and showy
A

SiON TE ae ese es Each $0.50 — Per 10 $4.50
PF «Ko U83) LSPS Coie OO ONO CLA IS Hach .40 Per 10- 3.50
C. Avellana Var. Atropurpurea (Purvle-leaved

Filbert) M—A very censpicuous shrub, with large,
dark purple leaves. Distinct and fine.

DeOMMOM UU tater er aren Bach-30.75' Peri0 $6.50
US) (io) BE She Hodes GOOD UO OD Each .60. PerJ0. 5.50
CYDONIA. Japan Quince or Fire

Bush aNe
C. Japonica. M—Flowers very abundant, bril-
liant crimson scarlet.- Fine for hedging.
- wach Peri10 Per 100
ROS eahieateraveteken cieisicnc sutushonetere 30.80 $2.50.* $20.00
LSP LOND ial ueshuehan cae 25 2.00 16.00

DESMODIUM

D. Penduliflorum. D—A low-zrowing shrub with
rose-colored flowers in September. Dies: to the
ground in winter. , :

; ‘ Each Per 10). Per 100

‘Strong clumps, 3-yr.....:... $0.45 $4.00 ~- $35.00
MLLON ES) CLIMDS 72 — Vleet eie eee 40 3.50 30.00

DEUTZIA

Showy Japanese shrubs of the’ highest ornamen-
tal merit, and adapted. to all good soils.. _Their
clean foliage, upright, dense.zrowth, free flowering
nature renders them especially valuable.

D. C. Candidissima (Double- White) = AL=— Very
pretty; pure white.

Bach Peri0Q Per 100
DSTORD ML Gey an ver -yonodsisns CMTenctonsu shear $0.35 $3 00 $25.00
.30 2.50 20.00

325) 2.00

Exocnorda Grandiflora (Pearl Bush)

Sew —— ee
Forsythia Suspensa (Golden Bell)
D. Crenata. M—The beautiful white single-

flowered species that is a mass of bloom in June.
Often preferred to the double sorts.

Hach Peri0 Per 100
CY) 1) Titn hocopoosonedods $0.35 $3.00 $25 0U
BY to) 2h Tis hoop adocooosusd el) 2.50 20.00
ho) Bi wileo an op SHO UO CO ono 2215 2.00 16.00

D. Gracilis (Dwarf) D—A low bush, three or
four feet in diameter; flowers pure white and
graceful. One of the prettiest and most popular
small shrubs. Fine for winter forcing.

Iaach Peri0 Per100
Tle} (Wey BZb 10 sag anoadoneDt $0.30 $2.50 $20.00
OA 7H), 1) WN po wo GoD OD ays) 2.00 15.00

D. Hybrida Lemoineii. S—A hybrid obtained
by Mons. Lemoine, of France, by crossing the
well-known Deutzia Gracilis with Deutzia Par-
viflora. Flowers pure white, borne on stout
branches, which are of upright growth. _ Habit
dwarf and free-flowering. A decided acquisition.

= Bach Period Per100

DB AW) Boies dotponodogves004 $0.30 $2.50 $20.00
ifs) (ko) WE anata Gono ooo OoO OU orAts) 2.00 15.00
D. C. Pride of Rochester. MA fine double
variety, rather earlier than D. Crenata. Flow-

ers pink in bud, white when fully expanded.

Fach Period Per10C
AGE: FAG alg op oo Dono DUS $0.25 $3.06 $25.00
BY no) Loe Goo bono oUODoO .20 2.50 20.00
yoy 8y ita conbacooocdnmoS 225 2.00 16.00

D. Rosea Plena (Double Pink) M-—All the
Deutzias are valuable and very profuse bloom-
ers in the sixth month. This is one of the pret-
tiest, tall-growing varieties.

Hach Perid0 Per100
ACUOULD PL Uaietereletatilsiateneren ts $0.85 $3.00 $25.00
Bie) 2 MEG eAadoondacpedD 4 .30 2.50 20.00
DEL OMoimsiiae: «ecsrere biekelicreusnenenete O15) 2.00 16.00

+ WEBER & SONS NURSERY

NURSERY, MO.

42

D. Scabra. M—A vigorous grower, with rough,
dull green foliage and clusters of showy double
white bell-shaped flowers, in June and July.

Each Peri( Per 100
4 CORDRDE A vercneianc tere sere, w esate alsNelele $0.85 $3.00 $25.00
SpbOnd Mts i revctecctevene seis ve csiisiar er etevene 30 2.50 20.00
2 ConBehtaverrsenetiteetcse toccioia wrecetene 25 2.00 16.0¢

D. C. Watereri. M—A new white variety from
England, with larger and more double flowers.
Each Period Per1i00

CRVONG) dlis 6 0.0 6 60 GO0 OG OOUT ODOC $0.35 $3.00 $25.00
SP LOLA ites. inracuetsevennnre e risierere -30 2.50 20.00
Ano) BiteoonghooadeaoogU Ue SUS 225 2.00 16.00

D. C. Wellsi. M—A strong-growing form, with

single white flowers. Hach Peri10 Per100
A tO VSIEt Aa ayitehe cess a atiesata scans $0.35 $3.00 $25.00
8) COVA UE Cr ener perenarc beucue tate lay ucooners 30 2.56 20.00
2) LOLSBEGS cnetnen asset on tekersie we ite 25 2.00 16.00
DIERVILLA. Weigelia

Beautiful shrubs that bloom in June and July.
The flowers are produced in so great profusion as
almost entirely to hide the foliage. They are very
desirable for the border or for grouping, and also
as specimen plants for the lawn. :

D. Amabilis. M—A fine pink flowering variety;
one of the best. Kach Perio Peri00
SUCOVASE Gavectapenetstieslaenenenenene tie $0.25 $3.00 $25.00
M1) Bien ocobooocooccnoDMTCcS 20 2.50 20.00

D. Amabilis Alba. M—Flower white, changing
to light blush at maturity. Strong growth.

Wach Peri0d Per 100
BON Maori h Siceekoo To Ge aabino oo C $0.35 $3.00 $25.00
9; LOSSES, aap eeceerenee pemeaene -380 2.50 20.00

M—Bright rose; a choice sort.
Each Period Per100

8 ito) Ch WES Shoo cD dcosoDoboONGS $0.35 $3.00 $25.00
A AWO) Bilbo occodoscoccUCUNSDNS 30 2.50 20.00
D. Candida. M—Of vigorous habit, flowers pure

white and produced in great profusion in June, and
continue to bloom at intervals through the summer.

Hach Perl10 Peri100
BC OUA EE Re ein cctaaconcteecteereretaicteteas $0.35 $3.00 $25.00
DONS EBS eae sevcrs temekorotocare here

-30 2.50 20.00

Hibiscus Syriacus (Rose of Sharon)

= 2—2_)) WEBER & SO

Hydrangea

D. Desboisii. M—A beautiful variety, with deep,
rose-colored flowers, resembling Rosea, but flowers
much darker. One of the best.

Bach Peri0 Per100
$3.00 $25.00
2 to's ft 2.50 29.00

D. Eva Rathke. M—A charming new Weigelia;
flowers brilliant crimson; a beautiful, distinct, clear

3 to 4 ft

shade. Each Peri10 Per100
SHtO SALES cyore serojevsletnee terete oe $0.40 $3.50 $30.00
2 CON SELES te eteratevencyote sislapele exere .35 3.00 25.00
D. Floribunda. M—A fine variety; flowers dark
red. A profuse bloomer,
Each Peri0 Per100
DS ALO? EAE stele afar aetotetaencesl + ereteee ts $0.25 $3.00 $25.00
2 .30 2.50 20.00
D. Gigantiflora. M—A fine flesh-pink variety.
2 COnS DCs ers eceeleto eer ee Each $0.35 Per 10 $3.00

D. Gustave Mallet.
good; very free flowering.

M—Flowers deep rose; habit

: Hach Perid Per100
iE 4 LOG rvareseorateel oejstetsivichors $0.40 $3.50 $30.00
ZtO. Si Les Satotetiseriueereretec 35 3.00 25.00

D. Lavallei. M—A new hybrid sort, with dark,
reddish purple flowers, that blooms more than once

during summer. Each Period Per 100
SitOVasitiy steven dieletetetareraevtece rere $0.35 $3.00 $25.00
DQ EOnS Lv arareretchatctete sre ricteie weit. .50 2.50 20.06
D. Madame Couturier. M—A fine white.
DZ CONSBLE cardparcierererateveveseie. toners Hach $0.40 Per 10 $3.50
D. President Duchartre. M—A fine red.
DRUOR SEL Ga avereratcrersierstey oy Melakersre Each $0.40 Per 10 $3.50
D. Rosea. M—One of the most popular shrubs
known. Flowers bright rose.
Each Peri0d Per100
Si COL ABEL cat ctohels{oisiotelerclere) cise ais $0.35 $3.00 $25.00
PANTIE IN BRIG oo OS Oe OOO OC OIE .380 2.50 20.00

D. Rosea Var. Kosteriana Follis Variegata (Kos-
ters Weigelia). M—Foliage beautiful, margined
with yellow; flowers pink.

3 to 4 ft Each $0.35 Per 10 $3.00

DUOL BML chaketetetaye si creimveeitiotens Hach .80 Peril10 2.50

D. Rosea Nana Variegata. S—An exceedingly
pretty variety, the variegation being very distinct.
3 to 4 ft Each $0.35 Per 10 $3.00
2 to 3 ft Each .30 Perl0d 2.50

3 to 4 ft

43

D. Stelzneri. M-—A strong grower and
abundant bloomer. Flowers dark red.
Each Perl0 Per100
Yuta scosgccoopsa0aqd $0.35 $3.00 $25.00
TECONGELE sioieic staveteunnctene ere .30 2.50 20.00
D. Venosa. M—Flowers veined pink.
DULL Ou bie talercbtsvel cl ereiets Each $0.85 Per 10 $3.00
D. Verschaffelti. M—A very fine pink va-
riety.
PIO Ey ey RENO e Osc nls Each $0.35 Per 10 $3.00
D. Van Houttei. M—A good grower, with
clear carmine flowers. J
Each Peril0 -Per100
BIO Hite otiH coe omoode $0.25 $3.00 $25.00
Li BONG) Lire chal ovaharercteleleloiate .30 2.50 20.00
ELEAGNUS. Oleaster
E. Longipes. S—A handsome, shapely
Silver-leaved shrub, with an ornamental,
reddish brown bark in winter; perfectly

hardy and easy to grow; the bright yellow
flowers appear in June on long stalks, but
the greatest value of the shrub is in the fruit,
which is produced in the greatest abundance
along the whole length of the branches, oval
in shape and about one-half inch long; color
deep orange red; very showy and attractive.
The fruit is not only very ornamental, but
has a sprightly, sharp, pleasant flavor, and
makes a delicious sauce when cooked.

Each Peri0 Per 100
TICE TONS a eLitaretrarsteRerciets $0.35 $3.00 $25.00
2 Lied PAYA ER Boos. ob .30 2.56 29.00
US itOmZ Aries revere reie vers avAS 2.00 16.00

E. Angustifolia (Russian Olive) T—A large
shrub, sometimes of tree form, with long,
narrow, Silvery green foliage. The flowers
are yellow, followed by yellow fruit.

Hach Peri0Q Per100
AELOMD ELL taretoestehelelsteretedsictehelishelets $0.35 $3.00 $25.00
sp ooddonacoonneoonas .30 2.50 20.00

E. Argentea (Silver-Leaved Oleaster) L—A na-
tive species of erect growth and beautiful silvery

foliage. Flowers small yellow. July and August.

Hach Peril0 Per100
CONGR LU e rene sterckaepovcvctay scanned neat $0.45 $4.00 $35.00
Chita) 6} SHES Gioia elbIe 0.0.0.0 OAIO OOD 35 3.00 25.00

Lonicera Tartarica (Bush Honeysuckle)

HS

Rhus Glabra Laciniata (Sumach)

EUONYMUS. (Strawberry or Spindle

Tree)

E. Alatus (Cork-Barked Euonymus) S—Dwarf,
compact habit; wood very corky; leaves small; fruit
red. Foliage turns bright red in fall. One of the
very. finest shrubs for autumn effect. :

3 to 4 ft.. Each $1.00 Per 10 $9.00
DitOrSebes ene ecoacree: chien Each .75 Perio 6.00

E. Americanus (American Burning Bush) lL—
Very conspicuous in the autumn and winter, when
loaded: with= scarlet- seed-pods, from which the
orange-colored herries hang on slender threads.

i Per 10 $3.50

3 toMttisn sus.
2 to3 ft-- .30 Peri0 2.50

E Europaeus (European Burning Bush) L—From
Europe and a favorite in old gardens, of good size,
with rosy-red pods.

: Hach Perl10 Per 100
5 to 6:ft..5 meee oGao oD $0.50 $4.50.. $35.00
4 to 5-ft. oD So 0b) 4.00 309.00
Si tonsttessee cos crsaons < 135 3.00 25.00

_ B. Bungeanus. L—Very attractive on account of
its rather large, yellowish fruits, which are borne
so profusely and remain so long upon the branches.
SP wo) “linea eon codon oRodoO Each $0.45 Per 10 $4.00
Haeh .&5. Peri10 3.00

- EXOCHORDA. Pearl Bush

E. Grandiflora. L—A very hardy and handsome
shrub from northern China and Japan, forming a
bush 10 to 12 feet high in as many years. The pure
white flowers are borne in clusters, on light, wiry
branches, which bend beneath their load of bloom
enough to be airy and graceful, and the unexpand-
ed buds are like small, round beads of pearly white-

3 LOMentee oe eee: Bach $0.40 Per 10 $3.50
2. tOnBeiE Es eres eee aioloniee Hach .85 Period 3.00

FORSYTHIA. Golden Bell

. F. Suspensa. M—A very early and showy spring
bloomer; flowers bright yellow; branches long ana
slender.

Hach Peri0 Per 100

4 CONS SEER Mea eee eee eee $0.35 $3.00 . $25.00

3 COLE CM cmasp cretion Ccoeaeea manent: .30 2.50 20.00

AKO) Biesgoaocodonescane0v00 +25 2.00 16.00

F. Fortuneii. M—Grows upright; foliage deep
green; flowers bright yellow.

Bach Peri¢ Per 100

BSton5 Lt ie ecsern leterstanctereteheleee $0.35 $3.00 $25.00

S/d): CO ero ORCI os OO OGD .50 2.50 20.00

OMUOMOMUC.-s ccekerencioueie reed bere 2215 2.00 16.00

44

a) WEBER & SONS NURSERY “_" oo

NURSERY, Mo.

CO

F. Intermedia. M—A form
with erect, arching branches,
foliage resembling Viridissima,
and flowers like Fortuneii. Very
free flowering.

Each Perl10 Per100

4 to 5 ft..$0.35 $3.00 $25.00:
3 to 4 ft. .30 2.50 20.00
2 to 8 ft. 25 2.00 16.00
F. Seiboldi. M—On the order

of F. Fortuneii, excepting that
the branches have more of a
weeping tendency; a _ profuse
bloomer, flowers bright yellow.

Bach Perl0 Per 100
4 to 5 ft..$0.35 $3.00 $25.00
3 to 4 ft .30 2.50 20.00
2 to 8 ft 325) 2.00 16.00

F. Viridissima. M-—A fine,
hardy shrub. Leaves and bark
deep green; flowers yellow. Very
early in spring.

Each Perl0 Peri100

4 to 5 ft..$0.35 $3.00 $25.00
3to4ft.. .30 2.50 20.00
2 to 3 ft. 2) 225 2.00 16.00

Halesia Tetraptera — See De-
ciduous Trees.

HAMAMELIS. Witch Hazel

H. Virginica. M—A tall shrub; yellow flowers;

late in fall, just before the leaves fall. Foliage
changes to bright colors in the fall.

Each Peri0 Per100
SUtOc4ab brn ctcuseee terlonene 60.0.000% $0.40 $3.50 $30.00
Di) Biles ooda0000 Soooa000000 35 3.00 25.00

Robinia Hiispida (Locust or Acacia)

— a

“ WEBER & SONS NURSERY |

G

Spirea Anthony Waterer

HIBISCUS SYRIACUS.
of Sharon

These are very fine, hardy, free growing, flower-
ing shrubs, of very easy cultivation, and very de-
sirable on account of their late summer blooming.
Should be in every garden. Our collection com-

prises a great variety of colors and shades. (See
descriptions below.)

(Prices unless otherwise noted):

Each Peri0 Per100

A COme ee icpe tats tarciapel frerviete. shel $0.45 $4.00 $35.00
SUO a eee Caius cummin vcleueinte. aCenetece 39 3.00 25.00
BAO) Th Whe dae anne colarc oun .80 2.50 20.00
DRED al er ateeye chete craiesavelere: « .25 2.00 16.00

H. Alba. L—Single, pure white.

H. Alba fl. pl. Ii—Semi-double, pure white.

H. Anemoneflora. I—Very large flower, meas-
uring 3% to 4 inches across; semi-double. red with
a very deep red base on outer petals. Stamens
showing prominently.

H. Ardens. I—Double violet, 2% to 3 inches
across flower; petals quilled; vigorous; very fine.

H. Boule de Feu. L—Large, 3%% to 4 inches
across flower; very double, well formed, light rose;
petals flecked at base with cardinal; one of the
finest reds; vigorous.

H. Coelestis. L—Single, flowers large of a deli-
eate shade of azure blue, showing red base.

H. Coelestis Alba. L-—Single white with crimson
eye.

H, Coelestis Rosea.
Panache, but larger

_ L—Single, on order of Fleur
individual flowers.

H. Coelestis Purpurea. L—Single purple, very
large, showing large velvety base.
H. Coelestis Rubra. JI.—Single bright red, with

deep red base.

H. Duchesse d’Brabant.
flowers.

H. Duchesse d’Bretange. U—large, single.
times showing semi-double flowers
with deep red base.

; H. Elegantissima. L—Semi-double, white show-
ing cardinal base, inner petals quilled.

H. Fleur Panache. L—Single white, blotched
and marked with red, showing cardinal base.

H. Grandiflora Superba. I—White, semi-double,
blush markings with deep cardinal base.

H. Jeanne de Arc. L—One of the best;
pure white, double; strong grower.

H. Lady Stanley. L—Very double, white with
beautiful tush markings, cardinal base.

L—Large, reddish lilac

At
; color rosy lilac

flowers

(ame {J NURSERY, MO.

Althea or Rose

one-half to three
deep rose.

the brightest of
than H. Anemone-

and
very double;

, bright red,

H. Leopoldii.
inches across flower;

H. Lucy.
our collection.
flora,

H. Meehanii. L—New variegated -leaved Althaea.
Robust habit, compact and somewhat dwarf; leaves
variegated: creamy white with irregular margins
and green centers; never sun-scalds. Flowers sin-
gle, 3% to 4 inches across, of a satiny lavender
sheen, and purple blotched at the hase of each of
the five petals, blooms perpetually from July to
September.

2 to 3 ft., grafted plants. .
18 to 24 in., grafted plants. Hach
H. Paeoniflora. Iz—Double,
grower, free flowering.
H. Pompon Rouge.

ers large.

H. Pulcherima. Vien: large, to 4 inches
across flower; double white, shaded to pink; outer
rows of petals broad and show cardinal base; inner
petals quilled. A very fine variety. Strong grower.

H. Purpurea. UL-—Purple, semi-double, showing
cardinal base.

H. Puneceus Plena.
showing individual single flowers;
small cardinal base.

H. Ranunculoeflora Plena.

L— Two

A shade deeper

Per 10 $4.50
Perl0O 3.50

rose, dwarf

. Mach $0.50

40
bright
L—Very double, rose, flow-

216

L—Semi-double, frequently
bright red, with

L—Double, with fuli

high center, petals notched; blush white, crimson
at base. 2

H. Rubra. UL—Double red.

H. Rubus. —Single red, showing cardinal BERG,

single and almost identical with Coelestis Rubra. +

H: Rubra Plena. U—Very double; red, fading to
a lilac as blossoms develop. -

H. Speciosa Rubra. L—Double red, tinged with
purple, deep cardinal base on outer. petals,

H. Variegata fl. pl. M—vVariezated leaves, flow-
ers very double, seldom open.

H. Violet Claire. L—Similar and almost iden-
tical with Purpurea. -

HYDRANGEA

Hydrangea Arborescens Grandiflora. s— This
beautiful shrub is being®> Sent out under various
names, as ‘‘Snowball Hydrangea.’’ “Hills of Snow,”
ete. This New American Hydrangea is believed to
be the most beautiful, hardy flowering shrub intro-
duced for many years.

‘The plant attains a height of five or six feet, with
about the same breadth, is far more graceful than

Spirea Van Houtte

the old form of Hydrangea Arborescens. Flowers
are borne in large trusses, beautifully formed and
of dazzling whiteness, rendering it a plant of peer-
less beauty. Seems to do best in rather damp or
shady location.

The flowers, when cut, remain in good coudition
a long time, thus making the plant especially use-

ful for cut flowers.
8 to 3% ft Each $0.60 Per10 $5.00
Hach) 45m bers Om t00
H. Paniculata (The Type) L—This shrub is in-
ereasing in popularity as it is of strong habit,
hardy, has handsome foliage and good bushy
growth. The panicles of white bloom are more
open than those of the Grandiflora. Can be used
by itself or in borders. A splendid plant for any

purpose. Kaeh Perl0 Per100
CORE is (one aren SAREE RIF yin lore $0.45 $4.00 $35.06
DY 110) 3 Teo sole oooGodo00D0000000 .40 3.50 30.00

Syringa V. Mad. Abel Chatenay (Lilac)

Hydrangea Paniculata Grandiflora (Bush Shape)
M—This is one of the most valuable hardy shrubs
in cultivation. It attains a height of six to eight
feet, and is perfectly hardy in all parts of the coun-
try. The flowers are white, borne in immense py-
ramidal panicles nearly a foot in length. It com-
mences flowering in July and continues until No-

vember. This is the finest flowering shrub for
cemetery planting we know of.

Fach Perl0 Per100
Buto; Bowlin eneaneretiels $0.45 $4.00 $30.00
2 to 3 LEU OUOU MOD OO OO OGOG 35 3.00 25.00
USMCORDA winery feecicnctepensdet terete 39 2.50 20.00

Hydrangea Paniculata Grandiflora (Tree Shape)
M—tThese are fine specimen plants, four to five
feet high. trained to tree shape, with about three
feet of straight stem and nice-shaped heads. Should
bloom profusely the first year.

4 to 5 Each $0.60 Per 10 $5.50
3 to 4 ft Hach .45 Perio 4.00

H. Quercifolia (Oak-leaved Hydrangea) S—Pur-
plish white flowers borne in panicles. Especially
admired for the large, handsome foliage, shaped
like an oak-leaf, turns bronzy purple in the fall
and lends a contrast to the dying shades of other

= 3 WEBER & SONS NURSERY (©

NURSERY, Mo.

46

leaves. Requires protection north of here and does
not hurt it to receive a little protection in this
section.

18 to 24 inches Each $0.75 Per 16 $6.50

HYPERICUM. St. John’s Wort

H. Moserianum (Gold Flower) D—A low creeping

plant, with bright green leaves that make a pretty

setting for the golden yellow flowers that continue
so long in bloom, from June to September. Desir-
able for planting among shrubbery and evergreens.
Requires protection in this section.

12 to 18 inehes Each $0.85 Per10 $3.0C

ILEX. Black Alder or Winterberry

I. Verticillata. M—A hardy native shrub, with
attractive foliage and habit. Very ornamental in
auturn and winter when covered with brilliant red

erries.

OE OUIR ME hee: Lak ties Bach $0.50 Per 10 $4.50
HS RCOaD eel Il cieeemkejetetereteve tere Each .40 Peril0O 3.50
ITEA
I. Virginica. S—A native shrub with racemes
of pretty white flowers in early summer.
Det Or DTA ch te eae eicwovetstese ,- Mach $0.35 Per 10 $3.00
ASS roR eth e 5G. Solo Babla-50 Each -30 Peril10 2.50

JASMINUM

J. Officinale (White Jasmine) S—A _ slender
species, requires support of a trellis and in a
sheltered position. Flowers white and fragrant;

Sto Bt eee Rae. Each $0.35
KERRIA (Corchorus). Globe

Flower

Handsome, free-flowering shrubs, thriving in
common garden soils.
K. Japonica FI. Pl.

S—AIl summer. Hand-

some, light green, finely toothed foliage and
showy flowers, freely and continuously produced.

Each Peri0 Per1i100
SetOus Lec: renee teneiete tevehaeverewere $0.40 $3.50 $30.00
2EtORSeLtavemem ene one 03 3.00 25.00

K. Japonica—Single yellow flowers, free flow-
ering. Bark green, a fine shrub for edging
shrubbery groups, sometimes kills back to near
the ground line, but sprouts readily and soon
regains its former size. ,

Each Peri0 Per100

2 to 3 ft so0000000 $0.35 $3.00 $25.00

K. Japonica Var. Follis Variegata (Variegated
Leaved) D—A choice sort, with beautifully var-
iegated silver and green foliage. Elegant at the

edge of shrubberies.

Hach Peril0 Per 100
US tO DAGMAR see veqereveretetehevens $0.35 $3.00 $25.00
15 to 18 in .30 2.50 20.00

LESPEDEZA. Bush Clover

A charming shrub for all soils; valuable for single
planting or grouped with other shrubs.

L. Bicolor. M—A very rare Japanese plant,
forming a large shrub or small tree, with a very
effective pendulous trend of the branches. The
foliage is clover-like and flowers are pea-shaped,
pink and white, and borne in drooping clusters
from axils of the leaves, and in such profusion as
to bend the branches with their weight.

Each Peri0 Per i100
A St Oa Dalby icowdstiortecueeiels eeekenee $0.40 $3.50 $30.00
B LORE PES Sav yorie eqevebate lal oxe nieve ~35 3.00 25.00
Pyiido) Botearign coo Coon UD DOOD -30 2.50 tae

LIGUSTRUM. Privet

The Privet is now one of the best known shrubs,
both for hedging and for ornamental planting on
the lawn. All of the varieties offered have merit,
some for their foliage, some for their berries. They

we

are almost evergreen and of dense habit and bear ~

shearing to any extent.

Ligustrum Amurense (North)

(Amoor River
Privet)—A distinet type which

has been found

hardy in the North.

Foliage and habit of growth

almost identical with the variety grown in the
South. Flowers white; black fruit.
Each Perl0 Per 100
Dab CQO MOU au etey ai « Cay ae.‘era|0/a\/eai"aile) » $0.20 $1.60 $12.00
ROA AS LIENS siekente soaks ciein atehahensle 15 1.20 8.00
L. Ibota. M—The form is spreading, with curv-
ing branches. Foliage grayish green; flowers pure
white, seeds bluish-black. A good border shrub
and hedge plant.
Each Peri0 Per 100
EUOMMAEL Crave blolets uo) ane; sieleisvotcrsya $0.25 $2.20 $18.00
ZUG) SEE SAB GRE dane Ge peoe -20 1.60 13.00
LMU DAMES cucceratetstotsiararars/clarele.e LS 1.20 9.00

L. Ibota (North) M—This type is known as the
upright Ibota and has been found to be perfectly
hardy in the North. For Northern sections this is

undoubtedly the best of the Privet for hedges.
Flowers white in upright panicles, fruit bluish-
black. Each Perl0 Per 100

DELO MB Get torsurtalevelcnctevsicle ore os $0.25 $2.00 $15.00
WSOUDAGIN es cierpeveteisietcveresate riene .20 1.50 10.00

L. Ovalifolium (California Privet) M—A vigor-
ous, hardy variety, of fine hahit, and foliage nearly
evergreen. Makes a desirable ornamental shrub
as well as hedge. We are St. Louis headquarters
for this valuable hedge plant. Our stock comprises
upwards of 100,000 plants in the various sizes.

Each PerlO Peri100 Per 1000
3 to 4 fis $0.15 $1.25 $8.00 $60.00
2% to 8 rte ply) 1.00 6.00 50.00
2 to 2% ft. .08 -60 5.00 40.00
18 to 24 in. .06 -50 4.00 35.00
15 to 18 in. 05 .40 3.00 25.00

L. Regelianum (Regal’s Privet) M—A fine, hardy
variety, desirable when grown singly as a speci-
men, or in mass planting; also suitable for hedges.
This is one of the berried varieties.

Each Period Per100
2% to 3 LE Serelalonete Stetaarstese" ave $0.40 $3.50 $30.00
2 COZ AG adi Erccvetcpeterelsvote sever otrs .35 3.00 25.00
18 to 24 UNE oo poco OS DUS HS -30 + 2.50 20.00

L. Sinensis Nana. S—A dwarf variety of very
pleasing effect. Fine for a medium hedge: very
graceful; can be trimmed if desired. Berries re-
main on plant until quite late.

Sito Bibehtenror erieuve satocte « Hach $0.50 Per 10 $4.50
2 to 3 LE Halse volt wie Each .40 Perl10 3.50
18 to 24 HTVerAtvetarstatavasvens Each .30 Perl0 2.50
LONICERA TARTARICA. Upright
Honeysuckle

L. Tartarica Var. Alba. M—Creamy white, fra-
grant flowers; forms a high bush. May and June.

Each Peri10 Per 100
STOVE DER av ctevciviciator cisvertiear ate $0.35 $3.00 $25.00
DeCORSnGE sipoieniereretovecne avalelerarers .20 2.50 20.00

L. Tartarica Var. Rosea. M—Pink flowers, which

contrast beautifully with foliage. June.

5, Each Peril0 Per 100
SEOTA DG ein iel steveus efeterevaie raincroeeta $0.35 $3.00 $25.00
DAtLOUS IDs ys, cave soveraroiene cavcletcrsiotone .30 2,50 20.00

L. Bella Albida. M—Flowers white, bright red
fruit in great profusion; very fine.

Each Perio Per100
Store LU iyryeters eis arevous clela els $0.35 $3.00 $25.00
PRLCTB TR UE, Clo Cio nO DOO COLE tenet .30 2,50 20.00

L. Fragrantissima. M—In sheltered situations
the dark green leaves of this shrub are retained
nearly all winter. Its pretty pink and white flowers
are numerous, but not very showy. Delightful fra-

grance. It is easily trained into a handsome bush.
Each Peri0 Per100
BUCO, Aah treteware revel at teverere otekaber severe $0.40 $3.50 $30.00
PUCOLS HE i rerstaherstorcvoveversie-cleen ¢ .85 3.00 25.00
WEDEOUDAMI MED Tire eects tie aS suave .30 2.50 20.00
L. Ledebouri. S—A distinet species with red
flowers in May.
Each Peri0 Per100
SUCH Ct a ccetsverctarcveres diet vis, soars $0.35 $3.00 $25.00
UacOnome catalyererecrkeoteiervakevevers ve .30 2.50 20.00
L. Morrowii. M—A fine variety from Japan;
valuable for its handsome red fruit.
Each Peri0 Per100
ZHCO) Sabie aye c ciovetes cree otererenarc $0.30 $2.50 $20.00
SPCORA ARITA Deere Sropeseto ataie vive ee API) 2.00 16.00

NURSERY,

47

SSS” >

\

CoO. E

Mo.

L. Ruprechtiana. S—A fine variety from Man-
churia, especially valuable for its showy red fruit.

Each Perl10 Per100

CUES hte tard Gas Cacho AO DIO OED ROO: $0.35 $3.00 $25.00

AWN BAS oS oadagaganodadovOOOOr -80 2.50 20.00

L. Rubra Grandiflora. M—A beautiful shrub,

very vigorous, and producing large, bright red
flowers striped with white, in June.

Each Peri0 Per190

BD LOEARLG eta spevatsta evevereterete ec erone $0.35 $3.00 $25.00

PANO ES Re ho oinice GiceckO DICUOLCAIOO .30 2.50 20.00

PAVIA. Dwarf Horse Chestnut

P. Macrostachya (Dwarf White Horse Chestnut)

M—A beautiful spreading shrub, producing numer-
ous large, showy spikes of flowers late in June.
Valuable.

SuLO MEA LUT taerebetsterdinetetavecerers) sielonetererel cranes Each $1.50
DRUOMRGBL toiotrratreterenonatededchencratenelonereieneterticis Bach 1.25
18 to 24 in Each 1.00

As ‘
Symphoricarpus (Snowberry)

PHILADELPHUS. Syringa or Mock
Orange

For grouping with other shrubs, forming large
screens or hedges which may not require pruning,
or used as single specimen lawn plants they are
desirable. They will bear heayy pruning and quick-
ee seeune their free, semi-pendulous, picturesque
effect.

P. Coronarius (Mock Orange) L—Early June.

Fragrant, pure white flowers, in dense clusters so
numerous as to bear the branches down when flow-

ering. One of the best.

. Each Peri10 Per100
38 to 4 ft ayololleliotote efeWel ei evclencisleiekers $0.35 $3.00 $25.00
FAKED UDO. O BOCOMEGODS Cap -30 2.50 20.00

P. Follis Aureis (Golden Syringa) D—A dense
srowing form, with clear, golden-yellow foliage,

NURSERY, MO.

well retained in color all summer. One of the best

golden-foliaged shrubs offered.

Each Peri0 Per 100

I} WOME We soscono0boanedgCD $0.35 $3.00 $25.00
UPA WHS Ws oaonenoospsedaonas .30 2.50 20.00
P. Cor. Flore Pleno (Double-Flowered Syringa)

L—Partially double flowers; very tragrant.

Each Per10 Per 100
AK) — BYNES SO GOO OHO OUDOUOOUOL $0.85 $3.00 $25.00
IS (Key CAE The, obo ooo OOOH oOoUoOOO -30 2.50 20.00

P. Grandiflorus (Large Flowering) I.—Has showy
large flowers, slightly fragrant; branches somewhat

straggling. Hach Perili0 Per 100
Ril ene oonogpooob od oO OLD $3.00 $25.00
OY Brita op ab'0.0'0 01101 OOO DOG .30 2.50 20.00

Tamarix

P. Gordonianus (Gordon’s Syringa) L—Vigorous
grower and profuse bloomer; flowers slightly fra-

grant; late bloomer.
Each ~ Per 10- Per 100
Bt itn we shsoeddododuuoodUD $0.35 $3.00 $25.00
D0) BR ive gsssochosonusoaoane .80 2.50 29.00
P. Lemoineii Erectus. M—A charming variety

of upright growth; flowers small, vellowish white,
fragrant, completely covering the plant.

Wach- -Perl10 -Per 100
2% to 8 ftir vel csvset noe etm hece $0.85 $3.00 $25.00
to QU VNitowaqon coos cove C -30 9750 20.90
Ua hesmdadoagaonuaoo o5) 2.00 16.00

M—A variety imported in 1909,
Vigorous’ grower.

P. Napalensis. — A
said to have special merit. .

Hach Peri0d Per 100
Mt oral fiteeee toe c ieee ene $0.35 -- $3.00 $25.00
Y iio). SH iio noe oouodDUoneIoDOUUN .80 2550: 20.00

P. Primuloeflorus. L—Flowers almost double;
pure white.

Hach Peri0 Per 100
tO outliceaaoooobapoooo00 dos $0.35 $3.00 $25.00
a1 HO GHG Bre CD OIG Bic. OU Giotto .30 2.50 20.00

P. Speciosus. Is—Very showy flowers; late. Dis-
tinet habit. : -

Bach Period Per 100
Girino) 4h Abu ao oie cob Oo O00 6 $0.35 $3.00 $25.00
YD Akay SB TWikoo ones Oooo UC OonDOOND .380 2.50 20.00

P. Sutzelmannii. L—Strong grower; single white
flowers. Distinct.

Fach Peri0 Per 100
CPO). 24 Eo OB OOO OO ro OO Doe UD $0.35 $3.00 $25.00
M6). SHES GR AG BOOooM OO CONS ONO .30 2.50 20.00

P. Zeheeri. I.—Free flowering: medium sized
single flowers. ;

Zach Peri10 Per100

BPA) CoCo oon Go doaonUOdOCOS $0.35 $3.00 $25.00

iO) Vitltodoscoboaaudan000000 .380 2.50 20.00

POTENTILLA. Cinquifoil

medium-growing shrub of easiest cul-
and succeeding admirably in the

A dense,
ture in any soil,
driest situations.

P. Fruticosa. S—July to September. Narrow
foliage, with silky under surface. Flowers yellow
and borne in continuous suecession for a long sea-

son. Each Perl10 Per1i00
Di OMe Brak th aireycl ceccana tat ettWene reVeetetes $0.35 $3.00 $25.00
LS PLOY QASIM Meas a eretete eteleloretons .30 2.50 20.00

PRUNUS JAPONICA. Double Flower-
ing Almond

A class of ornamental shrub or smali tree intro-
duced from the mountains of Asia Minor, and suc-
ceeding well in common garden soil. The flowers
are very showy, produced in great abundance, and
useful for their earliness. Fine plants to use in
grouping or for lawns.

F. Japonica Var. Flore Rosea Plena.
S—Small double pink flowers borne in
abundance in May.

P. Japonica Var. Flore Rosea Plena.
S—Small double white flowers.

BP AWoeh Whee po gcc Fach $0.40 Per 10 $3.50
D WO) Bsillosoose Hach 35 Perio (3700

See Prunus under Peciduous Trees
for flowering Peach, Plum and Cherry.

PTELEA. Hop Tree or
Shrubby Trefoil

P.. Trifoliata. D—A large shrub or
small tree; rapid growth; fruit in eclus-
ters and winged. Blooms in June.

Each Peri10 Per 100

EE oy 6) ditto ya ooe $9.35 $3.00 $25.00
RHAMNUS

R. Catharticus (Buckthorn) L—A

stiff, twiggy shrub with white flowers
in June and July. succeeded by black

berries. Splendid for massing in parks
and public grounds.

; : ach Perl10 Per 100
Ant Ouomlite: weneter ne $0.40 $3.50 $30.00
SriLOrABEtE Aiea BOI) 3.00 25.00

RIBES. Currant

Vigorous, remarkably ‘healthy plants, of easiest
culture. Besides their ornamental foliage and flow-
ers, the fr uit of several of the sorts is showy and
very attractive. Valuable for grouping as a class

-or with other shrubs.

R. Aureum (Missouri Currant) M—May. Golden
yellow, spicily fragrant flowers in showy racemes.
Foliage shining and glabrous, taking on showy,
autumnal coloring. Mach Perl10 Per 100
SaCOMASOES Paceone ys cpece cee rereaetene $0.55 $3.00 $25.00
QNtonsi ft .30 2.50 20.00

R. Gordonianum (Gordon’s Currant) M—May and
Tune. <A valuable hybrid with orange-red flowers
in showy spikes. Very choice.

Hach Perl0 Per 106

BY TOyEr eh oer niete tes oid chcholnea PEO ESG $0.85 $3.00 $25.00
QeCON SMES ccegee ce ror ee terre 3 2.50 20.00
R. Sanguineum Var. Flore Plena (Double Crimson
Flowers) M—Flowers very double, showy. ‘This

and its type do best in somewhat protected situa-
tions. Fach Peri0d Peri100
PASEO ESA ER tate ol onhiols SIDI Oe crac $0.40 $3.50 $30.00

RHODOTYPUS. White Kerria

R. Kerrioides. L—A choice and rare Japanese
shrub, recently introduced. It is a slender brancn-
ed bush, with very pretty, deeply veined leaves, and
pure white flowers, borne at intervals all summer.

Each Peri0 Per 100

SiO Aaah sisters eecaese siete Brae $9.35 $3.00 $25.00

tO} ISL eivsere ee wee .30 2.50 29.00

NSUCOSD 4: TAY eye cistonseaetee haere ale 125 2.00 15.00
RHUS. Sumach

R. Aromatica (Fragrant Sumach) S—\A native

variety, exhaling a strong odor. Flowers greenish
white; leaves lobed.

Hach $0.75 Per 10 $6.50

| WEBER & SONS NURSERY *
NURSERY, MO.

Shining green
green-

R. Copallina (Dwarf Sumach) S—
foliage, changing to rich crimson in autumn;
ish yellow flowers in August.

SMES era ra Ure sus « 1 otcia fe Mes) aap eee Fach $0.45 Per10 $4.00

R. Cotinus (Purple Fringe) L—A much admired
small tree or shrub for its curious fringe of hair-
like flowers that cover the whole surface of the
plants in middle summer.

Each Perl10 Per 100
Free Gantve rv tccdecte rc srcreieclarei a's 30.50 $4.50 $40.00
MMLGVORRU cia cielerevele eftscla ie teeveieve css 45 4.00 35.00
SRUORADED et pore cydves aVelore niente eraie.s 285 3.00 25.00

R. Glabra (Smooth Sumach) 1-—Very effective in
autumn with its crimson seeds and foliage.

Hach PerlQ Per 100
LON AL Cate Shea sisislslefshajaie) erere ec $0.35 $3.00 $25.00
CUPL Ueeeiamctn miei nec ekdrare Se, 5, os .30 2.50 20.00

R. Glabra Var. Laciniata (Cut-leaved) \I—A va-
riety with deeply cut, fern-like foliage. An elegant
plant for groups or the lawn.

Bach Perl0 Per 100

Pe ah Sel ewer occas 61g Ceo BaD $0.50 $4.50 $40.00
Ist CoP Nia ale Ss 65 Bigs Os eae 45 4.00

LAEOV LS AM arverecorcnetonh erate «ie one oe 3.00 5.00

R. Typhina (Staghorn Sumach) L-—A large cipal

or tree, brilliant foliage and scarlet fruit in autumn
Each Per 10 Per 100

AutosOelitrersersiev rare nae s wie £0.40 $3 50

CreLOes oh bascees emer rete rete trae sve .85 3.00

R. Typhina Laciniata (Staghorn Sumach) I-—A
large shrub or tree, brilliant foliage and scarlet
fruit in autumn. A very pretty effect. among shrub-
bery collections.

Each Perl0 Peri100
DULGRORC Gtr tcrrtste osteo ce cielo ok $0.50 $4.50 $40.00
AREOMD ALU steco tere wiete chee 45 4.00 35.00
PU mse teres e ress oe Olek Geet 40 - 350 30.00

R. Virginiana (Typhina) (Staghorn Sumaclh) L—
A large shrub or small tree, brilliant foliage and
scarlet fruit in autumn.

BEORL ORE Crtcret er erelsvevelenete oes Each $0.75 Per 10 $6.50

Gr COMB humm crore tereieieieiceestinic Each _.60 Per10 5.00

PEG) Waa ccdc Ota Cerner Each .50 Perl10 4.00
RUBUS. Bramble

R. Odoratus (Flowering Raspberry) S—Foliage

large; flowers pretty rosy purple.
PEON Per 10
2 CORSRLE NA Merrie cee ere ess $0.35 $3.00.

ROBINIA. “Locust or Acacia

R. Hispida (Rose or Moss Locust) "MA native
shrub of spreading, irregular growth. Flowers rose-

Per 100
$25.00

colored ‘in long clusters in June and*at intervals
through the summer. Hach .Per10 Per 100
2 TOUSRLU rarer areata ieee hehe $0.40 $3.50 $30.00

See Deciduous Trees for the Grafted SUM U
Trees of this’ variety.

SAMBUCUS. Elder

Rapid-growing shrubs, with ornamental foliage,
flowers and fruit.» Will thrive in all soils, but give
best fruiting- results in that of a moist nature. The
Golden Elder is-one of the finest golden-leaved
shrubs, and is yery useful. It shows its color best
on a dry soil.

S. Canadensis (Common American Elder) L—

Broad panicles of white flowers in June; reddish

purple berries in autumn. <A well known native
Sb Each Peri10 Per 100
OULORALGE bitacatticnevefevevelefwlevovc oldiehate $0.35 $3.00 $25.00
DAU ORE aie ec are eae cre gee eatoie ators .30 2.50 20.00

S. Nigra (Black-Berried Elder) L—Of medium.

growth, with purplish-black berries in September.

Each Perl0 Per 100

OMULORAT Bi icrsiels ersccleisteres ec aercless POLBD $3.00 $25.00
PEOROL Liliebegs take: seceWoreost ee ecors robe 50 AER) uekalle
S. Nigra Var. Aurea (Golden) I,—A_ beautiful
golden-foliaged form. Very useful for foliage ef-
fect. eae Per10 Per 100
4 to 5 ft $2.50 $30.00
8 to 4 fi 3.00 25.00
2 2.50 20.00

S. Nigra Var, Laciniata (Gut- Leaved) L—Deeply

eut foliage. ach Veri0d Per100
AMOR DADE ITE Sait ielchortic elevator $0.40 $3.50 $30.00
SMLORL, LCS ARs aeeelveneilnete 35 3.06 25.06
PAO GS OL is etme os COE Be eR .80 2.50 20.00

49

S. Nigra Var. Variegata (Variegated) L—Foliage
beautifully variegated with silver and green.

SRUOUAR TL Usweimctctecerchaleisvaetarsictels Bach $0.35 Per 10 $3.00
SRLOMG MUD errerover hale) Walerekerereretele Hach .80 Peril10 2.50

S. Racemosa (Red-Berried Elder) L—White flow-

ers in panicles in spring, fullowed by bright red
berries. iach Perl10 Per 100
SUCONAMUUeetehsishetetcercholatetot ens siicvers $0.40 $2.50 $36.00
DmUORSMOG rehesucvecerettonevattel oy iererele .35 3.00 25.00

SPIREA. Meadow Sweet

An indispensable class of small ta mediumni-sized
shrubs, embracing a wide range of foliage, habit ot
growth, color of flowers and season of blooming.
All of easiest culture in all soils.

S. Anthony Waterer. D—A new crimson-flowered
variety; one of the most beautiful of dwarf flower-
ing shrubs. It makes a low, conivact bush, 15 to 18
inches high, and is covered nearly the whole grow-
ing season with large umbels of deep erimson “flow-
ers. Perfectly hardy, it makes a fine compact plant
for low clumps or for bedding purposes. Grown as
a pot plant, it is a fine plant for house decoration.

Bach Perl0 Per 100
2ASTO)'3 OMIM cbeversheceheie etocevekacierers.« $0.30 $2.50 $20.00
USHEON DAMM ea wemmeerona toners itece 25 2.00 16.00
WAUCORUS IT ee rareabuceabelarsestereretsvers .20 1.60 14.00

aa Billardii. M—Medium sized shrub, producing
piked panicles of flowers, bright rose color

Hach Perl0 Per 100
Bi CORAME GR ys arctereneneteteh monet terere rel: $0.25 $3 00 %25.00
QU Batt once rere eee -30 2.50 20.00

S. Bumalda. S—A spreading, low hush, with dark
leaves brightened by corymbs. of pretty, light pink
flowers in “May, and at intervals all summet.

= Bach Perl0 Per100
QASC OWS OPIN Ye venehers ey ate ake rete $0.30 $2000 $20.00
SECORZA TIE Peachtree rsron aa a 6748) 2.00 16.00
S. Chamaedrifolia. M—A beautiful- species, with
small, wiry branches, ‘covered in June witk clusters
of white flowers.
Deaton altenae ie evlavcdstete stele Fach $0.25 Per 10 $3.00
SSL OMA Se IMM cijeqoivesscotelera sie berrs Iaach .30 Perl0 2.50

_S. Collossa.
tish umbels,

M—A choice species; flowers in flat-
bright pink and very showy.

; Each Perl0 Per 190
Pe ACONCLU Ub tke 3 org OO BO OO OOOO $0.35 ae $25.00
ie oy Oh las So nleto GOR GOO ol .30 2.50 20.00

S. Collossa Alba, D—Of compact grow th, with up-
right branches, crowded with large, flat clusters of
white flowers nearly all summer.

Each Perl10 Per 100
MB rtOpA Anime evesevcl eh aincheatersteiece $0.30 $2.50 $20.00
PORTO MUS UTLGy. eectsie ci cxesaienebePatetone ares) 2.00 16.00
S. Douglassi. M—Immense terminal spikes of
deep rose-colored flowers. One of the best.
Mach Perl0 Per100
SALOUS LL re dereecyosvevePeremevekens: ob ahevene $0.25 $3.00 $25.00
DevOW Ogu ruivereteltey cena Cito .30 2.50 20.00
S. Fontenayii Alba. M—A pretty variety, with
White flowers in summer. Upright growth and
pretty, light green foliage.
Fach Perl0 Per 100
SEUORSLLL fenawiuejc tenant vee $0.35 $3.00 $25.00
Pr MKC) G2 SH Bare ROOD. OC OC OMe .30 2.50 20.00
S. Fontenayii Rosea. M— Of same habit of
growth and foliage as Font. Alba, but flowers are

rosy white. Each Peri0 Per100
Seto wht as: s.cirstcteersteminte whee $0.35 $3.00 $25.00
2K) CIE > fin Blea ORO CAO ODIs 30 2.50 20.00

S. Lanceolata. M—A beautiful double-flowering
variety. Each Perl10 Per100
OPCOMABHE Botany ds onenerivcsetesio areas $0.35 $3.00 $25.00
QHUOKS LU sree Werehsvcversecs cece aca ae .30 2.50 20.00

S. Lindleyana. Shining dark green leaves

with pretty fauielee.

Numerous panicles of pure
white flowers.

BUH UWeogsoooongoche Gade Bach $0.35 Per 10 $3.00
2 UG). BMteoic.8 go ddin dow oer oho Each .80 Perl0 2.50

S. Multiflora Arguta.
ers clear white.

S—Of dwarf habit; flow-
The best very early flowering

white Spiraea. Early May.
DNTOM MIGUEL aid rerterererceteneiets Each $0.30 Per10 $2.50
18 to 24 1516 quota OREM ORD Hach .25 Perl10 2.00

S. Opulifolia (Nine Bark) M.
shrub with white flowers

A strong growing

Each Perl0 Per 1006

avai cents $0.40 $8.50 $80.00

oudo oO 0G 35 3.00 25.00
Sa0do0boOoDOOODdDOOE -30 2.50 20.00

M—Very conspicuous from

S. Opulifolia Aurea.
the golden hue of its foliage; of strong growth.

Bach Perl0 Per100

CHORD ooh oS oie CoD OG aO doo $0.40 $3.50 $30.00
2) 1) “ite o ooo nooo boo UOau nO aU .35 3.00 25.00
NK) Hike deg cucotoobUG oO OTaG -30 2.50 20.00
S. Prunifolia, Fl. Pl. M-—Very distinct, with
numerous small, double white flowers, blooming

early. Each Per10 Per100
BH COP AC Ltr tarcyene-anerspennickeremmende $0.40 $3.56 $30.00
Dit Oper Sishtee ies teasveveheletelstencvene ate Bes) 3.00 25.00
MSMTORI ASIN eet tenceeretoue eu testemeiers .30 2.50 20.00
S. Reevesii (Lance-Leaved—Single) M—One of

the most ornamental; showy flowers, pure white,
in umbels and very numerous.

Each Perl10 Per 100
iu Cutie sionndoapoodocooud $0.35 $3.00 $25.00
DPCLOMUS Mb tise aretenereucnenetoxeuchetoreaeiate .30 2.50 20.00

iS hoy PAINS GoooodoKoOUCOuD OO 5745) 2.00 16.00

S. Reevesii, Fl. Pl. (Lance-Leaved—Double) M—
A perfect gem, each individual flower as double as
a Ranunculus and very conspicuous.

Each Peri10 Per100

BUG io scooccdcnn0deodNK $0.35 $3.00 $25.00
BW) 8 Eo oeoco0d0g5 0005000 -30 2.50 20.00
IS} Wo MAb thls 5 o900000500000000 +25 2.00 16.00

S. Salicifolia (Willow-Leaved) M—Long, narrow,
pointed leaves,

and rose-colored flowers in June

Bach Perli0 Per100
$0.35 $3.00 $25.00
.30 2.50 20.00

S. Sorbifolia (Sorb-Leaved) M—A vigorous spe-
cies, with leaves like those of the Mountain Ash,

and long, elegant spikes of white flowers. July.
DUE OMS EEG alas isietencnescisnercuehs Each $0.35 Per 10 $3.00
ifs} (hay Bo ibNooooodouoon0Gd0D Each .380 Peril0 2.50

S. Thunbergii (Thumberg’s) S—Dwarf habit and
round, graceful form, branches slender and some-
what drooping; foliage narrow and yellowish green.
Flowers small, white. Esteemed on account of its
neat, graceful habit and early blooming.

Each Period Per 100
DYN THY BX MNS 6 Sood oOooObOOUO ROO $0.35 $3.00 $25.00
TH) 190). BY Ns g Holo 0 oo0 60000000 .30 2.50 20.00
At OMUGwI Near tarperier ackoiereronerens 42/5 2.00 16.00

S. Van Houtte. M—The grandest of all the Spi-
raeas. It is a beautiful ornament for the lawn at
any season, but when in flower it is a complete
fountain of white bloom, the foliage hardly show-
ing. Clusters of twenty to thirty flat, white florets
make up the racemes, and these clusters are set
close along the drooping stem. Perfectly hardy and

an early bloomer. Bach Perl10 Peri100
Eh ii) GB itoococcogaoucudo0G000D $0.40 $3.50 $30.00
BmtOnsentiesecrereneskenstee ic rerctetsiekerens 35 3.00 25.00
ONS boo sg 0a000b0 0 ONG 00006 .30 2.50 20.00
STEPHANANDRA

S. Flexuosa. S—A graceful shrub with spread-

ing, drooping branches, elegant foliage. Flowers

pure white, panicled racemes. June. Foliage turns
to handsome purplish coloring in the fall.

Each Peri10 Per 100

DW! Bites gsododaccodd00000 $0.35 $3.00 $25.00

ALG} 10) Ae shes So o'oaDOOn0ab000N .30 2.50 20.00

SYRINGA. Lilac

S. Vulgaris (Common Purple Lilac) M— Large
shrub, with larger leaves and flowers than above.
Flowers bluish purple. Each Peri10 Peri100

Eb 110) Mes oon ocaGnnKd00D0 DODD $0.50 $4.00 $36.00
B®) iteogudoao0doncuddoopuD -40 3.50 30.00
HUW Biwoosocncoco000000c0 G0 30 2.50 20.00

Ss. V. Alba (Common White Lilac) M—Flowers
in slender panicles, pure white and fragrant.

Each Perl0 Per100
BLO). CUES peo ou doOODOMOD OO ODN $0.40 $3.50 $30.00
PANO Jago oo oO bOboOOddd00000 .80 2.50 20.00

S. Persica (Persian Lilac) M—Of more slender
srowth and finer foliage than the Common Lilac.
We have these in pink and white colors.

SRL OMseLE. 7. ci deer error Each $0.50 Per 10 $4.50
OP 11)B}) Seg Glepo Gok 6.5 U_O1D-0.0 '0'0\9.0 Each .40 Peril10 3.50

NURSERY, MO.

50

S. Rhotomagensis Var. Rubra (Rouen Lilac) M—

A distinct hybrid variety, with reddish flowers;
panicles of great size and very abundant. One of
the finest lilacs. Each Period Per100
$0.50 $4.50 $40.00:

-40 3.50 30.00

S. Villosa (Japan Lilac) M—A species from Ja-
pan. Large branching panicles; flowers light pur-
ple in bud, white when open, fragrant. Especially
valuable for its late flowering. Single.

B COTES ttazccvevoteie wis atone tales Each $0.50 Per 10 $4.50
-40 Peri10 3.50

2; COWS EL Grass avcinre e orerhereeisverets Fach
_ S. Japonica. M—A species from Japan, becom-
ing a good sized tree. Foliage dark green, glossy;

leathery; flowers creamy white, odorless, in great

panicles. A month later than other lilacs.
Si COREE Socsancrencrelves fexerereitngs Hach $0.50 Per 10 $4.50
2 tOnsatt ic dee chsecseeee Each Per10 3.50

-40

Viburnum Plicatum (Snowball)

_S. Josikaea (Hungarian Lilac) M—A fine, dis-:
tinct species, of tree-like growth, with dark shin-
ing leaves and purple flowers in June, after the
other lilacs have done blooming. Esteemed for its

fine habit and foliage.
8 to 4 ft Each $0.50 Per 10 $4.50
cHoQAduocdcooDoddES Hach .40 Period 3.50

SINGLE AND DOUBLE VARIETIES
OF “SYRINGA VULGARIS”

For a number of years we have been collecting
the finer varieties of ‘‘Foreign Lilacs’ from vari-
ous sources, and believe we now have as fine a
collection as can be found anywhere.

_The great improvement in the lilac in the last
eight or ten years has been marvelous. No park
or large ground is now complete without a good

Son

Co

collection of these delightful novelties. The flow-
ers so far surpass the old varieties that there is no
comparison, excepting that they are of the Lilac
famliy.

It has been nothing unusual for us to cut spikes
of some of these varieties that measured 12 to 14
inches in length and from 6 to 8 inches in breadth,
from 3 and 4 year old plants, that brought from 15
eents to 25 cents per spike in the flower market.

In describing the varieties we mention those that
are double; those not so described are single. All
are beautiful in their distinct shades and markings.
They all attain a height of from 8 to 12 feet in
time, depending on location and soil.

Each Perl10 Per100

4 to 5 ft., grafted plants...$0.80 $7.50 $70.00
8to 4 ft., grafted plants... .60 5.50 50.00
2to 3 ft., grafted plants... .a0 4.50 40.00
18 to 24 in., grafted plants... .40 3.50 30.00

We have some specimen plants that we will quote
on application.

S. V. Alba Grandiflora—Very large, pure white

flowers.
S. V. Alphonse Lavellei—Large trusses, clear
lilac. Double. J
S. V. Belle de Nancy — Medium trusses, satiny
pink. Double.

S. V. Charles X—Large trusses, rather loose, red-
dish purple.

S. V. Colmariensis—Large pale blue flowers.

S. V. Doyen Keteleer—Pale wallflower-pink. Dou-
ble.

S. V. Emile Lemoine—Lilaceous pink. Double.
SH V. La Tour de Auvergne—Purplish violet. Dou-
ble.

S. V. Lavaniensis—Violaceous: pink.
7 S. V. Lemoinei Flore Plena—Carmine violet. Dou-
e.

S. V. Leon Simon—Bluish wallflower.

Ss. V. Lamarck—Large panicles, rosy lilac.
double.
. V. Louis Henry—Violaceous pink. Double.
V. Mad. Abel Chatenay—Milk white. Double.
V. Mad. Casimir Perier—Creamy white. Double.
Vv. Mad. Lemoine—Pure white. Double.

S. V. Mademoiselle Fernande Viger—Pure white.

S. V. Marie Legray—Pure white.

S. V. Mathieu de Dombasle — Carmine - violet.
Double.

S. V. Michel Buchner—Clear lilac. Double.

S. V. President Carnot—Light lilac. Double.

S. V. President Grevy—Large branched trusses,
rosy lilae, changing to lilac. Double.

S. V. Rubella Plena—vViolet. Double.

S. V. Rubra de Marly—Dark violaceous red.

S. V. Souvenir de L. Spath—Blackish red.

S. V. Virginalis—Pure white.

SYMPHORICARPUS. St. Peter’s Wort

S. Racemosus (Snowberry) S—Flowers incon-
spicuous, rose-colored, in June and July; leaves
thin, dark green; fruits large, milk-white, clustered,
persistent until late in winter.

Double.
Very

Each Perl0 Per 100

Sptomesaiere ete eee Oo bin SoCO0n ESD 5000
D COMNSALE: Mn Ce ante ae 00 2.50 20.00
VS yHOLZ ACI eve, pevevetetera<tycteter kel 25 2.00 16.090
S. Vulgaris (Coral Berry) S-—Similar to the

Snowberry, except that its fruits are red and that
the smaller red berries cluster in thick ropes about
the stems, which droop beneath their weight.

Each Perl0 Per 100

PIAS) 28 Tits oe nod Sudtic COdddCOS $0.25 $2.00 $16.00

TSC) PEN Gheln aerate cleo one O60 Oise .20 1.50 12.00
TAMARIX. Tamarisk

The tamarisks are hardy shrubs. of strong

growth, foliage light and feathery, their flowers

delicate and fringing, usually in some light shade
of red or pink. They will grow anywhere. Lately
the variety T. Africana has been used for hedging,
and it is indeed very pretty for that purpose; if
pruned several times during the season it is even
finer than the best of Evergreen hedges and from
a distance frequently taken for such. We are
growing them more largely now for this purpose,
and customers wanting something out of the ordi-
nary will do well to try a hedge of them.

“ WEBER & SONS NURSERY (__" ~—5 >
ee es ES

S"—~

>

T. Africana. F—A tall, graceful shrub with
small foliage like a Juniper, and declicate small
rosy purple flowers, produced in spikes; very pretty.

Each Per10 Per100
AUTOMO MU GvrdoreratUekever cretenslonev< lore $0.25 $3.00 $25.00
SUC) y BtlG Katto aodEoo AO GwOe .30 2.50 20.00
DiNLORSY LU sve cyee crarebeleystersici chorea: “PAs 2.00 16.00

T. Gallica. L—Delicate pink or white flowers in
slender-panicled racemes; leaves bluish green. An
exceedingly pretty species.

Each Perl0 Per100
ZW OHH 5c dB OU OCCT $0.35 $8.00 $25.00
SIU OMAr i etts atenePevenorsieicielennel ale els .30 2.50 20.00
PONG? Hike manors GOO NOOO OTtC «25 2.00 16.00

T. Hispida Estivalis (New) L—A new variety,
raised from TT. Hispida. More vigorous and not
so compact. In July the branches are covered on

the half of their length with numerous inflores-
cences of large flowers of a nice bright carmine
pink. Each Perl0 Per 100
SEROMA CTU cet euarccatacreteners: ste sys Each $0.40 Per 10 $3.50
{oy 8} tito obo OOD OOM TOONO Eahe .85 Peri10 3.00

Wistaria

T. Indica. L—Pink flowers in longer, more wand-
like sprays. Hach Per10 Per100
ARIE: Sigil ee cloteectsvete rar ce tev ctl as $0.35 $3.00 $25.00
SmUOMA WL Gre eyes oat eretaheterenoy Aeon. 3 2.50 20.00
JO) TELA Pack CHOC EPEC oie pAb) 2.00 16.00

The Tetandra Purpurea. J—Of dwarfer and more
dense growth than T. Africana. Purplish pink
flowers in mid-summer. Mach Perld Per100
AMLONS EL Getarctsvetore cern he eA re $0.35 $3.00 $25.00
SetOMseite rm cicicriesea a ustsieks 30 2.50 20.00
ZLOnopLe 57785) 2.00 16.00

“(\)

(&)

WSs

VIBURNUM. Snowball

V. Acerifolium (Maple-Leaved Viburnum) M—
Low-growing shrub, with flat heads of white flow-

ers in May. Black berries in autumn.
Each Peri10 Per 100
ANO Bilin aocoooocdcosodd 0 coo lhHO $4.50 $40.00

V. Dentatum (Arrow-wood) M—A fine shrub for
massing for foliage effect. Flowers greenish white.

Mach Peri10 Per 100
Sito 28 3S 5 Go OG OO DOD.0 00050000 $0.40 $3.50 430.00
Dy LORS MUEpetenenece tous tole then rvenheweueee .35 3.00 25.00

V. Lentago (Sheepberry) I-—Foliage light glossy

green. Flowers creamy white, very fragrant.
Each Peri0 Per 100
PINKO RINRED.G doom aU. OO ODO COO O $0.45 $4.00 $35.00

V. Lantana. L—A large, robust shrub, with soft
heavy leaves and large clusters of white flowers in

May, succeeded with red fruit; retains its foliage
very late. Each Period Per 100
OCS PS aC GIMe DOO DOO ODO $0.40 $3.50 $30.00
QHtON Sub Emrepeteneel ote eoreteteneneistereie -35 3.00 25.00

V. Opulus (High Bush Cranberry) L—Very orna-

mental. Berries resembling small cranberries, hang
until destroyed by frost late in fall.

Each Peri10 Per100
8B.) Zh ooo oD ooGd So onodoo $0.40 $3.50 $30.00
Det Oleromucepracierareneiemiensuemener ae -35 3.00 25.00

USN EEK ENG CG gine clo ono e OD OOd .30 2.50 20.00

V. Opulus Sterilis (Common Snow Ball) L—aAn
old and well-known shrub, bearing large balls of

pure-wnite flowers. Hach Peri0 Per100
SECO nee Leh Bee ares ocalreile: nutteyscenehaners $0.35 $3.00 $25.00
PYRO RCO WES GOTO EAD OO ao .30 2.50 20.00
1S} 1) OE Ne ce sacasosccocccme aD 2.00 16.00

<— 2-7) WEBER & SONS NURSERY
: NURSERY, MO.

V. Plicatum (Japan) M—A rare and exceedingly
beautiful species of Japan; flowers in large globular
heads; pure white, hanging long on the bush; a
very choice and desirable shrub.

Each Peri0 Per100

SB EOCEGRE rarccste pa yase coveve rer cveteveianebore $0.40 $3.50 $30.00
2 EONBSuE Uciscanseesess sue sevejie eveueuoneneite 35 3.00 25.00
V. Tomentosum. M-—The single form of V.

Plicatum; flowers pure white, borne along the
branches in flat cymes, in the greatest profusion,
early in June. Perfectly hardy, vigorous, and free

blooming. Desirable. Each Peri0O Per 100
SULOTAREG acu eral enter rader $0.40 $3.50 $30.90
DIONNE Ha learG DS en ONE Gu cECerO ceo co 235 3.00 25.00

Vitex Agnus Castus (Chaste Tree)—A graceful
shrub, growing from 5 to 6 feet high, with dense
spikes 6 to S inches long, of lilac-colored flowers

late in summer. Bach Peril0 Per100
HI TORESE Te ereteccucicys rales ic eistawete rere $0.4 $3.50 $30.00
PAR O).C} Vlboro Boo OD bo!D Deco 35 3.00 25.00

XANTHOCERAS. Chinese Chestnut

X. Sorbifolia. L—Forms a shrub or small tree,
foliage resembling that of the ‘Service Tree;’”
flowers five-petaled, white, reddish copper-colored
at base, disposed in racemes about eight inches
long; flowers expand in April or May with the
leaves. Very floriferous. Requires protection until
established. Each $0.60 Per10 $5.50

ORNAMENTAL VINES AND CLIMBERS

oe AKEBIA

A. Quinata—A peautiful, hardy Japanese
vine, with unique foliage and chocolate -pur--
ple flowers- of delightful fragrance, in large -
elusters: .°.
Strong 2-yr. plants.
Strong-plants in -
only, Hach 50c.

AMPELOPSIS

A. Veitchii. (Boston Ivy)—Cf Japanese ori-
gin; entirely hardy, with foliage turning bril-
liant red‘in the autumn. Jt clings tightly to
walls, and is unsurpassed as a basket or vase

“Rach $0.30 Per 10 $2.50
-in. pots, Song. delivery

plant. Each Peri0 Per 100
Strong 2-yr plants....$0.30 $2.50 $20.00
Strong 3-yr.plants.... .35 3.00 25.00
Strong 2-yr. plants in. 4

and 5-in. pots, spring

delivery only .:..... 3.50 30.00

A. Quinquefolia (American Ivy or Virginia
Creeper)—Has. beautiful digitate leaves that
become rich crimson in autumn; a very rapid
grower. One of the finest vines for covering walls,
verandas or trunks of trees.

Hach Peri0 Per100

Strong 2-vr. old plants SAO COC $0.80 $2.50 $20.06
Strong plants in 4 and 5-in.

pots, spring delivery only... .40 3.50 30.00

Shorter joint-
A good climher: grows 6 to

ed than Quinquefolia.

10 feet in a season. Mach Perl10 Per100
Strong 2-yr. old plants......$0.80 $2.50 $20.00
Strong plants in 4 and 5-in.

pots, spring delivery only. .40 3.50 30.00

A. Elegantissima—A new ace we are import-
ing from Holland this spring, said to be a decided
acquisition and worthy of trial. Plants will be
ready for delivery during the early part of March.
Siroayen Menee, Oil! evi oouooudouonb pve Each $0.50
Sinone, planes) ine pOUS eae ree neiien tener Each .60

52

A. Veitchii (Ampelopsis)

ARISTCLOCHIA. Dutchman’s Pipe

A. Sipho—A fine, hardy climber and well known
in some parts of the country as Chinese Yam, The

tubers grow very large and are edible. like sweet
potatoes. The vine is a beautiful, rapid grower,
producing sweet-scented flowers.

Strong plants Fach $0.75 Per 10 $6.50
Siscopokes FONE shay TOUS bog boousabounooue Fiach $0.90:

BIGNONIA. Trumpet Vine

B. Grandiflora—A strong, rapid grower, of rather
bushy habit and bearing large flowers of brilliant

orange red.
Each $0.30 Perio $2.50

Stong 2-yr. old plants
CELASTRUS. Bitter Sweet

C. Scandens—A native climber, with handsome,
glossy foliage and large clusters of beautiful orange-
erimson fruits retaining all winter. Very bright in
effect and charming for winter house decorations.
Strong plants Each $0.30 Per19 $2.50

CLEMATIS

A beautiful class of hardy climbers, excellent for

pillars or trellises. They delight in a rich soil and
sunny situations, and are perfectly hardy.

C. Coccinea—A native Southern species, quite
hardy, flowers small, bright searlet; a very inter-
esting plant.

Strong 2-yr. old plants....#ach 30.35 Per 10 $3.00

Strong plants in pots...... Each .50 Perl10 4.50
C. Duchess of Edinburgh — Double, pure white.

Strong 2-yr. old plants....Bach $0.50 Per 10 $4.50

Strong plants in pots..... Bach .65 Perio 6.00
C. Henryii—A magnificent, large

white flower, a free grower and

bloomer.

Strong 2-yr. plants..... Each $0.50

Strong 2-yr. plants....Per10 4.50

Strong plants in pots....Each .65

Strong plants in pots..Per10 6.00

Cc. Jackmannii—Deep violet pur-
ple, with a rich velvety appearance.
One of the best.

Strong 2-yr. plants..... Each $0.
Strong 2-yr. plants ....Per10 4.50
Strong plants in pots....Fach
Strong plants in pots...Per 10

C. Paniculata—A vine of
rapid growth, quickly covering
lises and arbors with handsome,
clean, glossy, green foliage. The
flowers are of medium size, pure
white, borne in immense sheets, and
of a most delicious and penetrating

fragrance.

Strong 2-yr. plants...... Each $0.30
Strong 2-yr. plants..... Per10 2.50
Strong 2-yr. plants....Per 100 20.00
Strong plants in pots....Hach .40

Strong plants in pots...Per10 3.50
Strong plants in pots. .Per 100 30.00

Cc. Mad. Koster—Bright rosy car-
mine; free flowering.

Strong 2-yr. plants...... Each $0.50
Strong 2-yr. plants..... Per10 4.50
Strong plants in pots....Bach .65

Strong plants in pots...Per10 6.00

DOLICHOS. Japanese
Kudzu Vine

D. Japonica—A very rapid grow-
ing vine that will make from 50 to
60 feet of growth in a year. It is
a very desirable vine for quick ef-
fects and useful for hiding unsight-
ly objects or covering rocky waste

Each $9.50 Per 10 $4.50

HEDERA. Ivy

The Ivies are evergreens and frequently suffer
from exposure to the bright sunlight in winter. For
this reason the north side of a wall or building is
a better situation than the south.

H. Hibernica (Irish Ivy)—A well known sort,
much used in cemeteries for covering graves.

Strong pot grown plants...Hach$0.40 Per 10 $3.50

H. Helix (English Ivy) —A familiar evergreen
vine, dark green leaves, favors shady location. The
young wood sometimes winter-kills in this climate,
due to the action of the sun, more than the cold.
Suitable to cover buildings, rocks, trellis work,
graves and as a carpet under trees in places where
grass will not grow.

Strong pot grown plants...Hach$0.10 Per 10 $3.50

) WEBER & SONS NURSERY *
NURSERY,

places.

Each Per 10 REAP A I
SELON SE PlaWeSweraarsre els $040 $3.50 tr GRowen-co;
Strong plants in pots.. .50 4.50 = :

EUONYMUS

E. Radicans Var. Variegata—An
evergreen vine, with variezated fo-
liage that clings to walls like ivy.
Strong pot grown plants

Mo.

LONICERA. Honeysuckle

L. Aurea Reticulata—A variety with beautifully
variegated foliage; leaves netted and veined with
clear yellow; flowers yellow and fragrant.

Strong plants, 2-yr. old. ... Mach $0.30 Per 10 $2.50
Strong 2-yr. plants in pots. Each -40 Perld 3.50

JL Brachypoda—A strong, vigorous grower; dark

green foliage; flowers yellow and fragrant.

Strong 2-yr. plants... 2... Bach $0.35 Per 10 $3.00
Strong 2-yr. plants in pots. Hach 45 Perld 4.00

L. Japonica Var. Chinensis (Chinese Evergreen)
—Blooms at intervals through the summer and re-
tains it foliage late in winter. Flowers nearly white.

Ciematis Paniculata

Strong 2-yr. plants : Each $9.30 Per 10 $2.50
Strong 2-yr. plants in pots.Each .40 Pe.10 3.50
_ L. Japonica Var. Halleana—Color white, chang-
ing to yellow, very fragrant, blooms from June to
November.

Strong 2-yr. plants. ah Obie Each $0.25 Per 10 $3.00
Strong 2-yr plants in pots.Mach .45 Perlod 4.0¢

L. Periclymenum Var. Belgica (Monthly Frag-
rant)—A fine rapid growing variety; flowers large
and very fragrant; color red and vellow; a con-
stant bloomer.

Strong IEW) News o5 codon Each $0.85 Per 10 $3.00
Strong plants, 2-yr. in pot.Bach .45 Perl0d 4.00

L. Sempervirens (Scarlet Trumpet) —A_ strong
rapid climber; blooms very freely the entire sea-
son; bright red, trumpet shaped flowers.

Strong plants, 2-yr........ Each $0.85 Per 10 $3.00
Strong plants, 2-yr. in pot.Hach 4.45 Perio 1.00

LYCIUM. (Matrimony Vine)

L. Chinese—Very hardy; grows anywhere. The
slender drooping branches are somewhat thorny and
bear grayish green leaves. Flowers small pink and
purple from June to September, and are then suc-
ceeded by a profusion of bright scarlet and orange
fruits through late fall and winter. <A good plant
for covering trellis work and howers; also for cov-
ering bare places or rock.

Strong 2-yr. plants........ Tach $0.80 Per10 $2.50

PERIPLOCA. Silk Vine

WEBER. & SONS NURSERY “=
NURSERY, MO.

CO.

Flowers purple
Foliage glossy.

Per 10 $3.00
Perl10 4.00

will grow 30 to 40 feet in height.
brown in auxilliary clusters.
SLEOM Le] AUS Mreseoevenedetsters ote Each $0.35
Strong potted plants....... Each .45

WISTARIA

W. Chinensis (Chinese)—Flowers in clusters, pale
blue, sometimes gives a second crop of flowers in

the fall.
Strong plants, 2-yr........ Each $0.35 Per 10 $3 00
180. Ocala TOUS) noasenuasoane Each .55 Perlod +.50

W. Chinensis Alba—Of similar habit to Chinensis.

with pure white flowers.
Simoes jE Soodconcsccs Each $0.60 Peri10 $5.50
bh Gah. FOU sosttdcogccdon Each .80 Perl10 7.50

P. Graeca—A beautiful, rapid growing climber.
Fine to twine around an old tree or other support;

HEDGE PLANTS

To secure a good hedge it is necessary to
plant well. Dig a wide, deep trench, and
work the soil thoroughly into the _ roots.
Tramp the ground firmly, so that each plant
will be set as solidly as a post; then mulch
heavily with loose manure for a distance of
one or two feet on either side, according to
the size of the plants. This is especially
necessary with Evergreens, and all exposure
of the roots to the sun and air mast be
strictly avoided.

Evergreens should not be planted in the
fall, except during the months of August and
September, when weather will permit.

The following classes and varieties are very
desirable for ornamental hedging. Descrip-
tions and prices will be found under the
proper headings in this catalogue.

Ligustrum (Privet) in variety.

Cydonia Japonica.

Althea in variety.

Tamarix in variety.

Lonicera Tartarica in variely.

Philadelphus in variety.

Spireas in variety. i

Berberry in variety. }

Rosa Rugosa—Red and white. ;

Arbor Vitae in variety (vergrecen).

Hemlock (Evergreen).

Norway Spruce (vergreen).

Osage Orange—Formerly largely used throughout the West for boundary fences, wind brakes, ete.
Not hardy in the extreme North. Now largely planted for timber belts; valuable for fence posts; also
used in the manufacture of wagon wheels. for prices see Forest Seedlings.

FOREST SEEDLINGS

The planting of timber belts or the planting of waste lands to timber is something that should be
given more attention by the agriculturist and horticulturist. There are few farms in this country where
a timber belt could not be planted to good advantage and with eventual profit, while on a large major-
ity of farms acres and acres of land are wasted with no ultimate prospect in view of ever realizing any
remunerative results from same, excepting as pasture lands, or to sell them, in time, at such price as the
‘buyer may elect.

If from one to five acres of timber were planted on every farm of 80 to 160 acres that now has no
timber, just think what a difference it would make in the value of these farms at the end of say, ten
years. y

, On high, dry lands the Catalpa Speciosa (see that you get the true), Black Locust, White Ash, Box
Elder, Soft Maple and Osage Orange do best.

On wet or swampy lands the Cottonwood is no doubt the best, but the Soft Maple will also do well.
The Black Walnut will do well if the soil is not too wet; it also does well on hill land, excepting that it
is of slower growth, but the timber is more solid and with finer markings. ’

In planting for timber the seedlings should be set either late in the fall or early in the spring, set-
ting them preferably 4 by 4 feet, same as corn, or 6 by 6 feet. Cultivate same as corn for the first year,
allowing the seedlings to grow at will. After one year’s growth cut all seedlings back to about ten inches
from the ground, leaving only one sprout; then during May or June go through the bleck and remove
all but the best one of the suckers, selecting the one nearest to the ground for your permanent tree.
With trees like Catalpa and Soft Maple it is a good plan to tie the young sprout loosely to the project-
ing stump until the wood has become hardened. Cultivate thoroughly, so as to get the best possible
growth. There will be no further pruning necessary, but cultivation should be kept up through the
third year, after which time the trees will take care of themselves.

When the trees get to crowding themselves after the sixth or seventh year, cut out every other tree,
starting with the second tree in the first row and with the first tree in the second row, and so on. This
will leave the trees alternately. This first cutting should pay the entire cost of the planting in vaiue
as firewood, fence posts or excelsior wood and a reasonable rental on the land. The remaining trees
should be worth at the end of ten years nothing less than $250 per acre and at the end of fifteen years
from $400 to $600 per acre.

Lumber is getting scarcer from year to year, and at-the end of fifteen years, the chances are that
a well cared for timber plot of twenty acres will support a family in reasonable circumstances.

a sean CR ND SR MERIT TS "

Ligustrum (California Privet)

54

HS

If you have a farm that has five or ten acres of
waste land, think this over. You cannot leave a
better asset to posterity than a good timber plant-
ing.

Four feet apart each way requires 2,792 trees ver
acre.

Six feet apart each way requires 1,210 trees per
acre.

Per 100 Per 10600

Catalpa Speciosa, 18 to 24 in........ $1.50 $12.00
Catalpa Speciosa, 12 to 18 in........ 1.00 8.00
Osage Oranges Nos, Weteeteirecerctea es» 75 5.00
Black Walnut, 18 to 24 in........... 4.00 30.00
Black Walnut, 12 to 18 in........... 3.00 20.00
Mulberry, Russian, 18 to 24 in....... 1.00 9.00
Eocust; Black, L& to 24 ine... ce. .90 7.00
Locust, Black, 12 to 18 in........... 80 6.00
WViRItevASH sls tO 2A IN cleletcsreisieisiel chavs 1,25 10.00
White Ash, 12 to 18 in.............. 1.00 38.00
S| CES Pe) Sve asee er oo raion 1.50 12.00
Box elder Usito seine craic cctelele « 15) 10.00
Maple, Soft, 18 to 24 in 1.00 8.00
Maple, Soft, 12 to 18 in .75 6.00

Cottonwood Seedlings. (Owing to the uncertainty
of the crop from year to year, we will quote prices

upon application.)
ROSES

i

During the last few years we have increased our

plantings of roses considerably and now haye one of
the best collections in the West.

All our Roses are field-grown plants, one and two
years old.

HINTS ON ROSE CULTURE

Soil—Roses delight in a clay loam, enriched with
well-rotted barnyard manure. Dig up the soil thor-
oughly to a depth of 12 to 15 inches, pulverize well;
do not raise beds above the level of the surrounding
soil. Soak the bed occasionally during the summer
with weak manure water.

Location—Roses delight in an open, airy situation
unshaded by trees and buildings. Always plant in
solid beds and each class for itself.

When to Plant—We advocate planting in the fall,
in friable soil, firmly packed with the foot, but do
not bruise the roots; give good soaking of water
after planting. As soon-as severe freezing weather
sets in, raise the earth around the plant three or
four inches, cover entire bed with dry, light manure,
then cover with leaves, straw or evergreen boughs,
weighting the former with pieces of wood or limbs.
Dormant plants set in the spring should be planted
early, before growth has started. No plant suffers
more by being planted late than does the Rose.

Pruning—tThis should be done during March. For
Hybrid Perpetuals remove about one-third to one-
half of the previous year’s growth. Strong growing
varieties require less pruning back than weak grow-
ing ones. In the everblooming class two-thirds of
the previous year’s growth should be removed. Cut
out all old or decayed wood annually, also all feeble
branehes and such as are crowding each other.
Some of the Hybrid Perpetual varieties can be made
to bloom again in the fall, if pruned soon after
spring blossoming time is over.

Insects and Diseases—Do not let these discour-
age you. There are now a number of remedies, eas-
ily applied, that will rid your plants of any insects
very quickly if applied promptly. (See Spray Cal-
endar and Formulas in this Catalog.)

HYBRID PERPETUAL ROSES
(Rosa Hybrida Cifera)

This class of roses is admirably suited for garden
culture, for the formation of rose beds, hedges and
permanent plantations, where hardy varieties of
roses are desired. They are of easy culture and
luxuriant in a deep, rich soil. They are benefited
by mulching in the fall of the year. Prune accord-
ing to the habit of the growth, cutting back close
all weak shoots and shortening the long canes to a
convenient length. ;

a_ WEBER & SONS NURSERY ©
NURSERY, MO.

55

Cou.

Catalpa Speciosa

The plants offered by us are strong’ field-grown,
delivered in dormant condition. Fall or early spring

delivery.

Wach Perl0 Per 100
INOn 1G 2=vear=Gldii. occ clcccieies $0.35 $3.00 $25.00
No. 1, l-year-old.......... -30 2.50 20.00

See Special Offers for smal! Pot Roses.

American Beauty—A variety too well known to
require description; color a rich red, passing to
crimson; fragrant. A rapid grower and constant
bloomer.

Alfred Colomb—Carmine crimson; large, full, fine
globular form.

Anna Diesbach—Bright rose color, very large and
showy; particularly fine in bud; flowers slightly
cupped. A vigorous grower: one of the best.

Baron de Bonstetten—F lowers large, very double
and full; color a rich dark red, passing to deep, vel-
vety maroon; highly scented.

Black Prince—A very fine, dark crimson variety.

Boule de Neige (Hybrid Noisette)—A finely form-
ed, pure white rose, occasionally shows light flesh
when first opening. Beautiful shell-shaped petals,
evenly arranged.

Conrad Ferdinand Meyer—The rose has Rugosa
blood in its make-up and is classed by some as
a Hybrid Rugosa. This is a grand rose; vigorous
grower, free bloomer; flowers large, perfectly dou-
ble, cup-shaped. Color deep, bright, vivid, intense
pink, with a-penetrating fragrance.

Clio—Flesh color; flowers often six inches in di-
ameter; very fine. ;

Coquette des Alps—One of the finest pure white
hybrid perpetuals; large, full, finely formed flower;
color pure white, sometimes faintly tinged with pale
blush; profuse bloomer.

Duke of Edinburgh — Brilliant crimson-scarlet,
shaded with maroon.

a_i

Baron de Bonstetten

Earl of Dufferin—Very dark red, double. Extra
fine. Vigorous.
Eugene Furst—Large and full, fine form. Color

deep. red shaded crimson. Profuse bloomer. A

most charming and grand rose.

Francois Levet—Light pink, fragrant. One of the
best.

Frau Karl Druschki—Very fine, large, beautiful,
pure white. The best white Hybrid Perpetual in-
troduced in years.

Gen. Jacqueminot—Brilliant crimson: very large,
globular and excellent; a free bloomer; unsurpassed
in its clear, rich crimson, scarlet color.

Gloire Lyonaise—Creamy white. Fine in bud.

J. B. Clark—Intense scarlet, shaded crimson-
maroon; very dark and rich; fragrant.

Mad. Chas. Wood—A true, perpetual!
bloomer. Begins to bloom almost as soon
as planted and continues throughout the
season. The flowers are extra large, very
double and full, and quite fragrant. Color
a bright, fiery scarlet, passing to fine rosy
erimson, elegantly shaded with maroon.
An old favorite.

Mad. Plantier—This is the old favorite
June rose. Vigorous grower. V ery hardy.
Pure white double flowers: Fragrant.

Mad. Masson—Large and double; color
a reddish crimson; of fine form; a fine
autumn bloomer.

Marchioness of Lorne—Rich rose color,
shaded in center with vivid carmine; extra
fine. zl

Margaret Dickson—One of the best
white Hybrid Perpetuals for garden plant-
ing Color white, with pale flesh center;
petals very large, well shaped and of im-
mense substance. Flowers produced sin-
sly on long, stiff stem, fine form, and
have a Magnolia fragrance. Vigorous.

Marshall P. Wilder—A favorite variety,
it certainly is a grand rose. Color deep,
rich, glowing red.

Mrs. John Laing—Delicate pink, frag-
rant, a continuous bloomer. ;

Paul Neyron—Flowers of immense size,
often five inches in diameter. Color deep
clear rose, very fresh and pretty. The
plant is a strong, healthy grower, with
glossy foliage, and is one of the most pro-
lific bloomers in the Hybrid class, young

WEBER & SONS NURSERY" ~~
NURSERY, Mo.

Co. -

‘if

+ plants in the nursery rows blooming almost
wy thout intermission from June to late Octo-
ber.

Prince Camille de Rohan—Very dark. This
rose is of a rich, velvety crimson, passing to
an intense maroon-shaded black, large, full
flowers. One of the darkest roses and very
handsome.

Ulrich Bruner—Extra large, bold flowers,
full and globular. Color rich, glowing crim-
son, elegantly flamed with searlet.

HYBRID TEA ROSES
(Rosa Thea Hybrida)

This class of roses is suitable for general
cultivation, as they are usually our very best
roses, blooming continuously throughout the
season. Require mcre care in winter protec-
tion than do the Hybrid Perpetuals in this
climate and further north, but well repay the
extra care in a goodly supply of fine flowers
when roses of the hardy variety are scarce.

Our plants are field grown, we take them
from 21-inch pots about May 1st, much de-
pending on the weather conditions at the
time and plant them in nursery rows, giving
them thorough cultivation and care during
the summer, by fall the plants will range
from 15 to 24 inches in height and are usual-
ly ready to transplant into permanent beds
or potted on or about Oct. 1st to 15th.

Price on fall delivered plants as dug from

sin Nursery:
Mach Peri0 Per100
Strong plants? Sarientyoctomene $0.35 $3.00 $25.00
WHEChintead IESG ooccacooanns .30 2.50 20.00
Price on spring delivered plants, in pots only:
3 Isach Peri0 Peri00
Strong plants in 4 and 5-in.
DOUSE. Steiscjecsnevehomcn arson ea $9.45 $4.00 $35.00
Medium plants in 3 and 4-in.
NOUS) Heid Ocho OA ade CODIGd C0 -40 3.50 30.00
See “Special Offers” for small 214-in. pot Roses.
Varieties

Antoine Rivoire—Too much cannot be said of this
grand rose; words will not describe its beauty. It
is a vigorous grower, with fine-shaped buds and
flowers; color salmon flesh in center to the edge
of its petals, shading to a creamy white, with a
delicate pink tinge; very fresh and clean.

Frau Karl Druschki

Etoile de France—The gold medal rose of France,
and claimed by the raiser, J. Pernet Ducher, to be
the finest rose he has ever sent out. Strong, vig-
orous grower. Flowers large, on good, long, stiff
stems; color a lovely shade of clear, red crimson
velvet; very fragrant and keeps well.

Helen Gould—Free growing and vigorous for its
color, it is remarkably constant in blooming, every
new shoot producing a flower. The blooms are
bright rosy carmine red, the buds are well formed,
the fragrance is delightful, and, taken altogether,
it is a variety that should be generally planted.

Kaiserin Augusta Victoria—Strong grower, free
bloomer, perfect flowers. Large fine buds, pure
white, does not pink up when planted out. A
superb variety. .

La France—An old and well-known variety. Color
silvery rose shades, with pink, it has a satin sheen
over all its petals. Hardy, eontinually in bloom;
first class in every way.

Madame Caroline Testout~—A charming
rose. Clear bright satiny-pink; flowers

very large and extremely showy, quite
distinct.
Madame Jules Grolez—An. exceedingly

free-blooming variety, with very bright,
large, full, finely formed flowers; buds
beautiful. Color a distinct and charming
shade of satiny pink. We are delighted
with this new addition to our list.

Meteor—We have no red rose that is
better for general purposes or that gives
so many perfect shaped flowers on nice
long stems. The color is rich, velvety
erimson, exceedingly bright and attrac-
tive. The plant is of vigorous growth
and very free flowering; a constant
bloomer. Fine for summer bedding or
pot culture.

Pierre Guillot—A bright, dazzling, crim-
son, passing to brilliant carmine. Flow-
ers large, very double, constant bloomer.’
Medium grower.

President Taft—This rose was raised in
Cincinnati, the home of President Taft,
and was named in his honor. It is a re-
markakle pink rose. Color a shining, in-
tense, deep pink. Plant is a fine grower.
free bloomer, good size and form, frag-
rant, is in a class by itself as to color.

Rhea Reid—Flowers large, rich red,
very double, fragrant and continuous
bloomer; strong grower; resists both mil-
dew and black spot.

Richmond—This is said to be the best
red forcing variety yet produced. Strong,
vigorous grower. Color deep red, long
pointed buds, elegant dark foliage.

White La France (Aigustine Guinnois-
seau)—This is a beautiful rose of the La
France type; color a fawn white.

William Shean —Purest pink, petals
shell-shaped, four io five inches long;
flowers of immense size and substance
and of perfect form; free blooming and

distinct.
TEA ROSES
(Rosa Indica Odorata)

Tea Roses are distinguished from others by the
delightful fragrance of the flowers and by the
delicate shades of colors. They bloom the entire
Summer and autumn.

Price on fall delivered plants as dug from nursery:

Each Peril0 Per 100
Strong splants: .. 47. n OLS 5 $3.00 $25.00
Medinmiplantse. a. cn eess ce 30 7.50 20.00
Price on spring delivered plants, in pots only:
: Each Peri0 Per 100
Strong plants in 4 and 5-in.
OLS Ter reinvercicie se sheian cel smrtaree OLD $4.00 $35.00
Medium plants, in 3 and 4-in.
Dots kei S Orb oe Mette Ae 40 3.50 30.00

WEBER & SONS NURSERY (_o ~—
NURSERY, MO.

57

CO.

See ‘Special Offers’? for small 2%-in. pot Roses.

Etoile de Lyon—This is the best yellow bedder
to date. Color lemon yellow, buds and blooms very
double and of large size. A good, tree bloomer.

Maman Cochet—tThis is our favorite rose. it is
of the largest size, the flower is built up or round-
ed and very double; the color is a deep, rosy pink,
the inner side of the petals being a silvery rose,
shaded and touched with golden vellow. Very vig-
orous; deliciously fragrant.

Marie Guillot—One of the standard varieties of
Tea Roses, which as yet has not been equaled by
any rose of its color; splendid for any use. WHspe-
cially desirable for summer rose beds. Color pure
white, sometimes tinted pale yellow.

Marie Van Houtte—This exceedingly lovely rose
cannot be surpassed by any rose of its color. In

Paul Neyron

the open ground it is truly magnificent. ‘The flow-
ers are extra large and are deliciously fragrant.
The color is pale canary yellow, shading to pale rose.

Mrs. B. R. Cant—A beautiful new rose on the
style and color of Papa Gontier. It is a free grower
and bloomer.

White Maman Cochet—A sport from Maman
Cochet, which it resembles in every particular ex-
cept color, which is pure white, occasionally tinged
with blush.

William R. Smith—The soft blending of the sal-
mon-pink and the rose-pink and the beautiful flesh
tints in this rose give it a singular resemblance to
the entrancing flush on a maiden’s cheek. A fine
bedder.

Gruss an Teplitz

CHINA ROSES (Rosa Indica)

This class is of luxuriant growth and are con-
stant bloomers, hardier than the Tea and Hybrid
Tea Roses. Fine for bedding or massing for color
effect.

Price on fall delivered plants, as dug from Nursery:

Each Peri10 Per100
SUR VENUES Sh olbn goad Onn on $0.35 $3.00 $25.00
Mediumlplants 2.25002 5.0. .50 2.50 20.00

Price on spring delivered plants, in pots only:
> Each Perl0 Per 100
Strong plants in 4 and

DEINGRDOUSH yeieichoteusnelstoreesiels $0.45 $4.00 $85.00
Medium plants in 3 and
LS thoy ous Go Scono000 005 .40 3.50 30.00

Gruss an Teplitz—One of the brightest color-
ed roses grown. Color dark rich crimsou, chang-
ing to bright scarlet, shading to velvety red.
Blooms continually; flowers good sized and de-
lightfully fragrant. One of the finest and most
useful bedding roses extant.

Hermosa—It would ke hut a waste of words
to write a lengthy description of Hermosa. It is
too well known and too great a favorite. It is
always in bloom and always beautiful; the color
is the most pleasing shade of pink, very frag-
rant. A grand rose for bedding or pot culture.

Queen’s Scarlet—Fiery-red, good bedder; a
fine variety.

POLYANTHA ROSES (Rosa
Polyantha)

Miniature roses derived from the Climbing
Polyanthas. Of dwarf habit, profuse bloomers.
Fine for bedding or for edgings. Perfectly hardy.

Price on fall delivered plants as dug from Nur-

sery:
Each Perl10 Per100
SHARON? ENMU Hogan oocoos $0.35 $3.00 $25.00
Medium plants .......... .50 2.50 20.00
Price on spring delivered plants, in pots only:
Each Peri10 Per 100
Strong plants in 4 and
5-in. “pots; seek near $0.45 $4.00 $35.00
Medium plants in 3 and
Acilns SIO) Goooooodooo00 | oc 8.50 80.00

Baby Rambler (Madame Norbert Levayas-
seur)—‘‘The new dwarf everblooming Crimson
Rambler.’ The greatest advertised, the most
talked of rose ever introduced in America.
Like Crimson Rambler in bloom, except that
it is dwarf and a true everbloomer. In bloom
all the time. A most wonderful rose.

Baby Rambler White (Catherine Zeimet)—
In habit of growth like Baby Rambler Red, but
with small double white flowers, in clusters.
Fine for cemetery planting.

Clothilde Soupert—Here we have a rose that
for bedding out doors or for pot culture is hard
to beat. Frequently the entire foliage is hid-
den with bloom. Medium-size flower, variaile
color, from almost pure white to deep pink.
Always in bloom.

BOURBON ROSES. (Rosa Bour-
boniana)

Price same as Polyantha.

Souvenir de la Malmaison—A superb o!d
favorite, with great flowers of clear flesh
white, double to the center. One of the finest
fall blooming roses.

CLIMBING HYBRID TEA ROSES

This class of roses require some protection
in this climate; a good plan is to lay them
down and cover with straw or Jeaf mulch.

Price on fall delivered plants, as dug from

Nursery:
Each Peri0 Peri100
| Showons TIEVMIS soacgccn0c $0.35 $3.00 $25.00
““ Medium plants ........ -30 2.50 20.00

Price on spring delivered plants, in pots only:
Bach Peri10 Peri100
Strong plants in 4 and 5-in.

INS) Soeanoncsacooueado0K60 $0.45 $4.00 $35.00
Medium plants in 3 and 4-in.

DOUS ndoodconddavoudabocsa -40 3.50 30.00

Cl. Kaiserin Augusta Victoria—A _ climbing

“Sport’’ of the fine variety whose name is bears,
identical with it in hardiness, freedom of bloom,
color and size of flowers.

dime)

KaiserIn Augusta Victoria

Cl. Madame Caroline Testout—A rampant climb-
er. In flower identical with Mme. Caroline Testout.
Beautiful glowing pink. :

Ci. Meteor—The brightest colored of all roses.
It is free, persistent bloomer, strong grower, in
bloom all the time; a true everbloomer.

CLIMBING HYBRID PERPETUAL

Cl. Frau Karl Druschki—An exact counterpart of
Frau Karl Druschki in every way, except that it is
a most vigorous climber. Flowers snow white.

SUTPOMEAIATIUS a terer tales aeleicvcrs evel cloretotererc 's Mach $0.50

RAMBLER ROSES. (Rosa Polyantha)

Under this class we list the Rambler sorts; they
are perfectly hardy and are suitable for trellises,
fences, porches, pillars, pergolas, arches, etc., ete.

Price on dormant plants, fall or early spring de-
livery: Tach Peric Per 100
NEC ONS AI ACS Ie wctcielulelatele clelers(« $0.35 $3.00 $25.00

Cl. Baby Rambler—This is a true
ever - blooming Crimson Rambler.
There has been a widespread demand
for a Crimson Rambler that would
bloom more than once in a season.
This is a climbing form of the Baby
Rambler, embracing all its good
qualities.

Crimson Rambler—The well-known
rose, of which there have probably
been more planted than any one-half
dozen other varieties put together
Strong grower, flowers in panicles of
30 to 40 blooms, color bright vivid
crimson.

Dorothy Perkins—See Wichuraiana
Roses.

Flower of Fairfield—Said to be an
ever - blooming Crimson Rambler.
Color deep crimson in large clusters.

Philadelphia Rambler—dit differs
from the Crimson Rambler in two
important particulars. First, the
color is brighter, deeper and more
intense. Second, the flowers are per-
fectly double to the center. It is a
strong, healthy grower, free and
abundant bloomer.

Tausendschoen or Thousand Beau-
ties—Flowers when opening are a
delicate shade of pink, changing to
rosy-carmine. It gets its name from
its many flowers and the variation
in coloring. A beautiful rose. You
want to plant a few of them.

White Rambler (Thalia)—In habit
of growth, foliage, manner of bloom-
ing and shape of flower this is iden-
tical with C. Rambler, differing only
in color, which in Thalia is a pure,
clear white.

Yellow Rambler (Aglaia)—A new,
hardy, yellow climbing rose, bloom-
ing after the same manner as Crim-
son Rambler in clusters; flowers of
medium size in immense clusters;
very sweet scented. Color a clear
yellow.

White Dorothy Perkins—See Wich-
uraiana Roses.

PRAIRIE ROSES. (Rosa Setigera)

This class is perfectly hardy and requires no pro-
tection. Each Perl0 Peri100

SEVONLY DIAN! Gielen dies strere e he $0.30 $2.50 $20.00
Baltimore Belle—Nearly white with a faint blush.
Queen of the Prairie—Large clusters of red flow-

- -WICHURAIANA ROSES

This class of roses is admirable for covering
trellises, walls, fences, trailing over rocky places,
slopes, etc. Each Peri0 Peri100
SELODEBDIANES forrest citelel icicle $0.30 $2.50 $20.00

NURSERY, Mo.

Alberic Barbier—Creamy-white with canary-yel-
low center; buds orange-yellow. The flowers are
semi-double in immense clusters. A very fine va-
riety.

Dorothy Perkins—A splendid, new climbing rose.
In foliage and habit of growth it is remarkably like
Crimson Rambler; the flowers are double, of good
size and borne in clusters. The petals are very
prettily rolled back and crinkled; buds remarkably
handsome; color a clear shell pink and holds a
long time without fading.

Evergreen Gem—Yellow in bud opening to almost
white and perfectly double; early flowering.

Lady Gay—Cherry pink, fading to soft white.
The flowers, in large, loose trusses, together with
the buds and foliage, form a mass of beauty from
base of vine to tips of branches,

Manda’s Triumph—Large clusters of double white
flowers; sweetly scented. ;

South Orange Perfection—Soft pink or blush,
changing to white.

Dorothy Perkins

White Dorothy Perkins—Identical with that fa-
vorite rose, Dorothy Perkins, excepting that it is
White. It has no rival as a white climber. You
should try it.

Wichuraiana—Strong grower in any soil. Flowers
Single, pure white, in great profusion during the
month of July.

1 . °
NOISETTE ROSES. (Rosa Noisettiana)
SUOMI) FIENNES Sooomocadmed Each $0.30 Per10 $2.50

Mary Washington — Flowers pure white, per-
fectly double, sweet and borne in endless numbers
in large clusters all summer. Vigorous grower.

William Allen Richardson—Very deep orange-yel-
low; medium size, but extremely showy and dis-
tinct; very attractive.

59

ws

MOSS ROSES. (Rosa Muscosa Bifera)

This class has always been a favorite in old gar-
dens. There is nothing prettier than the Moss rose
when in bud and the delicious fragrance. Perfectly
hardy.

StroncplantSemermee nie Each $0.25 Per10 $3.00

Henri Martin—Large full flower, deep red; well
mossed; fragrant.

Madame Louis Levecque—This is a grand new
Moss rose; large, full, delicate flesh, deeper in the
center; fragrant; splendid; well mossed. Resembles
Captain Christy in color.

Mousseline—Pure white flower,
beautifully mossed.

ROSA RUGOSA

This class of roses is specially adapted to hedges,
or for shrubbery collections, the splendid foliage,
the flowers and later the seed pods, makes this
class one that should be more largely used in land-

scape work.
Each Peri10 Per100

SO GOaye” NENMIC SooadooooddcKD $0.35 $3.00 $25.00

Blanc de Coubert—Pure paper-white, semi-dou-
ble; very good.

buds heavy and

with

Belle Poitevine—Deep
cast,

rosy-pink purplish

good buds.

WEBER & SONS NURSERY <7" ~
NURSERY, MO.

CO.

Conrad F. Meyer—Large double flowers, clear

silvery pink, extra fine.
Rugosa Alba—Single pure white.
Single deep rosy-carmine.

AUSTRIAN ROSES. (Rosa Lutea)

Siexoaye JENS say oonogodus Each $0.35 Per 10 $3.00

Persian Yellow—Deep golden-yellow; an old fa-
vorite. Blooms once a year.

SWEET BRIARS, HYBRIDS. (Rosa
Rubiginosa Hybrida)

PriGe=\reteheforsiaceis sinks a eovero sree Each $0.35 Per 10 $3.00
Anne of Gerstein—Color dark crimson.
Brenda—Peach, bright yellow anthers; fine.

English Sweet Briar—The old time Briar rose of
the English gardens.

TREE ROSES

The Tree rose is grafted on hardy stems four to
five feet high and thus form tree shapes. When in
bloom they are very handsome. We offer an as-
sortment of white, pink, scarlet and crimson va-
vrieties. As these trees are imported annually, we
can-only make spring deliveries.
IROKXeD ES ea Cie Oe ROM LCN ORORcnO DIOS Each $1.00

Per 10 $9.00

Our trees have all been transplanted two or three times, are handsome, selected trees, well branched

and rooted; suitable for lawns, ete.

Evergreens can be most successfully transplanted a short time before they are ready to start into

growth in the spring.

They can also be planted safely very early in the fall.

The soil to receive them

should be mellow and fine, and great care taken that it is well packed about the roots after they have

been well spread out in a natural position.

.

Wherever possible we dig with ball of earth and wrap same in dainp burlap; otherwise we pack roots

in wet moss immediately after digging.

Caution—Do not let the sun or wind strike the roots of EHvergreens even for a few minutes; you will

kill them if you do.
over the foliage.

Plant immediately on receipt; give thorough drenching of water, but do not apply

Specimen Trees and sizes not quoted herein will be priced on application.

Abies Concolor Var. Violacea (White Fir)—The
best strain of this hardy Western tree. Grows rap-

idly and forms magnificent specimens. Pale, glau-
cous blue needles. 5
SRULONSIYS, Lt. awit alleyprenenetcnederetareneteteretaie Hach $4.50
2 tows Tt wath allilerreweneverene DOD oCd0000 Each 3.50

Abies Balsamea (Balsam Fir)—A very regular,
pyramidal tree of ranid growth. Leaves dark green
above, silvery beneath.

SucOMeeLt.,mwiuli ballleparcterstetsteteretete
QOTOMS. Less mew Luh eb alll renee renereneneteiete

se tcett BaeleaD
.Hach 1.00

SS =
s)

PF rr, ox ~ ae

Abies Douglassii (Douglas Spruce)—Large coni-
cal form; branches spreading, horizontal; leaves
light green above, glaucous below.

COMES Liz, WALES clersveraraie aietwielcrel slelere Each $2.50
SMLOM Za eLitese Wiel SEL Lvevepweretelctuieleteleleners sree Each 1.50
Abies Nordmanniana (Nordman’s Silver Fir)—A

beautiful tree, foliage wide, dark green, silvery 0oe-

neath. it is a good, moderate grower and forms a
noble specimen in time. Contrasts well with
lighter colored evergreens.

ASEOMD NLU, “WULUML | GUI acl ovata! wieietia clecatelelp areas Each $6.00
Bait ade aie po mmdod COGODOOCOUS Each 4.50

Biota Orientalis (Oriental Arborvitae) — Pyra-

midal growth, densely clothed with fresh lively
green foliage; very hardy; one of the best.

BE i? Shay yy aul b eile Gad Gbotornocem oder Tach $2.50
SALOU Ome Lee Url Eli Dal lee-vaveperehterelstexecerey nine) Lele Each 2.00

Biota Orientalis Var. Elegantissima (Rollinson’s
Golden Arborvitae)—A splendid golden upright form

that turns a beautiful bronze in the winter. Espe-
cially useful for color contrasts.

4°EO* DOLE; sWitbwballlivaeteresrelantavercreua« . Hach $4.00
BOA, Lbs, Within DE epwerrevancrwel cis. ay ove: siereis. s Each 3.00

Juniperus Sabina (Savin Juniper)—A spreading
form, with deep, dark green foliage. Very valuable
for rockeries, grouping and border planting.

2to 2% ft., with ball Each $1.50
18 to 24 in., with ball Each 1.25

Juniperus Hibernica (Irish Juniper)—One of the
most popular Junipers known. Rigidly upright and
formal in character, resembling a green column.

3 to 4 ft., with ball Each $1.50
DeUOMo ECs VLU Mal lene reyercucnetoteversunrerenenelcete Each 1.25

Juniperus Virginiana (Red Cedar)—One of the
most valuable trees for screens and windbreaks:
perfectly hardy; too well known to need description.
Our trees are all extra well shaped and have been
several times transplanted.

3 to 4 ft., with ball Hach $1.50
2 to 8 ft., with ball Each 1.00

Picea Alba (White Spruce)—Of compact, pyra-
midal form, and greater symmetry than that of the
Norway Spruce, but possibly of less vigorous
growth; elegant silvery foliage.

Dibe COn Settee whee Dalle es. atcsce cy eens steele Hach $2.00
DZ towsse Fe eatin ae riercpcte crcccvseclacensre Mach 1 5¢
WSRtoT ZA oe ete cscreretetes cusvct cunie, sevens Fach 1.25
Picea Alcocquiana (Alcock’s Spruce) — From
Japan. Foliage pale green, silvery underneath,
Forms a beautiful tree of close habit. Valuable.
ZO Sette withiepalllevercsrersretelerreeisiel «id cree Mach $3.00

Picea Engelmann (Engelmann’s Blue Spruce)—
Another handsome Colorado species, exceedingly
hardy and fine in every way. Its foliage is soft and
plumy, and of a delicate bluish color.

DetOUSwLb. = Wile Dall orstetatrarctatrere hee ane Fach $2.50
Picea Excelsa (Norway Spruce)—Rapid in
growth, gracefully drooping in habit, dense in

structure, regular in outline and perfectly hardy.

Each Per10
SutOnGnte, WUE Me Allis ctetevereiatnicncierc aictererels $4.00 $35.00
4° tov Sift with: Dalles ccccl see cesicceere © 3.00 25.00
SAtO)-4URE WICH DAlls iis retetoracinrceo akee iene 2.00 17.50
216 to 3 iets Sa aU pao onaudbe onus 1.25 10.00
AtORDACALC eevee Wa Ac ieysvapelay cvstovoraletoiers 1.00 7.50
DSHtOn2 Asin’ pwc Wale tveete. crete cisteveee aie atl 5.00

Picea Excelsa Var. Inverta—A pendulous variety
of the Norway Spruce, the lateral branches droop-
ing gracefully.

SetOy Sut... Wl Uae tarcsreccvatoiareraiace see etree Each $4.00
Wmtons Lio withpalleceecteoiea de cmon eee Bach 3.00

Picea Pungens (Colorado Blue Spruce)—Of pyra-
midal form and compact growth. In the | seedlings
of this variety the color of foliage varies from dar! k

green to steel blue. A free grower and perfectly
hardy.

Stoc4ett a WitheDallcehiscchrchiconen eee Each $2.50
Zitoys LES with ballices ae common Each 1.50

Picea Pungens Glauca Kosteriana (Koster’s Blue
Spruce)—The richest colored of the tinted ever-
greens, hardy, vigorous grower, elegant habit. A
beautiful tree for any lawn with its silvery blue
sheen. We handle only the very best imported
grafted trees of this variety.

61

Sf 3) WEBER & SONS NURSERY"
Xe ( BS NURSERY, Mo. CO; J >

SPGCIMENS ac reiniesoseleleteietelelereners) cvs Each $10.00 to $15.00
BUEMLOMAMUC AWALULIE OAL ar cicletetevelcinietelelelstste:« Fach $9.06
SHOUS Pomc amUrLUM Dall erceicl nctetetersrenerstererene Each 8.00
Divs Mion pina alte Lelio pgcoo oUOCoOoar oD Each 7.00
2 to 2% ft., niphileyalote bei enc otclO CLO err Bach 5.50
THD (We) LE Thats Sealo) MENU hoa aneeaanagonbee Each 3.50
Pinus Austriaca (Austrian Pine)—From Central
Europe. Leaves or needles stiff and dark green.
Wardy everywhere and one of the most valuable
conifers for windbreaks, belts, ete.
Each Per 10
SELON RL nile WA UKE Dall lercheraleleretehene sist ence $2.00 $17.50
2to 38 ft., with ball 12.50
12 to 24 in., with ball 7.50

Pinus Cembra (Swiss Stone Pine)—Short, silvery
foliage; compact conical form; handsome and dis-

tinet.
PECOn oon Utes vy bie liite rata eieberstaicke violet oe ale Each $8.00
ish to) PATE Shai intel lERUL on oo honooDoadodda Fach 2.50

Pinus Mugho (Dwarf Mountain Pine)—Very dis-
tinet, leaves short, stiff, a little twisted and thickly
distributed over the branches; does not grow tall,
but spreads over the ground, generally assuming a
globular form; very dense.

1} (Go) DEP Sha, Awhile DENS S Oho aoo bo ooOmnG Mach $2.50
alley Ae) UG hos \wet EWI Geo ho oe poo uno. Each 2.00
7) eo) HG) dls Avalulot NGG a dodanbaeodbo od Each 1.50

P. Pungens Glauca (Koster’s Blue Spruce)
Pinus Strobus (White Pine)—An old and well-

known native tree of rapid growth and entirely
hardy.

ANCOMD Ut Wi Thea Nsreeis s sierorenchetelevey cteret el Each $2.50
Boy CU Gita, A Abb alow EAs Gowedood Onde Golo Each 1.50
PAC) Bitten W piper oyNlsootoomdcoruvn0 cept Each - 1 00

Pinus Sylvestris (Scotch Pine)—A rapid grower:
very hardy, from the central portion of Europe,
with short, rigid, light green leaves. Very valu-
able for screens and for masses.

Specimen Trees, dug with ball, Each $5.00 to $15.00

Bach Per 10
HL Aw) By iitieg Wado ENO 6 Co oer ooo auH OULU) $17.50
Sito Va his wibhiy Dalle. tet rere eens ete 1.50 12.50
PEtOmowt ley swith Daler rrererctentia omic ere 1.00 7.50
Uf} Wo) GEE Thre. Al ENTE On brooe noo OOd Bi Als 6.00
Retinospora Filifera (Thread-BGranched Japan
Cypress)—Unique habit; center shoot upright;
branches nearly horizontal.
Specimens 3% to 4 ft., with hall........ Each $5.06
Specimens 2% to 8 ft., with ball........ Each 3.50
Retinospora Pisifera—Of open growth, erect
branches, pendulous tips; foliage feathery, light
green; glaucous beneath.
Db LOM Settee Wa CIM DL rareie cise svene ERO Tach $3.00

GAT aes

Retinospora Pisifera Var. Aurea—Like above in
habit, with bright yellow foliage. Desirable for
planting in combination with green foliaged varie-
ties.

Vs oy Bh iis alee) Voedlls hogaonaconsoaanad Each $3.00

Thuja Occidentalis (American Arborvitae)—A
well-known native species of great value. It forms
an upright conical tree of only medium size, and is
especially valuable for screens and hedges.

Each Per 10

3 Consent witha baller resrenicutercrce $1.00 $8.00
US Wey rte ypuwey lens bo oomaanoagpadd aie) 6.00
PD Uiey WA sites Vale oENS Soo ooo oobooodS .60 5.00
DE a wore Maa bans aoiara a cia.G. bai Or ci eeOIc bio Onno -40 3.00
_Thuja_O. Var. Pyramidalis (Pyramidal Arbor-
vitae)—Of upright pyramidal compact habit. Very
desirable. Each Per 10
5) Wo) Outing Waa le ooaoonocconscca $3.00 $277.50
AWOL tit Wan LEW eaobaucgnouDnOOG 2.50 22.50
Bias CE We WAN TEM coo doonucDAauadN 2.00 17.50
2 00) B sities Ayal joENG soo acoso ooodbGOE 1.50 12.50

Thuja Lutea (Golden Arborvitae—Geo. Peabody)
—Of dwarf, compact growth; foliage bright golden
eolor, which it retains throughout the summer; the
best golden variety.

45tovottawith sballcseonaary ciate Each $5.00
ShCO} emhte-walthniib alps ieee keer eeeede ution Hach 4.00
A roy Save, yee JORMA Soscoaccaubbobebose Hach 3.00

Thuja O. Var. Globosa (Globe Arborvitae)—Same
shade of green as Pyramidalis.
UB or Deb aba, illo oN ys Sao Guo odo eoUdbS Fach $1.50
1 COs Sines iwi blab all le seerertrs eee renee ee Bach 1.25

Tsuga Canadensis (Hemlock)—A native species
of undoubted worth and beauty. Untirely hardy,
with drooping branches and dense habit.

Peto) Gy dite MANO WENNER Bh oue aoe dbon Oooo oN Each $3.50
Siiton4aftc with ballin ae ee Fach 2.50
PI ABO EIe Uy Ale del ofs) Wes etyc G Gta se GIG eon oF Each 1.50

EVERGREEN SHRUBS

Evergreen shrubs are coming into use more and
more, as they are so desirable in landscape work.
The foliage helps out and enlivens the bareness of
deciduous trees and shrubs in winter. ‘They are
all fond of shady places and are suitable for north
sides of houses, garages and north hill sides.

The soil for this class of shrubs should be care-
fully prepared with leaf mold, peaty soil and should
be mulched annually with well decomposed manure
or partly decomposed forest leaves.

Spring is the proper time to transplant.

AZALEA AMOENA

A bushy, dwarf grower with small green leaves
that deepen to a lustrous coppery hue in winter.
In April or May the whole plant is covered with
a mass of brilliant, claret-colored flowers that re-
tain their beauty for several weeks. Very orna-
mental and desirable for edging of drives and walks
or for bordering beds of Kalmia, Ilex, ete.

12 to 15 in. high and as broad, set with

HLOWErUDUASMee-aserecicioerin oie mieteneione Fach $2.00
15 to 18 in. high and as broad, set with
LOWErADUGS eae iain mien dare Each 8.00

ILEX. Holly

The Hollies are also coming in demand as veople
get to know what splendid ornamental plants they
are. The foliage is always beautiful, the flowers
interesting and the fruits ornamental. A group of
Iiollies are always a source of pleasure.

Ilex Aquifolium (English Holly)—Foliage darker
than the American variety, but not as large a
grower.

EVO 7h INE an OOOO ODO OO OOOOH OCSOD0G A000 Each $5.00

Illex Crenata (Japanese Hollvy)—Small, dark green
leaves and neat habit. Requires protection in this
climate.

AS. to) Q4sineeplantsmrrcmpeleier-iseersyasiveett ttets Fach $1.50

Ilex Crenata Follis Aureis (Golden-Leaved Japan-
ese Holly)—Our grower in Holland requested us to
introduce this beautiful variety here and as the
stock is very limited as yet, he has only consented

a 2_\) WEBER & SONS NURSERY © ~©
: NURSERY, MO.

to let us have five plants for spring 1912 delivery,
another year he expects to have more of them to
offer. The plants will be select specimens.
Pricesper DIAanty nice sie sre tevee eee rote oierahees $15.00
Ilex Opaca (American Holly)—This is our native
Holly, but is a rare plant in our American nurser-
ies. We expect to have some fine plants for spring
1912 delivery.
BAO CAD LE cto wits decode totes tacks ele ene eee Fiach $4.00
Sieyanetecereyiousls ele ienel axe peneteteneie note Reioncnewe none Each 3.00

pc
t+

fo)

<)
h
cot

Pinus Cembra

Kalmia Latifolia (Mountain Laurel)—A beautiful
native evergreen shrub, with shining foliage and
dense clusters of pink or nearly white flowers in
spring.

TS iit OM Aealvatareene event ween niche hep sheet tee kenRenonS Each $1.50:

Mahonia Aquifolia (Holly-Leaved Mahonia)——A
native species of medium size, with purplish, shiny
prickly leaves, and showy, bright yellow flowers in
May, succeeded by bluish berries. Its glossy foliage
and neat habit render it a very popular plant for
decorative purposes.

BAO) BO) WN acacocanpanodonds Mach $0.75 Per 10 $6.50
US ie) VE Ns SAS ooooGeosO0O" Each 50 Period 4.00

Rhododendron (‘‘Hardy American’’) (Catawbiense
Type)—This class is the hardiest and succeeds in
our climate better than any other. Requires some
protection in this climate from direct rays of sun
during thawing spells in early spring. We handle
only imported plants and of named varieties.

Caractacus—Rich purplish crimson.

Charles Dickens—Dark scarlet, fine habit and
growth.

Everestianum—Rosy lilac, spotted and fringed;
an excellent free blooming sert.

General Grant—Scarlet.
24 to 30 in. high, 15 to 25 flower buds...Mach $2.50
18 to 24 in. high, 12 to 16 flower buds...Each 2.00

Mo.

NURSERY,

Although popularly known as old-fashioned plants, Perennials have never been so popular as they
are at the present time, and we feel safe in saying that a permanent taste has been developed which
is certain to continue and make Perennials as popular in the United States as they have been in the
horticultural centers of Europe for many years. Cultivation is of the simplest, beginning with any good
soil for a foundation, which may be enriched with any good fertilizer, such as well decomposed cow ma-
nure or bone meal, deeply dug, well pulverized, in season as early as possible, so as to enable them to
become well rooted and established before hot, dry weather sets in, keeping the ground well stirred,
and where it is convenient to water beds during hot, dry weather, a mulch of any loose material, which
will keep the soil from baking, will be found very beneficial.

Short grass, the rakings of the lawn after culting, will be as good for this purpose as anything.

A covering of manure should be applied in the fall. This may be forked into the soil early in the
spring, and, beyond this, little care need be given, the occasional staking of a plant, the cutting off
of decaying flowers, which will prolong the flowering season of many species, and the Jividing and re-

planting occasionally of such varieties that have hecome too large, being all that is needed.

The following list has been made with special pains as to worthy varieties, large range of colors and
different styles of growth.

We shall endeavor to add yearly to our list any varieties that we think worthy and diseard such
as we think undesirable.

For such of our customers who are not acquainted with the different varieties we offer collections
of our own selection in lots of 12, 25, 50 or 150 distinct species, that will keep the garden gay with flow-
ers from the time frost leaves the ground until late in the autumn.

SEE “SPECIAL OFFERS”

63

WS

Aquilegia

ACHILLAE. Milfoil or Yarrow

A. Ptarmica fl. pl. (‘‘Boule de Neige’’)
(“Ball of Snow’’)—Flowe1 and habit same as
“The Pearl,’’ excepting that the flowers are

more perfect, with fuller centers, which
makes it appear purer in color. Grows 18
to 24 inches high.

Hache $0.25 ISS0 M5 onanoood $2.25

A. Miltefolium Roseum (Rose - Flowered
Yarrow)—Rosy-lilac flowers, frem June to
August. Grows 18 in. high.

WON Gococedod $0.15 PEE WW oo 50accaas $1.25

A. Ptarmica FI. Pl. (‘‘The Pearl’)—Flow-
ers borne in the greatest profusion the entire
summer on strong, erect stems, purest white.
As a summer cut bloom it is a great acquisi-
tion. Grows 24 in. high.

IDRC Ns 5 ono0 0000 $0.15 12S Wo. c0560 006 $1.25

ACONITUM. Monkshood

A. Autumnale—Deep purplish blue flowers.
Grows 3 to 4 ft. high.
IOEKSl aap oodan a $0.25 AEX) dal visinen oc o $2.25

A. Napellus—Large, dark-blue flowers; Au-
gust and September. Grows 8 to 4 ft. high.
IDEKO NG oo clob oo bb $0.25 IEA Soo d-olci010.0 $2.25

AEGOPODIUM. Bishop’s Weed

A. Podagraria Variegata—A rapid-growing
plant, with neat green and yellow variegated
foliage, thriving in any soil; makes a fine
border for a bed of shrubs or for covering
waste ground. Grows 1 ft. high.

IMAOM, boo asoco0 $0.15 IRI UO oo aoa 6 $1.25

ADONIS. Bird’s Eye

A. Vernalis—Bright yellow flowers, 2 to 3
inches across, in early spring. Grows 12 in.
high.
ete NO Silooa6s $2.25

AGROSTEMMA. Rose Campion

A. Coronaria—Bright crimson flowers on
stems 2% to 3 feet high.
Mache ryercyratcters $0.15 IPE Oiecsteseraietone $1.25

ALSTROMERIA. Chilian Lily

A. Chilensis—A tuberous-rooted plant, 2
ft. high, with spikes of showy flowers, vary-
ing from rosy-white to deep orange-red, flow-

WEBER & SONS NURSERY (© ~5 >
NURSERY, MoO.

54

CO.-

ering from July to September.
in exposed situations.
Hachette cieae $0.15

Requires protection

Pers Ov etsrarerernmets $1.25

ALYSSUM

A. Saxatile Compactum FI. Pl. (Double Gold
Tuft)—An indispensable plant for the rockery or
border, producing early in summer masses of broad,
flat heads of bright yellow flowers. Double; 1 ft.

igh. __ = Boe
Per LOK Gane $1.25

ANCHUSA. Sea Bugloss -

A. Italica (“Dropmore Variety’) —A great im-
provement on the common form; grows 5 to 6 feet
high, with spikes of beautiful _ blue flowers the en-
tire season.

IDEON GA Ggoogenoo ae $0.25 1242) dani AorrcroIe.o.0 $2.25

ANEMONE. Windflower

A. Pensylvanica (Pennsylvania Windflower)—The
prettiest of our native windflowers, producing its
large wnite flowers, which are slightly tinged with
rose on the reverse side, in the greatest profusion
from June to August; an excellent plant either for
the border or rockery, and succeeds equally well in
sun or-shade;.12' to 15 inches‘high. -

1 DEK) heptiaerie iD Oreo $0.15 Per 10 MORO Ooo ols $1.25
ANEMONE JAPONICA. Japanese
Windflower

These beautiful Windflowers are one of the most
important hardy plants. They begin blooming early
in. August and continue until cut -down by frost.
Excellent for cutting, lasting many days in good
eondition:. The- plants grow*2 to 2 feet high and
are perfectly hardy if given several ‘inches of muich
during: the winter.- Ehey- can--be-used. in solid beds
or borders or in clumps FRONEL. the hardy border.

ors “ “att

Cnrysantnermum, Shasta Daisy

ee

fo 2a
Gas

A. Japonica Rubra—Beautiful rosy-red,
bright yellow.

A. Japonica Alba — Large,
choice.

A. Queen Charlotte—Very large semi-double flow-
ers of La France pink, a color that is rare among
hardy plants.

stamens

snowy-white, very

A. Whirlwind — Large semi-double pure white
flowers; very free.
RACE eec tera dia 2 al avavares $0.15 WOT NON ratercrete relebate x $1.25

ANTHEMIS. Marguerite

The hardy Marguerites are among the most sat-
isfactory summer-flowering perennials. In bloom
all summer.

A. Tinct. Kelwayii—Similar to the type but with
deeper yellow flowers.

ORC sce ave eva ctrl bis $0.15 (PGI Ok ave tercsheneve re $1.25

A. Tinctoria—Of dense, bushy habit. with large

yolden-yellow flowers. Grows about 15 to 18 inches
high.
BACH: weretlaccice sieeve $0.15 BETS O Fe trartonctora areca $1.25

Mallow Marvels

ANTHERICUM

A. Liliago (St. Bernard’s Lily)—A pretty species,
hearing spikes of white flowers during May and

June. 18S inches high.

IDE NON AA mick ace Do cn $0.12 PCL ZS eporia ck cteteiets $1.00
A. Liliastrum (St. Bruno’s Lily) — A _ beautiful

plant, 2 feet high, with narrow grass-like foliage

and long spikes of white, fragrant lily-like flowers
in May and June.
IDE Kets aeieoipin ethic clot $0.12 RST Oercte cons cave tare’ whee $1.00

AQUILEGIA. Columbine

The Columbines are old favorites that sueceed in
any ordinary garden soil. The varieties offered are
a selection of the best kinds; 2 feet high.

A. Canadensis (Common American Columbine)—
The native bright red and yellow varicty, and one
of the brightest.

IDE Kato Gromer + $0.15

WEBER. & SONS NURSERY
NURSERY, MO.

—5 ~~

G
A. Chrysantha Alba—A _ preity white flowered

form,

IDE Kolo ho oaoun eco od $0.15 Aylin Slows 6.5 Gone o Ea Leis)

A. Coerulea—This is the true blue form of ‘Rocky

Mountain Columbine,’’ one of the handsomest of
the family. ,
Blaichinis etescieistarsiccals $0.15 IPOreliO nena eitetet tant evs $1.25

A. Chrysantha — The beautiful goiden-spurred

“Columbine.’ Flowers golden yellow; blooms in

the early spring.

1SEVO ein Oia codon rc $0.15 lee MN oo couudaga. $1.25
A. Nivea Grandiflcra— A beautiful large pure

white.

IDK ley Gananeo nia UIl $0.15 eA ganas uoaeo oT $1.25

ARENARIA. Sand-Wort

Close growing evergreen plants, desirable for rock
work.

A. Montana—Large, white floyvers, produced very
freely, in early spring, 6 to S inches high. :
BAI Nes Wrcianns ooo $0.25 MDE ss0occdc0e0s D225

ARMERIA. Thrift

Dwarf plants; succeed in any soil; flowers
in dense heads, on stiff, wiry stems about 9
inches high. In bloom off and on from early
spring until late fall. Sine for rockery or
borders; 9 inches high.

A. Maritima Splendens—Bright, rosy pink.

A. Maritima Alba—A pretty white.

IDIOM Gago ndc do $0.15 ese UM gesoance $1.26

ARABIS. Rock Cress

A. Alpina-—Desirable early spring floweriug
plant, adapted to the rock garden and border;
forms a dense carpet, completely covered
with pure white flowers early in the season;
6 inches high.

ACHE eS O15 ere Oleecetars $1.25
A. Alpina FI. Pl.—A distinet and pretty

double-flowering form.

IRE 6 oboe 0 aa $0.15 ete WHS corn do coo $1.25

ARTEMESIA

Fine for the border or among shrubbery,
foliage ornamental, can be used for carpet or
ribbon bedding; permits of cutting back.

A. Abrotamnum (Old Man)—Dark green,
finely cut foliage, with pleasant aromatic
odor; 2 feet high.

A. Stellariana (Old Woman)—Deeply cul
silvery foliage; much used in carpet bedding;
18 inches high.

IPersOer ria ie $1.25

IS AOnes Sageon an $0.15
ASCLEPIAS. Butterfly Weed
A. Tuberosa—Very showy, producing from
July to September; close, compact umbels of
brilliant orange colored flowers; 2 feet high.
IBEVC) hse en OO OCOD $0.15 Ite ales wae aces $1.25

ASTERS. Hardy Alpine

Fine for the rockery or hardy vorder; large,
showy flowers in May and June.

A. Alpinus Superbus—-A fine bijue, very free flow-
ering; 6 to 10 inches high.

A. Alpinus Albus—Pure white, 3 to 10 inches high.
Wreaclarpereerrscelen sierra $0.15 IR SrslOpye mer rctstersiene $1.25

ASTERS. Hardy

Michaelmas Daisies or Starworts

These are among the showiest of our late-flow-
ering hardy plants, giving a wealth of bloom at a
season when most other hardy flowers are past.
The collection offered below is made up of the
choicest varieties, only the weedy sorts being elim-
inated.
2 ae Pee SEnus -uevely amethyst-blue flowers;
3 feet.

A. Laevis—lI.avender blue; 4 feet.
A. Mrs. F. W. Raynor—Light reddish violet; 4 ft.

a Novae Anglae Rosea-—Bright purplish-manve;
4 feet.

A. Novae Analiae—Bright violet purple; 4 feet.

A. Robert Parker—Large sprays of beautiful lay-
ender blue flowers, with yellow center; 4 feet.

_ A. Ptarmicoides Major—-Distinct, pure white, fine
for cutting. August and September; 18 inches.

A. Tartaricas—Distinct; bluish viclet; 6 feet.
A. White Queen—Large white; very free; 4 feet.

WEBNS oo0nd0000006 $0.15 IRON on oapcocap oT $1.25

ASTILBE :

A. Davidii— An important addition to hardy
plants. Its 5 to 6 feet high stems, which rise from
a tuft of pretty dark green foliage, are crowned
with feathery plumes of deep rose-violet flowers
during July and August.
WEAN So oo6 mieneeerers $0.25

BAMBUSA. Bamboo

Fine for single specimens or in clumps and
for sub-tropical gardening, or with orna-
mental grasses. They are also valuable for
aquatie gardening.

_B. Aurea—A distinct and beautiful spe-
cies; vellowish stems and light green foliage.
Grows 15 to 20 feet high.

WES Mirenolon ooo OuD OO Ob Oc SoUnOUeDO DS $1.00
B. Metake—A handsome evergreen species:

TAREE, deep green foliage; grows 6 to 10 feet

1g

JDK) 0 Wer currin orc Ce clee raait oxcitra CHORD SOT SSG Ol $1.00

BAPTISIA. False Indigo

B. Australis—A strong growing plant, suit-
able either for the border or wild garden.
Foliage dark green, deeply cut, and spikes
of dark blue flowers in June and July; 2 feet
high.

RWOLOS coscowcd $1.25

B. Tinctoria—Produces spikes of bright
yellow flowers during June and July; 2 to 3

feet high.
RON Ss oob sb ul06 $0.15 PereliOeieiiedererni plac:

BELLIS PERENNIS. English Daisy

Flowers double, white and pink.
BEVIN SGoooDO 08 $0.19 SIRE HORS 6 Son do = $0.50

BOCCONIA. Plume Poppy

B. Cordata—A noble plant, beautifui in fo-
liage and flower; adapted for planting in
shrubbery borders, centers of beds and in
bold groups. Fiowers in terminal panicles;
of a creamy white color, during July and
August; 6 to 8 feet high.

WAO Ns A oo 66 bo ote) RW WOsGoooun os $1.25

BOLTONIA. False Chamomile

Among the showiest of our native hardy
perennial plants. with large single aster-like
flowers. The plant is in bloom during the
summer and autumn months, and with its
hundreds of flowers open at one time produces a
very showy effect.

B. Latisquama—Pink, slightly tinged with lav-
ender; 4 to 5 feet high.

BEN olpatateen ns eeestey Bis $0.15 PerwMORmrancnee $1.25
B. Asteroides—Pure white, very effective; 4 to 5

feet high.

My aChisereteis cvoveaceckonete $0.15 IMA MOS Sbooneeo0 oo $i. 25

CALLIRHOE. Poppy Mallow

C. Involucrata—An elegant trailing plant with
finely divided foliage and large saucer-shaped flow-
ers of bright crimson, with white centers, produced

all summer.
IDEKS ol MGcme eo OOD $0.15 BerslOisicreroclevsecee ot SEZ,

CALTHA. Marsh Marigold

Cc. Palustris—Bright yellow flowers early in
spring; 1 foot. ~
IBV 5 So oon on woh itis) Perr Oia conte S20

66

C. Palustris Fl. Pl.—Double flowering.
$0.25 Pr giO:sccimnteteg keener $2.25

CAMPANULA. Bell Flower

The Bell Flowers are among the most important
of the hardy plants, conm:bining a wide range of
habit and color with perfect hardiness

C. Grossekii—One of the prettiest of the Canter-
bury Bells, of erect habit, with dark blue flowers;

2 feet high.
IDEKO yn a Ove eee: $0.15 IP Creel ORrete tetera $1.25

C. Persicifolia (Peach Bells)—Blue salver-shaped
flowers during June and July: 2 feet.
WENA aoc bane ODD $0.15

IPeril0n tech eee $1.25

Double Hollyhocks

but with single white flowers; very pretty and free
flowering; 18 to 24 inches.
PCr Okeencpckersnee terete $1.25

C. Pyramidalis (The Chimney Bell Flower)—The
most conspicuous of all Campanulas, and an at-
tractive plant for herbaceous border, forming a per-
fect pyramid 4 to 5 feet high, crowded with large,
salver-like blue flowers.
1EXVE IN ots Oobae Cc! $2.25

C. Medium Calycanthema Blue (Cup and Saucer
Canterbury Bells).

C. Medium Calycanthema Rose (Cup and Saucer
Canterbury Bells).

C. Medium Calycanthema White (Cup and Saucer
Canterbury Bells). i

The Medium Calycanthema Canterbury Bells are
a beautiful form of this favorite flower.
$ IWAN Goad d a oo $1.25

oo - ES
+ i ae

Gs -\, WEBER & SONS NUR :
A BS" nursery mo. CO#_ I

Iris Germanica

Cc. Carpatica—A pretty species, growing in com-

pact tufts, not exceeding 8 inches high; flowers
clear blue.
OF 4s ene mi eer erereisn OLD eras Ole reve rel pteteiele ter: $1.25

Cc. Persicifolia Gigantea Moerheimi—A_ grand,
new sort, with large spikes of puré white double
camelia-like flowers, 2 to 2% inches in diameter; in
bloom from the middle of May until July.

OF Ke) eo soib ctarciotieino $0.25 IPO Olarrerselcccrsy a cceke $2.25
CARYOPTERIS
Cc. Mastacanthus (Ilue Spirea) —A handsome,

hardy perennial plant recently introduced from
China. It is of vigorous growth, producing flowers
in great profusion the whole length of its branches,
even young plants in small pots flowering freely.
The color is of rich lavender or sky blue. A val-
liable plant either fur bedding or pot culture, bloom-
ing continuously from midsummer until cut by frost
in the fall; 3 feet high.

SELON ePIAMESs sayarket ote dttka cele Each $0.25

CENTAUREA. Hardheads or Knapweed

in open, sunny position,
display

Per 10 $2.00

Of easy culture, delight
producing a wealth of bloom, make a fine
in the border, or for cutting.

C. Macrocephala—Very large thistle-like golden
yellow flowers, useful for cutting and showy in the
border. July and August.

C. Montana Alba (Perennial Corn Flower) —
Grows 2 feet high, bearing large white flowers from
July to September.

CERASTIUM. Snow in Summer

Cc. Tomentosum—A desirable, low-growing plant
with silvery foliage and white flowers, suitable for
athe rockery or for covering graves or steep banks;
‘an also be used for carpet bedding.

Ber Of ratrel res survenes SL re

CHRYSANTHEMUM. Moonpenny

Daisy
Cc. Maximum ‘“Triumph’’—A free-growing. plant,

not exceeding 3 feet in height; in bloom from early
July until Oetober. Flowers Daisy-like, 3 inches

and over in diameter, pure white, with a golden
center; of great substance; will last a week or more
when cut,

aC Leriemacyaterelersietris $0.15 12f Alo odioomeo COD $1.25

provement on the original, very free |

blooms 4% to 5 inches across, of pure white.

EKA DA Coane OOCOC $0.20 2 Or Ovarcdevatatensdtaensts $1.75
C. Shasta Daisy—Large, snowy-white flowers, 4

inches across; in bloom all Summer; a good cut

flower variety.

IGEKelabs a6 trOvOIOIDODO O $0.15 FROTHHUO Veretedeiesshovater oUev'e $1.25

CHRYSANTHEMUM. Hardy Pompone

This class of beautiful plants is now so univer-
sally popular for out-door bedding, and justly so.
They produce a lavish profusion of blooms, giving
color, life and beauty to the garden at a time when
other plants have been nipped by frost. They are
quite hardy, but it is well to give a slight covering
of leaves or manure during winter. Grow from 2
to 3 feet high.

Baby—A miniature flower; color lemon-yellow.

Cerise Queen—Cerise pink.

Eagle de Or—Fine golden yellow.

Golden Queen—A fine yellow.

Golden Fleece—Clear yellow.

Indian—Reddish purple.

Julia Lagravere—Rich garnet.

Pettilant—Creamy-sulphur.

Pompon Blush—Blush pink.

Princess of Wales—A fine white.

President—Rich purplish crimson.

Queen of Bulgaria—Rich rose-crimson.

Snow Clad—A fine white.

Soeur Melanie—Pure white.

Strathmeath—Rosy pink.

Victor—Rosy Crir
Fach $

Ww

Rerall Olver swuweeere et $1.2

New English Collection
For a number of years we have been trying to
get a Set of this beautiful fall blooming plant that
would nroduce larger individual flowers than the
Pompons and come to blooming earlier in the sea-

5

Iris Kaempferi

67

son. last spring we received this collection from
England and are pleased to say that in time of
blooming, size of flowers and colors, they are per-
fect. We expect to have a limited number of plants
of each variety to offer for spring 1912 delivery.

Hilda Blick Goaches Crimson
Bride of Keston La Pariesienne
Beacon Vivian Prince

R. Pemberton Estolb Yellow
Fee Japonaise Ralph Curtis

We offer the set of ten varieties for..........$2.00

CLEMATIS. Shrubby

C. Recta—A fine variety, growth erect, with
handsome, pure white flowers in large, showy clus-
ters; June and July; 2 to 3 feet high.

Ma chiewr meatier. ROR IASC WDsceodsdadgase

C. Davidiana—A. most desirable variety; fresh,
bright green foliage and tubular bell-shaped flow-
ers of deep lavender blue during August and Sep-
tember. Fragrant. 2 to 3 feet high.

DAaCchysch sie watee $0.15 Per 10

COREOPSIS

C. Lanceolata Grandiflora—This handsome vari-
ety is now probably the most popular perennial
plant in cultivation. It begins to flower early in
June and continues in flower until cut down by
severe freezing weather. It is continually one mass
of golden-yellow. It is easily grown, is perfectly
hardy and succeeds in almost any position, and
after once planted takes care of itself. The flowers,
which are of graceful form, are invaluable for cut-
ting -for decorative purposes; 18 inches high.

po0D0DDGDDODD 5 IWS MUD scaacdooono oslo

CONVALLARIA. Lily of the Valley

A lovely little hardy perennial, widely planted
everywhere for its delicate sprays of drooping wiiite
bells and their delightful fragrance.

Strong clumps Each $0.25 Per 10 $2.25

DELPHINIUMS. Hardy Larkspur

The hardy Larkspurs are one of the most im-
portant and most satisfactory plants in the herba-
ceous garden, and should be planted extensively
even in the smallest garden. Their long spikes of
flowers are procuced continuously from June unti!
late in the fall, if the precaution is taken to re-
move the flower stems before they can produce
seed.

D. Chinense—A. very pretty and effective variety,
with large, open panicles of handsome flowers,
varying in color through all the lighter shades of
blue to almost white; should be in every collection;
18 inches high.

Wa chimera ae $0.15 IPGrsll0) acca tonnes $1.25
D. Chinense Album—A pure white form of above.
IDEOMNE ooo ou occouG $0.15 12a es Siobo 0 olg.o 6 $1.25
D. Formosum—Probably the best known and

most popular of the lLarkspurs, producing long
spikes of deep blue flowers, with white eye; one
of the best; 3 to 4 feet high.

SrA OOOO 30.20 (RErsliOleprernrcseeentae ledeD

D. Belladonna—Cannot he recommended too high-
ly on account of its large, lovely sky-blue flowers,
which are heightened in richness by a distinct sil-
very sheen; remarkable free-flowering; beginning
in May, it continues a mass of bloom until late in
fall; 3 to 4 feet high.

IDEVElNln Gg solad can bors $0.25 Per 10

D. Gold Medal Hybrids—One of the finest strains
of mixed hybrids, consisting of the best named va-
rieties. The plants are of strong, vigorous habit,
with large flowers in spikes two feet and over long,
the majority running in the lighter shades of biue.
DEI cian. Gioia eo $0.15 Per 10

D. Sulphureum—An attractive species and entire-
ly distinet; strong, branching habit, forming a
pyramidal bush composed of stiff, wiry stems cov-
ered with pure sulphur-yellow flowers about an
inch in diameter; 3 to 4 feet high.

IDE Ola aetna oA $0.25

$2.25

R & SONS NURSERY (5 —~c
NURSERY, Mo.

68

CO =F

DIANTHUS

D. Barbatus Single Mixed (Sweet William)—Too
Well known to require description. Grown from
choice strain, mixed colors; 13 to 24 inches high.
ISENO narrates aces Cece $0.15 Per 10 $1.25

D. Double Giant Mixed—A fine strain of this
popular flower.
IBA Ne iG omidne b6.g0e0 $0.15 PEO yopeusletareenel tote $1.25
Named Varieties—Holborn Glory, Single Violet,
Single Red, Single Crimson.
EGAIGM Sn ohereneha san chalets $0.20 Per LOW. ee ease $1.75

DICTAMNUS. Gas Plant

A very showy border perennial, having fragrant
foliage and spikes of curious flowers, giving off
during hot weather a fragrant volatile oil, whicik
ignites when a match is applied to it.

D. Fraxinella—Showy, rosy-pink flowers, with
deeper veins: 18 to 24 inehes high.

D. Alba—Pure white; 18 to 24 inches high.
IDE Wel eh pse arin ce dicho $0.15 Per Lomi cwsershenene LS 2'>.

Lilum Tigrinum (Lily)

DIELYTRA OR DICENTRA

D. Spectabilis (Bleeding Heart or Seal Flower)—
Adapted for oui-door planting, doing splendidly in
semi-shaded position or for forcing for early spring
blooming. It bears long racemes of graceful, heart-
shaped pink floyrers; 18 inches high.

IDEN ou aca ato oshUE lS Per T0)Nic> ates neat $1.25

DIGITALIS. Foxglove

D. Gloxiniaeflora—The old fashioned Foxgloves
are always pretty. We can supply them in the fol-
lowing shades, 8 to 5 feet: White, Purple, Lilac,

Fc ids |

Rose.

IDES Wile gue Odeon $0.15 IE) QING ook bo oe $1.25
D. Maculata Superba—A superb variety.

DOE el obs Sr ateaP nmr E A hit) $6.15 Per LO see rare $1.25

D. Montrose Mixed—An excellent strain of this
popular flower.

HEEEKO! Od Semoccr a eae Ont $0.15 Per l0.ctk.ceee eee $1.25
D. Grandiflora—Showy flowers of pale yellow,

veined brawn.

DEVE Neca d ho onoone ohMOs IG Perle oaoeranee $1.25

<

7 a Ss ~ ss

| WEBER. & SONS N

Ta SS“

DORONICUM. Leopards Bane

D. Excelsum-

—Large, orange-yellow flowers; very
effective, early flowering perennial: height about
i8 inches.

IRAN rit, c¥ al obs: chele) a's $0.25 te Goto OL OT eo $2.25
EUPHORBIA. Milk Wort
E. Corollata—-A showy plant, in bloom from June
to August. Flowers in umbels, pure white. with
small green. eye; desirable for cutting; 18 inches
high.
LOC Tho aT Ae Oe eece $0.15 PGrUO Maite e ielevors tlee

EUPATORIUM
_E&. Coelestinum—A pretty, hardy plant, with
light blue flowers similar to the Ageratum; begins
to flower in July and continues until frost; a most
desirable and showy plant, and a color that is al-
ways scarce; 18 to 24 inches high.

_ E. Ageratoides—A useful border plant, of strong,
free growth, with minute white flowers in dense
heads; August and September; 2 to 4 feet high.

LOE KON mare artnet oeci6 £0.15 IHU s aesax Ton oot)

Paeonia

(Festiva Maxima) (Page 7

FUNKIA. Plantain Lily

broad green leaves; 18 to 24
inches.
F. Subcordata Grandiflora— Pure white, lily-

shaped, fragrant flowers; borne in
12 to 18 inches.

F. Undulata Media Picta—One
gated leaved plants; fine for
flowers; 12 to 18 inches high.

NEKO 6 Omidoe aoe DIA $0.15 Crh Okeersvenet cher eyeravae

GAILLARDIA

G. Grandiflora—Gaillardias are among the show-
iest and most effective of hardy perennial plants.
Beginning to flower in June, they continue one
mass of bloom the entire season. They will thrive
in almost any position or in any soil, but respond

large clusters;

of the best varie-
edsings; lavender

URSERY | =~
NURSERY, MO. (CO f ak

69

freely to liberal feeding. Being perfectly hardy,
they require absolutely no protection, taking care
of themselves. The flowers are large, from 2% to

81% inches in diameter. They are produced on long
stems and are excellent for cutting, and of the
most gorgeous colorings. The center is dark red
brown, while the petals are variously marked with
rings of brilliant searlet crimson, orange and ver-
million, and often a combination of all these colors
in one flower; 18 to 24 inches high.

DEK ping. ot OGue6 Do $0.15 Ord OVsararereteictetercen

GERANIUM. Crane’s Bill

G. Sanguineum—A desirable plant either for the
rockery or border, with pretty cut foliage, forming
a compact bush with bright crimson-purple flowers,
and continues in bloom from early in the summer
until late in the autumn; 18 inches high.

ACH istetctetaileieitrerats $0.15 Or Oat tote ace tales hers $1.25
G. Coccinetum-—A pretty border plant,- producing

large, dazzling, intense scarlet flowers during most
of the surinmer and fall months; 2 feet high.

Each 30.15 Sra OP irger ster avevanesevere $1.25

GYPSOPHILA. Baby’s
Breath

G. Paniculata—A beautiful, old-
fashioned plant. It forms a sym-
metrical mass 2 to 3 feet in height

and as much through, of minute
pure white, gauze-like flowers.
Valuable for cutting. August and

September.
WEE. 4 506 $0.15

G. Paniculata fil.

Pr UM aoe SWE
pl.—A new dou-

ble flowering variety of the above.
IDE te Goo a $0.25 Per10.... $2.25
GRASSES
Hardy Ornamental
For single specimens, beds or
groups on the lawn nothing gives

a finer effect than these. They are
now largely used in prominent po-
sitions in many of the public parks,
etc,

Arundo Donax—Will grow from
15 to 20 feet in this climate: must
be covered in winter with light ma-
nure or old hay, enough to keep
frost out. Poles should be cut be-
fore covering in fall. Beautiful for
center in large group of ornamental
grasses or hiding unsightly objects.
Will multiply yearly by sending up
new canes.

Bach... . $0.25 Perl10.... $2.25

Arundo Donax Variegata —A
beautiful variegated form of the

above. Foliage creamy white and

green, erowing 6 to 8 feet high

BEON GoocgooanoocnoocoadoUd $0.35
Erianthus Ravennae-—Grows from 8s to 12 feet

high, frequently throwing up from 380 to 50 flower
spikes. It resembles the Pampas Grass, but blooms

more abundantly.

Clumps Each 25c¢e and 50c

Eulalia Gracillima Univittata—Of compact habit.
with very narrow foliage, of a bright green color,
with a silvery mid-rib; 4 to 6 feet high.

Clumps Each 25¢e and 50c

Eulalia Japonica Variegata—A very graceful, tall
variety, from Japan. Its long, narrow leaf-blades
are striped green, white and often pink or yellow.
It throws up stalks from 4 to 6 feet in height, ter-
minated with a cluster of flower spikes.

Clumps ach 25¢ and 50c

Eulalia Japonica Zebrina (Zebra Grass)—The long
blades of this variety are marked with broad, yel-

NURSERY, MoO.

Paeonia (Fringe Leaf) (Fage 74)

low bands across the leaf. It makes a very at-
tractive specimen plant for the lawn; 4 to 6 ft. high.

Clumps Each 25¢ and 50c
Festuca Glauca (Blue Fescue)—A pretty dwarf

tufted grass, with glaucous foliage.

doD0GDooDDDOD €0.15 IHD UNE Gadloc coco ol BS)
Gynerium Argenteum (Pampas. Grass)—One of

the most effective. Its silvery plumes are produc-

ed on stems 8 to 10 feet high. Well established
plants can remain in the open ground if protected.

Clumps Each 25e and 50c
Phalaris Arundinacea Variegata (Variegated Rib-
hon Grass, or Gardener’s Garter)—Large variegated

foliage; an excellent grass for bordering large beds;
18 to 24 inches high.

Clumps

Bach 15e and 25e

HARDY FERNS

In almost every garden suitable positions can
be found for a tew Hardy Ferns. They do best in
shady or semi-shady positions, in rich but well-
drained soil, where they can be liberally supplied
with water during dry weather. Ground should be
enriched with a liberal quantity of leaf-mold, peat
or other like material. :

Pet-grown plants Bach $0.25 Per10 $2.00

varieties that require’ shade.

*Denotes
**Denotes
places.

*A3pidium Goldianum (Shield Fern)—24 to 36-in.

=kAsplecium Felix-Foemina Victorine (Queen of
Lady Feens)—12 to 15 inches.

**Asplenium Felix-Foemina Multifidum—12 to 15
inches, : Z

=*Asplenium Felix-Foemina Setigerum—15 to 18
inches.

*kLastrea Felix-mas (Male Fern)—15 to 2S in.

**Lastrea Dilitata—1S to 24 inches.

**Onoclea Struthiopteris (Ostrich Fern)—24 to 36
inches.

**Osmunda Cinnamomea (Cinnamon Fern)—24 to
36 inches.
“*kPolystichium Braunii—15 to iS inches.
“*Polystichium Setosum—12 inches.
Polystichium Lobatum—15 to 18 inches.

varieties that succeed in half-shady —

HELIANTHUS. Hardy Sunflowers

The perennial Sunflowers are among the most
effective hardy plants for large borders, for plant-—
ing among shrubbery or as clumps on the lawn-
They are remarkably free flowering, will succeed
in any soil, and are invaluable for decorative pur-
poses as cut flowers during the summer.

H. Maximilliana—A most graceful single-flower-
ed variety, growing from 5 to 7 feet high, con-

tinuing in bloom very late in the season. The flow-

ers are produced in Jong, graceful sprays, whiclr

make it invaluable for cutting purposes.

BBO ls voocapoudesc $0.15 IPOH Uo soancsodou- $1.25
H. Davidiana — Lemon - vellow, single flowers

about 3 inches in diameter; narrow petals, vere

distinet; 8 to 10 feet. August.

BAG ccoocnacc0a0 $0.15 IRE IOs oon 5c0 000 Ks $1.25

H. Soleil d°Or—Deep golden-yellow, quilled petals.
not unlike a Dahlia; 4 feet; August and September

Each $0.15 Per 10

_H. Orgyalis—A tall variety, with medium-sized,
single golden yellow tlowers during September; 6 ft.
PIDG iiss. veteteietereeione $0.15 Per 10 $1.25

HELENIUM. Sneeze-Wort

_H. Autumnale Superbum—Grows from 5 to 6 ft-
high, with broad heads of deep golden yellow flow-
ers during late summer.

WENO Sag asoKKaKO8 $0.15 Perl 0s eee

H. Rivertcn Gem-—Covered from August to Octo-
ber with brilliant old-gold suffused with bright
terra-cotta flowers, changing as they mature to 2
wallflower red; 2% to 3 feet. ‘

$0.25 Per Li. 42 nee $2.25

H. Riverton Beauty—Flowers rich lemon-yellow,
with a large cone of purplish-black, the two colors.

forming a most pleasing combination. Strong vig-
orous grower. 3 to 4 feet.
IWEKO Nobo om cotkocioo $0.25 Per sli0)..2 iste Seercnerecoee $2.25

_H. Pumilum Magnificum—A useful summer an@
fall-flowering perennial. growing about 18 inches
high and almost smothered with its golden yellow
blossoms.

Per dO vase $1.26

Paeonia (Dorchester) (Page 74) ~

Oriental Poppy (Page 75)

HELIOPSIS. Orange Sunflower

Similar in general habit to Helianthus, but com-
roencing to flower early in the season; of dwarfer
habit, rarely exceeding 3 feet in height; very valu-
able for cutting.

H. Pitcherianus—-A desirable, hardy herbaceous
plant, growing from 2 to 3 feet high and a per-
petual bloomer, beginning to flower early in the
season and continuing in bloom the entire summevr.
The flowers are of a beautiful deep golden-yellow
color, about 2 inches in diameter, of very thick
texture. and are very graceful for cutting.

WM aAchisinc, sete cn $0.15 HP OTAl Olea srereheusners $1.25

HEMEROCALLIS. Day Lily

H. Fulva (Yellow Day Lily)—A most useful and
desirable herbaceous plant, producing its large,
fragrant, yellow flowers during July and August in
the greatest profusion. The plants grow about 3

feet high.
IDEN RED A Oe orca $0.15 SIE L Olporareveuexevesciareve $1.25

H. Fulva fl. pl. (Double Orange Lily)—A double
flowering form of the Orange Lily, and a most de-
sirable herbaceous plant, that deserves being plant-
ed very largely: large orange-colored flowers shad-
ed copper; bloom the greater part of summer; 30
to 86 inches high.

AGH rate tester $0.15 IPOr UO rey sueveieresctevccate $1.25

H. Aurantiaca Major—-One of the finest flowers,
fully 6 inches in diameter, color a rich Indian-yel-
low throughout; in bloom from the end of June to
the close of July; height 2 feet; requires protection
in winter.

SHE Ke) Neeru OO On G $0.25 FPO, U0) oie eye fsxereiateress $2.25

H. Dumortieri—Very dwarf, rarely exceeding 20
inches in height, beginning to flower the first of
June, continuing throughout the month. In color
a rich cadmium yellow, buds and reverse of petals
bronzy-yellow.

LAE Forel ae chp Dene Coe AH

HEUCHERA. Alum Root

Desirable dwarf, compact, bushy plants of robust
constitution and easy culture, growing 1% to 2 feet
high and bearing during July and August, loose,
sraceful spikes of flowers in the greatest profusion.

, iy) WEBER & SONS NURSERY (9 5
fis wurserywa SOC COL

ee

7

YS

Fine for the rockery or border and of value for
cutting.
H. Sanguinea—Bright coral red.

IDpvelle GacidagAcoacy $0.15 Per 10

HESPERUS. Sweet Rocket

H. Matronalis—A_ strong - growing perennial,
forming stout, bushy plants 3 to 4 feet high, with
showy terminal spikes of pink flowers during June
and July.

DEK eons bh Les SO OI $0.15 ie{-ycha (0 ecareuencegia.certoronn $1.25

HIBISCUS. Mallow

A desirable border plant, with large foliage and
large, showy flowers of delicate coloring, produced
during the entire summer. :

New Mallow Marvels

This remarkable plant was introduced a few
years ago and has been widely sold throughout the
United States, giving the best of satisfaction. The
individual flowers are very large, often ten inches
across. Plants begin to bloom about mid-summer
and continue for a long time.

\We have a nice stock of Red, Pink and White.
The Reds and Pinks come in various shades.

pio CLahe ton eed

Red Mallow ............ ... Hach $0.75. Per 3 $2.00
IPajetke WIENS AGocccaanoOd SolDEdelet Ata) exes} ale)
White Mallow .......... so otSAOR § {ét5) ese BR} Io)

H. Moschuetcs (‘‘Crimson”’ Eye)—Flowers of im-
mense size, often measuring 20 inches in circum-
ference. The color is of the purest white, with a
large spot of deep velvet crimson in the center;
4 to 5 feet high.

BEKO No ooogoanpo perp Oslo IRD MOG goog bono $1.25

H. Moschuetes (Swamp lose Mallow)—Flowers

¢ inches in diameter, of a light rosy-red color, with
darker eye; 4 to 5 feet high.

RV cision ocho kuo Hd $0.15 IRQE MD coon eagooon $1.25

Platycodon (Page 76)

HOLLYHOCKS. Superb Double

Few hardy plants combine as many good quali-
ties as the Hollyhock. For planting im rows or
groups on the lawn, or for interspersing among
shrubbery, they are invaluable. The flowers form
perfect rosettes of the most lovely shades of yel-
Jow, erimson, rose, pink, orange, white, etc. The
Hollyhock requires a rich,-deep soil, well drained,
and will repay in quantity and elegance of bloom
any extra care. A _ slight protection during the
winter will be beneficial. We offer extra strong
one-year-old clumps that are certain to produce
grand spikes of flowers this season.

Double—White, Pink, Salmon, Yellow, Maroon

and Red. Grow 5 to 6 feet high.

Each Peri19
Named colors ..... Tenor oboe econo £0.20 $1.75
IDOE WubGel ogonseooonsoosocdsnoudd oil 1.25
Sinelemimixecdeeyn newer cerweac ties neater oll} TE BS
Allegheny doublte-fringed mixed...... oils 1.25

r

Hardy Phlox (Page 75)

IBERIS. Candytuft

innumerable

flat
heads of pure white flowers during April and May;
8 to 10 inches high.

ACN bolocbagu0ccs $0.15

1. Sempervirens —- Produces

IRE UD, Gooans00000 $1.25

INCARVILLEA. Hardy Gloxinia

1, Delavayi—Of recent introductions this is one
of the choicest. It prvuduces large Gloxinia-like
rose-colored flowers, which last in perfection a
long time; these are produced in clusters on stems
18 inches high; succeeds in sun or shade, but
should be protected with a covering of leaves dur-
ing the winter.

inachtene etree $0.15 EE RaKN Sos Gan Sono $1.25

IRIS GERMANICA. Fleur de Lis

The German Iris is one of the most desirable
early spring flowering plants. The flowers are of
large size and exquisite colors. No garden should
be without a collection of these popular flowers.
We have a fine list of varieties. Grow about 2 to
2% feet high, unless otherwise mentioned.

<> 2-25) WEBER & SONS NURSERY (_*—~—"_
\: NURSERY, MO. :

CO. E

ey

1. Aurea—Clear golden yellow; tine.

Il. Bougere—JLilae and velvety purple;
18 inches.

I. Celeste—Delicate light lavender blue.
1. Common Purple—Purple; ene of the best.

I. Florentina—White, tinged with blue and yel-
low; 2 feet; May.

Il. Hector—Light bronze, stained with purple; fine.

1. Jacquesiano—Deep maroon velvet, tinged with
bronze and crimson; a rare and remarkable color;
2 feet. June.

1. Jordain—Deep purple, shaded with rose.
I. L’Avenir—Lavender, a beautiful shade.
1. Liabaud—Yellow and maroon; fine.

1. Louis Van Houtte—Salmon, tinged and striped
with purple; 2 feet. June.

I, Madame Chereau—Clear white, handsomely
feathered and bordered with blue; undulated edge.

|, Pancrea—Buff and purple; distinct; fine.

I. Pumila—Bluish purple; first to flower; 3
to 6 inches. April and May.

Il. Sampson—Rich golden yellow;
maroon veined with white; fine.

I. Sappho—Clear blue and indigo; beauti-
fully blended.

}. Silver King—Flowers silvery white, dis-
tinet and fine.
INaiImed:at eaten Goscceldte nd Fach $0.15
IMD cll recessive foee Hach .10

distinet;

crimson

Per 10 $1.25
Perl10 .80

New Additions to Our List of Irises
1. Pallida Mandraliscae — Rich layender-

purple, handsome very early variety.

BEKO AG OAD DOS $0.25 IEtsiealWeais ob an-c $2.25
1. Pallida ‘“‘Aibert Victor’’—Large and fine,

falls beautiful lavender, standards soft blue.

IDEKONS Goo a obUOS $0.25 EE Clea O}evcleretoteretere $2.25

1. Pallida Dalmatica—Flowers very large
and fine; standards fine lavender, falls deep
clear lavender; a Superb variety, very scarce.
WAC. ooo0cb000 $0.30 Perlor creiercn $2.75

|. Germanica ‘‘Mrs. H. Darwin’? — Pure
white, very beautiful and free flowering, falls
slightly marked with violet at the base; 2 ft.

IDRC, Gh xoodone $0.15 IFDANDS o Goce $1.25
1. Germanica Parisiensis—Large, showy,

deep purple, delicately penciled white.

TEIN so codoauac $0.15 Per 10.2. .cepae2D
{. Cristata (Beardless JIris)—A dainty

creeping species, grows only 3 to 4 inches
high; flowers rich amethyst-blue; fine for the
rock garden.

ISAVO Me.cguie weaeo $0.20 Per Oh a0 ereteners $1.75

IRIS KAEMPFERIL Japanese Iris

These magnificent Irises are among the most
beautiful of our summer-flowering plants, and are
destined to become more popular every season. They
commence blooming about the middle of June and
continue in bloom for five or six weeks. Many of
these flowers measure from 10 to 12 inches in di-
ameter, and rival the orchids in their rich color-
ings and markings. While the Iris succeeds in al-
most any soil, and under any conditions, they de-
light in a rich, deep, wet position, and should be
abundantly supplied with manure and water. Grow
about 30 to 36 inches high.

Double Flowering or Six-Petaled
Japanese Iris

&8 Taiheiraku—Ten petals, crimson-purple with
yellow centre.

20 Kuma-funjin—Silvery-white, with a broad
border of magenta-lilac veined with white.

26 Uchiu—Bright purple with crimson sheen.

«eat dg ntiche

a an
4 HS

2...

Yoshimo—Very large flower;
delicately veined with violet.

creamy-white,

ts Fuji-mine—White, veined with deep purple.

72 Uji-no-hotaru — Bright violet-purple; shaded
blue.

91 Kan-ran—White, densely veined with rich

violet-purple.
Nacano—Rich violet-purple; shaded with blue.

Shimosa—-White ground, minutely and densely
spotted throughout with bright violet-purple.

dNncatidoss suace $0.25 1a G A seo tito ater)

Imperial Double Japanese Iris

Tokyo —Six large round petals, forming a
beautiful open flat flower of purest white;
the finest double white Iris grown.

OP ae dagen ooat $0.25 er NO ee lecc stele aie Goa

Single Flowering or Three-Petaled

Japanese Iris
Hano-no-nishiki—BPright violet-purple, veined
with white.
i2 Shippo—Light lilac, densely veined with pur-

ple.
15

107

11

5 Gekka-no-nami-—A very early pure white.

7 Yayaura—WwWhite, veined and dotted through-
out with violet-purple.

Tebotan—WWhite ground with prominent vio-
let-blue veinings. °
Osakazuki—Bright violet
shadings.
Komanyo — Bright violet, shaded with blue,
numerous white veins and markings.
Yomo-zakuru — Light ground color,
veined and suffused reddish-purple.
$0.25 IPSralORreretcr) sretere

Imperial Single Japanese Iris

Oyodo—Three large petals, rich, royal-purple,
shading deeper towards the base; the finest
single dark-colored variety.

Shuchiukwa—tThree large netals, crimson-pur-
ple, with white veins and large white halo;
a showy variety.

Sakata—Three large round petals, light violet
or lavender-blue with deeper colored vein-
ings; standards and minor petals ageratum-
blue.

IE a Goro esn oO $0.25 IRA HW) aricdian babe ae $2.25

LATHYRUS. Perennial Pea

96

98 mauve with lilac

90
100 densely

Sore o oes COS $2.

17

20

Lob

L. Latifolius—The hardy climbing Pea. We have
these in the following colors: Red, Pink, White.
IN VCH evetete nkchareiets $0.20 TESS S aoeoccere $1.75

LAVANDULA. Lavender

L. Vera—This is the true Sweet Lavender; grows

about 18 inches high; delightfully fragrant blue
flowers in July and August.
Bridle Dtwatebarteeteistatspeian Oo OU RUO! weet ecaretensvate: des $1.25

LIATRIS. Blazing Star

L. Pycnostachya (Kansas Gay leather)—Spikes

of light rosy-purple flowers; 4 to 5 feet.

L. Spicata—Deep purple flowers in spikes 2 to 3
feet high
lOEKO in acinece okor $0.15 PGi Ohne ska sists eka $1.25

LILIUM. Lily

A few Liliums should be scattered through ail
herbaceous borders. Most of the varieties offered
can be planted in the early spring, excepting such
as noted in the description.

Lilies do best in the hardy border where they
get re benefit of the shade from the surrounding
plants.

L. Auratum—F lowers very large,

delicate ivory
white, thickly dotted with rich

chocolate-crimson

—_S WEBER & SONS NURSERY (9 ~5
NURSERY, Mo.

73

CO.-

spots. A bright golden band runs through the cen-
ter of each petal. The finest of all lilies.
LEK 8 AGM OaIOL $0.20 PGT e aR Oiers os eiiicveditousnats $1.75

L. Candidum—The old-fashioned pure white gar-

den lily. One of the hardiest. Sliould be planted
in early fall. :
ITEKING Son eoOoeoDoUe $0.10 Orel Oleretercuctencin crete $0.80

L. Tigrinum fl. pl. (Double Tiger Lily)—Orange-
searlet, with dark spots.

EON oaopadcongds $0.15 lee WOscoodgcnacae $1.25

L. Speciosum Album—White, shaded with slight
rose tint on the ends of the petals.

Tae ier otarahn ay stereve £0.20 Per liQeey tsa sas $1.75
L:; Speciosum Rubrum—White, heavily spotted

with rich crimson spots.

TRAC patentee OGL er MO mrrestcslacterel = $1.60

Rudbeckia (Golden Glow) (Page 77)

LOBELIA

{fandsome border plants, preferring a moist deep
loam.

L. Cardinalis (Cardinal Flower) — Rich, fiery
cardinal flowers; strong plants often producing 10
to 15 spikes; 12 to 24 inches long.

TACT avolre'ayatec 0 eles oece $0.15 Ren ell OF iret cieney onic voyare Saleiey

L. Queen Victoria—Flowers deeper in color than
above and with rich, bronzy foliage; requires pro-
tection in winter.

LUPINUS. Lupine

L. Polphyllus—An effective plant producing large
spikes of blue flowers. Blooms the latter part of
May and early .une; grows about 3 feet high. Plant
in well drained garden soil and water during dry
weather, but only late in the afternoon.
$0.15 ISR oA eo 6 ee $1.

25

LYCHNIS. Campion

L. Chalcedonic2 FI. Pl. (Jerusalem Cross) — A
fine perennial, producing immense heads of ver-
million searlet tlowers, far exceeding in brilliancy
many of the brigntest Geraniums. A gem for cut-
ting, and one of the showiest border plants; 2 to 3
feet high.

DEVINE dio dino cooeo4 0 $0.25 EACIBU Ok vayotetsieier-enenen bee

L. Chalcedonica—A most desirable plant, heads
of brilliant orange-scarlet flowers, grows 2 to 3 feet
high and blooms all summer. -
MaGherimaccmecnee $0.15 IOeilWiossadcoussas $1.25

L. Chalcedonica Alba—A white flowered form of
EeaChalietlasple
DEKE oa daud juan} $0.15 PEP lV Sco aaadoudss $1.25

i. Vespertina (Double White) — Large, double
white flowers, which are produced in the greatest
profusion during the entire summer; taking the
place of the Carnation at a season when double
white flowers are scarce; 18 inches high.

DEIN oon noo ond $0.25 ISIE UNG oo caccc0ns oto

L. Viscaria (Double Red) (Ragged Robin)—Forms
a dense tuft of evergreen foliage, and in June it
sends up tall spikes of handsome double, deep-red
flowers of a most exquisite fragrance, and remains
in perfection from a month to six weeks; 12 inches
high.

IDVEIMo.o goo n000 000 cH WIS AEP UO roo0asco0000 $1.25

= iy ty JR

Stokesia Cyanea (Page 78)

LYSIMACHIA

L. Clethroides (Loose-Strife)—A fine, hardy va-
riety, growing about 2 feet high, with long, dense,
recurved spikes of pure white flowers.

DEVON po ooondeoo cos olb IRAE NOS Gid.oo0m0 01000 $1.25

L. Nummularia (Creeping Jenny or Money-wort)
—Valuable for planting under trees or shrubs
where grass will not grow, where it quickly forms
a dense carpet.
Hach....$0.10

MERTENSIA. Blue Bells

M. Virginica—An early spring-flowering plant,
growing about 1 to 1% feet high, with drooping
panicles of handsome light blue flowers, fading to
clear pink; one of the most interesting of our na-
tive spring flowers. May and June.

IDES 5 ceonoMteerO C0. 0 6 $0.15 (eter ctAS. o.dinaia o otdiolero il DB)

Perl0....$0.85 Per 100....$7.50

Sag ee & SONS NURSERY
NURSERY,

74

Mo.

MONARDA. Bergamot

M. Didyma—Flowers bright scarlet, produced in
spikes; July and August; 2 to 3 feet.

Hiacheewieewriacrantenp Onl: IEP ea dodune one $1.25

OENOTHERA. Evening Primrose

O. Speciosa—A rare, pure white variety with
flowers 8 inches across, blooming the entire sum-
mer; 18 inches high.

IDEN 5 on Solna talon o $0.15

PAEONIAS. Herbaceous

Are among the most showy and useful of hardy
plauts. They are all hardy and admirably adapted
to the climate of cur most Northern states, grow-
ing well in almost any situation or soil. We offer
a splendid assortment.

Price unless noted ........ Fach $0.25 Per 10 $2.00

Agida—Rich, dark, glowing red; double.

Alba Plena—Fine double white.

Canariensis—Flesh white, with rich canary cen-

IMDM Gogdncc nao 4 Silene

Tce Se er oa FAO WPT dseosccnac one
Delache—Tall, immense heads of crimson-ma-
(a)
Bach x SoH Reeeiiee $0.35 Perl Ol Accste mete perctauete $3.00
Duchess de Nemours—Large and full, almost
pure white.
IDEN hig COO UO O OOOO DO nO TOUCUOpDGOOT TOOT $0.75

Duchess de Orleans—Large compact flower. Rosy
lake, with ineurved salmon center. Late.

Duke of Wellington—large, creamy white.
Bacneanctuomncwcan $0.50 SriOer sa veiarcceteecmne $4.50

Festiva Alba—One of the best ordinary whites.

Festiva Maxima—One of the largest and most
popular Paeonias of them all. Flowers built high
on long stiff stems; pure white, inner petals slight-
ly tipped carmine. Early.
IBEVO NaS oticicka coco tao $0.35 Perel Oper. mieten « «$3.00

Francois Ortegat—Tall, with long stems, flow-
ers good size and shape, deep claret-maroon.
WEG Nsooonaaos0p00 $0.50 Ie OINoopwacudcaac $4.50

Dorchester—Pink; very late, dwarf, compact
crower; flower very full and double, color a beau-
{iful shade of pink.

[EXO ra lo oo ows ub $41.50
Humei—Bright, deep rose; vigorous grower; @
very fine late bloomer.
Jeannette—Mauve pink guards. buff center.
Jules Calot—Bright pink fading to flesh:
Louis Van Houtte—Brilliant red.
L’Eclatant—Broad full flower, purplish-crimson=
very fine.
Madam Crousse—White, with pink tinge; center
petals with carmine edges. Each, 75c.

Mad. Breon—Outer petals flesh, center lemon:
sometimes carmine tipped, when first open, chang-
ing to pure white.

Marie Lemoine—White, faintly tinged chamois-
Dwarf, very late, very scarce.

WAKO ocncc0000000 - $0.60 POP UOs S606 ote fapetava rep De

Modeste Guerin—Brilliant carmine-rose, with 2
high and stiff center full of rosy-pink petals.

BEKOogooago00 d010 0 MOBI IED MVsqoooorce do% $3.00
Mrs. Lowe—Very early white.

IDEIO oitarnic ond BIC o $0.50 IPCrMOjcr-cereierieeenemnere $4.56
Officinalis Rubra FI. Pl.—Rich deep crimson-~

very early; one of the best dark colored varieties.

Prince de Galles—Carmine-rose.

Rose Quintal—Pink, cream center.

Rosea Plenissima Superba—Bright crimson, very
double, full centered and massive.

Triumph du Nord—Very double, violaceous pink-
Long stems.

Tenuifolia Fl. Pl.—A very interesting and hand-
some variety, double rich crimson flowers. Foliage
fine and feathery, a very pretty ornamental plant.
IDENCIbIo co aol bio b.0.00 $0.30 IPSN 5 Ola too’ cc $2.50

a

- f ms € 4 ene

— “ =

PAPAVER. Poppy

P. Orientale (Oriental Poppy)—Nothing can equal
these in gorgeous effect, and, whether planted
singly or in masses, their large flowers, rich bril-
liant colors and freedom of bloom render them

conspicuous in any position. We offer them in
mixed colors; 18 to 24 inches high.
1 Oe) FICE PIECE Le $0.20 PGT ie rete cite: eae enacts Se 5
P. Goliath—V¥iery-scarlet.
P. Princess Louise—Salmon-pink.
P. Mrs. Perry—Salmon-rose.
P. Silberblick—Bright salmon-red, with white
spots.
P. Trilby—Brilliant red.
TOOCH ei etetsichotelase) cisie'e $0.25 Ora UOlererteratatster ccs era eo

PENTSTEMON. Beard Tongue

P. Barbatus Torreyii—Spikes of brilliant scarlet
flowers; height 3 to 4 feet; June to August.
MPAs og ooboadO bd $1.25

P. Digitalis—lLarge spikes of long, purple white
flowers, with purple throats, during June and July;
2 to 8 feet.

LOO is pies ne Oer on $0.15 Per 10

P. Grandiflorum — Large, bright
flowers, produced very freely during
months, on stems 2 to 2% feet high.
Cieraieveceleteystatecs;« $0.15 Perl erates setsicraeterico

PHLOX PANICULATA. (Hardy)

The Perennial Phloxes are among the most use-
ful and desirable of our hardy herbaceous plants,
and should be planted largely. They succeed in
any position, and can be used to advantage either
as single specimens in the mixed border, or as
large clumps or beds in the garden or lawn. Range
in height from 1 to 3 feet.

Price unless noted: Each, $0.15; Per 10, $1.25;

Per 100, $10.00.
White Sorts

F. G. Von Lasburg—Flowers very
white.

Jeanne d’Arc—A fine late blooming white.

Mrs. Jenkins—Early and free bloomer; immense
panicles. Fine for massing.

Red and Scarlet Sorts

Vesuvius—Pure red, with bright purple eye;
brilliant color.

Pecheur d’Islandi—Crimson-red,
cochineal-red and carmine-red eye.

Etna—Crimson-red suffused with
cherry-red eye.

Coquelicot—FPure scarlet with crimson eye.

George A. Strohlein—ELright scarlet. crimson-red
eye. Flowers large, does not bleach.

Pink and Rose Sorts

General Von Hettsz—Brilliant salmon-red, with
white center.

Pacha—Deep pink,
eye.

Selma—A _ preity,
distinet red eye.

General Giovaninelli—Bright Tyrian rose, with
light shadings at the base of the petals; pure red
eye,

Pantheon—Bright earmine-rose.

La Vague—Pure mauve with aniline-red eye.

Sunshine—Aniline-red with crimson eye.

Purple and Crimson Sorts
Edmond Rostrand—Reddish-violet, large white
star-shaped center.
_ Louis Blanc—Reddish-violet, with purple shad-
ing. he x : z

purplish-blue
the spring

large, pure

a

suffused with

fiery-red;

suffused with red: carmine

delicate, soft pale rose, with

wards the edges; large white center.

NS NURSERY (9 ~~
NURSERY,

Mo. CO) }

B. Comte—Glowing reddish or French
one of the finest dark colored varieties.
Jules Cambon—Brilliant reddish-purple, with ex-
ceptionally large, pure white center.
Obergartner Wittig—Bright magenta, with crim-
son-carmine eye: iarge flower truss; very fine
Champs Elysee—A bright rosy magenta; very ef-
fective.
_ Eclaireur—Brilliant
lighter halo.
_ Von Hochberg—An ideal crimson; the richest of
its color.

Dark Eyed Sorts, Light Colors

P. Albion—Strong vigorous grower, producing
very large panicles of pure white flowers, with a
faint red eye.

H. O. Wijers—Pure
mine eye.

Aglae Adanson—Snow white, with red eye; im-
mense flowers.

Colibri—White,
very late.

purypee,

rosy magenta with large

white, with crimson, car-

with crimson-carmine center;

Tritoma (Page 78)

Mottled Sorts

_ Beranger—Ground color white, delicately suf-
fused with rosy-pink and distinct amaranth-red eye.

Eugene Danzenvillier—Lilac, shading white to-

PHLOX SUFFRUTICOSA
EARLY FLOWERING HARDY PHLOX

Miss Lingard—A very fine white variety; begins
to flower after the middle of June and continue:
throughout the season. Largely used for cut flowers.

Per 10

NURSERY, MO.

Vueen Filamentosa (Paz re 78)

PHLOX DIVARICATA CANADENSIS

One of our native varieties that is but rarely met
with, and which has been introduced in HPurope
the past few years as a novelty. A plant that is
certain to meet with much favor . when better
known, as nothing can produce such a cheerful
corner in the garden in the very early spring; fre-
quently beginning to bloom early in April, it con-
tinues until about the middle of June, with large,

bright, lilac-colored flowers, which are produced
on stems about 10 inches high, in large, showy
heads, and are very fragrant.

DEK Na Gooeoo00b000 $0.15 IEP AEG Gro GioM!n OOS $1.25

PHLOX SUBULATA. Moss or

Mountain Pink

A pretty creeping type, with moss-like evergreen
foliage, which in early spring is hidden beneath a
mass of bloom. One of the very best plants in our
collection for the rockery, and invaluable for cov-
ering graves or carpeting the ground. Grow ahout
6 inches high.

P. S. Lilacina—Light lilac.

P. S. Rosea—Bright rose.

P. S. Alba—Pure white.

P. S. Atropurpurea—Purplish-rose.

Hach $0.15 IRSP NOs ssocc00 5680 $1.00

PHYSOSTEGIA. False Dragon Head

One of the most beautiful of our midsummer flow-
ering perennials, forming dense bushes 8 to 4 feet
high, bearing spikes of delicate nowy flowers, not
unlike a gigantic heather.

P. Virginica—Bright but soft pink; 3 to 4 feet.
P. Alba—Pure white; very fine: 8 to 4 feet.
LEEIO NG 5 A d0 5 OB OO SOnLD PerklObe eee ee nue

76

PINKS. Hardy Garden

Dwarf, hardy pinks, bearing double flowers of
rich colors, decided improvements on the old sorts;
6 to 9 inches high.

Pach Per 10

Cc. Comet—Bright rosy-crimson;
flower.

. Delicata—Soft, pleasing, delicate rose.
Elsie—Bright rose, maroon center.

Her Majesty—Large flowers of purest white.
Homer—Rosy-red with dark center.
Juliette—White, laced crimson.

» Souv. de Salle—Soft rosy-red.

White Reserve—A nicely fringed pure white.

PLATYCODON. Balloon Flower, or
Japanese Bell Flower

P. Grandiflorum—Deep blue, cupped, star-shaped
flowers; 1% to 2 feet.

a fine, large

WEONs 5ao0Ko000000 $0.15 IPCrsl Ovvencvercioleteniier $1.25
P. Grandiflorum Album— An extremely pretty

white variety; blooms from June to October; 1%

to 2 feet.

Machig a siare,fiecsseeceiewe $0.15 PerilO\ieietssecaee $1.25

P. Mariesi—Deep blue bell-shaped flowers, near-
ly 3 inches across on 1 ft. high plants.
WA CH ye A iercccscatesienere $0.15 Per:l0e. avn oe

PLUMBAGO. Lead-Wort

_ P. Larpentea—-Of dwarf, spreading habit, grow-
ing 4 to 6 inches high, useful as an edging plant
or for the rockery; covered with beautiful deep
blue flowers during the summer and fall months.

IDEN No o.dine oo eden oN $0.15 eH ILD G oo5000ucss $1.25

POLYGONUM

P. Compactum-——A variety which is deserving of
great popularity. It grows about 15 inches high,
and during August and September the entire plant
appears as a foamy mass of white flowers.

IDEN ol sy eerpecne cca cad c $0.15 Per 10

25

Ganna (Page 79)

———— —

— 12a) WEBER & SON
NURSERY, MO.

Gis

PRIMULA. Primrose

P. Cortusoides Seiboldii (Japanese Primrose)—
These are not so well known as they deserve: they
are of free, vigorous growth, with dark green foli-
age, and throw up in late spring innumerable stems
of large flowers, varying in color from pure white
to rich crimson; 8 to 10 inches high.

HUE KO TS Biicicte Oo Gale $0.20 POG RK aetaretetersejleirene $1.75

P. Veris Superba—A giant-flowered form of the
Finglish cowslip, producing individual flowers from
1 to 2 inches across, in heavy trusses, which
measure from 10 to 15 inches in circumference;
color bright canary-yellow, with a golden center.

IDEM a Goceoraocodn $0.15 Ineo popabono nes $1.25

PYRETHRUM

P. Hybridum Fi. Pi.—Too much cannot be said
of this grand hardy perennial. No class of plants
wives a wider range of colors, while the form and
substance of the flowers is all that could be
wished. Their main season of blooming is
in June: but if the old flower stems are re-
moved they will give a fair sprinkling of
flowers in the autumn. The bloom is sim-
ilar to that of an aster, and ranges in color
from pure white and vellow and the various
shades of pink and red to deep purple. The
plants we offer are seedlings grown from
an extra select strain.

BAC N art: cys levesessione $0.15 emi Omrierctere te $1.25

P. Alfred—Color rich crimson; 18 to 24 in
MACH ees ces cs $0.30 Perlore wae one

P. Bridesmaid—aA fine large white; 18 to
24 inches.

PAGS aycfatcke tats sss $0.50 122i Vee Sabie Reade)

P. Uliginosum (Giant Daisy)—Grows 4 to
5 feet high and is covered with large white,

daisy-like flowers, 3 inches in diameter,
from July to September.
LOEKe nieccigng clan b $0.15 EQ ralWe saiga oem $1.25

RANUNCULUS. Crow-Foot

R. Aconitifolius Fl. Pl. (Fair Maids of
France)—Forms a branching bush 2 feet
high, flowers double, pure white, in May and
June.

WE CHia/areyerare cata ke $0.15 12425 net ES ereter cs $1.25

R. Repens Fl. Pl. (Bachelor’s Button)—A
pretty double flowering, bright golden yel-
low Buttercup. Grows 2% feet high and
blooms during May and June.
iTS BA Bipot $0.15 leyoulhe nA Sce $1.25

ROSEMARINUS. Rosemary

R. Officinalis—An old favorite aromatic
herb of neat habit of growth; requires pro-
tection in winter; 18 to 24 inches high.
Wachivsxstoe craves $0.15 IPSOERNOL . srarretarene $1.25

RUDBECKIA. Cone Flower

R. Laciniata—A glorious plant, and one
that should find a place in every garden.
Without question the best hardy plant intro-
duced in many years. It is of fine habit
and vigorous growth, attaining a height of
from 4 to 6 feet, and begins to flower early in the
season, and continues until late in the fall. The
flowers are produced in enormous quantities on
long stems, and resemble a fine double golden-yel-
low eactus dahlia; and as a cut flower for vases,
ete., it has no equal.
IVA CI .«- rapterarstereteretere $0.15 ORCC sratctetatens tar chet sik $1.25

R. Purpurea (Giant Purple Cone Flower) —
Flowers about 4 inches across, of a peculiar red-
dish-purple, with a remarkably large cone-shaped
center of brown, thickly set with golden tips in
spiral lines; forms bushy plants from 2 to 3 feet
high, and blooms from July to October.

Bacchi. sneer recetotels $0.15 IO. 6 og uULOOUAe $1.25

R. Newmanii—Dark orange-yellow flowers, with
deep purple cones, borne on stiff, wiry stems 3
feet high; flowers from July to October.

BSG erence tae $0.15 IP GrALO nian aster ta teva ii $1.25

S NURSERY

7 aie aac ge evar

SALVIA. Meadow Sage

S. Azurea—A Rocky Mountain species. growing
2 to 3 feet high, producing during August and
September, pretty sky-blue flowers in the greatest
profusion.

IDEN aoe anoRoUs $0.15 1e¢evral U(r iausis orola ate a $1.25

S. Argentea—Grown for its large, ornamental,
silvery white foliage; flowers white; in June; 2 ft.
IBEX e5 po Gaon 20s $0.15 IROOM OG aos od oo ob an $1.25

SCABIOSA

These are among the handsomest perennials we
possess, and should be grown in every garden, if
only for cutting purposes, for which they are ad-
mirably adapted, lasting a long time when placed
in water.

S. Caucasica—Of a peculiarly soft and charming
shade of lilac blue; 18 to 24 inches high.

IDEN vans acco teckcnae $0.15 [2X y ih i) Gia sas gta foreach Dicte $12

Dahlia (Page 79)

SEDUM. Sione Crop

The dwarf or creeping varieties are suilable for
rock work, covering graves, dry, sunny banks and
carpet bedding.

- Ss. Acre. (Golden Moss)—Creeping; foliage and
fiowers bright yellow; 2 to 3 inches high.
IDEN NAc DCO OIE $0.10 Perm lOl rer hesccsekenel sae $0.29

S. Spectabilis (Brilliant Stone Crop)—One of the
prettiest erect growing species, attaining a height
of 18 inches, with broad, oval, light green foliage
and immense, showy heads of handsome rose-col-
ered flowers; indispensable as a late fall-bloom-
ing plant.

IDE KO) ger Oihcarhe ceeetce ete $0.15 Per 10 $1.25

| Hod:

SENECIO. Groundsel

S. Pulcher—Forms a neat tuft of foliage, from
which spring up, trom July to October, a succes-
sion of 2 feet high stems, with clusters of brilliant
rosy-purple flowers of good size.

HA Chey once eee $0.15 Perl. hes ccmwacer $1.25

= SPIRAEA. Goat’s Beard

S. Aruncus—A noble variety, 3 to 5 feet high,
producing in June and July, long, feathery pani-
cles of white flowers.

S. Filipendula Fl. Pl. (Double-Flowered Drop-
Wort)—Numerous corymbs of double white flowers
and pretty, fern-like foliage; 1 to 2 feet.

LOE ONe SS meer aie Sore $0.15 PO aliQiasaaet ties oerene $1.25

S. Palmata (Crimson Meadow Sweet)—One of
the most beautiful hardy plants, the deep purple
red of the stems and branches passing into the
crimson-purple of the broad corymbs of flowers,
which are produced very freely during June and
July. 3 feet.

PEKONNG soa oauoH ane ost 5)

Per 10

Gladiolus (Page 79)-

STOKESIA

S. Cyanea—One of the prettiest and most dis-
tinet hardy plants in our collection. It produces
showy aster-like deep lavender blue flowers, fre-
quently 5 inches across, in clustered heads from
early in June until cut down by severe frost in
the fall. Grows about 18 inches high.

DMION Aca goceD 400) $0.15 Ike Wn cosoodaaoano
S. Cyanea Alba—lIdentical to the blue variety

e795
$1525

above in every way except color, which is pure
white.
iDEXOING.6 woo doen ho OO $0.20 PUNO cieco coon clo $1.75

THALICTRUM. Meadow Rue

Very graceful, pretty flowering plants, with fine-
y eut foliage; great favorites for planting in the

hardy border.

T. Aquilegifolium Atropurpureum — Hlegant,
zraceful foliage, and masses of rosy-purple flow-
ers; 3 feet.

T. Aquilegifolium Album—Pure white flowers;
3 feet.

T. Aquilegifolium Roseum—A light rose-colored
form; 3 feet.

TTEON 5 G66 doe oO Ot $0.15 IEXeyO ALN) Gachione Sitio bateoro.6 S525)

WEBER & SONS NURSERY
NURSERY, MO.

|

TRICYRTIS. Japanese Toad Lily

T. Hirta—An interesting Japanese plant, grow-
ing 18 inches high and producing in the greatest
profusion in fall clusters of peculiar lily-like flow-
ers. creamy white, spotted purplish brown.
Fach $0.15 Peril 0 jee seeeeie

TRILLIUM. Wood Lily

Suitable for shady situations or in sub-acquatic
gardening, flowering in early spring.

T. Grandiflorum—Large, white flowers, probably
the finest; 6 to 9 inches.
Hach poco pele ~— IRC) ooaascocaon

TRITOMA. Flame Flower or Torch Lily

Splendid summer and fall flowering plants, with
stately flower scapes and magnificent, dense ter-
minal spikes of high-colored flowers, familiarly
known on account of their shape and glowing
colors as the ‘‘Red-Hot Poker’’ plant.

T. PfitzeriimA grand improvement on Tritoma
Uvaria Grandiflora. The spikes, which are pro-
duced with considerable more freedom than in
the old variety, are of gigantic Size, frequently
4% feet high, and with heads of bloom over 12
inches long, of a rich orange-scarlet, shading to
salmon-rose on the edge; first-class acquisition.

Per 0

T. Uvaria Grandiflora—Orange-red flowers;
3 to 4 feet high.

$0.15 Pell. O's seveetoetoiene $1.25

TROLLIUS. Globe Flower

T. Europaeus—A giant buttercup in appear-
ance. The plant grows from 2 to 2% feet high
and produces large, bright yellow, globular flow-
ers, 2 in. in diameter, from May until August.

cov od noD0b0G IBD MO 5 goo ccoy aa RE

VERBENA. Vervane

V. Venosa—A very showy perennial variety,
growing 15 inches high, producing masses of
bright purplish-heliotrope flowers from June to
October.

IDEYElNG oonc0no00 00 SO Per 10

VINCA

Periwinkle, or Trailing Myrtle

V. Minor—An excellent dwarf evergreen trail-
ing plant that is used extensively for carpeting
the ground under shrubs and trees, or on graves
where it is too shady for other plants to thrive.

Each...$0.10 Perl0...$0.80 Peri00...$7.00

VERONICA. Speedwell

Most desirable hardy plants, the tall-growing
sorts being admirably adapted to the border, while
the dwarf varieties are excellent rock plants.

Vv. Incana—Bright, silvery foliage, with spikes
of amethyst blue flowers; 1 foot high.

V. Longifolia Subsessilis—Should be planted in
spring, begins to bloom in mid-July and continues
to mid-August, grows about 3 feet high, flowers
deep blue. Should be mulched in winter and wa-
tered at times during dry weather.

V. Rosea—A most desirable variety; bright rose
flowers; 1% feet high.

V. Spicata Alba—A fine border

plant, grows

oxonoeD DODD OO $0.15

YUCCA. Adam/’s Needle

Y. Filamentosa—Among hardy ornamental foli-
age and flowering plants this can be classed at
the head of the list. Its broad, sword-like foliage
and tall branched spikes of large, fragrant, droop-
ing, creamy white flowers make it an effective
plant for all positions; 5 to 6 feet high.

IBENO NG pio ooo.0 BIO blot 6 $0. 2'5

$2.25

a\

Whew)

“ WEBER & SONS NURSERY |." ~
) NURSERY,

{ <p)
Mo. Sy

“TENDER BULBS AND TUBERS

(SPRING PLANTING ONLY)

Caladium Esculentum (Blephant’s Har)—A very
etfective plant for the border or for single speci-
mens and clumps on the lawn. Should be planted
in good, rich garden soil and should receive plenty
of water and fertilizer throughout the summer.
Bulbs must be taken up in fall and kept in a ary,
warm place.

xtra sizes bulbs... 4: 0-0. Each $0
Yirst size bulbs Each

Per 10 $3.00
Per10 2.00

Calla Lilies—A well-known plant that requires
no description.

85
25.

BOE KL Manic iene 5 6 CORMIER O GIST O a CECIC SEN CRDR CR ROR EER EE eee $0.15
Each Perli0 Per 100
Strong dormant roots, assort-
ed) warletlesirxiactness cet $0.15 $1.25 $10.00
Strong plants, started in pots,
ooh Aen aise So eboececce .20 1.75 15.00
Alsace—Dainty, medium sized flowers of sul-

phur-white; 4% feet.
Ami Pichon—Velvet red; 4 to 4% feet.
Beaute Pointevine—Bright crimson; 3 to 3% ft.

Black Prince (Green-Leaved)—A tall growing
sort with fine, showy flowers of crimson; dark foli-
age, heavily ribbed and margined chocolate; 4 ft.

Buttercup—Deep buttercup yellow, almost pure;
very effective; 3 feet.

Chas. Henderson—Crimson; 3 to 3% feet.
Duke of Marlborough—Deep crimson; 4 to 4% ft.

Express—Foliage wide-spreading and low, 2 to
2% feet high; literally crowned with massive flat
jieads of bloom, rich vermillion.

Francis Willard—Dark red, mottled deep red; 3
to 3% feet.

Florence Vaughan—yYellow, spotted red, 3 to 315
feet.

Fuerst Bismarck—Rich scarlet crimson, of large
size; 3% feet.

Hofgartner Hoppe—Foliage clean dark bronze;
flowers tawny red, mottled with crimson and golden

throated; 4 to 5 feet.

J. D. Eisele—Bright vermillion scarlet, overlaid
with orange; a fine bedder; 344 feet.

King Humbert—In this grand Canna we have a
combination of the highest type of flowers with the
tinest bronze foliage. Its flowers measure 6 inches
in diameter, produced in gigantic trusses, a bril-
liant orange scarlet, with bright red markings;
ee broad and massive, of a rich coppery bronze;
5 feet.

La France—Bronze-leaved,
mottled throat; 4 to 4% feet.

Louisiana (Orchid - Flowering) —Soft, glowing
scarlet, with orange throat markings; 6 feet.

Mme. Crozy—The popular golden edged, bright
scarlet; 4 feet.

Mile. Berat—The nearest approach to a pink iw
a first-class bedder; 4 feet.

Pennsylvania—Five feet; green foliage; flowers
extra large; deep red, of solid color; 5 to 6 feet.

Philadelphia—Bright glowing red,

deep red, salmon

rich velvety;

2 to 2% feet.
President Myer—Handsome bronze and sepia fo-
liage. Flowers large, in wide trusses, cherry-car-

mine; 4 feet.
Rubin—The ruby carmine flowers of this are not

large, but are produced in profusion and are in-
tensely rich and Zlowing, which, combined with
the dark, bronzy green foliage, make it one of

the best bedding varieties in our collection.

Tiach...$0.04

79

Richard Wallace—As a good, free-flowering yel-
low Canna of vigorous growth we believe that this
variety comes nearer to the ideal than any variety
yet offered. In color it is a pleasing canary-yellow,
with exceptionally large flowers, which are carried
well above the foliage; 4% feet.

Rose Unique—Rose; 3% to 4 feet.

Queen Charlotte— Makes a gorgeous display
when planted in masses. Color a wide ragged band
of yellow, bordering a center of scarlet, suffused
carmine; 3% feet.

Souvenir d’Antoine Crozy—lIntense crimson-scar-
let, with a broad golden-yellow border; an excep-
tionally free-flowering variety, and the brightest
of the gilt-edged sorts; 3% feet.

Venus—One of the softest and most delicately
colored varieties that has yet been introduced. The
flowers are of fair size of a soft rosy-pink, with a
pretty mottled border of creamy-yellow; 3% feet.

Wm. Greisinger—Full spikes and well opened
flowers of bright yellow, thickly studded with
searlet. The center petal is all red, the lower
petals red, broken up throughout by wavy threads
of gold; 3 to 4 feet.

DAHLIA

The Dahlia has come to the front as one of the
most important summer and autumn flowering
plants.

We have endeavored to get together a short list
of the very best sorts of recent introduction and
of distinet colors.

Our Dahlias are grown from ‘divisions,’ and all
orders are supplied with strong dormant roots in
the spring.

,

Each Per10 Per 100
Pormant roots, in assortment..$0.15 $1.25 $10.00

Cc. W. Bruton (Decorative)—A fine bright yellow.

Catherine Duer (Decorative)—TIrridescent gera-
nium red; a great favorite.

Grand Duke Alexis (Quilled) — Large, massive
flowers, ivory white, with a faint tinge of rose
at the extremities of the petals.

Kriemhilde (Cactus)—Flowers perfect, on long
stems; color a brilliant pink, gradually shading to
white at the center. A popular cut-flower sort.

Maid of Kent (Decorative)—Intense scarlet, var-
iegated with pure white; frequently a solid scarlet.

Mrs. Dexter (Show)—A rich shade of salmon.
best of its color.

Mrs. Winters (Decorative)—A large. finely form-
ed snow white; a grand cut-flower.

Mrs. Roosevelt (Quilled)—Very large, perfectly
double; color delicate silvery rose.
Snow (Show)—A beautiful pure white; long

stem; excellent as a cut-flower variety.

Wilhelm Miller (Decorative)—Rich, deep aniline
red, suffused with purple.

GLADIOLUS

We offer this year the “Groff Gold Medal Mix-
ture.’’?’ This mixture contains select varieties with
sreat diversity in color, ranging through all the
shades of Red, White, Yellow, Blue, ete.
Each....$0.08 Perdoz....$0.75 Perl100....%6.00
If wanted by mail add 10c per doz. to cover postage.

TUBEROSES

_One of the most delightfully fragrant and beau-
tiful of the summer-flowering bulbs. For out-door
planting set hulhs about May 10th to 15th, after
tanger of frost is over.
Double Pear!—The best double variety.
Single—The old-fashioned single.
Per doz... .$0.30 Per 100...$2.00

>
a Jn SC ea

ae a,

WEBER & SONS NURSERY
NURSERY, MO.

BULBS FOR FALL PLANTING

Supplied on orders only. Express cor Postage charges to be paid by Purchaser.

SELECT MIXED HYACINTHS

By Mail le Each, Extra for Postage

Out-Door Culture in Beds or Borders—The bulbs may be planted almost any time in October
until the ground is frozen solid. They succeed in any good, well drained garden soil, which should
be well spaded, and will be better if some well rotted manure is mixed through it. Set the bulbs so that
tops wil) be between four and six inches below the surface and four to six inches apart.

Pot Culture In the House—Plant from September to December in rich, sandy loam, in four or five
inch pots, inserting the bulb so that its top will be just below the surface. Do not pack the soil in the
pots, as the bulbs will be more likely to push out when the root growth commences, if the soil is loose.
Water thoroughly and set the pots away in a cool, dark place for several weeks. If cold coffee is used
oceasionally instead of water, it will often increase in intensity the coloring of the flowers. Keeping in
the dark will allow the roots to grow and become firmly fixed in the soil, when the plants can be brought
into the light and will at once commence the top growth. By bringing the pots into the light at different
times, something of a succession of bloom may behad. During their growth they should be kept near
the light and at a temperature of 50 to 70 degrees and watered frequently.

Assorted Double Single Blue
Doz 100 i —Rich d . spl id spike.
White and pure white varieties...... $0.50 $3.50 SUG) Gi YUE Blue leh dans bluer sp endigsh
Dark red, red and rose varieties .... .50 3.50 Queen of the Blue—Clear blue, large truss.
Jark blue, blue and light blue varieties .50 3.50 ae 3
Yiellowavianieticsmennmereonereiammeceer 60 4.00 Single Yellow
* x Hermann—Orange yellow.
Assorted Single
Doz. 100 Double Red and Rose
Wier end pure wie mae eee Be pues peed Boquet Tendre er Waterloo—Carmine rose. red
Dark blue, blue and light blue varieties .50 3.50 truss. : : ; :
Mell owanvalhle GleSel snr nere stain ene ae 60 4.00 Prince of Orange—Pink, carmine striped, semi-
Roman-—White (for forcing only).... 50 3.50 double.

Double White

large truss, early.
La Virginite — Blush white, good
bells and truss.

Double Blue

Bloksberg—Bright porcelain striped,
large truss.

Garrick — Fine bright blue, good
bells, handsome truss.

Double Yellow

Goethe—Fine yellow.

TULIPS
For Forcing and Bedding
By Mail, 10c per dozen extra.

The culture of Tulips is the same as
that of Hyacinths except that the
bulbs should be planted two to six
inches apart. Tulips are perfectly
hardy, so only a slight protection is
required.

Tt is difficult to conceive of any-
thing more brilliant in color than a
bed of good Tulips. Their great vari-

Hyacinths ety of color, intense brilliancy and
beautiful shading, make them ee
eee sal favorites, and they can be cultivated easily,
Select Named Hy acinths only requiring good, common garden soil to grow
Price 10c each; per dozen $1.00. By mail, le them tc perfection. There are no bulbs which
each extra for postage. make such a rieh and gorgeous display of blossom
with so little care and cultivation.
Single Red and Rose Early Single Tulips
Charles Dickens—Fine rose, large spike. Doz. 100
Gigantea—Blush, large close truss. Artus, fine bright red...........-...- $0.25 $1.50
Si ] Whit Belle Alliance, scarlet ... sag cee 2a 28
In¢gie 1te Cottage Maid, fine rose and white.... . >
& 4 Chrysolora, pure yellow, large........ Bra 1.50
Baronnesse Van Tuyll—Pure white, large truss, Keizerskroon, deep red, yellow border .30 2.00
early. L’Immaculee, pure white ............ 125 1.50
Grandeur a Merveille rosy white, large truss. La Reine, white, rose shaded....... 225) 1.50
$o

La Tour d’Auvergne — Pure white, 3

a

Mo.

NURSERY,

Doz. 100
Pottebakker,; white: 2 2.534 acctclere nied ne .85 2.00
Pottebakken, scarlet o0 sev cme cere ce ot .35 2.00
Pottebakken; Yellow) is ven cisco telatacie .85 2.00
Yellow Prince, large golden yellow.... .25 1.50

Early Double Tulips

Doz. 100
Agnes; .Drlent Scarlet weet wel-kesteous .85 $2.00
Duke of York, rose, white border..... .30 1.50
La Candeur, pure white ............. 25 1.50
Le Blason, rose and white..........-. “35 2.00
Rex Rubrorum, scarlet. .......0..5.6> 185 2.00
Tournesol, red, yellow border........ 35 2.00
Yellow Rose, large golcen yellow..... 50 1.74

Mixed Tulips

Doz. 100

Choice Early Single, all colors........ $0.15 $1.00
Choice Early Double, all colors....... 15 1.00
Choice Late Double, all colors....... 20 1.25
Darwin alle COLTS ric cic oe eas tare tens crele aD 1.50
PERT OC ALL COLOTSe. stetedad-ve stale nie etek seniee .20 1.25

CROCUS

Among the earliest to blossom in spring is this
beautiful little flower, lifting its head almost be-
fore the snow has disappeared. Blooming al a
time when the ground is destitute of foliage and
flower, it is a welcome visitor. They present the
best appearance, however, when grown in masses
in a bed, for which large quantities should be used,
say from one hundred to five hundred in a bed.

A desirable effect is produced by setting crocuses
here and there over the lawn. It is only necessary
to lift the turf and insert the bulbs about two
inches deep. ;

Doz. 100
TASS TRAD oat bb 02s (ni O Eac CIReeR CIRCE Eee $0.10 $0.50
Kine Striped) mixed ..\....0...0...%. -10 -50
WINGiEWWIDICE eINIR'C GS pare: ce. tap eel ateleaxchene use 10 50
Liar OV ClO Wieden fata Yo ate al srersvenarere ea ieee" 10 60
IMAL (Cfo osgsh Gnhaye) goottb<isl GAAS ono e oop 10 50

NARCISSUS OR DAFFODIL

They are not only desirable for the garden, but
equally so for the house. One to four bulbs set in
a five-inch vot will be sure to give flowers where
their beautiful color and delicate fragrance are
doubly welcome.

Pot as soon as received in good turfy loam, and
keep moderately moist so that they may root, then
remove to the window or conservatory.

By Mail, 10c extra ner dozen.-

Doz. 100
Doubleyswbites sisal. risen eee eo ee $0.25 $1.50
Single, Wl sinccel sero rune elas 25 1.50
Dovhle Von Zion, yellow ............ 185 2.00
Single VonvZions vellowelo., seek «een .50 1.75
Paper: White mattee erin meson cee cat .30 1.50
Grand Monarque, white, vellow cup.. .50 2.00
Queen Victoria, white .............. 50 2.00

JONQUILS

A species of Narcissus, native of Spain, easily
grown in house or garden and always a favorite
for its bright yellow, deliciously fragrant flowers
which are produced in abundance. They are very
fashionable and popular as cut flowers, and can be
sucesstully grown by everyone. Well suited for
window plants. as the flowers seldom fail to ex-

pand, and continue a lone time in perfection. Cul-
ture same as given for Narcissus.

; Doz. 100

Single. Jonquils: Goce eee ~. 0.20 $1.25

Dowole Son cjUils heer eee apy) 2.00

OXALIS
Well adapted to house culture. They bloom
freely and the flowers last a long time. Plant in

pots, six or eight bulbs in a pot, and cover about
one inch deep.
Per dozen.....

- $0.15 SEES D owt cst oot ata $1.00

r
SNOW DROPS

The first flower of spring is the delicate Snow
Drop, white as snow. its appearance is a joyful
surprise.

Plant in the fall, in beds or masses of a dozen
or more, about one inch apart and three inches
deep. Desirable for growing in pots, ete., in the
house in winter.

A dozen may be planted in quite a, small pot or
saucer. A few planted on the lawn produces a fine
effect early in the spring before the grass will need
Perfectly hardy and bulbs can remain
without removing.

eutting.
several years

Single
IDYOybU NY WES wiht. as yt Grace Aci O Nene CRCRC RAID Rea ee rene orcas .30 2.00

Tulips

FREESIA

Bears peculiar clusters of flowers of the most
delicious fragrance which lasts a long time even

after being cut. Forces easily, and will come into
bioom in January and February. It also grows
well and blooms freely in an ordinary sitting room
if placed near a window, and not kept too warm.
Will stand a slight freezing without injury. It ap-
pears to the best advantage when four or five bulbs
are set in a six-inch pot in light rich soil.

Per dozenin tc. siec<s $0.15 IEGIP ANS Sage vac $1.00

CHINESE SACRED LILY

_This is a variety of Polyanthus Narcissus cul-
livated by the Chinese from time immemorial for
the purpose of decorating their sacred 1emples or
Joss Houses, and to hail the advent of their New
Year’s day which occurs in February.

The flowers are pure silver white with golden
yellow cups and exquisite fragrance. The great
wealth of dark green leaves adds much to the
beauty and fully completes the picture. A dozen
bulbs started at intervals in shallow bowls of water
with just enough small pebbles or stones to pre-
vent them from toppling over, will give a succes-
sion of flowers throughout the winter.

ihiKees C2K ioe dg A ~-.$0.10 PerudOZenne meter $0.75
SPANISH IRIS
(HISPANICA) Hardy
Yoz. 100
British Queen, white ............... $0.15 $1.00
DAG DUNS aearin ee Oe Aili) 1.00
Shirysoloracv.ellowss tert cenit eiuneete we 1.60

Xe

NURSERY, Mo.

GREENHOUSE DEPARTMENT

Abutlilon (Flowering Maple)—Popular pot plants
or for bedding, vases and baskets.

ooabdbotoo-sbs $0.15 Per doz

Acalypha Sanderi (Chenille Plant)—Showy foli-
age plants for ornamental and sub-tropical bed-
ding.

$0.10 Per doz

Ficus Elastica (Rubber Tree)

Achyranthes—Graceful foliage plants, fine for
_ bedding.
IDEAS souoaoon0HOS $0.10 IER CWOAS nog ndo 56 $1.00

Ageratum Stella Gurney—Low growing, bushy
border plant for bedding; fine blue flowers.
Each $0.10 Per doz

Alternanthera—Fine foliage plants for bordering
flower beds or carpet bedding; yellow, red and

bronze.
ER OS $0.05 EGE COs Goo o son cM DoDO

Asparagus Plumosus Nanus—Fine for single pot
plants and indispensable for floral decorations.

Each, according to size .............. 25e and 50c
Asparagus Sprengeri— Graceful pot plant for
house decoration or for hanging baskets.
Fach, according to size 25¢e, 50c and 75c
Begonlas (Flowering Varieties)—Popular house
plants. Argentea Guttata, Flambeau, Dewdrop,
Metallica, Otto Hacker, Rubra, Warscewice, etc.
Lot OMBe eer rcounNO Oso bod sone . $0.25
Specimen plants prices on application

eee eenee . CC ac

Begonia (Rex Varieties)—Fine pot plants for

house decoration, basket and vases.

BOT: Ke) Were ea oc CMO OO rena Ootou Doo 6 25e and 50c
_Coleus (Assorted Varieties)—Fine for carpet bed-

ding and borders for Canna beds.

SoUOPAOSSOSH0 $0.05 Per doz

Cyperus Alternifolius—A splendid acquatic plant.
Fach 10e and 25c

Dracena—Noted for the odd and beautiful foliage.
Each, according to size $0.50 to $1.50

FERNS

Nephrolepis (Scotti)—Identical to Boston Fern,
except that it is more compact and the foliage is
smaller; a fine decorative plant.

4-in. pots....Each $0.75 5-in. pots....Hach $1.00
Nephrolepis Bostoniensis (Boston Fern)—A won-

derfully healthy, rapid-growing house plant; well
known.

4-in. pots....Each $0.50
Nephrolepis Whitmanii

The most valuable plant of the type.
are dense, broad and graceful.

4-in. pots....Each $0.50 5-in. pots....Hach $0.75
Fuchla—Splendid window plant or for shady
spots in the garden.
Fach, according to size
Ficus Elastica (Rubber
table decoration plant.
Mach, according to size......... 50c, 75c and $1.00

5-in. pots....Hach $0.75

(Ostrich Plume Fern)—
The fronds

AR OO Oa. os 0 15e and 20c
'Tree)—Best house or

Kentia Forsteriana

= 2) WEBER & SONS NURSERY (5
‘ome NURSERY, MO. Om _

GERANIUMS IKXentias are the hardiest house plants; they are
of slow growth and are less affected by dust and

The most popular flower for summer bedding. dry atmosphere.

Our collection comprises many fine varieties, both Heibo, WOWS, US ive) PO) TY Ios gonaonodac Bach $1.50

single and double, in the various shades. 6-in. pots, 24 to 80 in. high............ Each 2.60

MAT DOCS pstalaialacn, = ace Each $0.15 Per doz. aan T= DOL OWL LL at isliciers laleiecsis)clers.elerels Each 4.00

8-in, pOtS .......-..+ee- Dac : Per doz. 1.00 .

Bae DOU, = sii Mech P Su . Kentia Forsteriana— Of taller habit than the
Geraniums (lvy-Leaved) —Fine for baskets or Relmoreana; somewhat heavier foliage.

vases, or where a trailing or climbing plant may 4_in pots, 15 to 18 in. high............ Each 1.00

be desired. : i Gn-insepotspelen to oan ineehicheeens ssc. Bach 2.00

Each.........+++- $0.15 Perdoz.......-.-. $1.50 G-in. pots, 24 to 30 in. high............ Each 3.50
Geraniums (Scented Leaves)—Noted for their Latania Borbonica (Fan Palm)—Too well known

scented leaves. We have the rose, lemon and nut- to need description.

eee 4-in. pots, 15 to 18 in. high Each $1.00
S 4 : ; 1 JAM oo6caoonsuE

ORR ae AoC Om ODe $0.15 Per doz... Siné.6 Dolawo $1.50 G-in. pots, 18 to 20 in. high.........-.. Bach 2.00
Heliotrope—A favorite flower with everyone. Pandanus Veitchi (Screw Pine)—One of the best

IDPH a Ger CO On BOS $0.15 IEC EGLY 7c, Soe och CHO DAO $1.50 and most attractive decorative plants for the

house. ‘the leaves are lhght green, beautifully

Hibiscus Sinensis—Single red and pink, double jar, ¢6a with stripes of white and gracefully curved.

red and pink.

= - es - 2 : cloryak, poyorich, SIP wow nay shee Melba ceo Gk Annee Each $1.00
Each, according to size......... BEC cean eet OR eer noise (nuconls) ine high) oe ona. Bach 2.00
a Lantana—Showy bedding or basket plants. on Salvia (Scarlet Sage)—One of the most popular
BAC iicerelsralsistatciaiel els $0.15 POI O Zisteneyotarels| sietele $1.50 bedding plants.

Moonflower (Mexican) —The fastest growing aii, INS Gooaoocds DO ODO Each $0.15 Per doz. $1.50
climbing annual. SIND OCS erpsrerhelatereleverer ee Each .10 Perdoz, 1.00
IDEN io Soe omomolidae $0.20 Peri GOZor-aieiielaas $2.00 Tradescantia (Wandering Jew)—Splendid plants

PALMS for basket and window boxes.
eee ae MACH aACCOLAIME MLO SIZO ais a) tele alareiciotelens s Se and 10c

Cocos Weddeliana—The most graceful of the : if 2
smaller Palms. Its slender, erect stem is freely Vinca Major Variegata—A popular plant for
furnished with gracefully arching leaves of a rich Vases, baskets and window boxes, trailing vines.
green. MACH; tACCOLGINSRCOMSI ZC) siereeieierelele tela elel ere 15¢c and 20¢
b-in, pots, 18 .to24 ine highs). Each $1.75 Vinca (Perrywinkle)—A splendid plant for bed-

Areca Lutescens—One of the most graceful and ing or for borders; grows 18 to 24 inches high;
beautiful Palms in cultivation. The foliage is of | 2!ways clean and blooms continuously throughout

a bright green, with rich, golden yellow stems. the summer; flowers single.
4~in, pots, 15 to 18 in. high............ Hach $0.75 Vv. Alba—White.
6-in. pots, 24 to 30 in. high............ Each 1.75 Vn YN R
Taine pots meorine Hiebert setter ere: cnieshe Each 3.00 - Aurea—khose,
Kentia Belmoreana—Of dwarfer habit than For- V. Aurea Reticulata—White, with red eye.
steriana, but with more spreading leaves. The Mach....$0.05 Perdoz....$0.50 Per100....$4.00

CUT-FLOWER DEPARTMENT

This department is in charge of our Walter T. _ Weber, who is a practical grower of cut-flowers. We
would be pleased to have our customers favor this department when in need of anything in that line.

We make up designs for all occasions, can ship by Express if outside of St. Louis, or we deliver
by messenger to any part of the City of St. Louis.

in making prices herewith we only give same approximately as prices vary according to season.
‘they are usually twice to three times higher around Thanksgiving, Christmas and Easter than at any
other time,

The pest way to order is to tell us what the flowers are to be used for and state the amount you
care to spend, leaving the selection to us as much as possible, we will endeavor to please you.

In ordering funeral designs always state amount you wishto pay and the design you wish; we will
then make up as large a piece as we cdn afford tor the money.

All orders by ‘Telephone or Telegraph will be shipped C. O. D. unless the parties have an estab-
lished credit with our bookkeeping department. All cut-flower orders are due the 5th of the month
following purchase.

Our Phone number is Bell South 897. Direct wire with South Branch, St. Louis. Kinloch, Long
Distance, Affton 804. 7 z

NO ORDERS ACCEPTED FOR LESS THAN $1.00.

Cut Carnations—From October to June. From Ferns—l1l5c per doz.; 25¢ per bunch of 25.
75¢c to $1.75 per dozen according to season. Smilax—25c to 50c per string

Cut Roses—White and Pink Killarney, Bride and Boxes of Assort

z J ed Flowers—$1.00, $2.00, $3.
My Maryland, from September to June; trom $1.00 4.00 and upward, as desired. Sent to ee nanareee
to $3.00 Bey dozens BECOraInE to season, size of with your card enclosed, if so ordered iin
ower and length of stem. , b 6

x Hand and Table Bouquets—Small, $1.00 to $1.5(

Special Roses—Such as American Beauty, Rich- alot : % nO eat OnstyE8
mond, ete., at regular market rates. Tell us what each; medium to large, $2.00 to $5.00 and upward.

you want; we will get it for you, if to be had. ean Buttonhole Bouquets—l0c to 25¢ each;
Chrysanthemums—In season; from $1.00 to $2.50 °° So 2200. per dozen; $5.00 to $10.00 per 100.
per dozen and up, according to size of flower, Ladles Corsage Bouquets—Gracefully arranged,
length of stem, etc. = choice fiowcrs; 50¢ to $3.00 each.
We furnish sufficient Ferns or Asparagus sprays Fancy Basket of Cut-Flowers—Small to medium,

for ordinary purposes with cut-flowers free of $1.60 to $3.00; medium to large, $3.50 to $5.00:
charge, but should an extra quantity be required, extra fine, $6.50 to $10.00 and upward ,to order

we can supply at the following prices: Bunches or Sprays of Choi
ce) R
Asparagus Sprays—sic each; 40c per doz; 25, 7ic. ribbon. $3, 34,35. $6, $8, $10, sizeana’ coward.

Bunches of American Beauty Roses—$3 to $15
and upward, according to season.

Sprays of Carnations—$1.50, $2, $2, $4, $5, $6,
and upward.

Sprays of Roses and Carnations Combined—$3,
$4, $5, $6, $8, $10 and upward.

Bunches or Sprays of White Lilies—$4, $5, $6,
$8, $10, $12, $15.

BRIDE’S BOUQUETS

The popular kind is the large, round bouquet of
White Roses with a shower of Lily-of-the-Valley,
with a profusion of Asparagus and narrow Chiffon

NURSERY, MoO.

ribbon. Small, $5.00 to $6.50:
large, $12 to $15.

If made of solid Lily-of-the-Valley,
Roses—Small,

medium, $8 to $10;

instead of
$3 to $10; medium, $10 to $12; large,

$15 to $18.
Bridesmaids’ Bouquets—Are the same as _ the
Brides’, except that they are usually of pink or

some other color than white.
Arm Bouquets for Brides and Bridesmaids—Made

ae White or pink Roses and Asparagus. $8, $5,
50.
Arm Bouquet of Chrysanthemums—In_ season;

B35 fib Sar/ KO
Arm Bouquet of Carnations—$3, $4, $5.

FLORAL EMBLEMS

Following are the leading We

can furnish any size or

standard designs.
design upon order.
Anchors—$4, $5, $6.50, $8, $10.
Large Anchors—On stands; $9,

Broken Wheel—A beautiful large design,
eative of a broken life: $10, $15, $20, $30.

Broken Column—A very neat design, r
from 24 to 60 inches in height; $15, $25. § $35

Cross—$4, $5. $7.59, $10, $15, $20.

Cross, Standing or Reclining on Base—$6.50, $8,
$12, $15, $20.

Casket Cross—$5, $7.50

Cross, Slanting—$4, $5, $6.
Crescent Wreath—$4, $7.50, $10.
Cross and Crown on Base—$10, $15.

Faith, Hope and Charity — Anchor,
Heart on Base; $10, $15.

Gates Ajar—$12, $15, 320, $25, $35, $50.
Heart, Open Center—$3, $5, $7.50, $10, $15.
Heart, Closed—$5, $7.50, $12.50, $25.
Horseshoe—$5, $7.50, $12.50.

Sle pune
indi-

ae

Cross and

Horseshoe and Horn of Plenty—Used to sym-
bolize good will and good luck, openings, ete; $15
and $25.

Horn of Plenty on Base—$5, $7.50, $10.

Harp—A very pretty piece. Flat or on a base.
$6550; Si. 505 Sil0} (S15, 125.

Ladder—$12, $15, $20.

Lyre—A_ beautiful piece, similar to the harp, but
made up different. Flat or on base; $5, $7.50, $10.

Masonic Emblem, Square and Compass in Wreath
—$10, $15.

Open Book—$15, $20, $25.

Odd Fellows Design, Three Links—$10, $15.

Scroll—With any lettering desired; $20, $25, $35.

Shield on Base—$10, $15, $25.

Sickle—$3, $5, $7.50.

Star in Color. $7.50, $10.

$7.50, $10.
Triangle—$3, $5, $7.50.
Wreaths—$3, $5, $7.50, $10, $12.50, $15, $25.

White Doves—Natural, stuffed. used for designs
and other purposes. $2, $2.50 and $38, according to
quality.

ri

o\ ine

=

22) WEBER. & SONS NURSERY
NURSERY,

a oa ~

Co, a — >

Mo.

INSECTICIDES AND FUNGICIDES

TERMS—CASH WITH ORDER

PRATT’S SCALECIDE

Best remedy for scale and sucking insects. Man-

ufactured by B. G. Pratt Co., New York. We are
Western distributing agents for this well-known

insecticide. Send for special circular. One gallon

makes 16 to 20 gallons of spray. Prices, f. 0. b.

St. Louis, Mo.

50 gal. barrels, 50c per gal................ $25.00
80 Bal. half barrels) sos ce swe ee 16.00
BOP Paleacketed: ENS setae iret yedaictoies-ieitwr=it= 15.00
MO PB CSS Oi a cteieioie wale taictesfatete neues ei nilelbieue ales 6.00
Fy EGIL (ree) oon go aU oD DolO b OO UODe Ooo 3.25
1 fet LAER] Sb aio od Bo. Olord.h @o.pibine 5 Simorcro 1.00
1 GpEha EME BEng oppo as uno oo OU OUMOORUoIO 40

PRATT’S SULFOCIDE

A soluble sulphur summer spray. <A substitute
for Bordeaux Mixture. More effective, less expen-
sive. Basier to apply and sticks like paint. <A
most powerful, non-poisonous fungicide for fruits
and vegetables—for blight, rusts, mildew, scab,
canker, brown rot, etc. 'The best repellant for cur-

culio. One gallon makes from 200 to 500 gallons

of spray. Send for special circular. Prices, f. 0. b.

St. Louis, Mo.

50 and 80 gal. barrels, per gal............. $ 1.00
U0) FEN INGER Go agoee do bodoe cto oboro oo Ome aolOd 12.50
(iy TECHS UCI LOS ey aes mich Gee Cecio PUICR ORI EPOID CG s(0)
ui. Fees eh 21s 0 iy SCRE Ce nG IDRC Othcach CIGNA Gere! Ow TROEIIG 2.00
PECULIAR CANES ae otek creo} ap avictc arava stevewasttens vane, atheven es wD
Th ie? CEH coaMtaUeDO Cou] odo uto ito OOUROT .50

On orders of 10 gallons or over (Sulfocide only)
we prepay the freight.

Do not use near painted buildings.

Sulphur, Flowers of (for making Lime-Sulphur-
Salt Solution)—-Per lb. 19e; 5 lbs. 40c; $10 lbs. 60c;
50 Ibs. $2.50; 100 lbs. $4.00.. Larger quantities
priced on application.

Copper Sulphate (for making Bordeaux Mixture)
—Per lb. 15c; 10 lbs. $1.25; 25 lbs. $2.50. Larger
quantities priced on application.

GRASSELLI’S ARSENATE OF LEAD
PASTE

For all leaf-eating insects such as Codling Moth,
Potato Bug, etc. In most cases use 3 pounds of
the paste to 50 gallons of water. Send for special
circular. Prices f. 0. b. St. Louis, Mo.

Per |b.

Way [oR VGHIS! ooo dade god o some UoOd CO OC OOOO $0.12
NOW) ao ME Sandoobosoooddood pula ddG DOOUDO OO .14
AN opr keys 6 ects Gon coloeu oo DO ono] DUE E TE «5
Diy Mey IES pooch uopouocoudaT DOU OOOO OOOO O .16
HOS Mee URGES alo od ro 6 OOS HO DRO OD IE cReROI nlf
Sel Can Srenmerebacteanetnietetn tsk cbs ieccs-iche <a) atel acake 18

Uso. CNS oss ceele Same b CoGOICHO IOI Eee Cage -25

GRASSELLYS BORDEAUX MIXTURE
PASTE

For all Fungous diseases. Should be applied
early in the season in order to obtain best results.

For ordinary use it takes 11 pounds to 50 gallons
of water.

For peach and trees with delicate foliage use 11
pounds to 60 to 70 gallons of water. Send for

special circular. Prices f. 0. b. St. Louis, Mo.
Per lb.
MW ANTS S erevcveueteieses sires. tate ts fonwves situs tevaketanie ove pel enone $0.06 1%
TOOT VIR E SS iyniters cos rchereve tonenevat aiehensy Satie otare be tacsle 07
Apel Des ICES Wan aie kona teste ayer cinta Teer ee etonaeva tele aye 07%
POW AS KOS Sita everclear sins tava: atavere res edenersahsranerete: ss 08
Onl Deen ail Seysyerevep terctishecche seks tek orek Ser eh any ecereueirake .10
By Usp XeNNSriog athos bop o COS a 6 tro oc eect 13
Zo Won MENS Foc doo acunsacbopaet 65 somo De aD 14
iv UiiCEN Sob odoooodoon Ue Udeolomacoeimtan 20
White Hellebore (for Worms and Leaf-Mating
Insects) —% Ib. 10¢e; % lb. 15c; 1 1b. 25c; 5 Ibs. SI.

Paris Green—¥% lb. 25c; 1 lb. 40c; 5 Ibs. $1.75
Write for prices on larger quantities.

Whale Oil Soap (Good’s)—1 lb. 20c; 5 lbs. 75c;
25 lbs. $1.75. Write for special price on larger
quantities.

PRICE LIST DEMING SPRAY PUMPS AND APPLIANCES

Shipments made from St.

Appliances.
Fig. 689, the ‘Perfect
Success’’ has a_ special

adjustable foot rest, which
clamps bucket and pump
firmly together ‘so that
the entire outfit may he
carried from place _ to
place in one hand. The
bucket is not furnished as
illustrated.

Four feet of %-inch
hose and our ‘‘Bordeaux”’
nozzle are furnished with
each of these pumps.
They are packed in neat
strawboard boxes. Ship-
ping weight, crated, about
12 pounds.

Fig. 689—‘‘Perfect Suc-
cess” Pump as illustrated
and described (Cipher,
Kelter) $4.50

Seven foot section of 34
inch hose, couplings and
pole holder for tree spray-
ing (Cipher, Kedlack),

TATE LG OticnoC.OU OOOH $1.20

“Success’’
Bucket Sprayer

Fig. 689.
Pump Catalog

See page 10,

Louis or direct from factory.
The following are only a few of the styles we carry.

85

Send for complete catalog of Pumps and
These prices are net.

Fig. 645—The ‘“Cen-
tury” Pump, is the best
all-around barrel sprayer
on the market. It is very
strong and durable and
with proper care will last
for years.

_ The pump is only 44
inches high, having the
large air chamber located
principally within the
barrel, leaving no.projec-
tion to catch in the
branches. The cylinder is
submerged in the liquid
and is constantly primed.

The “Century” Sprayer
has a 2%-in. cylinder. A
special mechanical agita-
tor is provided, also ad-
justable base in which is
a filling hole with cap.
Base fits a 10x10 square
hole. All working parts
are brass and the plunger
is provided with special
packing. Double discharge
Y, Fig. 364, is regularly
furnished.

Shipping weight of pump
only, boxed, about 75 lbs.

“Century” Barrel Sprayer
Fig. 645. See page 20,
Pump Catalog

50 gal. Barrel, paint-
ed and ready for
mounting ....... $2.00

| WEBER &
NURSERY,

Mo.

Fig. 645, Sprayer only, with Y connection Section of %-inch ‘“‘Deco” Sprayer Hose, 12%
(Cipher, Kinate) 9. ao is.cichinecorcnonn elnios 11.00 feet long, with couplings, pole holder and
Outfit A, as above, with one 12% foot section nozzle (Cipher, Knavish) .........-+..++.-+ 3.25
of %-inch hose, Demorel nozzle and pole
holder (Cipher, Kernish) ................ 14.00 THE “GARDENER’S CHOICE”

SPRAYER

For gardeners, florists, growers of small fruits,
ete., the ‘“‘“Gardener’s Choice’ Sprayer is very suit-
able. It is light and easy to work; is well made
and strong.

The frame is largely wrought iron pipe and the
twenty-four gallon tank is hard wood, well hooped.
The wrought iron wheels are 24 inches in diameter,
with a tire width of two inches. The extreme dis-
tance from hub to hub is 33 inches, and 30 inches
from ground to top of tank. No axle is used, the
wheels being attached to the tank by trunnions.

The pump used in this outfit is similar to the
Captain Sprayer. It has a 1%-inch brass cylinder
and 4-inch stroke and is furnished with a twin-
paddle agitator, 6 feet of discharge hose and the
Bordeaux nozzle.

The shipping weight of Fig. 651 complete, crated
(including cart). is about 120 pounds.

Fig. 651, Gardener’s Choice complete, as illus-
trated and described (Cipher, Kidder)....$13.50

Fig. 651. ‘‘Gardener’s Choice’’ Sprayer Section of 14-inch ‘‘Deco’”’ Sprayer Hose, 12%

Outfit B, as above, with two 12%-foot sec- feet long with couplings, pole holder and
tions of %-inch hose, Demorel nozzles and Demorel nozzle for tree spraying (Cipher, A
pole holders (Cipher, Knightly) .......... 17.00 Kn avi shy ceieeoe ier eeolei iene heierteerete B25

SPECIAL COLLECTION OFFERS TO OUR MAIL ORDER TRADE

: To those who do not care to select special varieties from the catalog, we are making a few “Special
Offers.’”’ The selection of varieties must be left to us; we select only good varieties in filling these
orders, and send you first-class stock only. ;

Our terms are ‘‘Cash with Order.’’ Express or freight charges are to be paid by the purchaser on
collections not specifically marked ‘‘By Mail.’’ Order by number only.

Collection No. 1—Ten Everblooming Roses from Collection No. 8—Ten Ornamental Shrubs, 2-yr.
2%-inch pots, May ist delivery. 10 varieties. By old plants in 10 standard varieties. Our selection.
MAI] POStPAIGs Wea aie euekeess eva eletoemeotees $1.00 PHICSk hi A Sie Bens eee ntoks Girne eee $2.50

Collection No. 2—Twenty Everblooming Roses Collection No. 9—Twenty Ornamental Shrubs, 2-
from 2%-inch pots. May ist delivery, 10 varieties. year-old plants in 20 varieties. Our selection, $4.50
LAE SMEG TOOSHOMIGL- sonnoaccodgovu0dnebonoDdad .. $2.00

; Collection No. 10-—Fifty Ornamental Shrubs in 25
Collection No. 3—*ifty Roses from 2%4-inch pots, varieties, strong 2-year-old plants. Our selection.

May ist delivery, 25 varieties, 30 Everblooming IE ina ao Sct ern OOO GOD aval eveianeCrtst one $10.00
AinGl OX) Jalidoaiel [Aa sEN Goobbaanovoodgoednue $4.50 Collection No. 11—Two Apple, two Peach, two
Collection No. 4—One hundred Roses, 60 Fiver- Pear, two Plum, two Cherry, 5 to 6 feet high. First
blooming and 40 Hybrid Perpetual in 25 varieties; OAC aceanepodooouDeanoooooDDGbo04 we cccee $3.50
Matyas thidlelivieryeccicisisicrusicc.s.cisonlekecolehe costae te Plein $8.00 Collection No. 12—Twelve Grape Vines, 2-year
CollectionNion Saimentvativcuriarayamercnniale plants, 4 varieties. Our selection .... terete - $1.00
in 25 varieties. Our selection ............... $3.00 Collection No. 13—Five Gooseberry, five Currant,
Carne A seit Tena? 12 1 : 2-year plants wooo ..< cts qicele ctoleieiisls-siche eee AO)
ollection o. 6—Fifty Hardy Perennials. in 50 i 4 - ' 5
varieties. Our selection .................... $5.50 So ae Ne. a a: Ehpee Japan Walnut wae eitce
Collection No. 7—One hundred Hardy Perennials Collection No. 15—Six Apple (3 varieties), six
in 75 varieties. Our selection ............. $10.00 Peach (3 varieties), first-class .............. $8.00

86

GENERAL INDEX

Puge Page
Classification of Ornamental Shrubs .......... Bom AaTOVe Perennials. 5 <jotis cle eslcletal cis ipicisiclete: vis 68-75%
Classification of Ornamental Trees ........... 26 Insecticides and Fungicides ..............0.005 86
Cut Flower Departmentias cis ace eo Bee 5 MeL NEVO CLOL Vater roreteercinicraisietalatarcuaierievel acter rarely, aire) arene 1
DeachW@Hous s Shri saeetete pete oaleteteishe ial cie rata 89-52 INStuucttonseroruSprawinean. ciniecisnloeniem ste 1 ais 6-7
Deciduaus TLLGess oo ees ate ie ctetostel sie orotate 25-34 Landscape Department ......
Directions for Planting Trees and Shrubs.... 4-5 Ornamental Department . me
RIVOre GANS? « ciecccc celeriac isp < - Gdlo ec ee 60-62 MOINS dopo cooaro ecnub boro
PIVEREECOM SMM aclete tte alotelelerelereleleefecel<ts eiecafanere 62 Special Collection Offers
MOLVESELGOGOMNES Hacicieneaer clint eievct elses) sferexe: crete 54-55 Sere WAvosabels!! Srionctonoccomuorh Con op eee cotton
Formulae for Making Spray Mixtures......... 5-6 Tender Bulbs and Tubers..............-... bao Vid)
Ty gthiial Deyo kway er ak coon Goo Cue o OOH O 9-23 Terms, Conditions and General Remarks....... 3
Green House Department .............--005 82-83 WineSranideGHimbersteccnmcrelssircislere miretmeiaio ts 62-54
EVEL CL) Eat Sie areher siete ptatnieyepetoretetinrer cae) etal chelisi'ajfet'sy.ne 80-81 \ivciobrye WBRSS! a vododcadoundooovodooonnunAD 34-85

INDEX TO VARIETIES

Page Page 7

A IBIEVAYS Siehe 5 aracbenidnaogec 3 Daye Tal liv Acesisrcrene ayers stents cle ‘ “Tl
AH UOT Re CO): ead 82 IBIMSHElISU ety eto eee 74 Deciduous Trees ....... -.25-34
AGAClaEs ee ee ene 33-49 IVb) MESONE) cooocanoungouocc 70 Delphinitimae see eee 68
Acalyphan mes chroma nce 82 ane SHEE oooopoostesoned 63 Tele atete NEE PRON CLO a OncoIICS 41

St Rew ae 25-26-34 OCCOULAM ect treet taet ie 00 GUIWAE) adonaacou00nean bullae
rare ag tw dig, SPO. es het IBOltOmIa a eines oto Se 66 DEW DOREY efi cits cen eee: a 31
Achyranthes ..........0++- “82 IBOSTONUIVY.0 careeieoroeekiolersroha iene 52 Mianthuspassccrcvo mee 68
Woon itumli een kanes 64 TAM NE Soooaoonsnoocgo0n08 49 Wicentrakassee yas Ae ee 6s
AWdam’s: Needle los. ocncto. tes 78 Ise Glee, oo don noone abe 39 IDK. soosoondcconunnus 68
Nal OVS RE feat Isiee! Saison dope oben 79-80-81 Melytratra cots pie cone 68
Aegopodium Bushs Clover sracy..crcleve cevstere cle 46 IDIGAAMNED 4 oaabobahn sbaco slwele
Mesculucgeens Re choke D, Butterflys-VWieedmyemensaecmoe 65 Di sitalisterestepyt ccc 65
Ageratum ....... a ¢ EuttonmBushwersee cco ooe eee 40 Peawocd nYatcistelevetenerel cieis 29-40-41
Agrostemma c olichos Hefavonsverateisnarevereierriote 53
TANT See os ae ena Doronicum .,... meno d G00 :
FTULE So ntevnbigeb enacts Gultomimerivece a. ee 47 Double Flowering Grab’ 1.11132
RIE ee ; Callirhoe cl RAR Reece 66 Dracena Se RGN GaRerS es)
SIN Se ee he te 5) EN et etn curd GOR ORE ceed Ome 66 WERE LIVI sopcasseanaaguc 10
Bintang soi os soc ee 7 Calycanthusiac con scene 40 Dwarf Horse Chestnut...... 47
IISTESINOLIA tn foe once Campanillawerer ener 66-67 Dutchman’s Pipe ........., 52
Alternantherc GampIONyeee oe ee 74 :
/SICLTCE NT ec REE eRe ee Gandy Tuft oo... 121s eee... 72 = E
ATH INR OO Ger erences CUMS AO GonbtCOOOb UN BODO OS 79 (AL MOOD OOOO OU Dee 0
ITV SENTIMEE MES © Skee ote ie: Caraganamquecuinconr techie 40 IDEM soododo0cdudoboons
Amalanchier Cardinal Flower ............ 73 EVI S oreysh reenact ks nine ae
‘American Ivy Canpintistepnrrnry. wore w on 27-25 Emptess Tree ...
ANNONGNAM oe ncn Carolina All Spice .......... 40 IDBINEN Bop cocnacecacsoooun
AGMpOlOpaISeee: foc eee ‘ Carolina, Poplar }.-.¢:.....:. 31 EW paltonitimee ee nes
Ammedaluspey ici: Caryopteris BUOATINE ooogasouenacenoae
TGF (O SEEN co Ee Calalpanyee con sym k ren cite 28 IDOE) SoooksoocangnatiZc
Mvlewionene.... : : CAstanecatiny en eee Hvening Primrose Be
Angelica Tree @eanothuswert icine HiVereneens| pe soe
IR AECSTI EL toh. a ee ae : Celastriisee Rew tro shuer tee 3 Evergreen Shrubs
ARTE OnI CUI rte ee 65 Celtis oe ee : EXOCHORd ater
ADIGH eT as it terauseee 9-10 Centaurea ...... a0bot STAG TSM Nt, aon on Cees
Maple mb want. a6 5) eee cernnue 10 Cephalanthus B
Amulet Crabiee os ee 10 Cerastitmr wre er csc eee HA SUS ie peaterte eee 29-34
ESWC |b SSCS Sen 15 COVERS Gacgdccncgguo0nee 2 False Chamomile .......... -66
ISGICIGISED heat Bete i a eth 65 Gercidiphyllumbe ase aes 28 False Dragonhead ..... 76
TASB” 01 ee ene ae ae! 65 Cercistiin ee he pa Sane 8 Halsenindigoweee cena ae 39-66
JNA EUEES 5, Ea eee et Ua a 27-39 Gherryagis- natn: 13-14-32-34 INAS, IBN? sooradnae os 70
TE Co ae 83 Chestnut smite 16-46-47 Inv, GENE Songa sonoonhe 82
MAE, ena 65 Ghiliamblilyevere cs eee 64 Festuca Glauca ..........1.: 70
APIRCOICCHIA eek ee 52 Chinese Chestnut ........... 52 CUS Sir esl Mean lice 3 ame aatans 82
Vial). Ga ees ae 65 ChinéSemiilya cence 31 UO cleat ee eo eras iae ae eee ae 16-41
ATECINGSI abate ee a 65 Chionanthus) sscnceacm eee 29 Hirer Bus hiwescr men seas
ATUNdol Monat nL iher 69 Chrysanthemum ......... 67-65 Flame Flower
Nacloplast Ave ht oer 65 Cinquifoil Fleur-de-lis
ASTisai he. ee 29-30-33-34 Cee Flowering Thorn

Se Se «at RL 65-66 QUE eco eei ca. Gio. cn 6 Gatco Oman orest Seedlings ...
CHES) dra ocgnenado uM Porsythia 5
Aspandeus eee oc 24-89, Columbine Foxglove
WiZaleah kia in, Renn ar 39-62 Baus sheet : ates
OVE Germ thie ose Os cee omen evel reesia
, B (Comic: TNGiiGier Genene come dom oe IONE cococsedcor

Baby/si eueathemeerer aca 69 Woriyallani aia vty aes & 68 Giunkianh acy een yams beat es
Bacchantsy spictxs stele. ies 39 (COKGCHUS indo gooapedudoouwaGe 46
Balloon Wlowerl 230s. eee 76 CGOLECODSISH is aire sasierecetne 68
Bamboo. cae le a 66 Conners ernie thisioroans 40-41 Gaillardia
BambDusae ts teres oe 66 BOE SM rye sicke ethetsursusns 29-40-41 Gash antennas
Barberryzestinteve coherent 39 Soronlllaimevie Were. wiki ees 41 Geraniumene ie as ene OF
Baptesigy tens oe ees 66 WOU Hers fetaictave lsc onic oe 41 (CANE AR ho at ae ene eae
Beard’ Tongues scsee oe ee 75 (OS H=)) ofS SURE AE S art mest a ee ea 10-32 GUEGIOWEE) scacoctonoucnn cn.
Béech Hae cece Oe Crane sr Billiard sy. scene 69 Gleditschiame as aan
Begonia... see oer 82 CHEIZCEUEL Pap bem de doaben bone 29 Globe Flower ..........
Bell Blower .......... 66-67-76 Creeping Jenny ............ 74 Goats Beard Re
Berberis's .. ...sasremreatiee re ere 39 CLrOWAHOOt case a. cae Sales Golden Bell ...
Bergamot (OCC. HOSUR TOOT oe 81 Golden Chain
Betula tic..isven eine eee c GaMrantSe is says etre io ies 17-18-48 Gooseberry
Bignoniaue a. nee SY GOniater try eee Mlle cameo 41. Grapesnn ts es aoe ae is
Pird’s Eye CY PLCS eee ets hoon 33-82 Gretasestie yet sn. eae ee
Bircham 6 OMUEIEE). 66.2 polo ce COO EtG 29 CROCE HU nnatogonoscce
Bishop's) Weed! )..- 20-7... .. 64 Groundsel Tree
Ritter Sweet ...¢..:210500. 52 D Gymnocladus
Blackberry secs macnn 19-20 IDG htholohl oa po pa aeie mos be Bre 81 Gynerium ,....
Pladder Senna 2.22 ll. 40) IDENFUIGE to Arce: fer eRe em Ae 79 Gupaaphilaics wise 5 os

INDEX TO VARIETIES—Continued

Page
H
ELA ck Derry cme entealocvoneee: 28
Pal esiawan airmen tote 30
IeeuMehven oc os contoeoecconoc 44
TPAC ya Seepera soni Oioer areas 16-41
Frardhieddsmiasisue accent 67
Hardy Perennials ........ 63-78
Hardy Sunflowers .......... 70
Eled seme lantsmeneytteeeeeD
VCGELA, Geaietertisicoieoce nace 53
1ekeyKyobhbhorlks orm pocorn ohio tay Goca os 70
ISIN MIO Gooochecceoncccos 70
FLCMODSISH ent taeeen 71
HiSllOtRODe ee sei eee 83
ELETMICTOCALSIEEE ieee eee 71
EVerculesm@ lu bien 27
TICSPETUS is aay ain cE eee fal
PICUCHer ay te ance etnine 71
FA DISCUS mre eee 45-71-82
(elo) | higemeurirce ay Siem. cheeig ercnGiots chika 62
ELOY HOCKS irene 72
leloraeny ALCOR. Gogauaaoeocobd 30
ELONeEYSUCKIC Hee eee eine cen 47-52
TODS MET C Ors sissecs aeons feo 48
THOMA OVER Socanoguossocne 27-28
Morse Chestnut ......:... 26-47
ISRAVOINIDS “Gooeoodgoosaacode 80
EG Grangseaener nr meee 45-46
IERAQPIOB Gat io oogwecnauepacaos 46
I
PD ELIS Rose eo ew ain hens 72
WOR Hae rescene ine osteo oto 46-62
Inidianwes canine on ieee as
Imecarvalleaio scanenceiscn rhea 72
Tiss GenrmManweeineen mnie 72
ihe," UENO sootadancudws d 72-73
DGS. UXEiexomorrercit Boa bodaac 72-73
ibatse Spool “Gdoddedsooscaus 81
1st ee Sehnert tice Ok i ae ReRCA eee eRO 46
Vays ic tten esecect asin eaten a eS
J
Hehoeh WAVOIE ssoucpoouscupus 26
Japan @ Uincemers awn eine 41
MASoopotbhe Ks sogroocec space 46
Jierusalem) (Cross! {oss eae oe: 74
JONG WIS Mens ee ee 81
JudasPEneeusiwn si eee ere 28
JUSIANS oor ean een 16
K
IWMI,” oc ocpoaggascDsog0dnO 62
Kansas Gay Feather ........ 73
Ee MibI as Jase etnias torneo yoke tere 83
Kentucky Coffee Tree ...... 30
IEAM OE NMS Gian ates OLS A OER SHOT 46
NAD WECOMA SEIS. jcreator 67
iKoelreuteniam neeneee enter 30
IKoCvAb WING) Ss aco 0 acco cbeo 53
L
ISATICAN AT ERAT reece cae 83
ILCH AO ay EAinnip gibt oO a aoe 30
IEE Ob ncaa deo ce toe ba Uo 30
marks pur See ey ceva nua e tere 68
Wartaniarstincsseveealeaie ieee 83
Wathyruseeeceee ces Che eu SiN nee 73
A VeNilETsiisaasicucrarn eens ie ee 73
Wavendulavee eerie teenie 73
Bea dwort! i ser iidiesoe eee ones 76
Leopard’s Bane ............ 69
Meriodendcont rere eee 30
THES PCE Z ai is toate tee 46
GREW EAC er epererork rade Morera OD OIG Rc 73
TiS US true ee eerie 46-47
DESI EI Oplereien Sh osreb ther eimaritite 50-51
MSIE ees als ais eee 73
JEAN Die ctomia a Dice mae tence Oo OIOKoe 73
Lily-of-the-Valley .......... 68
Minden accede se neo OS
ILCHOWIGEBAN XS! “555 55en00cconOS 30
WOD eliaictt tye rns isteactie eC epee 73
TWO CUS Peasant Rey eee 33-49
lombardy, Poplars... seen 31
WWONICETA Sars aoe eee 47-53
WOOSCHSUPITCS renee eee aioe 74
ME UDITI Cw a slanew suet teste Ree ee 73
WAU PINUS) Wrevecucps nredonetecencrenewo ear 73
TEV. CHMIS Perera eat Oe 74
I iconv be alah ereciaus Binnie oe orc Orn cro
Lysimalchiai@e reise neater 74
M
MEVANAIEY: Gbiabinoeosateso oc 30-31
MAM ONIA» .. a Gaetereeste ene 62
WIEIGIEI IBEW Aon oo oe aans aon oho

Page
Mallow nits ss eon area Til
Mapleticies tsa cn ciiee 25-26-34
Mar giienite tactics 65
MarsheMarigola sans nee: 66
Matrimony Vine ..:..)......54
WIGEICWOKy, IRIE Baa oov oes candcs 78
McCAd OW ESakeue eee oe if
Meadow. Sweet .°...5..:. 49-50
MGKtEN SIA. coe Gumi 74
MINT OU Manes ee oon eee 64
ILM OVE EN s Ortraccn Gioia to O.o.8 prose ac 69
MOC OLAN ere pee 47-42
MOM ANAS Saas ete oe eee ee 74
IICIENAWOAE Goocacdaunonsodana 74
MIG ASKCHOC! oobuecacueeancuas 64
Wioontlowerunnre rsa ieee rie 83
Moonpenny Daisy .......... 67
IWLORUS Cy: ceetsiererens © Stree neat ee 15-34
INLOSS#ePinikeee ee ire ee 76
MiGibUEhoN ING Gos bsoscsonsde 33
IMD KAGAA Socom nooo omaooe A 15-34
Myrtle on ackves Bisco 78
N
INAECISSUSE ces eters 81
Netter Tree iw pecs HOLS
INGwie SIGUE MNGEY Gaagdcsogooe 40
ENTS a2 Seeceeosie ree Ree PES 16
1e)
(OV on a oicaite cake Mees Fame oat 32-33
Oenothera = desctis se ecm 74
Oleasterstecwee cnn creme one 43
Orange Sunflower .......... 71
OAS reatenea ys Mea eee 81
=)
TACOMA Aten Mere werner 74
Palms eee eee 83
IEAVaN ORIG] CHARS p56 bcccosnos5c 70
ani Gan Sianercee eae $3
IPADAVieDE Re OL rane oer 75
Pauloni ain ei ssthord keene ee 31
IRAN LO ASR Se eee nines 47
PeaChurcte ruse r cee 11-12-32
Rear ae eee ees 12-13
IBEETAL BOS 55 goaw de poo bOO6 44
IEEE Ab Soo aagobnoeesacous 40
Pecan Haw ee cisternae 16
IPenS tenon eel 75
erennial ee came merece 73
IPE DIOCE- Sasoocdogsnncunp moe
PReriwinklesins nee tees 73-83
Persicad miki: epee Oe
IRETSIMNINO Nees 16
Pb alariShice pecans era Roe eRe 70
huladelp hiss eee eee 47-48
PHL OXE Se eee ran cata tee ase 75-76
ENYVSOSCESIA we aac ine 76
Pier Rlamtioirie ocr aioe aan DD
FOINIKISE tae oe easel ApEn eee 76
IP hale ADWA Son coco coon oro 69
Plane vLree ss ne eee 31
Blatamus oi sieince dearer ee vee 31
PI avyiCcodOnween Eee 76
IP humasiixioeiete sate ee eee 14-15-32
IPAlEHOMOEVEO), Gascossdaoucosss02 76
Iie JEON Hocasenooenccsd 66
Polygonum eee emit 76
Poplar: Ree erase eee 31-32
PODDYasts. Gitte ee oe Le 75
Poppva Mallowae-e. eee 66
IPO OMS sonnoscoscnceno vamos?
Potentillatiks sy ac.cscconk niet 48
Pele aig vorsrirceasseie acre ec eke tohe 4$
IPRIM TOS Cyr eceyeutcn cacti an
PEUIMUIAw payee sere ere 77
Privietstee Sa oe 46-47
Bruns aasoercrs ee enone 32-48
IAprewavewbad coogoooneocesonns 77
RY LUST Ae ptt oem ae eons 32
Q
QUIN CORB e Ate ce eae 15
QuerCUSE Seco eR epee

Ragged Robin
INEM DMOVOONIS Gosconncecnoeses

aS DREGE of hci ee 20-21
REC Budy 7s. cota eer ee 2S
IQUaeheaIS! Geooeovsconcuaocue

Rhododendron
RHOGOLV DUS neice eto
aN ONDIS Ha CMen aA cetntosroc Minnow tio.b

Page

Rese/Campionws eee 64
Rose: Marints) 5. sos pct ceee 77
ROSCMAarys cic eee 77
ROS LOLsSharOn sein ae 45
ROSES wrarercniemae Pe the o-o Uieiaiaie ms boi 50)
FRUPUS = iacrsren Geo an nee 49
WGK GNOGE, ne od aeanonccolu ce 77

Ss
Salisbunia: [tance en cae 33
SAMI. Store eee 77-83
SSR ses serge stereo ee 33-35
SEMIS. Seo goododoessnans 49
SAM wort! «...5 Fn eee eae 65
SGCabloSayh nus aera eee eee 77
SCOLDIONE Senna tees 4]
See) IiWENOGSIS S vacoucacauesedc 64
FS) S\olt Non een CRRRaETEb oD cro. & Ble a 7
SEn€CIO Gee ao rn 78
Silks Vane iat ue ee ee 54
SIMEPNBEL Voainanenn eee 30
SNCEZEW OLPEt aki eee 70
SONAL so sadauseqddosecncn 52
SHOWAD RODS mene mine 81
Sits MOMS, WO caecdgauaesn- 46
Sin JENS WWVOires panos eacac 51
SOnDUSHE Savy. eee ee ae 33
Speedwell sr. sseseeeet eee 738
Spindle irecet nee ane 44
SDITAeA se inle oe e eee 78
SPinéay Pic ec oe eee 49-50
Stephanandra sieharat een 50
StonerCropieeeeeee ee ene 77
Stokesiay ache one eee 78
SENVANIGA, sa ouceoonaous- 21-22
Sirawikenrnyshkee ees 44
SNUG CMa socaeoncacact las 30
Sweet Pepper .............. 40
Sweet Rocket = f02.)soeneee 71
nee NWANUNENI sao onsbannce 68
SUMAaCh A. Helo ee ee 48-49
SY Camore oes anon een eee 31
SNe elWOPACEHANNS 4454 50escc cn 51
Svringa, swesee Ole 47-50-51

Ww
DAMAPISK \ vrs se aos ele eee 51
TAM ATi ..< wis: shares Oren ee el
Tartarian Honeysuckle ...... 47
ARE OVENONEN SS ogaddsasacacc 3508333
AVOEVN@ Wee Soccepnoodse cen os Te
HOLT « Gyateeradeeeinrere oe ee 29
Thrilt. si eas ee. ee eee
Rb Berea ecomtaeth notes cress:
Toad Wily sak eects os ae 7
Torch Milly? tix utocn eee
Tradescanttiaheerse eee :
Tree of Heaven
Trefoil! ssa one ae
INTIEVELIS. vars eee ee
“REI! ce Sees ae eee
TrItOM a: nieces eet eee
Arollius 23civa eae enone 5
thigh aah oXeibe WOUaUSy ay ois a mig cise Gmc
Auber ROSES! sara ee cere
TRONS se Aas uct eee
Tulip Dreev:. fesceen eee

U
Wlmus~ aiicts ose ane eters 34-35
Marnish =r eels... ene eee 30
Verbena. <2 imsccaeina ne 78
Wieronica. oietines so sce 78
MeTviane — 205 sanittend s See 78
Muloppeabitl So 6hoessoccas so oct 5 2
MIN Cab oscar tastier eee 78-83
Virginia Creeper ............52
Vitex Agnus ‘Castus Samer y. 52

WwW
Wiel Ui 8a 5 cosa cetera 16
Wieigelia a2 22 Saeteeee 42-43
White Eringe- = sc: 2s 29
Wihite: Kerriay = 22 ce eee 48
WHO W-".siens «oll Cie ee eee 33-35
MWwanaChHONWDSE beosccucnccu+s [5c 64
Winiterberry.) 2) json ent 3...46
Wistaria: (2 Doe ova EL
Watch) (laizele aa ee eee 44
Wio0od ily. a tore eee eae 73
Santhocerasi a. ces eee

Serre retort one ne cweesaesee

08,

SAILAIUVA

AGS UE RD

PPO PU OR Ee eee ee

ORDER SHEET

H. J. WEBER & SONS NURSERY CO.

NURSERY, MISSOURI

| BY) (Cee 9 ee gee See Se Forward by Exess esas A ai tlacl cat erm | Please do not write here
UNG a a ent Se re Se See gna pS eg ene Sr rere
Street, P. O. or
RumaleDelivery. 3.) ss ee sa eee
ost Ollice: se et ee eee
Express Office (if different from P. O.) -.. .........--..----.---------
GOUT Eee Nn eae eee SLAC ress see ee
Amount Enclosed
nee ao Money Order on St. Louis
ees ee ae pas Draft on St. Louis, Chicago or New York
Ree Se Check on St. Louis
Ss eeenteed a ee Express Money Order
ae ae ees ae CES Registered Letter on Nursery, Mo.

Crate | VARIETIES Grade Price TOTAL

|
|

Batch: NC15 1912 Wa-We

29 AW,

. fig ; :¢ " "7 Fé i Gat
j >
eeeua P°?Se0Geessdtaa) &

oo

+

10 TEE) Gone) Bt
ai me i

iat ied
an