rjjjwM'Oit

iSHS ffl \ SH

l§B88$8fi§tffl fl

* ■-'■■>■>'■■'■'' -.i-.'- '''■'.'■■■■: y :'-, :

tiiihi ttTTiTnraiimffffTT iti

^HijiiiH;^;:;;!1-;1:;-,':

tmHcH

'■'■ HeHS ■ ' '■'■'■■

v - * « . ■

■■'■■■■: • <;»: » ..•.•..•-'.'..... .

;-":•':■ hV'.«.;-;.) ;;■;;•,:■;-- ^.

" "■' ' ' ' ■■'■ '■/■.! -".''■* ? " - 'i ' .■-.;*.. ■

^:i:

Warn

M

— :'-■£'.;.■.■ ■. ;. -■"■•■■ ■■ --■-■■■-■■

in>;:!-vii;:;r;-:;;-

8g§

;';; ■'''••■'•■ ;' Ssij ;.-■:■ • " ''

■ • i -4. i-. • . ■■- :•■:.;:■ i ■■■■::■ I •■.'.;. ■ ■•-•''•-'-■ '. . ..;-■'' '-■ ?' ' , ' • - ■ -. ■ '■

WBXSm

IwfMfMMifllffi

UNIVERSITY OF FLORIDA LIBRARIES

COLLEGE LIBRARY

Digitized by the Internet Archive

in 2012 with funding from

LYRASIS Members and Sloan Foundation

http://www.archive.org/details/johnmiltonscompl01milt

UNIVERSITY OF ILLINOIS EDITION

OF

JOHN MILTON'S COMPLETE POETICAL WORKS

IN PHOTOGRAPHIC FACSIMILE WITH CRITICAL APPARATUS

IN FOUR VOLUMES VOLUME I

JOHN MILTON'S COMPLETE POETICAL WORKS

Reproduced in Photographic Facsimile

A Critical Text Edition Compiled and Edited by HARRIS FRANCIS FLETCHER

VOLUME I

POEMS, -&c. UPON SEVERAL OCCASIONS, 1673 POEMS, BOTH ENGLISH AND LATIN, 1645

With Fugitive Printings, Manuscript Copies, and Their Collations

URBANA

THE UNIVERSITY OF ILLINOIS PRESS

1943

1868-1943

This book is published by the University of Illinois Press, under the auspices of the Graduate School, in commemoration of the Seventy-fifth Year of the University of Illinois.

Copyright, 1943, by the University of Illinois Press. All rights reserved. Permission for reproduction in any form may be obtained from the Publisher.

This edition is limited to 550 copies of which this is

Copy No. 25 7

CONTENTS

PREFACE AND ACKNOWLEDGMENTS

PAGE

I

I. POEMS, &c. Upon Several Occasions, 1673 On the Morning of Christ's Nativity, 15 Paraphrases of Psalms 114 and 136, 21 On the Death of A Fair Infant, 23 The Passion, 25 On Time, 26

Upon the Circumcision, 27 At A Solemn Music, 27

Epitaph on the Marchioness of Winchester, 28 Song on May Morning, 30 On Shakespeare, 30

POEM ATA, 1673

Testimonia, 100-103

Elegiae I-VII, 104-118

In Proditionem Bombardicam et al., 118-119

On the University Carrier I & II, 30-31

L'Allegro-Il Penseroso, 32, 35

Sonnets I-XIX, 39-45

The Fifth Ode of Horace and Ad Pyrrham, 45

At A Vacation Exercise, 46

On the New Forcers of Conscience, 49

Arcades, 49

Lycidas, 52

A Mask (Comus), 56

Psalms 1-8 (1653) and 80-88 (1648), 79-97

99

In Inventorem Bombardae, 119

Ad Leonoram Romae Canentem et al., 1 19-120

Apologus de Rustico et Hero, 1 20

SYLVAE

In Obitum Procancellarii Medici, 121

In Quintum Novembris, 122

In Obitum Praesulis Eliensis, 127

Naturam non Pati Senium, 128

De Idea Platonica, 130

Ad Patrem, 130

121

Greek: Psalm 114, Philosophus, In Efngiei, 133-134 Ad Salsillum, 134 Mansus, 135

Epitaphium Damonis, 138 Ad Joannem Rousium, 143

II. POEMS, Both English and Latin, 1645 On the Morning of Christ's Nativity, 157 Paraphrases of Psalms 114 and 136, 162 The Passion, 164 On Time, 166

Upon the Circumcision, 166 At A Solemn Music, 167

Epitaph on the Marchioness of Winchester, r68 Song on May Morning, 169

POEMATA, 1645

Testimonia, 218-221

Elegiae I-VII, 221-235

In Proditionem Bombardicam et al., 236

On Shakespeare, 170

On the University Carrier I & II, 1 70-1 71

L'Allegro-Il Penseroso, 171, 175

Sonnets I-X, 178-182

Arcades, 182

Lycidas, 185

A Mask (Comus), 189

In Inventorem Bombardae, 236

Ad Leonoram Romae Canentem et al., 237

147

217

SYLVAE

In Obitum Procancellarii Medici, 238 In Quintum Novembris, 239 In Obitum Praesulis Eliensis, 244 Naturam non Pati Senium, 245 De Idea Platonica, 247

238

Ad Patrem, 247

Greek: Psalm 114, Philosophus ad Regem, 250-251

Ad Salsillum, 251

Mansus, 252

Epitaphium Damonis, 254

PAGE

III. A MASK Presented at Ludlow Castle, 1637 Edition and Manuscripts 261

A Mask, 1637, 262 Manuscript of the Five Songs, 340

The Bridgewater Manuscript, 300

IV. LYCIDAS, 1638 345

V. EPITAPHIUM DAMONIS, [ca. 1640] 353

VI. POEMS PRINTED BY OTHERS 363

On Shakespeare, 1632 3 States; 1640; 1663-64, 365 Hobson I & II, 1640, 1657, 1658, 369-371

Lawes Sonnet, 1648, 368 Fairfax, Cromwell, Vane, and Skinner Sonnets, 1694, 372-373

Vane Sonnet, 1662, 368

VII. VERSES FROM THE PROSE WORKS 375

VIII. THE TRINITY COLLEGE MANUSCRIPT 381

IX. MANUSCRIPT OF AD JOANNEM ROUSIUM 457

INDEX OF TITLES AND FIRST LINES 463

PREFACE AND ACKNOWLEDGMENTS

A BOUT THREE HUNDRED YEARS AGO a small volume of poems appeared in the /— \ London book market, introduced only by a statement of its professional bookseller- A )\ publisher. The volume contained all but one of the shorter poems by John Milton that have since won the acclaim of critics and the undying admiration of discriminating readers of English poetry. Only the Cromwell sonnet was missing from the roll-call of Milton's immortal shorter poems. It is peculiarly fitting, therefore, that this facsimile edition of Milton's minor poems should appear, in a way marking the passage of three hundred years since he first printed any of his poetry under his own name.

This Illinois edition of Milton's minor (shorter) poems assembles the necessary materials, in print or manuscript, for the study of the authentic texts of all the poems concerned. Herein are collected reproductions of those poems printed and thus acknowledged during his lifetime and of the manuscript copies of the same or other verses which he made or had other persons make. The remainder of the poems or copies of poems included in the present edition consists of repro- ductions of fugitive or otherwise irregular printings, of manuscript copies of the same poems made during Milton's lifetime, and of a few authentic though posthumously printed poems. Thus, the present edition is aimed at satisfying the serious student of Milton who desires, above all else, to know exactly what Milton wrote or succeeded in getting printed.

The majority of the texts reproduced here come, of course, from the two editions of 1673 and 1645 respectively. All texts are presented in photographic reproductions, which, for the printed editions, are the actual size of the originals; but which for some of the manuscripts are reduced in size. The order of printing calls for some explanation. The 1673 text is placed first because for all the minor poems except the three posthumously printed sonnets, this edition is the last Milton himself could have seen through the press, and it thus becomes the most important of all texts for the minor poems that it contains. This is followed by the text of the 1645 edition. After this, in roughly chronological order, come the other printings, followed by the Trinity College Manuscript, reproduced here from the William Aldis Wright reproduction of 1899 by permission of the Cambridge University Press. The Bridgewater Manuscript and its transcription have been placed with the texts of Comus. By permission of The Earl of Ellesmere, the manuscript is re- produced here for the first time.

The notes provided are textual only, showing variants, if any, in different copies of the same edition or issue, and the principal textual differences between editions. The variants listed be- tween different editions are all that the editor has found; but the list may not be complete. However, the originals are before the reader, and the list may be increased. A variant within the same edition may begin as a sort of peculiarity in a particular copy or in some particular copies, and then the peculiarity may have been changed at some point of the printing process ; hence any peculiarity in any copy may, but not necessarily must, give rise to a true variant in another copy. The variants within the same editions have therefore received the greater amount of attention, as most of the differences between different editions or between printings and manuscripts, can be observed directly in the photographic reproductions as printed here. The variants obtained from collating different copies of the same editions are not thus evident, and dependence upon notes becomes necessary.

The collations need special mention. Every attempt has been made to assemble as many copies as possible of each edition used for textual purposes. Most libraries in England and the United States owning copies of printed editions of the minor poems in their various forms have

PREFACE AND ACKNOWLEDGMENTS

supplied photographic reproductions of all the copies they possessed. At the same time, enough original copies of the various editions required have been assembled during the past fifteen years at Illinois to ensure control over almost any textual peculiarity that might be encountered. The textual notes are the results of collating all these copies, actual and photographic. In the case of manuscripts, the actual work done was based on photographs; but all the principal manuscripts were examined in the places in which they are located, in situ, as it were. Unfortunately, the so- called Lawes Manuscript of the songs from Comus, according to Foss (The Mask of Comus. Nonesuch Press: Bloomsbury (London), 1937, p. xvii) 'now the property of the Misses Church of Beaconsfield' was not available, and not even photographs of it have been procurable, because of war conditions.

There is no need to explain the mechanical processes by means of which film was made, here or elsewhere, as the use of both strip or cut film and photostats is today too well known to require such explanation. The term 'magnification' used occasionally in introductions and notes needs more precise description. Magnification of printed or written materials used under present con- ditions has been of two slightly different kinds, direct and photographic. The condition of the type in all early Milton editions, indeed, the whole printing process involved in producing the small, cheap original editions in which Milton published his various works, very early in this study necessitated the use of direct magnification for any mark that might appear on any page of any text. At first, reading glasses of various kinds, including jewelers' glasses, were used, ranging from two to ten diameters or powers in strength ; but in too many instances, these degrees of mag- nification were insufficient. After much experimentation, a specially mounted low power binoc- ular, direct image microscope was secured. With different combinations of eye pieces and ob- jectives, magnifications ranging from nine diameters or powers to 6.8 x 17 or about one hundred fifteen diameters or powers can be obtained, and this range of magnification has proved ample for all direct purposes thus far. But once or twice, as on page 6 of the 1645 edition, even larger magnification was required for purposes of reproduction, and photographic magnification was used. That is, the punctuation mark that refused so stubbornly to identify itself was photo- graphed microscopically at about one hundred diameters on a glass plate and a positive paper print made from the glass negative. By projection, almost any degree of magnification could have been secured from the negative; but the magnitude mentioned proved sufficient. Thus, whenever the word 'magnification' is used, in introduction or notes, it means such degree of magnification as is required, and theoretically might mean anywhere up to a thousand diameters ; but practically in the minor poems, magnitudes of not much over one hundred diameters were almost always adequate.

It is difficult to deal adequately with the debt of gratitude incurred over the period of twelve or fifteen years required for the completion of this edition. The editor wishes to express formally his gratitude to every one of the scores of persons in this country and out of it, living and dead, and to the various institutions that some of those persons represented, that in any way contributed to the formation of this work. Acknowledgment is hereby made of the most generous response to all manner of requests, chiefly for photographs and information particularly about copies of vari- ous texts, from all libraries approached, directly or by correspondence, in England, France, and the United States, especially the British Museum, the Bodleian, Cambridge University, Trinity College, Harvard, New York Public, Folger, Yale, Texas, Huntington, Morgan, Columbia, Bos- ton Public, Princeton, Newberry, Wellesley, Chicago, Michigan, Cleveland Public,. Bibliotheque Nationale, and to James Hammond Pershing of Denver. The Cambridge University Press per- mitted full reproduction of the Trinity College Manuscript (reproduction of 1899), and The Earl of Ellesmere granted permission to reproduce the Bridgewater Manuscript of Comus.

PREFACE AND ACKNOWLEDGMENTS

The entire project owes more than can be adequately expressed or in any way repaid to the unwavering support in its early days of the late Arthur Hill Daniels, then Dean of the Graduate School, and to the active and incessant efforts of Phineas Lawrence Windsor, now Librarian Emeritus, to assemble the original and photographic copies necessary to carry out the idea. Ten or fifteen years ago, support of a ^lan as tenuous as this one then was, required courage, imagination, and foresight of its supporters. Dean Robert Daniel Carmichael of the Graduate School has been an unfailing source of counsel and encouragement, and through the Graduate Research Board, has generously funded the various needs of the entire enterprise. Without his support, financial and otherwise, the work could not have been carried on through the long, formative period required to assemble, collate, and arrange the necessary texts. Willia Kathryn Garver has been an unfailing aid in acquiring the needed copies, and of inestimable value in working out ways and means of making and keeping the assembled materials readily available. Librarian Carl Milton White generously took over the increasing responsibilities of collecting and housing the growing amount of books and photographs, and the equipment required to make both usable. The editor owes much to Isabelle Fitch Grant for her excellent arrangement and care of the materials assembled, as well as for her countless kindnesses and services. Marian Harman has read much of the bibliographical material herein contained, and pointed out many an error of omission or commission. Professor Sidney Erwin Glenn proofed and corrected all introductions and headnotes. Professor Frank Allen Patterson has responded in his kindly and generous fashion to all manner of requests and questions. The personnel of the University Press who have come in contact with the publication have been most helpful. Harrison Edward Cun- ningham, Director of the University Press, and Charles Everett Herman, Superintendent of the Print Shop, have been most helpful, patient, and generous with their consideration, time, and wide typographical knowledge, in connection with the complex publication problems presented to them.

To produce this book, the editor's material was set in type, and proofs made. These proofs were combined with photographic prints of the original books and manuscripts. The book was then made from photo-offset reproductions of these combined proofs and prints.

The canon of Milton's poetical works is easily established, except for the many posthumously printed poems attributed to him. These attributed pieces are arbitrarily excluded from this edition by those standards set forth in the second paragraph of this preface. Careful attention must be paid, however, to the excellent statement by Professors Mabbott and French in the Co- lumbia edition of Milton's Works, volume 18, page 585ff., and to their notes to various ascribed poems. There remains only the matter of the two Latin poems found by Alfred J. Horwood with the manuscript Commonplace Book and published by him in 1877 as presumably Milton's work. See Professor Patterson's text and notes, Columbia edition, volume I, part i, unpaged appendix for texts and translations, and the appendix of part 2 of the same volume for an account of their provenience. These verses are excluded from the Illinois edition because their authenticity is un- proved, indeed, cannot today be proved.

POEMS, &c.

UPON SEVERAL OCCASIONS

1673

POEMS, &c. UPON SEVERAL OCCASIONS, 1673

INTRODUCTION

T

^HE MOST IMPORTANT TEXT OF MILTON'S MINOR POEMS is to be found in the inclusive edition which he published only about a year before his death. In the Term Catalogue (Arber, i:i5i[b] 1903) for the Michaelmas term ending November 24, 1673, occurs the entry, 'Poems, etc. upon several occasions. By Mr. John Milton. Both English and Latine, etc., composed at several times. With a small Tract of Education, to Mr. Hartlib. In octavo. Price, bound, 2s. 6d. Printed for Th. Dring at the Blew Anchor, over against Fetter lane, in Fleet street.' The book contains all the minor poems which Milton wished to pre- serve, except the four sonnets, XV (Fairfax), XVI (Cromwell), XVII (Vane), and XXII (Skinner II).

The Term Catalogue entry would indicate that the book was actually published sometime be- tween September, the beginning of the Michaelmas Term, and November 24. It was published by Thomas Dring, the bookseller ; but no printer's name appears on the main or English title page. However, on the Latin title page following page [166] is the statement Excudebat W.R. As the English and Latin poems were printed together with the leaves continuous and with the last sig- nature on which English poems occur actuallv carrying some Latin poems, the same printer cer- tainly printed the entire book. The initials, W. R., offer but two possibilities for identification. John Redmayne had been printing for a number of years by 1673, and at some time in the first or second half of the decade of the 1670's, his brother William began printing, usually joining his name to that of his brother John. There are apparently no known examples of William Red- mayne's printing before 1675; but all specimens of his work, six or eight in number, that have been examined, use type, ornaments, and style strikingly different from the same typographic elements in the Milton volume. The other possibility is William Rawlins, one of the 'printers set up since the act (1672) was in force' mentioned in the list of 'printing houses taken that day' March 29, 1675. (See Calendar of State Papers, Domestic, 17(1907) 43, Car. II. 369 number 97.) Specimens of books printed by W.R. or William Rawlins are seldom met with; but two or three such books have been examined, notably Symon Patrick's Jewish Hypocrisie, London, 'Printed by W.R. for Francis Tyton, . . . MDCLXX.' The fact that the date of the book, 1670, is earlier than the date of 'the act', 1672, does not mean that William Rawlins was not printing before 1672, but that he had taken the oath, as prescribed by the act, after 1672 and before March 29, 1675. The types in the two books, Patrick's and Milton's, are the same design, though of different sizes, and the small ornaments used in the two sparsely decorated books are the same. The Greek type on page 99 of Patrick and on Latin pages 70-71 of Milton is certainly the same, and much of the italic types in the two books is identical. Perhaps Rawlins' most famous book was La Calprenede's Cleopatra, translated by Robert Loveday, published by Peter Parker in 1674, and printed by 'W.R. and J.R.' in folio. William's type and ornaments are used for the first six parts of the book, or the first 540 pages, and the remaining 572 pages, beginning on a new page 1 and a new signature A with different type and ornaments, are the work of John Rawlins, William's brother. The type of the text in the first part of the book or that of W. R. is identical with the type of Milton's 1673 Poems. Another example of Rawlins' printing that was examined was John Fox's Time and the End of Time, 'London, Printed by William Rawlins, and are to be sold by George Calvert etc. . . . 1683.' This is a small duodecimo volume whose type is the same size as that of Milton's 1673 Poems. The type in the two volumes, both roman and italic, is identical, as examination of the lower case letters c, k, n, r, s, and w, and the capital

8 POEMS, &c. UPON SEVERAL OCCASIONS — 1673

letters C, R, and W demonstrates. Another peculiarity of this type font appears in the star shaped period, Poems page 155 line 44, and Time page 160. From direct comparison of the type and ornaments in these three printed books known to have been done by Rawlins, it is almost certain that William printed Milton's 1673 Poems for Thomas Dring.

The 1673 edition is not an especially rare book today, although not many copies examined seemed to be in their original state and condition. But some of the thirty or forty actual copies examined are probably in the same bindings and perhaps in very much the same condition, except for some wear and tear, in which they were sold by Dring. Such copies are Illinois copies 1673 copy 3, 16732 copies 4 and 6, and Spencer John Ware, the last named bearing the date in inked manuscript, 1695 on the recto of the single old flyleaf in the front of the volume. Copies 4 and 6, both certainly bound before 1700 in their present bindings, have two blank leaves at the beginning and ending of the letter press. In copy 4, both front and back outer end papers are conjugate with what would ordinarily be the paster leaves. Both these leaves, the one in the front and the one in the back of the book, have been cut to about a one-inch stub. Copy 6 has had its end papers so wet that they are entirely loose in the book, and it is impossible to discover either their conjugacy or their order. Copy 3 certainly has a very old binding, but single end papers, back and front, both conjugate, however, with their respective inner cover papers, and perhaps these inner cover papers, now pasted to the inner covers, were once the other two free leaves of the double end papers. Other copies examined are less complete. As the book was issued to sell bound for two shillings sixpence, and as it is doubtful if other than sheepskin was used for binding books sold at that low price, calfskin bindings, however old they may be, are special bindings. In such a case as copy 4, the book, bound in calf, seems to have been prepared for the binder by the printer in exactly the same fashion as all other copies, and with end papers intact. Then the printer or the binder cut off most of the front and back outer leaves of the end papers, probably preparatory to tipping on heavier paster sheets; but for some reason or other, now and forevermore unknown, the binding plans for these copies were changed, perhaps a lighter binding than originally selected was used, and the cut stubs allowed to remain as they were.

The front end papers, originally almost certainly double, or two leaves of a quarter sheet of cap paper folded once, were followed by four leaves of preliminary material, the four leaves formed from a half sheet of cap paper folded twice, with only the second leaf actually lettered A2, the title page being [A] recto, with the verso blank. This arrangement all but guarantees that the book was originally issued without any printed material before the title page, hence with no portrait. Only one of the thirty or thirty-five original copies examined and of the dozen or more copies known only in photographic reproduction, carries a portrait that may have been bound in originally, but there is no indication that such was the case. A few copies carry eighteenth century prints of some portrait or other, usually pasted on a flyleaf; but no other portrait condition than these was encountered. It seems strange that so few copies exist with a portrait bound in with a seventeenth century binding, especially the portrait of the type sometimes found in Milton's Logic of 1672-73, and usually found bound in the second edition of Paradise Lost, 1674. But the whole problem of the portraits in Milton's publications of 1672- 73-74 is a thorny one. Professor Patterson (Columbia 1(1931) 406) stated without hesitation that 'Most copies [of 1673] have no engraved portrait, though some have the reproduction by Dolle of the Faithorne [History of Britain, 1670] portrait, previously used for the . . . Logic' But of all copies examined or collated for the present edition, originals or photographs, only one, the Newberry Library copy, has the Dolle reproduction bound in, but not originally; and only Folger Copy 174 seems in any way to have had that portrait bound in before 1725. New York Public Library has a copy (16732) with a portrait taken from the 1645 edition! All copies of the Logic examined which have the portrait have it in a size too large for the book, the

INTRODUCTION— 1673

Dolle cut being made for a small octavo, and the Logic being a small duodecimo. The Dolle cut fits the 1674 Paradise Lost perfectly and is present in many copies, usually folded around the four preliminary leaves, with the inner conjugate sheet cut off and the stub still showing before the first page of the text of the poem proper. Could it be that the cut was originally made for the second edition of Paradise Lost during the year 1674, used in that book, then some copies of both the Logic of 1672-73 and of the Poems of 1673 supplied with it from the common stock of portraits? If this was not the situation, why do so few, if any, copies of the 1673 Poems carry it; why does it commonly appear, folded, in the Logic of 1672-73 ; and why is it so common in the 1674 Paradise Lost? The size of cut fits both the 1673 Poems and the 1674 Paradise Lost; but there seems to be no reason whatever for supposing that the 1673 Poems regularly carried the portrait, as almost no extant copies have it, and there is no proper place for it in the preliminary leaves. The denial of it to the 1673 volume is strongly indicated only because both these conditions hold. Occasionally the 1673 edition is found with much later portraits than the Dolle, but these always are obvious affectations.

The verso of the title page is blank. Leaf A2 carries the Table of the English Poems and this table is continuous to the Table of the Latine Poems, which begins on [>43v], occupying also [^r], whose verso carries the Errata. The English poems begin on page 1, leaf Ar, and continue through page 165, [L,3r], whose verso is blank. Next comes the title page of the Latin poems on page [1], leaf [L,4r], with verso blank; Milton's brief Latin preface appearing on page 3; the encomiums addressed to him beginning on page 4, and continuing through page 10. Milton's Latin poems begin on page 11, leaf Mr, and continue through page 94, leaf R2V. The prose tract Of Education begins on page 95, leaf R3r, and continues through page 117, leaf [S6r] ; with a cata- logue of thirty-nine law books printed for and to be sold by Th. Dring beginning on the unpagi- nated verso of that leaf and continuing through four more pages, or through the two leaves re- maining in the S gathering, [S7] and [S8] . The Latin and English poems, indeed the entire book, was printed as a unit, from the English title page through Dring's list of books, as the signatures prove; but the Latin poems bear their own pagination, which continues through the prose tract.

The ornaments are few and small, the only one of any magnitude being regrettably bad. Rows of ornaments occur on A2T, [A^v], [A^v], page 84, the Latin title page, Latin page 3, Latin page 11, Latin page 44, Latin page 45, Latin page 70, Latin page 79, Latin page 80, Latin page 95, and the only decorated initial found in the whole volume, one H, occurs at the beginning of the Latin preface on Latin page 3.

The type is not particularly noteworthy, being the usual Garamond roman used by so many London printers of that day and earlier. It is well adapted in size and appearance to its purpose in this volume. It has a few peculiarities which may be noted here. The W and w as in most Garamond designs have the left half of the letter cut lighter and a little shorter than the right half, which peculiarity in the capital letter makes it look too short as a letter whenever it occurs before a lower case letter with a full height ascender. The lower case k is worth noting, because the top of the upper right diagonal stroke of the letter is at exactly the height of the body of the other standard lower case letters. The accent marks in the Latin poems have been set from a font that had too few of them, and the compositor has met the situation as best he could from what he had to work with, which sometimes was very little.

The paper on which the 1673 edition was printed was single cap stock sheets originally about fourteen by seventeen inches, folded three times after recto and verso printing, to form a small octavo volume with gatherings of eight leaves or sixteen pages. Almost no untrimmed leaves were encountered in the copies examined, and the measurements of paper this old can never be more than approximate, as the original sheets varied among themselves in the same stock and there is no telling how many times the volumes may have been trimmed. The chain lines of the

10 POEMS, &c. UPON SEVERAL OCCASIONS— 1673

paper are in a vertical position in the printed pages. Three different paper stocks are found in the copies examined, usually two different watermarks being found in each copy, with an occa- sional copy in which are found all three watermarks. One of these watermarks, the most frequently encountered in the copies examined, is made up of the initials A H in connected letters a little over a half inch high, and the entire watermark is about an inch and a quarter wide. The axis of these letters is at right angles to the axis of the print. A second watermark encount- ered much less frequently is made up of two separate square initials E H in letters about seven eighths of an inch high, and the whole watermark is nearly two inches wide. These letters also have their axis at right angles to that of the lines of type. The third watermark encountered is rela- tively undecipherable, being so small that it is usually ruined in the binding, but it may be an even smaller pair of undecipherable initials. No copies examined had end papers containing any of these watermarks. The paper is uniformly of a poor quality, probably made in England, perhaps across the Channel.

There are few variants between copies of this edition, so far as the text is concerned,, the most notable being the change in location of the publisher's shop recorded in the two different states of the title page. Only the publisher's signature at the bottom of the page seems to have been reset. It has always been assumed that Dring was first at the Blew Anchor and then at the White Lion, so far as the issuing of these two title pages goes, largely because in the Term Catalogue entry, he was located at the Blew Anchor. But the book, as was frequently the case, may have been published before the record of its entry was made, and after Dring had left the White Lion. An examination of a number of Dring's publications during the years between 1671 and 1675 reveals that he had been at the White Lion in 1672, e.g., Buckingham's Rehearsal, published by Dring 'at the White-Lyon, next Chancery-lane end in Fleet-street.' He seems to have been at the White Lion before he was using the Blew Anchor, then by 1675, e.g., Wycherley's Country Wife of that year, he was 'at the Harrow, at the Corner of Chancery-lane in Fleet-street.' Of course all these locations were near each other, and he may have begun using any one of them before he had given up either of the others. Indeed, he might have used two of them simultaneously.

The edition of 1673 seems to nave been a large one and, on the whole, many copies of it have survived, a copy of it being, perhaps, the easiest, and certainly the cheapest to secure today of all editions of any of Milton's poetry printed within his lifetime.

The copy reproduced herein is a composite, made up of Illinois 1673 unbound and 1673 Spencer Blew Anchor.

LIST OF COPIES COLLATED FOR THIS EDITION

Originals. IU: 1673; 1673 copy 2; 1673 copy 3; 16732; i6732copy2; i6732copy3; 16732 copy 4; 16732 copy 5; 1 673s copy 6; Baxter; Gannon; Spencer, unbound, White Lion ; Joseph Knight, White Lion ; Spencer, Blew Anchor ; Spencer, White Lion ; Spencer, John Ware.

Photostats and Films. British Museum: 684^.34; 1070.L19; G.18867. California, University of, at Los Angeles: Clark. Cambridge, University Library: Syn.8.67. 10; Trinity College Library: H.4.66; Cap.W.3. Chicago University Library. Folger: 174. Harvard: Nor.3107; 14485.12; 14485. 12.2.A; 14485. 12.2. B. Huntington Library : 106455. Johns Hopkins: 353. Michigan, Uni- versity Library: P.R.3552.A2. 1673. Morgan Library: 18489. New York Public Library: 1673; 16732. Newberry Library: Y. 185. M. 6367. Paris, Bibliotheque Nationale: Yc.9647.9648. Per- shing, James Hammond, Denver. Princeton: Ex. 3859.3698. i.B. Texas University Library: Wrenn. Wellesley. Yale.

THE TWO TITLE PAGES— 1673

11

POEM S,&c.

UPON

Several Occafions,

B Y

Mr. 7 0 H N M I LT 0 N:

BothENGLISH and L AT.lN.&c.

Compoled at feveral times.

With a fmall Tra&ate of

EDUCATION

To Mr. HARTLIB.

LONDON.

Printed for Tho. Dring at the White Lion

next Chancery Lane End, in

Fket-Jlrcct, 1679,

POEM S,&c.

UPON

Several Occafions.

B Y

Mr. f 0 H N MILTON:

BothE N G L I S H and L A T lN,&c. Compofed at feveral times.

With a fmall Tractate of

EDUCATION

To Mr. HARTLIB.

LONDON,

Printed for Tho.Dring at the Blew Anchor

next Mitre Court over againft Fetter

Lane in Fleet-Jireet. 16 y 3.

Note the two different colophons. LONDON,/ Printed for Tho. Dring at the White Lion/ next Chancery Lane End, in/ Fleet-jtreet. 1673./

LONDON,/ Printed for Tho. Dring at the $lew Anchor/ next Mitre Court over againft Fetter/ Lane in Fleet-Street. 1673./

12

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

His

«■» 4k <M» <«• t»» 1MB «|n 4k

awa co» sgjF *fl* «k» «ra» «w» <«& «fc>

THE TABLE

Of the £»g/^ Poems,

ON *fo Morning ofchrijls Nativity. Pag. I Ti&e Hymn. 2

A Paraphrafe on Pfalm 1 14. 13

1 on Pfalm 136. 14

0« the Death of a fair Infant dying of a Cough. 1 7

The Pajfion* 21

'On Time. 24

£^0# f/>e Circumcifion. 25

>4* d Solemn Mufick. 26

An Epitaph on the Marchionefs of Winche- fter. 27

Song on May morning. 31

On Shakefpear. 31

Off the Univerfity Carrier, who fickiid in the time of his Vacancy , being forbid to go to Lon- don, by reafon of the Plague. 3 2 Another on the fame. ' 3 $

A 2 L'Atte-

35 4i

49 57 58

62 64

THE TABLE,

L' Allegro.

II Penferofb.

Sonnets.

To Mr. Henry Lawes, on his Aires.

On the late Majfacre in Piemont.

The fifth Ode of Horace, Lib. i.Englifi'd.

At a Vacation Exercife in the Colledge.

On the new forcers of Confcience under the Long

Parliament. 69

Arcades. Part of an Entertainment prefented

to the Countefs Dowager of Darby. 70

I- Song. 70

2. Song. 74

3. Song. 74 L Y C I D A S. In this Monody the

Author betoailes a Learned Friend^ unfortunately drown d in his pajjage from Chefter, on the

Irifh^/, 1637. A M ASK.

Song. Song. Song. Song.

Pfalm I. done into Verfe, 1653 Pfalm 2. Pfalm 3. Pfalm 4. Pfalm 5,

75

84

94 122

126

127

130

131

132

133

135

'.6,

There is no Table of Contents in 1645.

Note that four of the Songs of A Mask are separately entered.

THE TABLE — 1673

13

JSEXJwifriTwaiX* fafaftfoT.fofofifoft<r&ww&

THE TABLE.

Tfalm 6. Tfalm 7. Tfalm 8. Tfalm 80. Tfalm 81. Tfalm 82. P/4/0S 83. P/2f//» 84, P/4/^ 85. Tfalm 86. Tfalm 87. Tfalm 88.

*37

138

141

146 149

151 *54

1 58 161

162

THE

THE TABLE.

Of the Lathe Poems.

ELegia prima ad Carolum Diodatum,

Ekgia fecunda in Obitum Tr&conis Academici Cantabigienfis. 15

Ekgia tertia in Obitum Trtfulis Wintonien- fis. 16

Ekgia quart a^ ad Thomam ^unium^ &c. 19

Ekgia quint a, in adventum veris. 2 5

Elegia fata, ad Carolum Diodatum, ruri Com- morantem.

Ekgia feptima

In proditionem Bombardicam.

In Inventorem Bombards.

Ad Leonoram Rom<e Canentem.

Apoldpts de Rufiico & Hero.

Sylvantm Liber.

?* J%nirttum Novembris.

In Obitum Trafulis Wintonienfis,

Naturam non pati finium.

3*

35 40,41

42

42,43

44

45

47

57 60

De

2 Poems.] Ink mark above the period appears in all copies examined.

14

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

THE TABLE.

pe idea Platcnica , guemajdmodum Arifioteks intelkxit. 6$

Ad Tatrem. 64

ffalm C XIV 70

fhilofofhus ad Regent quendam qui eum ignotum & infontem inter reos forte captnm infcrus dantnaverat , •»> Bj Wt? ws*viifr®» hac jubitt ntiftU 71

In Effigiei Ejus Sculptorem. ibid.

An Saljillum Voetam Romanum agrotantem, ib. Manfus 74

Epitaphihw Damonis. 80

Ad Joannem Roufiujn Oxonienjis Academi* Bibliothecarinm. 90

Of Education to Mr, Samuel Hartlib. 94

«tftfr3 && tW» fMtBlSSt9 1&I3 fHt/9 1

ERRATA.

PAge 21. at the end of the Elegie mould have come in the Verfes at a Vacation Exercife , which follow afterwards, from pag.64. to p. 68, p.56. line S. after it r. ft, ib. I. p. for ColiJ^o r. Colk$tto, p. 5?. 1. 4. for/J> r. /?»>, p. dp. 1. 17. forfowj^ r. &**£, p. po. 1. p. for Mecca? r. fieeat\ p. pi. 1. 1 p. leave out the Comma after Miy, and for here r. ta*r, p. 128. 1, 3. leave out that. In the fe- cond part p. 43 . 1. 1 ♦ for Canentam r. Canmem, ibid. J. 4. for defipuljjfet rf defipuijfet, p. 4p. 1. 2. for Adamantius r. Adamantinns , ibid. 1. p. for Note* r. Natat, p. 52. ]. 2. fox Relliquas r. Relliqnias , p. 53. 1. 17, 18. a Comma after M**ex , none after ExMst- Some other Errors and mifpointings the Readers judgement may corred.

ERRATA.

7 Hecat\] The /f is dropped down in all copies examined. 11 First r+ The first diamond or star shaped period in 1673, but not the last. See 1673 page 155, line 44.

ON THE MORNING OF CHRIST'S NATIVITY— 1673

15

(0

ON THE

MORNING

O F

Chrifts Nativity.

r.

THis is the Month, and this the happy morn Wherein the Son of Heav'ns eternal King, Of wedded Maid, and Virgin Mother bom, Our great Redemption from above did bring > For fo the holy Sages once did fing, 5

That he our deadly forfeit mould rcleaie, And with his Father work us a perpetual peace.

II. That glorious Form, that Light unfufferable, And that far-beaming blaze of Majefty, Wherewith he wont at Heav'ns high Councd- Tabic, io To fit the midft of Trinal Unity, He laid afide > and here with us to be, Forfook the Courts of everlafting Day,

And chofe with us a darkfom Houfe of mortal Clay.

A III.S»y

O)

IIL

Say Heav'nly Mufc, (hall not thy facred vein 15

Afford a Prefent to the Infant God >

Haft thou no verfe, no hymn, or folemn ftrein,

To welcome him to this his new abode,

Now while the Heav'n by (fie Suns team untrod,

Haih took, no print of the approaching light, 20

And and all the fpangled hoft keep watch in fquadrons

1 V. (bright >

See how from far upon the Eaftern rode

The Star-led Wifards hafte with odours fweet,

O run, prevent them with thy humble ode,

And lay it lowly at his bleflcd feet > 25

Have thou the honour firft, thy Lord to greet,

And joyn thy voice unto the Angel Quire, From out hisfecret Altar toucht with hallow'd fire.

The Hymn.

I.

IT was the Winter wilde, While the Heav'n-born-childe, All meanly wrapt in the rude manger lies > Nature in awe to him Had doff't her gawdy trim, With her great Matter fo to fympathize :

30

i?

This poem was first printed in 1645. There is no other text of any consequence except that of 1673. Title line 4 Chrift's] Christs The 1645 title occupies two lines only, and continues after 'Nativity.' 'Compof'd 1629.' which 1673 omits. Nativity.] N dropped down in all copies examined. 2 Wherein] Wherin 4 Redemption] redemption 5 Sages] fages 10 Wherewith] Wherwith

16 Prefent] prefent 17 verfe,] vers, 18 welcome] welcom 21 And and So all 1673 copies examined.] And 23 fweet,] fweet: The Hymn.] The Hymn. 32 awe] aw The type of the catchword at the bottom of the page is badly battered in all copies examined, and more so in some than in others.

16

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

O)

ft was no feafon then for her 35

To wanton with the Sun her lufty Paramour-

II. Only with fpeeches fair She woo's the gentle Air

To hide her guilty front with innocent Snow, And on her naked fhame, 40

Pollute with finfull blame,

The Saintly Veil of Maiden white to throw, Confounded, that her Makers eyes Should look fo near upon her foul deformities.

III. But he her fears to ceafe, 45

Sent down the meek-ey'd Peace,

She crown'd with Olive green, cape foftly Aiding Down through the turning fphear His ready Harbinger,

With Turtle wing the amorous clouds dividing, 50 And waving wide her mirtle wand, She (hikes a univerfal Peace through Sea and Land.

IV. No War, or Battels found Was heard the World around

A a %hs*

(4)

The idle Spear and Shield were high up hung, 55 The hooked Chariot Hood Unftain'd with hoftile blood,

The Trumpet fpake not to the armed throng, And Kings fate Hill with awfull eye, As if they furely knew their fovran Lord was by. 60

V. But peacefull was the night Wherein the Prince of light

His raign of peace upon the earth began : The"Winds wit/i wonder whift, Smoothly the waters kift, 65

Whifpering new joyes to themilde Ocean, Who now hath quite forgot to rave, While Birds of Calm fit brooding on the charmed wave.

VI. The Stars with deep amaze Stand fixt in fiedfaft gaze, 70

Bending one way their pretious influence, And will not take their flight, For all the morning light,

Or Lucifer that often warn'd them thence >

But in their glimmering Orbs did glow, 75

Untill th&irLord himfejf befpake, and bid them go.

VI h

37 Only] Onely 39 Snow,] Snow, Columbia note is wrong. 42 Veil] Vail 44 near] neer 46 meek-ey'd] meek-eyd 47 fliding] The lower part of the g is broken in all 1673 copies examined. 52 univerfal] univerfall 53 Battels] Battails

54 around] around:

55 Spear] fpear Shield] fhield hung,] hung; 62 Wherein] Wherin 64 Winds] Windes

ON THE MORNING OF CHRIST'S NATIVITY— 1673

17

(5)

vir.

And though the (hady gloom Had given day her room,

The Sun himfelf with-held his wonted (peed, And hid his head for ihame, 8o

As his infcriour flame,

The new enlightn'd world no more mould need * He faw a greater Sun appear Then his^bright Throne,or burning Axletree could bear.

VIII.

The Shepherds on the Lawn, 85

Or ere the point of dawn,

Sate fimply chatting in a ruftick row i Full little thought they than, That the mighty Tan

Was kindly come to Hve with them below > 90

Perhaps their loves, or elfe their (heep, Was all that did their filly thoughts fo buiie keep.

IX.

When fuch mufick fweet

Their hearts and ears did greet,

As never was by mortal ringer ftrook, 95

Divinely-warbPd voice

Anfwering the ftringed noife,

As all their fouls in blifsfull rapture took :

A 1 ifzz

CO

The Air fuch pleaiute ioth to lofc, 99

With thoufand echo's ftill prolongs each hcav*nly dofe.

X. Nature that heard fuch found Beneath the hollow round

Of Cynthia s feat, the Airy region thrilling, Now was almoft won To think her part was done, 105

And that her reign had here its laft fulfilling \ She knew fuch harmony alone Could hold all Heav'n and Earth in happier union.

XI. At laft furrounds their fight A Globe of circular light, no

That with long beams the (hame-fac't night arrayd, The helmed Cherubim And fworded Seraphim,

Are leen in glittering ranks with wings difplaid,

Harping in loud and folemn quire, 115

With unexprefiive notes to Heav'ns new-born Heir.

XIL

Such Mufick ( as 'tis faid )

Before was never made,

But

82 new enlightn'd] new-enlightn'd need;] need; The Columbia note is wrong; but the Columbia text is correct, and many an editor has stumbled over this punctuation. 90 come] com

91 elfe] els 95 mortal] mortall 96 Divinely-warbl'd] Divinely-warbled 98 blifsfull] blisfull Columbia text is cor- rect, but notes omit. Catchword The] The he failed to print but not to make an impression in some copies.

103 thrilling,] cf. note to this line, 1645, p. 159. 105 done] don 106 reign] raign

18

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(7)

But when of old the fons of morning lung,'

While the Creator great HisConftellationsfet,

And the well-ballanc't world on hinges hung, And caft the dark foundations deep, And bid the weltring waves their oozy channel keep,

XIII. Ring out ye Cryftall fphears, Once blefs our humane ears,

( If ye have power to touch our fenfes fo ) And let your filver chime Move in melodious time •»

And let the Bafe of Heav'ns deep Organ blow, And with your ninefold harmony Make up full confort to th'Angelike fymphony*

XIV for if fuch holy Song Enwrap our fancy long,

Time will run back, and fetch the age of gold, And fpeckl'd vanity Will ficken foon and die,

And leprous fin will melt from earthly mould,

And Hell it felf will pafs away,

And leave her dolorous manfions to the peering day

A4

120

1.25

130

135

I40

XV.

Yea Truth, and Juftice then

Will down return to men,

Orb'd in a Rain-bow i and like glories wearing Mercy will fit between, Thion'd in Celeftial (heen, 145

"With radiant feet the tiffued clouds down Hearing, And Heav'n as at fome Feftivall, Will open wide the Gates of her high Palace HalU

XVI.

ButwifeftFatefayesno,

This rouft not yet be fo, 150

The Babe lies yet in (railing Infancy, That on the bitter croft Mull redeem our loft;

So both himfelf and us to glorirlc : 1 54

Yet firft to thofe ychain'd in fleep, (<k«P« The wakeful trump of doom muft thunder through the

X<II.

With fhch a horrid clang

As on mount Sinai rang

While the red fire, and fmouldring clouds out brake :

The aged Earth agaft 160

With .'errpur of that blaft,

Shall from the furface to the center (hake i

When

120 great] Great 121 Constellations] constellations 126 humane] human 132 fymphony^] Note the star shaped period like a small cross. See 1673 Errata, page 11, and page 155, line 44. after 132 XIV] XIV. No period in any 1673 copy examined. No note in Columbia.

The lines of print are noticeably wavy in most copies examined. 143-144 1645 reads: 'Th' enameld Arras of the Rainbow wearing,/ And Mercy fet between,'/ 145 Celeftial] Celeftiall 147 fome] fom Feftivall,] feftivall, 156 wakeful] wakefull

deep.] deep, In 1673 deep, is put above the line because the line is too long, and in 1645 'deep,' below the line for the same reason.

ON THE MORNING OF CHRIST'S NATIVITY — 1673

19

(9) When at the worlds, laft feffion, The dreadful Judge in middle Air (hall fp* cad his throne.

XVIII. And then at laft our blifs 165

Full and perfet is,

But now begins j for from this happy >,/ Th'old Dragon under ground In ftraiter limits bound,

Not half fo far calls his ufurped fway, 1 70

And wroth to fee his Kingdom fail, Swindges the fcaly Horrour of his foulded tail.

XIX. The Oracles aredum, No voice or hideous humm

Runs through the arched roof in words deceiving.' 175 ApUo from his (hrme Can no more divine,

With hollow fhreik the fteep otVelphos leaving.

No nightly trance, or breathed fpell,

Infpires the pale-ey'd Prieft from the prophetic cell; 180

XX.

The lonely mountains o're,

And the refounding (hore,

A voice

(10)

A voice of weeping heard, and loud lament ? from haunted fpring, and dale Edg'd with poplar pale, 185

The parting Genius is with fighing fent, With flowre-inwov'n trefles torn The Nimphs in twilight (hade of tangled thickets mourn.

XXI. In confecrated Earth, And on the holy Hearth, igo

The Lars, and Lmures room With midnight plaint, In Urns, and Altars round, A drear and dying found

Affrights the Flaminszt their fervice quaint i And the chill Marble feems to fweat, 195

While each peculiar power forgoes his wonted feat*

XXII. Peor> and Baalim, JFbrfake their Temples dim,

With that twice batter'd god of TaUftintt And mooned AJhtaroth, 200

Heav'ns Queen and Mother both,

Now (its not girt with Tapers holy (hine,

The Libyc Hammon (hrinks his horn,

In vain the 7yrian Maids their wounded fkamuz, mourn.

XXIII.

164 dreadful] dreadfull 166 perfet] perfect 167 The last word in the line is day It actually printed in only about half of the copies examined. The word is clearly printed in these copies, and the type made some kind of an impression, though frequently inkless, in all copies. 171 wroth] wrath 173 dura, ] dumm, 180 Infpires] Infpire's

185 pale,] pale. 193 drear] drear, 199 twice] twife

20

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

00 xxin.

And fallen Moloch fled, 205

Hath left in (hadows dred,

His burning Idol all of blackeft hue > !n vain with Cymbals ring, They call the grifly King,

In difmal dance aboutthe furnace blue » 210

The brutifo gods of Nile as faft, Jfis and 6rut} and the Dog Anttbis haft.

XXIV. Nor is Ofiris feen In Mmpbian Grove, or Green,

Trampling the unfliowi'd Grafs with lowings loud: Nor can he be at reft 216

Within his facred cheft,

Naught but profonndeft Hell can be his fhroud, In vain withTimbrel'd Anthems dark The fable- ftoled Sorcerers bear his worftiipt AiL 220

XXV.

He feels from Judas Land

The dredded Infants hand,

The rayes of Bethlehem blind his dusky eyn h Nor all the Gods befide, Longer dare abide, 225

Not tyfbm huge ending in fnaky twine :

Our 8a{>e to (hew his Godhead true,

Can in his fwadling bands controul the damned crew.

XXVI. So when the Sun in bed,

Curtain'd with cloudy red, 230

P Pillows his chin upon an Orient wave.,, The flocking (hadows pale, Troop to th'infernal Jail,

tiach fetter'd Ghoft Hips to his feveral grave, And the yellow-skirted Fayes, 235

Fly after the Night-fteeds,leaving their Moon-lovM maze.

XXVII. But fee the Virgin bleft, Hath laid her Babe to reft.

Time is our tedious Song fhould here have ending *. Heav'ns youngeft teemed Statj 240

Hath fixt her polifht Car,

Her fleeping Lord with Handmaid Lamp attending : And all about the Courtly Stable, Bright- harneft Angels fit in order ferviceable.

A Para-

207 hue;] hue, 209 King,] king, 210 difmal] difmall blue;] blue, 215 Grafs] Graffe loud:] loud: So all copies examined of both editions. Columbia text and note are both wrong. 221 Judo's] Juda's 224 Gods] gods

231 All 1673 copies examined show heavy spacer mark at the beginning of the line, wave,] wave. 233 th'infernal] th'infernall Jail,] jail, 234 feveral] feverall 239 ending:] ending, 241 Car,] Car. Columbia note reads 'car.' for 1645. 242 attending:] attending.

PSALMS 114 AND 136 — 1673

21

(i3) A Paraphrafe onPfalm 114,

This and the following vfalm were done by the Author at fifteen years old.

WrHen the bleft feed of Tcrab's faithful Son, After loog toil their liberty had won, And pali from Pharian Fields to Canaan Land, Led by the ftrength of the Almighties hand, Jehovah's wonders were in Jfrael (hown, His praife and glory was in Jfrael known. Thatfaw the troubled Sea, and (hivering fled, And fought to hide his froth- becurled head Low in the earth, J or dam clear ftreams recoil, As a faint Hoft that hath receiv'd the foil. The high, huge-bellied Mountains skip like Rams Araongft their Ews, the little Hills like Lambs. Why fled the Ocean > And why skiptthe Mountains ? Why turned Jordan toward hisChryftal Fountains? Shake earth, and at the prefence be agaft 15

Of him that ever was, and ay (hall laft, That glafly flouds from rugged rocks can crufh, And make foft rills from fiery flint- ftones gu(h.

Pf4m

10

(H)

ffalm i%6,

LEt us with a gladfom mind Praife the Lord, for he is kind For his mercies ay endure, Ever faithfull, ever fure.

Let us blaze his Name abroadv For of gods he is the God i For his, &c,

O let us his praifes tell, Who doth the wrathfull tyrants quell For his, &c.

Who with his miracles doth make Amazed Heav'n and Earth to (hake. For his, &c.

Who by his wifdom did create The painted Heav'ns fo full of Mate. For his, &c.

Who did the folid Earth ordain To rife above the watry plain. For his, &c.

Who by his all-commanding might, Did fill the new-made world with light. For his,e^Ci

10

!5

20

AuU

First printed in 1645, and again in 1673. Headnote 2 done] don 3 years] yeers 1 Terah's] The h is characteristic of the italic font being used, and throughout the book many times looks like b; but in no case, cf. p. 15 line 36 Erythraean is the letter other than ft. faithful] faithfull 3 Fields ] fields 7 troubled] troubl'd 8 froth-becurled] froth-becurled Columbia text and note are wrong. Cf. line 18 this poem for another worn hyphen very much like this. Every 1673 copy examined shows at least a trace of a hyphen. 10 Hoft] hoft 14 Chryftal] Cryftall

Psalm 136 wasfirst printed in 1645, and again in 1673. 2 kind] kind, 7, 10, 13 For his, &c] For, &c. 9, 11, 14, 17, 20 Who] That 22 For] The F is badly worn and poorly spaced in all copies examined.

22

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

0$)

And caus'd the Golderi-tieffed Sun, AU the day long his courfc to run. For his, &c*

The horned Moon to fhine by night, Amongft her fpangled fiflers bright. For his, &c*

He with his thunder- dafping hand, Smote the fir ft- bom of Egypt Land. For his, &c.

And in defpight of Pbarso fell, He brought from thence his Jfrael.

For, &c.

The ruddy waves he ckft in twain, Of the Erytbrtan main. For, &c.

The flouds flood ftill like Walls of Glafs, While the Hebrew Bands did pafs. For, &c.

But full foon they did devour

The Tawny King with all his power. "

25

30

35

40

His chofen people he did blefs In the waftfull Wildernefs. For, &c.

In bloudy battel he brought down Kings of prowefs and renown. For, &c*

He foild bold Seon and his hoft* That rul'd the Amorrean coali For, &c.

And large-limb'd Og he did fubdue, With all his over- hardy crew. For,<£-c.

And to his Servant Ifraeli He gave their Land therein to dwell* For, &c.

He hath with a piteous eye BeLrld us in in our mifery<» For, &c.

And freed us from the flavesy Of the invading enemy. For, &c%

45

50

55

6o

His

AH

24 courfe] cours 30 Smote] mote So all 1645 copies examined. 33 hislfrael.] No space in any copy examined. 38 flouds] floods 42 Slight spacer mark at end of and above line, in all copies examined. 43 Spacer mark like the letter 'L' before this line in all copies examined, except IU 16732 copy 4; Huntington 106455; and Pershing Denver copies which have no sign of a mark here.

The page numbering] The 6 is smeared in all copies examined. 45 Wildernefs.] Wildernes. 47 bloudy] bloody battel] battail 50 hoft. ] hoft, Columbia prints comma in text, and carries no note. 53 large-limb'd ] large-lim'd 54 over-hardy] over-hardy Columbia note states that 1645 reads 'over hardy' or without hyphen, and so some 1645 copies appear; but others clearly show the mark of the hyphen, and all copies examined under magni- fication show at least type mark, if no ink. Cf. 1645 note. 56 Servant] fervant 57 therein] therin 60 in in] in 63 enemy.] enimy.

DEATH OF A FAIR INFANT— 1673

23

C'7) All living creatures he doth feed, 65

And with full handfupplies their need?. For, &c.

Let us therefore warble forth His mighty Majefty and worth*

For, &c. 70

That his manfion hath on high Above the reach of mortal eye.

For his mercies ay endure,

Ever faithfull, ever fure*

Anno aetatis tj. OH the Death of a fair Infant dying of a, Cough,

I.

OFaireft flower no (boner blown but blafted, Soft filken Primrofe fading timelefslie, Summers chief honour if thouhadft out-lafted, Bleak winters force that made thy Moflbme drte > For he being amorous on that lovely die 5

That did thy cheek cnvermeil, thought to kifs But killed alas, and then bewayl'd his fatal Miff.

If. For finae grim Aquilo his charioter

By botftrous rape th* Athenian damfel got, He thought it toucht hi* Dcitie full necr, 10

B U

If likewife he fome fair one wedded not, Thereby to wipe away th* infamous blot,

Of long-uncoupled bed, and childlefs eld, Whicn'mongft the wanton gods a foul reproach was held*

III. So mounting up in ycie-pearled carr, 15

Through middle empire of the freezing aire He wanderd long, till thee hefpy'd from farr, There ended was his queft, there ceaft his care. Down he defcended from his Snow-foft chaire,

But all unwares with his cold-kind embrace 20

Unhous'd thy Virgin Soul from her fair biding place.

IV. Yet art thou not inglorious in thy fate i For fo Apollo, with unweeting hand Whilome did flay his dearly-loved mate Young Hyacinth born on Eurotas ftrand 25

Youn^ Hyacinth the pride of Spartan land »

But then transform'd him to a purple flower

Alack that fo to change thee winter had no power,

V.

Yet can I not perfwade me thou art dead

Or that thy coarfe corrupts in earths dark wembe. 30

Or that thy beauties lie in wormie bed,

Hid

68 therefore] therf ore 69 worth.] worth. Note that the period here has a slight mark above it; but it is not a colon, as Columbia note states. That is, it is unlike any other colon in this edition, but is probably exactly the same piece of type as at the end of line 8, May Morning, p. 30, or p. 30:61 Epitaph. It is a treacherous piece of type, which under magnification seems to be either a period with a piece of dirt or metal above it that took ink and made a slight impression ; or it is a colon with most of the top dot knocked off. It seems usually to have been used as a period. Not all cases are as clear as this, when this piece of type appears. 72 mortal] mortall eye.] ey. Fair Infant was first printed in 1673. Catchword If is smeared in all copies examined.

25 Eurota's] Sic until Newton, 1753. Catchword Hid] The H is smeared in most, but not all copies examined.

24

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

09)

Hid from the world in a low delved tombe » Could Heav'n for pittie thee fo ftricT-ly doom ? Oh no ? for fomething in thy face did (hine Above mortalitie that fhew'd thou waft divine. 35

vi.

Refolve me then oh Soul mod furely bleft

( If fo it be that thou thefe plaints doft hear )

Tell me bright Spirit where e're thou hovereft

Whether above that high firft-moving Spheare

Or in the Elifian fields ( if fuch there wer^. ) 4o

Oh fay me true if thou wert mortal wighe And why from us fo quickly thou didft take thy flight.

VII. Wert thou fome Starr which from the ruin'd roofe Of fliak't Olympus by mifchance didft fall •, Which carefull Jeve in natures true behoofe 45

Took up, and in fit place did reinftall ? Or did of late earths Sonnes befiege the wall

Of fheenie Heav'n, and thou fome goddefs fled

Araongft us here below to hide thy nedfor'd head.

VIII.

Or wert thou that juft Maid who once before 50

Forfook the hated earth, O tell me footh

And cam'ft again to vifit us once more ?

C a Oi

Or wert thou that fwect fmiling Youth* Or'that cown'd Matron fage whitc-iobcd tt uth >

Or any other of that heav'nly brood 55

Let down in clowdic throne to do the world fome good.

IX. Or wert thou of the golden-winged hoaft, Who having clad thy fclf m humane weed, To earth from thy prefixed feat didft poaft, And after fhort abode flic back with fpced, 60

As if to fhew what creatures Heav'n doth breed,

Thereby to fet the hearts of men on fire Tofcorn the fordid world, and unto Heav'n afpire,

X. But oh why didft thou not ftay here below To blefs us with thy heav'n- lov'd innocence, 65

To flake his wrath whom fin hath made our foe To turn Swift-iufhing black perdition hence, Or drive away the flaughtering peftilence,

To Hand 'twixt us and our deferved fmart But thou canft beft perform that office where thou art. 70

xr.

Then thou the mother of fo fweet a child

Her falfe imagind Iofs ceafe to lament,

And wifely learn to curb thy fonows wild ?

Think

34 Oh no?] Probably should be, and invariably today printed, Oh no! There are two different states of the signature of this leaf, there being about as many copies erroneously reading C2 as there are correctly reading B2.

53 Youth!] Columbia, probably correctly, emends to Youth?

54 Or that] Spacer mark between these two words in all copies examined, cown'd] Probably should be crown'd

THE PASSION — 1673

25

(21)

Think what a prefent thou to God haft fcnt,

And render him with patience what he lent > 75

This if thou do he will an off-fpring give , That till the worlds laft-end (hall make thy name to live.

The PaJJioa,

I.

E Re- while of Mufick, and Ethereal mirth, Wherewith the ftageof Ayr and Earth did ring, And joyous news of heav'nly Infants birth, My mufe with Angels did divide to fing i But headlong joy is ever on the wing, 5

In Wintry folftice like the fhortn'd light Soon fwallow'd up in dark and long out- living night,

ir.

For now to forrow muft I tune my fong,

And fet my Harp to notes of faddeft wo,

Which on our deareft Lord did feafe ere long, 10

Dangers, and fnares, and wrongs, and worfe then fo,

Which he for us did freely undergo.

Moft perfect Htroe, try'd in heavieft plight Of labours huge and hard, too hard for human vvighf.

B 3 HI. He

(22) III.

He fov'ran Prieft (looping his regal head 15

That dropt with odorous oil down his fair eyes,

Poor flefhly Tabernacle entered,

His ftarry front low-rooft beneath the skies •>

O what a mask was there, what a difguile !

Yet more j the ftroke of death he muft abide, 20

Then lies him meekly down faft by hisBrethrens fide.

IV. Thefe lateft fcenes confine my roving vers, To this Horizon is my Phcebw bound, His Godlike ads i and his temptations fierce, And former fufferings other where are found i 25

Loud o're the reft Cremona s Trump doth found »

Me fofter airs befit, and fofter firings Of Lute, or Viol (till, more apt for mournful things*

V. Befriend me night beft Patronefs of grief, Over the Pole thy thickeft mantle throw, 30

And work my flatter'd fancy to belief, Thai Heav'n and Earth are colour'd with my wo i My forrows are too dark for day to know :

The leaves fhould all be black wheron I write, 34

And letters where my tears have walht a wannifti white.

VII. See

The Paffion.] The Paffion. Harpe

2 Wherewith] Wherwith 9 Harp]

15 regal] regall 19 mask] Mask 22 lateft] latter 24 acts;] acts ? There has been much disagreement here among textual editors over what mark, comma or semi-colon, actually occurs in 1645. See note to 1645 text. Many 1645 copies look here as if a comma was printed, but others have marks suggesting semi-colon. It is of some significance that careful editors like Beeching and those who prepared the Oxford facsimile print a comma. But magnification of the most doubtful cases seen shows beyond a doubt that whatever the print mark looks like, a worn semi-colon was used for type.

26

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

VI.

Sec fee the Chariot, and thofe mining wheels,

That whirl'd the Prophet up at Cbtbar flood,

My (pint fom tranfporting Cb$rub feels,

To bear me where the Towers of Salem flood,

Once glorious Towers, now funk in guiltlefs blood i 40

There doth my foul in holy vifion fit

In penfive trance, and anguifli, and ecftatick fir,

VII. Mine eye hath found that fad Sepulchral rock

That was the Casket of Heav'ns richeft ftorc,

And here though grief my feeble hands up lock, 45

Yet on the foftned Quarry would I (core

My plaining vers as lively as before >

For fure fo well intruded are my tears,

That they would fitly fall in order'd Characters.

VIII.

Or mould I thence hurried on viewles wing* 50

Take up a weeping on the Mountains wilde, The gentle neighbourhood of grove and fpring Would foon unbofom all their Echoes milde, And I ( for grief is eafily beguild )

Might think th' infection of my forrows loud, 55 Had got a race of mourners on fom pregnant cloud.

Tbii Sub'ytU the Author finding to be above the jttrs be bad, vrben be *?*„'** » **t*otbingfoisf?d with what was faun, left it un-

10

finifyt.

B4

On

On Time,

FLy envious Tim, till thou run out thy race, Call on the lazy leaden- ftepping hours, Whofe fpeed is but the heavy Plummets pace i And glut thy felf with what thy womb devours, Which is no more then what is falfe and vain, And meerly mortal drofs » So little isourlofs, So little is thy gain.

For when as each thing bad thou haft entomb'd, And laft of all thy greedy felf confum'd, Then long Eternity (hall greet our blifs With an individual kifsi And Joy (hall overtake us as a flood, When every thing that is fincerely good And peife&ly divine,

With Truth, and Peace, and Love (hall ever thine About the lupreme Throne Of him, t' whofe happy-making fight alone, When once our heav'nly-guided foul (hall dime, Then all this Earthy grofnefs quit, Attu'd with Stars, we (hall for ever fit,

Triumphing over Death,and Chance,and thee O Time.

'Upon

.'ttfMSB

15

20

40 guiltlefs] guiltles 42 fit,] fit. 45 up lock, So all in copies examined.] up-lock, 53 unbofom] unboofom their] thir The signature is set in smaller type than the other signatures in all copies examined.

This poem also occurs in Tr. Coll. MS. See p. 395. It was printed in 1645 and again in 1673, and the variants are from the 1645 edition. " Title. On Time.] On Time. 10 all] all, 20 grofnefs] grofnes Notice imprints of spacers in right hand margin, occurring in all copies examined.

UPON THE CIRCUMCISION— 1673

27

Y

(35)

Vpon the Circumcifion, E flaming Powers, and winged Warriours bright,

That erft with Mufick, and triumphant fong Firft heard by happy watchful Shepherds ear, So fweetly fung your Joy the Clouds along Through the (oft filence of the liftVing night i Now mourn, and if fad (hare with us to bear Your fiery eflence can diftill no tear* Burn in your fighs, and borrow Seas wept from our deep forrow, He who with all Heav'ns heraldry whilear Enter'd the world, now bleeds to give us eafc s Alas, how foon our (in Sore doth begin

His Infancy to feafe ! 0 more exceeding love or law more juft ? Juftlaw indeed, but more exceeding love ! For we by rightful doom remediles Were loft in death, till he that dwelt above High thron'd in fecret blifs, for us frail duft Emptied his glory-, ev'n to nakedness And that great Covenant which we ftill tranfgrefs Intixcly fatisfVd,

10

15

20

And

(26) And the full wrath befide Of vengeful Juftice bore for our excefs, And feals obedience firft with wounding fmart 25

This day, but O ere long Huge pangs and ftrong

Will pierce more near his heart.

At a folemn Mufick:

BLeft pair of Sirens., pledges of Heav'ns joy, Sphear-born harmonious Sifters, Voice, and Vers, Wed your divine founds, and mixt power employ Dead things with inbreath'd fenfe able to pierce, And to our high-rais'd phantafie prefenf, 5

That undifturbed Song of pure concent, Ay fung before the faphire-colour'd throne To him that fits thereon With Saintly fhout, and folemn Jubiiy, Where the bright Seraphim in burning row 10

Their loud up-lifted Angel trumpets blow, And the Cherubick hoft in thoufand quires Touch their immortal Harps of golden wires, With thofe juft Spirits that wear victorious Palms, Hymns devout and holy Pfalms 15

Singing

This poem occurs also in Tr. Coll. MS. See p. 395. First printed in 1645, this poem was printed again in 1673, and the variants are from the 1645 edition. Upon the Circumcifion.] Upon the Circumcifion. 10 whilear] whileare 17 rightful] rightfull

28 near] neer At a folemn Mufick.] At a folemn Mufick. This poem occurs in the MS., was printed in 1645, and again in 1673. The variants here are from 1645. 6 concent,] content, For meaning, the 1673 word must be preferred. 8 thereon] theron

28

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

07)

Singing everlaftinglyi

That we on Earth with undifcording voice

May rightly anfwer that melodious noife >

As once we did, till difptoportion'd fin

Jarr'd againft natures chime* and with harm din

Broke the fair mufick that all creatures made

To their great Lord, whofe love their motion fway'd

In perfet Diapafon, whilft they ftood

In firft obedience, and their ftateof good*

O may we foon again renew that Song,

And keep in tune with Heav'n, till God ere long

To his celeftial confort us unite,

To live with him, and fing inendles morn of light.

20

25

An Epitaph on the Marchienefs.of Winchefttr*

THis rich Marble doth enterr The honour'd Wife of Winchefttr, A Vicounts daughter, an Eaks heir, Befides what her vertues fair Added to her noble birr h, More then (he could own from Earth, Summers three times eight fave one She had told, alafs too foon,

After

(28)

After fo tiiort time of breath,

To houfe with darkne&,and with death.

Yet had the number of her days

Bin as compleat as was her praifc,

Nature and fate had had no ftrife

In giving limit to her life.

Her high birth, and her graces fwecf ,

Qaickly found a lover meet }

The Virgin quire for her requefr

The God that fits at marriage fcaft i

He at their invoking came

But with a fcarce-wel-lighted flame*

And in his Girland as he ftood,

Ye might difcern a Cyprefs bud.

Once had the early Matrons run

To greet her of a lovely (on,

And now with fecond hope (he goes,

And calls Lndna to her throws >

But whether by mifchance or blame

Atropos for Ltttina came >

And with remorfles cruelty,

SpoiPd at once both fruit and tree :

The haples Babe before his birth

Had burial, yet not laid in earth,

:■/> i-

10

J ,.-20015

• "s f.rt-. i.i

20

't/.-qr^s

30

And

The page numbering] The 7 is broken at the top in all copies examined. 23 perfet] perfect Not in Columbia notes.

Marchioness Epitaph. This poem was printed in 1645 and again in 1673. The variants are from 1645. There is a ms. version of it, British Museum Sloane ms. 1446, of no known textual value or connection with Milton. 3 Ealrs] Earls 8 alafs] alas

10 darknefs,] darknes, 22 Cyprefs] Ciprefs 32 Had] Ha these two letters rise up in all copies examined. Note spacers marks in right hand margin of the page, so in all copies examined.

EPITAPH ON MARCHIONESS OF WINCHESTER— 1673

29

<?9) And the languid* Mothers Womb

Was not long a living Tomb.

So hsve I feen fome tender flip

Sav'd with care from Winteis nip,

The pride of her carnation train,

Pluck't up by fom unheedy fwatn,

Who onely thought to crop the flowr

New (hot up from vernal (howr >

But the fair bloflbm hangs the head

Side-ways as on a dying bed,

And thofe Pearls of dew (he wears,

Prove to be prefagjng tears

Which the (ad morn had let fall

On her baft'ning runersll.

Gentle Lady may thy grave

Peace and quiet ever have »

After this thy travel fore

Sweet reft fcafe thee evermore,

That to give the world encreafc,

Shortned haft thy own lives leafc i

Here,beGdcs the forrowing

That thy noble Houfc doth bring,

Here be tears of perfect moan

Weept for thee in Hr/ia*,

35

40

45

50

55

And

(30)

And fom Flowers, and fome Bays,

For thy Hears to ftrew the ways,

Sent thee from the banks o(Camey

Devoted to thy vertuous name i

Whilft thou bright Saint high fit'ft in glory*

Next her much like to thee in ftory,

That fair Syrian Shepherdefs,

Who after yeers of barrennefs,

The highly favour'd Jofepb bore

To him that ferv'd for her before,

And at her next birth much like thee,

Through pangs fled to felicity,

Far within the boofom bright

Of blazing Ma jetty and Light,

There with thee, new welcom Saint,

Like fortunes may her foul acquaint,

With thee there clad in radiant (heen,

No Marchionefs, but now a Queen,

6o

65

70

SONG.

35 fome] fom 40 vernal] vernall 49 travel] 52 leafe;] leafe, 53 Here,] Here

travail

57 fome Bays,] fom Bays, 61 glory.] glory, This is the same punctuation mark encountered on page 17, Psalm fj6, line 69. In many 1673 copies, its appearance is as an ordinary period; in other copies, there is a mark above the dot. In no case examined is there any doubt of it being a period. Yet textual editors generally, and Columbia and Beeching in particular have printed it in their texts as a comma. The meaning of the lines certainly calls for a comma, as in 1645; but just as certainly 1673 printed a period. Under magnification, in all copies examined, the principal mark is a round dot exactly like many periods in this edition; but the same or very similar mark may be seen in Psalm 136:69; and May Morning, line 8, p. 31, 1673. Columbia has no note on this point, and text has a comma. 64 barrennefs,] barrennes,

30

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

00

SONG.

On May Morning,

NOw the bright morning Star, Daycs harbinger, Comes dancing from the Eaft, and leads with her The Flowry May> who from her green lap throws The yellow Cowflip, and the pale Primrofe.

Hail bounteous May that doit infpire 5

Mirth and youth and warm defire,

Woods and Groves are of thy drefling,

Hill and Dale doth boaft thy bleffing.- Thus we falute thee with our early Song, And welcom thee, and wifti thee long.

10

On Shakefpear. 1630.

WHat needs my Shakefpear for his honour'd Bones, The labour of an age in piled Stones, Or that his hallow'd reliques (hould be hid Under a Star-ypointing Pyramid ? Dear lbn of memory, great heir of Fame, 5

What need' ft thou fuch weak witnefsof thy name ? Thou in our wonder and aftonifhment

Haft built thy felf a live-long Monument.

For

For whilft to th' fliame of flow-endeavouring art, Thy eafie numbers flow, and that each heart Hath from the leaves of thy unvalu'd Book, Thofe Delphick lines with/leep impreffion took, Then thou our fancy of it felf bereaving, Doft make us Marble with too much conceaving *, And fo Sepulcher'd in fuch pomp doft lie, That Kings for fuch a Temb would wifti to die.

10

15

On the Vniverfity Carrier, whoficknd in the time

of his vacancy, being forbid to go to London,

by reafon of the Plague.

HEre lies old Hobfon, Death hath broke his girt, And here alas, hath laid him in the dirt, Or elfe the ways being foul, twenty to one, He's here ftuck in a flough, and overthrown. 'Twas fuch a ftnfter, that if truth were known, Death was half glad when he had got him down > For he had any time this ten yeers full, Dodg'd with him, betwixt Cambridge and the Bull. \nd furely, Death could never have prevail'd* lid not his weekly courfe of carriage failM i

10 But

May Morning. Title. SONG.] SONG Columbia note is wrong and misleading. On May Morning.] On May morning. Again, Columbia note is wrong. 6 youth] youth, But it seems signi- ficant that all 1673 copies examined have space after the word youth for comma though none has even the slightest mark in that space. 7 Groves] Groves, Note difference in space here in 1673 edition and in same edition line 6. 8 Dale] Dale,

Again, note lack of space as compared with line 6. bleffing. ] bleffing. This is the same punctuation mark, or one very much like it, as appeared on p. 30, line 61. Columbia has no note on this point; but treats this mark as a period here.

On Shakefpear. This poem had been printed in 1632 and again in 1640 before Milton printed it in 1645. It was printed once more, in 1663-64, before this text of 1673. See p. 366 for collations. The variants here are from 1645 only. 6 witnefs] witnes

9 to th'fhame] toth'fhame No space in all 1645 copies examined, and no note in Columbia.

University Carrier. See pages 369-371 for other printings of these Hobson poems. Collation here is between 1645 and 1673 only. Title and headnote, 1645 has Roman type where 1673 has Italic, and Italic type where 1673 has Roman. 2 And] A

See note to this in 1645 p. 170. 3 elfe] els 5 'Twas] ,Twas No note in Columbia. The initial letter A of line 9 and the initial letter H of line 10 are cut off at the left on a diagonal line that took off only the lower left hand stroke of the A but which left only the top of the right hand ascender of the H in all copies examined except IU 1673 copy 2, Baxter, and Wellesley College, in which three copies the letters ate clearly printed.

10 courfe] cours

ON THE UNIVERSITY CARRIER II— 1673

31

(33) But lately finding him fo long at home And thinking now his journeys end was come, And that he had tane up his lateft Inne, In the kind office of a Chamberlin Shew'd him his room where he muft lodge that night, 15 Pull'd off his Boots, and took away the light ; If any ask for him, it (hall be fed, Hobfou has fupt,and's newly gon to bed.

Another on the fame.

HEre lieth one who did tnoft truly prove, That he could never die while he could move, So hung his deftiny never to rot While he might ftill jogg on and keep his trot, Made of fphear- metal, never to decay 5

Untill his revolution was at flay. Time numbers motion, yet (without a crime 'Gainft old truth) motion numbcr'd out his time : And like an Engin mov'd with wheel and waight, His principles being ceaft, he ended ftrait, 10

Reft that gives all men life, gave him his death,

And too much breathing put him out of breath i

C Nor

20

(34)

Nor were it contradiction to affirm

Too long vacation haftned on his term.

Meerly to drive the time away he fickn'd, 15

Fainted, and died, nor would with Ale be quickn'd,

Nay, quoth he, on his fwooning bed out-ftretch'd,

If I may not carry, fure Tie ne're befetch'd,

But vow though the crofs Dodtors all flood hearers,

For one Carrier put down to make fix bearers.

Eafe was his chief difeafe, and to judge right,

He di'd for heaviners that his Cart went light,

His leafure told him that his time was com,

And lack of load, made his life burdenfom,

That even to his laft breath (ther be that fay't)

As he were preft to death, he cry'd more waight »

But had his doings lafted as they were,

He had been an immortal Carrier.

Obedient to the Moon he fpent his date

In cours reciprocal, and had his fate

Linkt to the mutual flowing of the Seas,

Yet (ftrange to think) his wain was his increafe r

His Letters are deliver'd all and gon,

Only remains this fuperfcription.

VAlltgt*

25

30

The page numbering] The first 3 is broken in some but not all copies examined.

Hobson II. Title. Italic type of 1673 is Roman in 1645. 4 on] on, 8 time:] time;

16 quickn'd, I quickn'd; 17 out-ftretch'd,] outftretch'd,

18 I'le] He 22 heavinefs] heavines 28 been] bin immortal]

immortall 34 Only] Onely

32

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(35)

L' Allegro.

HEnce loathed Melancholy Of Cerberus, and blackeft midnight born, In Stygian Cave forlorn.

'Mongft horrid fhapes,and (hreiks, and fights unholy, Find out fome uncouth cell, 5

Where brooding darkrrefs fpreads his jealous wings, And the night- Raven fings •,

There under Ebon (hades, and low-brow'd Rocks, As ragged as thy Locks,

In dark Cimmerian defer t ever dwell. io

But com thou Goddefs fair and free, In Heav'n ydeap'd Eupbrofyne, And by men, heart-eafing Mirth, Whom lovely Venus at a birth

With two filter Graces ntore 15

To Ivy- crowned Bacchus bore » Or whether ( as torn Sager ling ) The frolick Wind that breathes the Spring. Zephir with Aurora playing,

As he met her once a Maying, 20

There on Beds of Violets blew, And frelh-blown Rofes waflit in dew,

G a FifiM

(30

Fill'd her with thee a daughter fair, So buckfom, blith, and debonair. Hafte thee nymph, and bring with thee Jeft and youthful Jollity, Quips and Cranks, and wanton Wiles, Nods, and Becks, and Wreathed Smiles, Such as hang on Hebe's cheek, And love to live in dimple fleeki Sport that wrincled Care derides, And Laughter holding both his fides. Com, and trip it as you go On the light fantaftick toe, And in thy right hand lead with thee, The Mountain Nymph, fweet Liberty v And if I give thee honour due, Mirth, admit me of thy crue To live with her, and live with thee, In unreproved pleafures free > To hear the Lark begin his flight, And finging ftartle the dull night, From his watch-towre in the skies, Till the dappled dawn doth rife ; Then to com in fpight of forrow, And at my window bid good morrow.

25

30

35

40

45 Though

The page numbering] The 5 is broken in some, but not all copies examined. The texts of the two twin poems L'Allegro- II Penseroso are found only in 1645 and 1673. The collations are of those two editions. 3 forlorn. So all copies examined. ] forlorn 5fome]fom 6where]wher darknefs] darknes 11 Goddefs] Goddes 18 Spring.] Spring, Columbia, though insisting, see in- sistence in note to line 3, that it is following 1673 text, prints a comma here in text and has no note. Yale copy and Michigan 3552. A2, the former certainly and the latter probably, have been corrected with pen and ink from period to comma. All other copies examined show a single dot here. Under magnification, no copy shows this dot with any trace of a tail, as of a comma. The mark is almost certainly a battered period. The alignment here makes it obvious that the compositor emptied his stick upon completing this line, and he set a period, or intended to set one here.

33 you] ye 44 the] In all 1673 copies examined, the t has dropped down. Catchword is erroneously Though for Through in all 1673 copies examined.

L'ALLEGRO— 1673

33

(37) Through the Sweet-Briar, or the Vine,

Or the twifted Eglantine.

While the Cock with lively din,

Scatters the rear of darknes thin,

And .to the ftack, or the Barn dore,

Stoutly ftruts his Dames before,

Oft lift'ning how the Hounds and Horn

Chearly roufe the flumbring morn,

From the fide of fom Hoar Hill,

Through the high wood echoing fhrilL

Som time walking not unfeen

By Hedge-row Elms, on Hillocks green,

Right againft the Eaftern gate,

Where the great Sun begins his ftate,

Roab'd in flames, and Amber light,

The clouds in thoufand Liveries dight,

While the Plowman neer at hand,

Whittles ore the Furrow'd Land,

And the Milkmaid fingeth blithe,

And the Mower whets his fithe,

And every Shepherd tells his tale

Under the Hawthorn in the dale.

Streit mine eye hath caught new pleafures

Whilft.the Lantskip round it meafures,

C3

50

55

6o

65

70 RuflTct

(38) Ruffet Lawns, and Fallows Gray, Where the nibling flocks do ftray, Mountains on whofe barren breft The labouring clouds do often reft ; Meadows trim with Daifies pide, Shallow Brooks, and Rivers wide. Towers, and Battlements it fees Boofom'd high in tufted Trees, Wher perhaps fom beauty lies, The Cynofure of neighbouring eyes. Hard by, a Cottage chimney fmokes, From betwixt two aged Okes, Where Corydon and 'thyrfts met, Are at their favory dinner fet Of Hearbs, and other Country Meffes, Which the neat-handed Phillis dreffes ; And then in hafte her Bowre flie leaves, With Tbejlylis to bind the Sheaves j Or if the earlier feafon lead To the tann'd Haycock in the Mead, Some times with fecure delight The up-land Hamlets will invite, When the merry Bells ring round, . And the jocond rebecks found

75

80

85

90

To

53 Horn] horn, 60 Where] Wher 62 dight,] dight.

61 Roab'd] Rob'd

91 Some] Som

34

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(39)

To many a youth, and many a maid,

Dancing in the Chequer'd (hade i

And young and old com forth to play

On a Sunfhine Holyday,

Till the live- long day-light fail,

Then to the Spicy Nut-brown Ale,

With (lories told of many a feat,

How Faery Mab the junkets eat,

She was pincht, and pull'd (he fed,

And by the Friars Lanthorn led

Tells how the drudging Goblin fwef,

To em his Cream-bowle duly fet,

When in one night, ere glimps of morn,

His (hadowy Flale haththrefh'd the Corn,

That ten day-labourers could not end,

Then lies him down the Lubbar Fend.

And ftretch'd out all the Chimney's length,

Basks at the fire his hairy ftrength i

And Crop-full out of dores he flings,

Ere the firft Cock his Mattin rings.

Thus done the Tales, to bed they creep,

By whifpering Winds foon lull'd afleep.

Towred Cities pleafe us then,

And the bufie humm of men,

C 4

95

ioo

105

no

"5

Where

<40)

Where throngs of Knights and Barons bold,

In weeds of Peace high triumphs hold,

With (lore of Ladies, whole bright ejes

Rain influence, and judge the prife,

Of Wit, or Arms, while both contend

To win her Grace, whom all commend,

There let Hymen oft appear

In Saffron robe, with Taper clear,

And pomp, and feaft, and revelry,

With mask, and antique Pageantry,

Such fights as youthful-Poets dream

On Summer eeves by haunted ftream.

Then to the well-trod ftage anon,

Ifjonfons learned Sock be on,

Or fweeteft Sbafyfpear fancies childe,

Warble his native Wood-notes wilde,

And ever againft eating Cares,

Lap me in foft Lydian Aires,

Married to immortal verfe

Such as the meeting foul may pierce

In notes, with many a winding bout

Of lincked fweetnefs long drawn out,

With wanton heed, and giddy cunning,

The melting voice through mazes running »

120

125

130

135

140

Untwifting

104 And by the . . .] And he by Friars ... 108 Corn,]

Corn no Lubbar Fend.] LubbarFend. No space, and no note in Columbia. 115 done] don 116 Winds] Windes

122 prife,] prife 124 commend,] commend. 129 youthful] youthfull 140 fweetnefs] fweetnes

IL PENSEROSO — 1673

35

f40

Untwifting all the chains that ty The hidden foul of harmony. That Orpheus felf may heave his head From golden (lumber on a bed Of heapt Elyfian flowres, andliear Such ftreins as would have won the ear Of Plttto, to have quite fet free His half regain'd Efirydice. Thefe delights, if thou canft give, Mirth with thee, I mean to live.

Il Penferofi.

FTEnce vain deluding joyes, *■ •*• The brood of folly without father bred, How little you befted,

Or fill the fixed mind with all your toyes ; Dwell in fome idle brain,

And fancies fond with gaudy (hapes poffef^ As thick and numberleis

As the gay motes that people the Sun Beams, Or likeft hovering dreams The fickle Penfioners oiMorfbeuf train,

MS

150

10 But

(40

But hail thou Goddefs, fage and holy,

Hail divineft Melancholy,

Whofe Saintly vifage is too bright

To hit the Senfe of human fight i

And therefore to our weaker view,

Ore laid with black ftaid Wifdoms hue.

Black, but fuch as in efteem,

Prince Mormons fitter might befeem,

Or that flarr'd Etbiope Queen that ftrove

To fet her beauties praife above

The Sea Nymphs, and their powers offended.

Yet thou art higher far defcended,

Thee bright-hair'd Vefta long of yore,

To folitary Saturn bore i

His daughter fhe ( in Saturm raign4

Such mixture was not held a (lain)

Oft in glimmering Bowres, and glades

He met her, and in fecret (hades

Of woody Idas inmoft grove,

While yet there was no fear of Jove*

Com penfiveNun, ckvout and pure,

Sober, ftedfaft, and demure,

All in a robe of darkeft grain,

Flowing with majeftick train,

15

20

25

30

And

// Penseroso. 5 fome] fom

11 Goddefs,] Goddes, 15 therefore] therfore 19 ftarr'd] Starr'd 21 offended,] offended. In all copies 1645 examined, the period is clear. Columbia omits from notes.

36

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(43)

And fable dole of Cipre J Lawn, Over thy decent (houlders drawn. Com, but keep thy wonted ftate, With eev'n ftep, and mufmg gate, And looks commercing with the skies, Thy rapt foul fitting in thine eyes : There held in holy paflion (till, Forget thy felf to Marble , till With a fad Leaden downward caft, Thou fix them on the earth as fa(t. And joyn with thee calm Peace, and Quiet Spare Faft, that oft with gods doth diet, And hears the Mufes in a ring, Ay round about J ova Altar ling. And adde to thefe retired leafure; That in trim Gardens takes his pleafures But firft, and chiefeft, with thee bring, Him that yon foars on golden wing, Guiding the fiery-wheeled throne, The Cherub Contemplation, And the mute Silence hift along, 'Lefs Tbilomel will deign a Song, In her fweeteft, faddeft plight, Smoothing the rugged brow cf night,

35

40

45

50

55

While

C44J) While Cynthia checks her Dragon yoke, Gently o're th'accuftom'd Oke > Sweet Bird that fhunn'ft the noife of folly, Moft mufical, moft Melancholy ! Thee Chauntrefs oft the Woods among, I woo to hear thy Even- Song i And miffing thee, I walk unfeen On the dry fmooth- (haven Green, To behold the wandring Moon, Riding neer her higheft noon, Like one that had bin led aftray Through the Heav'ns wide pathles way •, And oft, as if her head (he bow'd, Stooping through a fleecy cloud. Oft on a Plat of rifing ground, I hear the far-off Curfm found, Over fome wide-water'd (hoar, Swinging (low withfullen roar » Or if the Ayr will not permit, Som (till removed place will fit, Where glowing Embers through the room TeachJight to counterfeit a gloom, Far from all refort of mirth. Save the Cricket on the hearth,

6o

65

70

75

8o

Or

49 leafure;] leafure, Some doubt may, with reason, be expressed over the exact intent of the 1673 punctuation. The 1673 edition follows the 1645 text very closely throughout both L' Allegro and II Penseroso. At this point, different copies of the 1673 edition show a most unusual semi-colon or comma, which ever was intended. The mark is certainly a semi-colon; but it is badly battered; was a battered semi-colon employed here because the compositor thought he was actually setting a comma? 56 deign] daign 57 In] Id Not in Columbia notes.

62 mufical,] muficall, Melancholy!] melancholy!

64 Even-Song;] eeven-Song; 75 fome] fom 81 mirth.] mirth,

IL PENSEROSO — 1673

37

(45)

Or the Belmans drowiie charm, To blefe the dores from nightly harm : Or let my Lamp at midnight hour, Be feen in fome high lonely Towr, Where I may oft out- watch the Bear, With thrice great Hermes? or unfphear. The fpiritof Plato to unfold What Worlds, or what vaft Regions hold The immortal mind that hath forfook Her manfion in this flefhly nook : And of thofe Damons that are found In fire, air, flood, or under ground, Whofe power hath a true confent With Planet, cr with Element. Som time let Gorgeous Tragedy In Sceptei'd Pall com fwceping by, Prefenting thebs, or Pelops line, Or the tale of troy divine. Or what (though rare) of later age, Ennobled hath the Buskind ftage. But, O fad Virgin, that thy power Might raife Mufiens from his bower, Or bid the foul of Orpheus ling Such notes as warbled to the firing.

85

90

95

ioo

105

Drew

(4«)

Drew Iron tears down Vlutos cheek, And made Hell grant what Love did feek. Or call up him that left half told The ftory ofCambufcan bold, Of Camball, and of Algdrfife, And who had Canace to wife, That own'd the vertuous Ring and Glafs, And of the wondrous Hors of Brafc, On which the Tartar King did ride i And if ought els, great Bards befide, In fage and folemn tunes have fung, Of Turneys and of Trophies hung » Of Forefts, and inchantments drear, Where more is meant then meets the ear, Thus night oft fee me in thy pale career, Till civil- fuited Morn appeer, Not trickt and frounc't as (he was wont, With the Attick Boy to hunt, But Cherchef't in a comely Cloud, While rocking Winds are Piping loud, Or uflier'd with a (hower ftill, When the guft hath blown his fill, Ending on the rufsling Leaves, With minute drops from off the Eaves,

no

"5

120

125

130

And

83 drowfie] droufie 86 fome] fom 88 unfphear.] unfphear This is a difficult crux so far as the punctuation is concerned. No punctuation seems to be necessary, or at most a comma would suffice; but all copies examined show a mark, which, even under magnification, reveals no traces of the tail of a comma. This happens several times in the 1673 printing, i.e., the appear- ance of a period like this one and perhaps the same piece of type where no punctuation is needed. See p. 91, 1673 Comus, line 165 duft. Here, where exactly the same conditions obtain. On p. 103, Comus, 1. 445 Woods, and p. 105, ibid., 1. 490 elfe. the period is called for, and the one used rises above the line of the type as in the case noted here. 106 ftring,] ftring, Columbia note is wrong, 1645 carrying a small, battered comma, clear only under magnification.

125 Cherchef't] The C is from a larger font of type in all copies examined, comely] comly

38

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(47J

And when the Sun begins to fling His flaring beams, me Goddefc bring To arched walks of twilight groves, And (hadows brown that Sjlvatt loves Of Pine, or monumental Oake, Where the rude Ax with heaved ftroke, Was never heard the Nymphs to daunt, Or fright them from their hallow'd haunt. There in clofe covert by fome Brook, Where no prophaner eye may look, Hide me from Day's garifli eie, While the Bee with Honied thie, That at her flowry work doth ling* And the Waters murmuring With fuch confort as they keep, Entice the dewy-feather 'd Sleep > And let fom flrange my fterious dream, Wave at his Wings in Airy ftrcam, Of lively portrature difplay'd, Softly on my eye-lids laid. And as I wake, fweet mufick breath Above, about, or underneath, Sent by fom fpirit to mortals good, Or th'unfeen Genius of the Wood.

135

140

145

150

(48)

But let my due feet never fail,

To walk the ftudious Ctoyfters pale.

And love the high embowed Roof,

With antick Pillars rnafly proof,

And floried Windows richly dight,

Cafling a dimm religious light.

There let the pealing Organ blow,

To the full voic'd Quire below,

In Service high, and Anthems deer,

As may with fweetnefe, through mine ear,

Diflblve me intoextafies,

And bring all Heav'n before mine eyes.

And may at laft my weary age

Find out the peacefull hermitage,

The Hairy Gown and Moffy Cell,

Where I may fit and rightly fpell

Of every Star that Heav'n doth (hew,

And every Herb that fips the dew i

Till old experience do attain

To fomething like Prophetic ftrain.

Thefe pleafures Melancholy give,

And I with thee will choofe to live.

155

160

165

170

175

SONNETS.

But

132 Goddefs] Goddes 139 fome] fom 140 prophaner] profaner 143 fing.] fing,

156 pale.] pale, 164 fweetnefs,] fweetnes, 174 fomething] fomthing

170 fpell] fpell,

SONNETS— 1673

39

(49)

SONNETS. i.

O Nightingale, that on yon bloomy Spray Warbl'ft at eeve, when all the Woods are ftili, Thou with frefh hope the Lovers heart doft fill, While the jolly hours lead on propitious May>

Thy liquid notes that clofe the eye of Day, Firft heard before the (hallow Cuccoo's bill Portend fuccefs in love j O if Joves will Have linkt that amorous power to thy foft lay,

Now timely fing, ere the rude Bird of Hate

Foretell my hopeles doom in fom Grove ny :

As thou from year to year haft fung too late

For my relief > yet hadft no reafon why, Whether the Mufe, or Love call thee his mate,

Both them I ferve, and of their train am I.

If.

Donna leggiadra il cut bel nome honor a

Vherbofa vol di BMeno^ e il nobil varco,

Bene e colui d'ogni valort fcarco

Qual tuo fpirto gentil Hon imamora-, Cbe dolcemente moftrafi difuora

Ve fui atti fsavi giamai parcot

10

(50)

E i don\ chejm d'amor fame td arco» La onde I* aha tub vkt» s%fidtt.

Quando tu vaga parity o lieta canti Che mover pojfa duro alpeftre legno0 Guardi ciafcun a gli occhi^ ed agli ortcchi

Uentrata^ chi di te ft truova indegno j Gratia foladi fit glivaglia>inanti Cbe'l difio amorofo al cttor s'inveccbi*

III.

§>ual in colle afpro, al itnbrunir di jera Vavezza giovinetta pafiorelta Va bagnando Vberbettafirana e bella Che mat ft fpande a difufata /per a

Fuor di fua natia alma primavera, Cofi amor meco infu la lingua fnella Vcfia. ilfior novo di ftraniafavella, Memre io di re, vezzofamente altera^

Canto-, dal mio buon popol non intefo £'/ be I 'tamigi cangio col bel Arm* Amor lo volfe, ed u a faltrui pefo

Seppi ch* Amor cofa mat volfe indarno. Deb ! fcji' il mio cuor lento e'l duro few A cbipiama dal delft buon terreno*

10

10

Canzone.

D

E»

Sonnet I. Printed in 1645, and again in 1673. 11 year to year] yeer to yeer

Sonnet II. Printed in 1645, and again in 1673. 3 Bene] Ben 6fui]fuoi

Sonnet II. 7 arco.] arco, 8 virru] virtH

Sonnet III. Printed in 1645, and again in 1673. 5 natia]

natia Columbia omits in notes. 6 amor] Amor infu] infd fnella] fnella Columbia text reads 'suella' and carries no note.

40

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

I (50

Canzone.

RIdonfi donnt e giovani amor oft M' accojlandofi attorno, e percbe fcrivi, Percbe tu ferivi in lingua ignota e fir ana Verfeggtando d'amor, e come t'ofi ? Dinne,fe la ttta fpemefta mat vana, E de pen fieri lo miglior f arrivi > Cofi mi van burlando, altri rivi Altri lidi fafpettan, & aim onde Nelle mi verdi fponde Spuntati ad bor, ad bor a la ttta cbiotna V immortal guider don d'eterne frendi Percbe alle fpalle ttte fovercbia foma ? Canzon dirotti. e tu per me rifpondi Vice mis Donna, el fuo dir, e il mio cttore ^ttefta e lingua di cui ft vanta Amore.

IV. Diodati, e til diro con maraviglia,

Quel ritrofo io clamor fpreggiar folea

E defuoi lacci fpeffo mi ride a

Giacaddiyovbuom dabben talbor s'impiglia'

Ne treccie d'oro, ne guanc'u vermiglia

AT abbaglian ft, ma fotto nova idea

Tellegrina bellezza cbe'l cuor bea,

Portamento alti bonefti} e nelle ciglia

D a

10

i5

&*el

00

Quel fereno fulgor d' amahil new, Parole adorne di lingua piu £una, E7 cantar cbe di mezzo fhemifpero

Traviar benptto lafaticofa Luna,

E degli occbi fuoi auventa ft gran fmeo Cbe Vincirar gli ortcchi mifia foco,

V.

Per certo i bei vojlr^occbi, Donna mia E(fer non puo cbe non fian lo mio file Si mi fercuoton forte, come ei fuoh Per farene di Libia cbi sinvia,

Mentre tin caldo vapor (nefentipria) Va quel laio ft fpinge ove mi duole, Cbe for fe amanti nelle lor parole Cbiamm fofpir i io nonfo cbe ft fia :

Parte rincbiufa, e turbidafi cela

Scojfo mi il petto, epoi nufcendopoco gjhtivi £ attorno o iaggbiaccia, o s'ingiela

Ma quanta a gli occbi gtunge e trovar loco *tutte le notti a me fuol far piovofe Fincbe mia Alba riviencolma di rofe.

VI.

Ciovane piano, efemplicetto amante Pti cbefuggir me fiejfo indubbio fine,

io

IO

Madonna

Canzone. Printed in 1645, and again in 1673. 14 e il] e il 15 e] e

Sonnet IV. Printed in 1645, and again in 1673. 1 diro] diro 2 folea) folea 3 ridea] ridea 4 s'impiglia.] s'impiglia, Colum- bia has no note here. 6 fi] si

Sonnet IV. 12 puo] pud

Sonnet V. Printed in 1645, and again in 1673. 1 occhi, ] occhi 2 fian] fian Columbia text prints fian and has no note. 5 fenti] fenti 12 e trovar) a trovar

Sonnet VI. Printed in 1645, and again in 1673. 2 indubbio] in dubbio

SONNETS— 1673

41

10

(53)

Madonna a voi del mio euor I' b until dono

Faro divoto > to ctrto a prove tame L'bebbifedele, intrepido> coftante,

Ve penfieri leggiadro, accorto, e buono i

guando rugge Ugran tnondo, efcocca il tueno,

S'arma dife% tTintero diamante-, 7amo del forfe , e £ invid'ta ftcnro,

Di timori, e fferanze al p^ol ufe

Quanta fingegtio, e £ alto valor vago, E di eetra fonora , e deBe mufe :

Sol troverete in tal parte men dttro

Ove amor mife fiafanabil ago.

VII. How foon hath time the futtle theef of youth,

Soln on his wing my three and twentieth yeer \

My hading dayes flie on with full career,

But my late fpring no bud or bloflbm fbew'tb. Perhaps my fcmblance might deceive the truth,

That I to manhood am arriv'd fo near,

And inward ripenes doth much lefs appear,

That fom more timely-happy fpirits indu'th. Yet be it lefs or more, or foon or flow,

It (hall be flill in ftri&eft meafure eev'n,

To that fame lot, however mean or high,

D 3 Toward

10

(54)

Toward which Time leads me, and the will of Heav'n >

All is, if I have grace to ufe it fo, As ever in my great task Matters eye.

VIII.

Captain or Colonel, or Knight in Arms, Whofe chance on thefe dcfencelefs dores may feafe, If deed of honour did thee ever pleafe, Guard them, and him within protect from harms,

He can requite thee, for he knows the charms 5

That call Fame on fuch gentle adte as thefe, And he can fpred thy Name o're Lands and Seas, What ever clime the Suns bright circle warms.

Lift not thy fpear againft the Mufes Bowre,

The great Emathian Conqueror bid fpare io

The houfe of Tindarus^ when Temple and Towre

Went to the ground : And the iepeated air Of fad Ehdra's Poet had the power To fave th' Athenian Walls from ruine bare.

IX.

Lady that in the prime of earlicft youth,

W ifely haft fhun'd the broad way and the green,

And with thofe few art eminently feen,

That labour up tne Hill of heav'nly Truth,

rhe better parr with Mary and with Ruth, 5

r Chofen

Sonnet VI. 3 Most copies examined have a spacer mark at the end of this line. It is not present in IU 1673, 16732 copy 2, Baxter, Spencer unbound; California (Clark); Harvard 14485.12., ibid. 14485.12. 2.B., Wellesley. 4 Faro] Faro 8 fe, d'intero] fe, e d'intero Columbia text reads as 1673 with no note of 1645 reading; but suggests fe. 14 amor] Amor

Sonnet VII. There is a ms. text of this poem in the Trinity College Ms. in the first draft of the Letter to an Unknown Friend. See page 389. The poem was printed in 1645, and again in 1673. The collations here are between the two printed editions only. 1 time] Time 2 Soln] Stoln twentieth] twentith 11 mean] mean,

Sonnet VIII. Contained in the MS. and printed in 1645, and again in 1673. Collations here are of the printed texts only. 3 If deed of honour did thee ever pleafe,] If ever deed of honour did thee pleafe,

Sonnet IX. Contained in the MS. and printed in 1645, and again in 1673. Collations here are of the printed texts only. 5 Mary and with Ruth,] Mary, and the Ruth,

42

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

C55)

Chofen thou haft, and they that overween,

And at thy growing vertues fret their fpleen,

No anger find in thee, but pity and ruth. Thy care is fixt and zealoufly attends

To fill thy odorous Lamp with deeds of light, 10

And Hope that reaps not (hame. Therefore be fure Thou, when the Bridegroom with his feaftfull friends

Paffes to blifs at the mid hour of night,

Haft gain'd thy entrance, Virgin wife and pure.

X. Daughter to that good Earl, Once Prefident

CXEnglands Comtd, and herTreafury,

Who liv'd in both, unftain'd with gold or fee.

And left them both, more in himfelf content, Till the fad breaking of that Parlament 5

Broke him, as that diftioneft viclory

At Chdroma, fatal to liberty

Kill'd with report that Old man eloquent, Though later born, then to have known the dayes

Wherin your Father flouriftt, yet by you, i0

Madam, me thinks I fee him living yet \ So well your words his noble vertues priife,

That all both judge you to relate them true,

And to poffefs them,Honour*d Margaret*

D 4 XI. A

f50 xl.

A Book was was writ of late call'd Tfetracbordon > And wov'n clofe, both matter, form and ftile > The Subject new : it walk'd the Town a while, Numbring good intellects i now feldbm por'd on»

Cries the flail- reader, blefs us! what a word on 5

A title page is this ! and fome in file Stand fpelling fals, while one might walk to Mile- End Green. Why is harder Sirs then Gordon,

Coliktto, or Macdonnel, or Galafp ? Thofe rugged names to our like mouths grow fleck 10 That would have made guiutilian ftare and gafp.

Thy age, like ours, O Soul of Sir John Cheeky

Hated not Learning wors then Toad or Afp > (Greek. When thou taught'ft Cambridge* and King Edward XII. On the fame.

I did but prompt the age to quit their doggs By the known rules of antient libertie, When ftrait a barbarous noife environs me Of Owlesand Cuckoes, Affes, Apesand Doggs.

As when thofe Hinds that were transform'd to Froggs 5

Raild at Latonas twin-born progenie

Which after held the Sun and Moon in fee.

But this is got by calling Pearl to Hoggs •,

That

Sonnet IX. 9 fixt] fixt,

Sonnet X. Contained in the MS. and printed in 1645, and again in 1673. Collations here are of the printed texts only. This is the last sonnet to be printed in 1645. 3 fee.] fee, 7 Chxronea,] Chxronea, 8 Kill'd] Kil'd 10 you,] you Columbia omits from notes.

Sonnet XI. There are two copies of this and the following sonnet in the MS. They were first printed in 1673, the only printed text. 1 Note was was in all copies examined. 8 Supply it after is (from errata) 9 For Coliktto read Colkitto (from errata)

SONNETS— 1673

43

(57)

That bawlc for freedom in their fencelets mood, And ftill revolt when truth would fet them free. Licence they mean when they cry libertie i

For who loves that, muft firft be wife and good i But from that mark how far they roave we fee For all this waft of wealth, and lofs of blood.

To Mr, H. Lawcs, on his Aires,

i XUI-

Harry whofe tuneful and well raeafur'd Song Firft taught our Englifh Mufickhow to fpan Words with juft note and accent, not to fcan With Midas Ears, committing fhort and long \

Thy worth and skill exempts thee from the throng, With praife enough for Envy to look wan » To after age thou (halt be writ the man , That with fmooth aire couldft humor beft our tongu

Thou honour'ft Verfe, and Verfe muft fend her wing To honour thee, the Prieft of Phoebus Quire That tun'ft their happieft lines in Hymn, or Story

Vante ftull give Fame leave to fet thee higher Then his Cafe Ha, whom he woo'd to fing Met in the milder fhades of Purgatory.

10

10

When

(58)

XIV.

When Faith and Love which parted from thee never, Had ripen'd thy jnft foul to dwell with God, Meekly thou didft refign this earthy load Of Death, call'd Life v which us from Life doth fever.

Thy Works and Alms and all thy good Endeavour 5 Staid not behind, nor in the grave were trod i But as Faith pointed with her golden rod, FolUw'd thee up to joy and blifs for ever.

Love led them on, and Faith wh» knew them beft Thy hand-maids, clad them o're with purple beams 10 And azure wings, that up they flew fo dreft,

And fpeak the truth of thee on glorious Theams Before the Judge, who thenceforth bid thee reft And drink thy fill of pure immortal fireams.

On the late Maffacher in Picmont.

XV.

Avenge O Lord thy ftaughter'd Saints, whofe bones Lie fcatter'd on the Alpine mountains cold, Ev'n them who kept thy truth fo pure of old When all our Fathers worftiip't Stocks and Stones,

Forget not : in thy book record their groanes 5

Who were thy Sheep and in their antient Fold

Slain

Sonnet XIII. There are three different drafts of this sonnet in the Trinity College Manuscript, see pages 445, 449, the first draft being dated 'Feb. 9, 1645' i.e., 1646, N.S. The sonnet was first printed in Choice Psalmes Put into Musick, For Three Voices. London, for Humphrey Moseley, 1648. The sonnet occurs on leaf a, and was printed again by Milton in 1673. See headnote to the reproduction of 1648 printing on page 368. The collation is of the 1673 text with that of 1648. To Mr. H. Lawes, on his Aires.] To my Friend Mr. Henry Lawes. 1 Harry] WArry, 1648 has large

Song] fong 2 Mufick] Mufic

6 Envy] En vie wan;] wan:

humor] humour tongu] So in all

9 fend] lend 10 Quire]

hymne Story.] *ftory. In

roman H. tuneful] tunefull 4 Ears,] eares, long;] long, 7 man,] man 8 aire] Aire 1673 copies examined for tongue. Quire, 11 lines] Lines Hymn,]

left hand margin of 1648 occur the four lines 'The ftory/ of Ariadne/ fet by him in/ Mufic./' 12 Dante] Dante 13 fing] Hng,

Sonnet XIV. First printed in 1673, this sonnet is found in three different drafts in the Trinity College MS., the first two drafts in Milton's handwriting. For nearly three hundred years, the subject was unknown; but Smart pointed out the 'a' in the crossed out title in the MS. which changed the name of the woman to whose memory the sonnet was written, and for 'Thomson' we now read 'Thomason,' and with her identity known, the poem has taken on new significance. Cf. J. S. Smart, The Sonnets of Milton. Glasgow, 1921.

Sonnet XV. Columbia number XVIII. First printed in 1673, this text is the only one preserved. The catchword exists in two different states. In most copies examined, it is erroneously Slain though the first word on the next page is Slayn and in a very few copies, notably IU Gannon and 16732 copy 6, the catchword is Sayln.

44

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(59)

Slayn by the bloody Tiemontefe that roll'd Mother with Infant down the Rocks. Their moans

The Vales redouble to the Hills, and they ToHeav'n. Their manyr'd blood and afhes fo io Ore all th» Italian fields where dill doth fway

The triple Tyrant : that from thefe may grow A hunderM-fold, who havinglearnt thy way Early maj fly the Babylonian wo.

XVI.

When I confider how my light is fpent, E're half my days, in this dark world and wide, And that one Talent which is death tb hide, Lodg'd with me ufetefc, though my Soul morebent

To ferve therewith my Maker, and prefent 5

My true account, leaft he returning chide, Doth Godexad day labour, light deny'd, I fondly ask > But patience to prevent

That murmur, foon replies, God doih not need

Either man's work or his own gifts, who beft I0

Bear his milde yoak, they ferve him beft, his State Is Kingly. Thoufandsat his bidding fpeed And port o're Land and Ocean without reft : Tkey alfo ferve who only ftand and waite.

XVII.

(60)

XVII.

Lawrence of vertuous Father vertuous Son,

Now that the Fields are dank, and ways are mite, Where (hall we fometimes meet, and by the fire Help waft a fullen day i what may be won

From the hard Seafon gaining : time will run 5

On fmoother, till Yavonim re-infpire The frozen earth i and cloth in frefh attire The Lillie and Rofe,that neither fow'd nor fpun.

What neat repaft (hall fcaft us, light and choice^

Of Attick taft, with Wine, whence we may rife 10 To hear the Lute well toucht, or artfull voice

Warble immortal Notes and tnsM^n Ayre > He who of thole delights can judge, And fpare To interpofe them oft, is not unwife.

XVIII.

Cyriackj whofe Grandfire on the Royal Bench Of Britsifh Themis, with with no mean applaufe Pronounc't and in his volumes taught our Lawes, Which others at their Barr fo often wrench »

To day deep thoughts refolve with me to drench 5

In mirth, thit after no repenting drawes >

Let Euclid reft and Archimedes paufe,

And what the Swede intend, and what the French.

To

Sonnet XV. Columbia No. XVIII. 10 fo] Errata, change

this to fow.

Sonnet XVI. Columbia No. XIX. This, 1673, is the only surviving text.

Sonnet XVII. Columbia No. XX. This, 1673, is the only surviving text.

Sonnet XVIII. Columbia No. XXI. This, 1673, except for lines 5-14 only in the Trinity College MS., is the only surviving text.

SONNET XIX

FIFTH ODE OF HORACE — 1673

45

(Si)

To meafure life,learn thou berimes, and know Toward folid good what leads the nearcft way , For other things mild Heav'n a time ordains,

And disapproves that care, though wife in (how, That with Xuperfluous burden loads the day, And when God fends a cheerful hour, refrains.

XIX.

Methought I faw my late efpoufed Saint Brought to me like Alceflis from the grave, Whom Joves great Son to her glad Husband gave, Refcu'd from death by force though pale and faint.

Mine as whom waftit from fpot of child-bed taint, Purification in the old Law did fave, And fuch,as yet once more I truft to have Full fight of her in Heaven without reftraint,

Came vefted all in white, pure as her mind : Her face was vail'd,yet to my fancied fight, Love, fweetnefc, goodnefs, in her perfon (hin*d

So clear, as in no face with more delight. But O as to embrace me (he enclin'd I wak'd, (he fled, and day brought back my night.

10

10

The

(62)

the Fifth Ode of Horace. Lib, I.

Qyis multa gracilis te puer in Rofa , Rendred almotf word for word without Rhyme accord- ittg to the Latin Meafnrey as near as the Lan- guage will fermit.\

WHat (lender Youth bedew'd with liquid odours Courts thee on Rofes in (bme pleafant Cave,

Pyrrha for whom bindft thou

In wreaths thy golden Hair, Plain in thy neatnefs > O how oft (hall he 5

On Faith and changed Gods complain : and Seas

Rough with black winds and (forms

Unwonted (hall admire: Who now en joyes thee credulous, all Gold, Who alway es vacant alwayes amiable 1 0

Hopes thee > of flattering gales

Unraindfull. Haplefcthey To whom thou untry'd feem'ft fair. Me in my vow'd Picture the facred wall declares f have hung

My dank and dropping weeds 15

To the (tern God of Sea.

Sonnet XIX. Columbia No. XXIII. A fair copy of this sonnet appears in the Trinity College MS. The first and only printing by Milton was in 1673. The following collation is with the MS. There is little significance in the minute differences. 1 Methought] Meethought Saint] faint 2 Brought] brought grave,] grave 3 Whom] whom Son] fon Husband] hufband gave,] gave 4 Refcu'd] refcu'd 5 child-bed] childe-bed taint,] taint 6 Purification] purification Law] law 7 And] and 8 Full] full Heaven] heaven 9 Came] came mind:] minde: 10 Her] her vail'd,] vaild, fight,] fight 11 Love,] love, goodnefs,] goodnefs 12 So] foe clear,] cleare, 13 O] o embrace] imbrace enclin'd] enclin'd, 14 night.] night

This translation, one of the finest ever made from any language into English by any translator at any time, has only one basic text, that of 1673. The poem seems because of its maturity to have been written after 1645, or after the publication of the first edition of the Minor Poems. Perhaps the decade between 1645 and 1655 would be the nearest approach that can be made to its date. In the catchword, the A is badly smeared in all copies examined.

46

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(*3)

AD TTRRHAM. Ode V.

Horatius ex Pyrthtf illecebris tanquam e nau- fragio enataverat, cujus araore irretitos , a£ firmat efle miferos..

QVU mult a gracilis te puer ht rofa Perfufus UquiSi urget ederibw> Grato, Pyrrha, fub antro } Cut flavsm religaseomam Simplex mttnditie ? beu quotUs fidem Mutatofque deos flebh > & offers Nigris *quora ventis Emirabitur ittfoleHS, Qui nunc te fruitier crtdulm attre* : Qui femper vacuam , femper amakUem Speratyttefem surs\- Fallacis* miferi qutints btttnma nites. me tabula facer Venva paries indie at uvida Sufpendiffe petmti Veftimtmo maris Veo*

10

15

Anno

(64)

Anno iEtatis 19. At a Vacation Exercife in the Colledge, part Latin, part Englifh. The Latin .fpeeches ended, the Englifh thus began.

IT Ail native Language, that by finews weak

*• •*'Didft move my firft endeavouring tongue to fpeak,

And mad* ft imperfect words with childirti tripp s,

Half unpronounc't, Aide through my infant-lipps,

Driving dum filence from the portal dore,

Where he had mutely fate two years before :

Here I falute thee and thy pardon ask,

That now I ufe thee in my latter task;

Small Iofs it is that thence can come unto thee,

I know my tongue but little Grace can do ther

Thou needft not be ambitious to be firft,

Believe me I have thither packt the worft :

And, if it happen as I did forecaft,

The dainteft diflies (hall be ferv'd up laft.

I pray thee then deny me not thy aide

For this fame fmall neglect that I have made:

But hafte thee (trait to do me once a Pleafure,

And from thy wardrope bring thy chiefeft treafure i

Not thofe new fangled toys, and triming (light

"Vhich takes our late fantafticks with delight,

10

15

20 But

5 munditie?) Most texts of Horace read 'munditiis?' quoties] Some old and a few modern texts read 'quotiens'. 1 1 The spacer mark after aurae is present in all copies examined. 13 Intentata) Modern texts read 'intemptata' thus the Loeb Bennet text, 1927, 1934.

According to the 1673 errata list, Milton wanted this poem to be placed on page 21, at the end of the Elegie, i.e., after the Death of a Fair Infant, and before The Passion. The only text extant is that of 1673. 3 tripp s,] This spacing occurs in all copies examined.

AT A VACATION EXERCISE— 1673

47

(65)

But cull thofericheft Robes, and gay'ft attire

Which deepeft Spirits, and choictft Wits defire t

I have fome naked thoughts that rove about

And loudly knock to have theii pafTage out i

And wearie of their place do only Hay 25

Till thou haft deck'c them in thy beft aray >

That fo they may without fufpeft or fears

Fly fwiftly to this fair AfTembly's ears>

Yet I had rather, if I were tochufe,

Thy fervice in fome graver fubjedr ufe, 30

Such as may make thee fearch thy coffers round,

Before thou cloafh my fancy in fit found : .

Such where the deep tranfported mind may Toare

Above the wheeling poles, and at Heav'ns dore

Look in, and fee each blifsful Deitie 35

How he before the thunderous throne doth lie,

Liftening to what unfhorn Apoh fings

To th* touch of golden wire*, while Hebe brings

Immortal Ne&ar to her Kingly Sire :

Then palling through the Spherse of watchful fire, 40

And miftte Regions of wide air next tinder,

And hills of Snow and lofts of piled Thunder,

May ttll at length how green-ey'd Neptune raves,

In Hea v*ns defiance muttering all his waves *>

E Then

45

50

(66)

Then Gng of fecret things that came to pafc When Beldam Nature in her cradle was > And laft of Kings and Queens and Hero's old, Such as the wife Vemodow once told In folemn Songs at King Acinous fcaft, While fad Vliffes foul and all the reft Are held with his melodious harmonie In willing chains and fweet captivitie. But fie my wandring Mufe how thou doft ftray I Expectance calls thee now another way, Thou know'st it muft be now thy only bent To keep in compafs of thy Predicament : Then quick about thy purpos'd bufinefs come, That to the next I may refign my Roome,

Then Ens is represented as father of the Tr£* dicaments his ten Softs , whereof the Eldeft flood for Subftance with his Canons > which Ens th$trfpeakittg-> explains.

55

GOod luck befriend thee Son i for at thy birth The Faiery Ladies daunc't upon the hearth ; Thy drowfie Nurfe hath fworn (he did them (pie Come tripping to the Room where thou didftlie i

60

And

48

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

<67)

And lweetly (inging round about thy Bed*

Strew all their bleflingson thy deeping Head*

She heard them give thee this, that thou (hould'ft ftili 65

From eyes of mortals walk invifible,

Yet there is fomething that doth force my fear,

For once it was my difmal hap to hear

A Sybil old, bow-bent with crooked age,

That far events full wifely could prefage, 70

And in times long and dark Profpe&ive Glafs

Fore- faw what future dayes fhouki bring to pafsr,

Your Son, faid flie, (nor can you it prevent)

Shall fubjedt be to many an Accident.

O're all his Brethren he (hall Reign as King, 75

Yet every one (hall make him underling,

And thofe that cannot live from him afunder

Ungratefully (hall (hive to keep him under,

In worth and excellence he (hall out-go them,

Yet being above them, he (hall be below them » 80

From others he (hall (land in need of nothing*

Yet on his Brothers (hall depend for Cloathing*

To find a Foe it (hall not be his hap,

And peace (hall lull him in her fiowry lapi

Yet (hall he live in ftnfe, and at his dcre 85

Devouring war (hall never ceafe to toare :

E * Yea'

(69)

Yea it (hall be his natural property

To harbour thofe that are at enmity.

What power, what force, what mighty fpell,if not

Your learned hands, can loofe this Gordian knot ?

90

The next Quantity and Quality , fpake in Vrofc then Relation was call'd by his Name,

Rivers arife } whether thou be the Son, Of utmoft Tweed, 01 Oofe, or gulphie Van, Or Trent, who like fome earth-born Giant fpreads His thirty Armes along the indented Meads, Or fullen Mole that runneth underneath, Or Severn fwift, guilty of Maidens death, Or Rockie^z/0*, or of Sedgie Lee, Or Coaly Tine, or antient hollowed Dee, Or Hnmber loud that keeps'the Scythians Name, Or Medway finooth, or Royal Towied Thame

The retl teas Trofe.

95

100

On

NEW FORCERS OF CONSCIENCE

ARCADES— 1673

49

C«9)

On the new forcers of Confcience under the Long PARLIAMENT.

BEcaufe you have thrown of your Prelate Lord, And with ftiff Vowes renoune'd his Liturgie To feife the widdow'd whore Pluralitie From them whofe fin yeenvi'd,notabhor'd,

Dare ye for this adjure the Civill Sword To force our Confciences that Chritt fet free, And ride us with a claffic Hierarchy Taught ye by meer A. £.and Rotberford?

Men whofe Life, Learning, Faith and pure intrtr Would have been held in high efteem with Paul Muft now be nam'd and printed Hercticks

By (hallow Edwards and Scotch what d* ye call : But we do hope to find out all your tricks, Your plots and packing wors then thofe of Trent*

That fo the Parliament

May with their wholfom and preventive Shears 16

Clip your Phylacteries, though bank your Ears,

And fuccour our jufi Fears

When they (hall read this clearly in your charge

Nw Presbyter is but Old Priejl writ Large.

E 3 ARCADES.

10

20

(70) ARCADES.

Tart of an Entertainment prefented to the Countefs. Dowager of Darby at Harefield, by fome Noble terfons of her family ^ who appear on the Scene in P aft oral Habit , moving toward the feat of State > with this Song. s

i. SONG.

LOok Nymphs, and Shepherds look, Whit (udden blaze of MajeHy Is that wfich we from hence defcry Too divine to be mi (look :

This this is (he 5

To whom our vows and withes bend, Heer our (olemn fearch hath end.

Fame that her high worth to raiie,

Seem'd erft fo lavi(h and profufe,

We may juftly now accufe io

Of detraction from her piaife,

Lefs then half we find expreft,

Envy bid conceal the reft.

Matk what radiant (late (he fpreds,

In circle round her (hining throne,

Shooting

This Poem is in the Tr. Coll. MS., see p. 455, and was printed in 1673. The collations are of 1673 text and MS. 1 of] off Lord,] Lord 2 with] wth The Columbia notes disregard such abbreviations as this. Vowes] vowes renoune'd] renouncd 3 widdow'd] widow'd Pluralitie] plurality 4 ye] yee not] nott abhor'd] abhorrd, 5 Civill Sword] civill sword 6 fet] sett 7 with] wth 8 ye] yee and] & Rotherford?] Rotherford. 9 Life, Learning, Faith and] life, learning, faith & 10 been] bin with] wth n nam'd] namd and] & 12 and] & call:] call; 13 we] wee do] doe 14 plots] plotts and] & packing] packings wors] worfe 15 Parliament] Parlament 16 with] wth wholfom] wholsome and] & Shears] sheares 17 Phylacteries,] Phylacteries Columbia does not specifically mention, bank errata list says change to bauk] bauke Ears,] eares 18 Fears] feares 19 clearly] cleerly 20 Prieft] Preist writ] writt Large.] large.

Arcades. The date of composition and performance of the Arcades is conjecturally placed between 1631 and 1634. Milton printed it in 1645 and again in 1673. In the Trinity College MS., the first three much mutilated pages contain a version, some of which has been destroyed, of the piece. The collations are between 1673 and 1645 only, and the MS. reproductions begin on page 385. ARCADES.] Arcades. Title. The preliminary statement in 1645 has roman type where 1673 and italic type where 1673 has roman, and is otherwise the same except for the following. 1 Entertainment] entertainment 2 fome] fom 3 Perfons] perfons • 4 Paftoral Habit,] paftoral habit, SONG.] SONG. 2 Majefty] majefty

50

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(70

Shooting her beams Tike filver threds, This this is (he alone,

Sitting like a Goddes bright,

In the center of her light.

Might (he the wife Latotts be, Or the towred Cybele, Mother of a hundred gods> Juno dare's not give her odds j

Who had thought this clime had held

A deity fo unparalel'd ?

20

25

As they com forward, the Genius of the Wood a$* pears, and turning toward them, fpeakj,

f^lLn. Stay gentle Swains, for though in this difguife, ^* I fee bright honour fparkle through your eyes, Of famous Arcady ye are, and fprung Of that renowned flood, fo often fung, Divine Alpbeut, who by fecrct flufe, 30

Stole under Seas to meet his Aretbufe* And ye the breathing Rofes of the Wood, Fair filver-buskin'd Nymphs as great and good, I know this queft of yours, and free intent Was all in honour and devotion ment 35

E 4 To

To the great Miftres of yon princely fhrtne,

Whom with low reverence I adore as mine,

And with all helpful (ervice will comply

To further this nights glad folemnity i

And lead ye where ye may more near behold 40

What (hallow- fearching Fame hath left untold \

Which I full oft amidft thefe (hades alone

Have fate to wonder at, and gaze upon:

For know by lot from Jove. I am the powr

Of this fair Wood, and live in Oak*n bowr, 45

To nurfe the Saplings tall, and curl the grove.

With Ringlets quaint > and wanton windings wove.

And all my Plants I fave from nightly ill,

Of noifom winds, and Mailing vapours chill.

And from the Boughs brum off the evil dew, 50

And heal the harms of thwarting thunder blew,

Or what the crofs dire- looking Planet fmites,

Or hurtfull Worm with canker'd venom bites.

When Ev'ning gray doth life, I fetch my round

Over the mount, and all this hallowM groim'd, 55

And early ere the odorous breath of morn

Awakes the (lumbring leaves, or taffeld horn

Shakes the high thicket, hafte I all about,

Number my ranks, and vifit every fprout

1 With

22 hundred] hunderd The stage directions in 1645 are in roman type, otherwise the same. 33 filver-buskin'd] filver-buskind

40 near] neer 46 grove. So in all copies examined.] grove 47 quaint;] quaint, 54 Ev'ning] Eev'ning 55 groun'd,] ground,

ARCADES— 1673

51

C73)

With puiflant words, and murmurs made to bids, 60 But els in deep of night when drowfines Hath lock't up mortal fenfe, then liftcn I To the celefiial Sirens harmony, That (it upon the nine enfolded Sphears, And (ing to thofe that hold the viral (hears, 65

And turn the Adamantine fpindlc round, On which the fate of gods and men is wound- Such fweet compulfion doth in mufick ly, To lull the daughters oiNeceffity, And keep unfteddy Nature to her law, 70

And the low world in meafur'd motion draw After the heavenly tune, which none can hear Of human mould with grofe unpurged eari And yet fuch mufick worthier! were to blaze The peerles height of her immortal praife, 75

Whofc luftre leads us, and for her moft fit, If my inferior hand or voice could hk Inimitable founds, yet as we go, What ere the skill of Iefler gods can (how, I will affay, her worth to celebrate, 80

And fo attend ye toward her glittering ftate* Where ye may all that are of noble fiemm Approach, and kifs her facred vettures hemm.

(74) 2. SONG.

O'Re the fmooth enamel'd green Where no print of (tep hath been,

Follow me as I (ing,

And touch the warbled firing. Under the (hady roof Of branching Elm- Star-proof.

Follow me, I will bring you where (he fits Clad in fplendor as befits

Her deity. Such a rural Queen All Arcadia hath not feen.

3. SONG.

NYmphs and Shepherds dance no more By fandy Ladons Lillied banks, On old Lyc£us or Cyllene hoar,

Trip no more in twilight ranks, Though Erymatyh your lofs deplore,

A better foyl (hall give ye thanks; From the ftony Mtftalur, Bring your Flocks, and live with us,

85

90

95

100

Here

62 lock't] lockt 73 grofs] groffe ear;] In most, but not all copies of 1673, the e is battered and a piece of metal or dirt has clung above the letter leaving a small ink mark like a diaeresis. But in other copies, the letter is clean.

84 enamel'd] enameld 89 Elm-Star-proof . ] Elm Star-proof. 91 fits] fits, 97 banks,] banks.

52

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(75)

Here ye (hall have geater grace,

To ferve the Lady of this place.

Though Syrinx your Pans Miftrefs were, Yet Syrinx well might wait on her.

Such a rural Queen All Arcadiahzth not feen,

105

L Y C I D A S.

In this Monody the Author bewails a learned Friend , unfortunately drown d in his paffage from Chefter on the Irifti Seas, 1 6 37* And by occafion foretells the mine of our corrupted Clergie then in their height.

YEt once more, O ye Laurels, and once more Ye Myrtles brown, with Ivy never fear, I com to pluck your Berries harm and crude, And with forc'd fingers rude, Shatter your leaves before the mellowing year. Bitter conftraint, and fad occafion dear, Corapells me to difturb your feafon due : For Lycidas is dead, dead ere his prime, Young Lycidas, and hath not left his peer : Who would not fing for Lycidas ? he knew

10 Himfelf

(76)

Himfelf to fing, and build the lofty rhyme.

He rouft not flote upon his watry bear '

Unwept, and welter to the parching wind,

Without the meed of fom melodious tear.

Begin then, Siflers of the fatted well, 15

That from beneath the feat of Jove dojth fpring,

Begin, and fomewhat loudly fvveep the firing.

Hence with denial vain, and coy excufe,

So may fome gentle Mule

With lucky words favour my deftin'd Urn, 20

And as he partes turn, And bid fair peace be to my fable ihrowd. For we were nurft upon the felf-fame hill, Fed the fame flock i by fountain, (hade, and rill.

Together both, ere the high Lawns appear'd 25

Under the opening eye-lids of the morn, We drove a field, and both together heard What time the Gray-fly winds her fultry horn, Batt'ning-our flocks with the frcfli dews of night, Oft till the Star that rofe, ar Ev'ning, bright, 30

Toward Heav'ns defcent had flop'd his weftering wheel. Mean while the Rural ditties were not mute,

TemperM to th' Oaten Flufe,

Rough Satyrs dane'd, and Fauns with clov'n heel,

From

104 geater] greater 106 Miftrefs] Miftres 109 feen,] feen. Lycidas. This poem is in the MS. and was first printed at Cambridge in 1638. See page 346ff. Milton printed it in 1645, and again in 1673. The collations are of the 1673, 1645, and 1638 printed texts. Title. LYCIDAS.] Lycidas.} Lycidas. The five line headnote, lacking in 1638, has the italic and roman type reversed in Milton's editions, except for the date, '1637' which is roman in both. Otherwise, 2 unfortunately] unfortunatly paffage] Paffage 4 foretells] foretels 5 Clergie] Clergy The entire 1638 text is set -in italic type, which will be ignored in collation. 1 Laurels,] ] laurels, more] ] more, 2 Myrtles]] myrtles Ivy]] ivy never fear,] never-fear,] never-fere, 3 com] ] come Berries] ] berries 4 rude,] ] rude 5 year.] ] yeare. 6 dear,] ] deare 7 Compells] Compels] Compells 8 prime,] prime] prime, 9 Young Lycidas,] ] (Young Lycidas!) peer:] ] peere.

12 bear] ] biere 13 wind,] ] wind 14 fom] ] fome tear.] ] tear. With a spacer mark that looks like '!' in some copies and lacking in others. 15 well,] ] well 16 fpring,] ] fpring;

17 fomewhat] fomwhat] fomewhat ftring.] ] ftring:

18 denial]] deniall excufe, ] ] excufe. 19 fome] fom] fome 20 Urn,] ] urn, 21 paffes turn,] ] paffes, turn 22 fhrowd.] ] fhroud. 24 flock;] ] flock, rill.] ] rill; 25 1638 does not in- dent. Lawns] ] lawns 26 opening] ] glimmering 27 afield,]] a-field, 28 Gray-fly] ] gray-fly 30 1638 'Oft till the ev'n-ftarre bright' bright,] bright] bright 31 Heav'ns] ] heav'ns weftering] ] burnifht 32 Rural] ] rurall mute,] ] mute

33 Oaten] ] oaten Flute,] ] flute: 34 Satyrs] ] Satyres clov'n] ] cloven heel,] ] heel

LYCIDAS— 1673

53

(77) From the glad found would not be abfent long} 35

And old Damttas lov'd to hear our fong.

But O the heavy change, now thou art gon, Now thou art gon, and never rauft return ! Thee Shepherd, thee the Woods, and defert Caves, With wilde Thyme and the gadding Vine o'regrown, 40 And all their echoes mourn. The Willows, and the Hazle Copfes green, Shall now no more be feen, Fanning their joyous Leaves to thy loft layes. As killing as the Canker to the Rofe, 45

Or Taint- worm to the weanling Herds that graze, Or Froft to Flowers, that their gay wardrop wear, When firft the White Thorn blows % Such, Lycidas, thy lofs to Shepherds ear.

Where were ye Nymphs when the remorfelefc deep 5°

Clos'd o're the head of your lov'd Lycidas?

For neither were ye playing on the Iteep,

Where your old Bards ', the famous "Druids > ly,

Nor on the fhaggy top of Mona high,

Nor yet where Veva fpreads her wifard flream : 55

Ay me, I fondly dream !

Had ye bin there— for what could that have don ?

What could the Mufe her felf that OrPhtns bore,

The

(78) The Mufe her felf for her inchanting fori Whom Univerfal nature did lament, When by the rout that made the hideous roar, His goary vifage down the ftream was fent, Down the fwift Hebrus to the Lesbian Chore, Alafs ! What boots it with unceffant care To end the homely flighted Shepherds trade, And ftii&ly meditate the thanklefs Mufe, Were it not better don as others ufe, To fport with Amaryllis in the fhadej Or with the tangles of Negro's hair ? Fame is the fpur that the clear fpirit doth raife ( That lad infirmity of Noble mind ) To fcorn delights, and live laborious dayes» But the fair Guerdon when we hope to find, And think to burft out into fadden blaze, Comes the blind Fury with th'abhorred (hears, And flits the thin (pun life. But not the praife, Thxbus repli'd, and touch'd my trembling ears , Fame is no plant that grows on mortal foil, Nor in the gliftering foil Set off to th' world, nor in broad rumour lies, But lives and fpreds aloft by thofe pure eyes, And peifet witnes of all-judging Jove >

60

65

70

75

80

As

36 Damxtas] Damwtas] Dametas hear]] heare 37 O]] oh gon,]] gone, 38 gon,]] gone, 39 Shepherd,]] fhepherds, Woods,] ] woods, Caves,] ] caves 40 wilde] ] wild Thyme] ] thyme Vine] ] vine o'regrown, ] ] oregrown, 42 Willows,] ] willows Hazle Copfes] ] hafil-copfes green,] ] green 43 feen,] ] feen 44 Leaves] ] leaves 45 Canker] ] canker Rofe,]] rofe, 46 Taint-worm]] taint-worm Herds]] herds

47 Froft]] froft Flowers,]] flowers wardrop]] wardrobe

48 White Thorn] White thorn] white-thorn blows;]] blowes;

49 lofs] ] loffe Shepherds] ] fhepherds ear.] ] eare. 50 This line is not indented in 1638. Nymphs] ] Nimphs remorfelefs] ] remorfeleffe 51 o're] ] ore lov'd] ] lord 53 your] ] the Bards,]] Bards Druids,] Druids]] ly,] ] lie 54 fhaggy] ] fhaggie 56 Ay] ] Ah 57 bin] ] been don?] ] done?

59 felf] felf,] ] fon] ] fonne? 60 Univerfal] ] univerfall 61 roar,] ] rore 63 Lesbian] Letbian] Lesbian 64 1638 does not indent. What] ] what 65 end] tend] tend Shepherds] ] fhepherds 66 ftrictly] ] ftridly thanklefs] thankles] thankleffe Mufe,]] Mufe? 67 don]] done ufe,]] do, 69 Or with]] Hid in Nexrd's] ] Columbia text and note are both wrong, fpurre raife] ] raife, 71 infirmity] ] noble 73 Guerdon] ] guerdon when] ] Furie 76 thin fpun] thin-fpin] ] life.] ] Phebus ears;] ] eares. 78 grows] ] growes mortal] ] mortall 79 gliftering] ] gliftring 80 lies,] ] lies; 81 lives]] lives, fpreds]] fpreads eyes,]] eyes 82 perfet] ] perfect witnes] ] witneffe all-judging] Columbia note is wrong on 1645. all-judging] ] Jove;] ] Jove:

Neera's 70 fpur] infirmitie Noble] where 75 Fury] life; 77 Phoebus]

54

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(79)

Ashe pronounces laftly on each deed,

Of fo much fame in Heav'n expeft thy meed.

O Fountain Artthufe> and thou honour'd floud, Smooth-Aiding M'mcm, crown' d with vocal reeds, That (train I heard was of a higher mood i But now my Oat proceeds, Andliftens to the Herald of the aea That came in Neptune's plea, He ask'd the Waves, and ask'd the Fellon Winds, What hard mifhap hath doom'd this gentle fwain ? And queftion'd every guft of rugged wings That blows from off each beaked Promontojry i They knew not of his ftory, And fage Hippotades their anfwei brings, That not a blaft was from his dungeon ftray'd, The Air was calm, and on the level brine, Sleek Panope with all her fitters play'd. It was that fatal and perfidious Bark Built in th'eclipte, and rigg'd with curfes dark, That Gink fo low that (acred head of thine.

Next Camus, reverend Sire, went footing flow. His Mantle hairy, and his Bonnet fedge, Inwrought with figures dim, and on the edge Like to that fanguine flower infciib'd with woe.

85

90

95

ioo

105

Ah J

Ah -, Who hath reft (quoth he; my dearer! pledge t

Laft came, and laft did go,

The Pilot of the Galilean lake,

Two maffy Keyes he bore of metals twain, i io

(The Golden opes, the Iron (huts amain)

He (hook his Miter'd locks, and (km befpake,

How well could I have fpar'd for thee, young fwain,

Anow of fuch as for their bellies fake,

Creep and intrude, and climb into the fold > 115

Of other care they little reck'ning make,

Then how to fcramble at the (hearers feaft,

And (hove away the worthy bidden gueft*,

Blind mouthes ! that fcarce themfetves know how fo hold

A Sheep-hook, or have learn'd otrght els the lead 120

That to the faithfull Herdmans art belongs !

What recks it them ? What need they ? They are fped •,

.And when they lift, their lean and flamy fongs

Grate on their fcranncl Pipes of wretched draw,

The hungry Sheep look up, and are not fed, 125

But fwoln with wind, and the rank mift they draw,

Rot inwardly, and foul contagion Tpread :

Befides what the grim Woolf wich privy paw

Daily devours apace, and nothing fed,

But

84 Heav'n] ] heav'n 85 1638 does not indent. O] ] Oh

Fountain] ] fountain 86 vocal] ] vocall reeds,] ] reeds;

87 mood:] ] mood. 88 Oat] Oate] oat 89 Herald] ] herald

Sea] ] fea 90 Neptune's] ] Neptunes plea,] ] plea.

91 Waves,] ] waves, Fellon] ] felon Winds,] winds,] ]

93 wings] wings,] ] 94 blows] ] blowes Promontory;] ]

Promontorie: 95 ftory,] ] ftorie; 97 ftray'd,] ] ftray'd;

98 Air] Ayr] aire brine,] ] brine 99 play'd.] ] play'd:

100 fatal] fatall] ] Bark]] bark, 103 1638 does not indent.

Camus, reverend Sire,] ] Chamus (reverend fire) 104 Mantle] ]

mantle hairy,] ] hairie, Bonnet] ] bonnet 106 woe.] ] wo: The

catchword is correctly Ah! but the first word on the next page

is Ah; in all copies examined.

mitred 1 1 4 Anow ] ] climb] ] climbe

107 Ah;] Ah!] ] Who] ] who no maffy] ] maffie

in Golden]] golden Iron]] iron 112 Miter'd]

113 thee,] thee] thee, fwain,] fwain.] fwain,

Enough fake,] ] fake 115 intrude,] ] intrude

116 reck'ning] ] reckoning 118 gueft;] gueft.] ]

120 Sheep-hook,] ] fheephook, els] ] elfe 121 Herdmans] ]

herdmans 122 What need] ] what need They are] ] they are

123 lift,] ] lift flafhy] ] flafhie 124 Pipes] ] pipes

125 Sheep] ] fheep 128 grim] ] grimme Woolf] ] wolf

129 devours]] devoures nothing]] little fed,]] said.

LYCIDAS— 1673

55

(81)

But chat two-handed engine at the door, 130

Stands ready to fmite once, and finite no more.

Return Alpbeue, the dread voice is paft, That (hrunk thy dreams i Return Sicilian Mufe, And call the Vales, and bid them hither caft Their Bells, and Flourets of a thoufand hues. 135

Ye valleys low where the milde whifpers ufe, Of (hades and wanton winds, and gufhing brooks, On whofe fre(h lap the fwart Star fparely looks, Throw hither all your quaint enameld eyes, That on the green terf fuck the honied (howres, 140 And purple all the ground with vernal flowres. Bring the rathe Primrofe that forfaken dies. The tufted Crow- toe, and pale Geffamine, The white Pink, and the Panfie freakt with jeat, The glowing Violet. 145

The Musk-rofe,and the well att it 'd- Woodbine, With Cowflips wan that hang the penfive head, And every flower that fad embroidery wears : Bid Amaranths all his beauty (hed, And Daftadillies fill xheir cups, with tears, 150

To ftrew the Laureat Herfe where Lycid lies. For fo to interpofe a little eafe,

Let our frail thoughts dally with falle furmife.

F Ay

(8*)

Ay me ! W hilft thee the Chores, and founding Seas

Warn far away, where ere thy bones are hurl'd, 155

Whether beyond the ftormy Hebrides

Where thou perhaps under the whelming tide

VihVft the bottom of the monftrous world »

Or whether thou to our moift vows deny'd,

Sleep'tt by the fable of Bellerus old, 1 60

Where the great vifion of the guarded Mount

Looks toward Namancos and Bayonas hold v

Look homeward Angel now, and melt with ruth.

And, O ye Dolphins, waft the haples youth.

Weep no more, woful Shepherds weep no more, 165

For Lycidas your forrow is not dead,

Sunk though he be beneath the watry floar,

So finks the day- ftar in the Ocean bed,

And yet anon repairs his drooping head,

And tricks his beams, and with new fpanglcd Ore, 170

Flames in the forehead of the morning sky :

So Lycidas funk low, but mounted high,

Through the dear might of him that walk'd the waves

Where other groves, and other dreams along,

With Nettar pure his oozy Lock's he laves, 175

And hears the unexpreflive nuptial Song,

In the bled Kingdoms meek of joy and love.

There

130 door,] ] doore, 131 fmite no more.] ] fmites no more.

132 Return] ] Return, paft,] ] paft 133 Return] ] return,

134 Vales,]] vales, 135 Bells,] Bels,] bells, Flourets]] flowerets 136 low] ] low, milde] ] mild ufe,] ] ufe 137 winds,] ] winds 138 Star] ] ftarre 139 enameld] ] enamell'd 140 terf]] turf 141 vernal]] vernall flowres.]] flowers. 142 Primrofe] ] primerofe dies.] ] dies,

143 Crow-toe,]] crow-toe, Geffamine,]] geffamine,

144 Pink,] ] pink, Panfie] ] panfie 145 Violet.] ] violet, 146 Musk-rofe,]] musk-rofe, well attir'd] ] well-attir'd Woodbine,] ] wood-bine, 147 Cowflips] ] cowflips head,] hed,] head, 149 Amarantus] Amaranthus]}

150 Daffadillies ] ] daffadillies 151 Laureat] ] laureat Herfe] ] herfe 153 furmife.]] furmife;

154 Whilft] ] whil'ft fhores,] ] fhores Seas] ] feas 155 far] ] farre hurl'd,] hurld,] hurl'd, 1 56 Hebrides ] Hebrides, ] ] 157 whelming] ] humming 159 vows] ] vowes deny'd,] ] deni'd, 161 Mount] ] mount 163 ruth.] ] ruth, 164 Dolphins,] ]

dolphins, haples] ] hapleffe 165 woful] ] wofull Shepherds] ] fhepherds, more,] ] more; 167 floar,] ] floore: 168 day-ftar] ] day-ftarre 170 Ore,]] ore 171 sky:]] skie: 172 high,]] h'gh 173 waves] waves;] ] 175 oozy] ] oazie Lock's] ] locks

176 hears] ] heares nuptial] nuptiall] ] Song,] ] long;

177 This line is not in 1638.

56

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

1 80

C83>

There entertain him all the Saints above, In folemn troops, and iweet Societies That ling, and ringing in their glory move, And wipe the tears for ever from his eyes. Now Lyeidas the Shepherds weep no more j Henceforth thou art the Genius of the (hore, In thy large recompenfe, and (halt be good To all that wander in that perilous flood*

Thus fang the uncouth Swain to th' Okcsand rills. While the mil morn went out with Sandals gray, He touch'd the tender ftops of various Quills, With eager thought warbling his DoricJ^lay : And now the Sun had ftretch'd out all the hills, And now was dropt into the Weftern Bay » At laft he rofe, and twitch'd his Mantle blew J To-morrow to frefh Woods, and Paftures new*

185

fn

190

<84)

MASK

PRESENTED

AtLUDLOW-CASTLE,i«34.^.

The firft Scene difcovers a wilde Wood.

The attendant Spirit defemis or mttrs.

|Efore the flairy threshold oijovts Court My manfion is, where thofe immortal (hape Of bright aereal Spirits live infphear'd In Regions mikk of calm and Cerene Air, Above the fmoak and ftlrr of this dim fpot, 5

Which men call Earth, and with low-thoughted care Confin'd,and pefter'd in this pin- fold here, Strive to keep up a frail, and Feaverifh being Unmindfull of the crown that Vertue gives After this mortal change, 'o her true Servants Amongft the enthron'd gods on Sainted feats. Yet fom there be that by due ft'eps afpire

10

To

1 78 above, ]] above 179 troops,] ] troups Societies] ] focieties, r8i Now Lycidas] ] Now, Lycidas, Shepherds] ] fhepherds 183 Henceforth] Hence forth] Henceforth fhore,] ] fhore 185 perilous]] perillous flood.]] floud. 186 Swain]] fwain Okes] ] oaks 187 Sandals] ] fandals gray,] ] gray; 188 Quills,] ] quills, 190 Sun] ] funne 191 Weftern] ] weftern Bay;] bay;]] 192 Mantle]] mantle blew:]] blew, 193 Woods,] j woods Paftures] ] paftures The catchword A is merely a smear of ink in most but not all copies examined.

The collations that follow here are of 1673, 1645, and 1637. See also page 262ff. 1645 carries separate title-page, and letters of Lawes and Wotton, 1637 Lawes letter only. See page 264. 1 f tarry] ] ftarrie Joves] ] loves 2 immortal] ] immortal!

fhape ?] fhapes] ] It is possible that 1673 'intended to read fhapes and that final s was knocked off the end of the line; some existing copy may read fhapes but no copy examined reads other than fhape though all but one or two carry a badly bat- tered e. 3 aereal] aereal] aereall 4 milde] ] mild calm]] calme Air,] Ayr,] aire, 5 fmoak] ] fmoake ftirr] ] ftirre fpot,]] fpot 8 keep]] keepe frail,]] fraile Feaverifh] ] feaverifh 9 Unmindfull] ] Vnmindfull crown] ] crowne 10 mortal] ] mortall change,] ] change 12 fom] ] fome

A MASK (COMUS) — 1673

57

(85) To lay their jua hands on that Golden Key That ope's the Palace of Eternity : To fuch my errand is, and but for (uch, 15

I would not foil theb pure Ambrofial weeds, With the rank vapours of this Sin-worn mould.

But to my task- Neptune befides the fway Of every fait Flood, and eacbebbing ftrcam, Took in by lot 'twixt high, and neather Jove, 20

Imperial rule of all the Sea-girt lies That like to rich, and various genoms inlay The unadorned boofom of the Deep, Which he to grace his tributary gods By courfe commits to feveral government, 2 5

And gives them leave to wear their Saphire crowns, And weild their little tridents, but this lie The greateft, and the beft of all the main He quarters to his biu-hair'd deities, And all this tra# that fronts the falling Sun 30

A noble Peer of mickle truft, and power Has in his charge, with tempered awe to guide An old, and haughty Nation proud in Arms : Where his fair orT-fpring nurs't in Princely lore, Are coming to attend their Fathers ftate, 35

And newentrufted Scepter, but their way

F 3 Lies

(86)

Lies through the perplex't paths of this drear Wood,

The nodding horror of whofe (hady brows

Threats the forlorn and wandring Paffinger.

And here their tender age might fuffer peril, 40

But that by quick command from Soveran Jove

I was difpatcht for their defence, and guard >

And liften why, for I will tell you now

What never yet was heard in Tale or Song

From old, or modern Bard in Hall, or Bowr. 45

Bacchus that firft from out the purple Grape,

CrufiVt the fweet poyfon of mif-ufed Wine

After the Tufcan Mariners transferred

Coafting the Tyrrhene (here, as the winds lifted,

On Circes Hand fell (who knows not Circe 50

The daughter of the Sun > Whofe charmed Cup

Whoever tafted, loft his upright (hape,

And downward fell into a groveling Swine)

This Nymph that gaz'd upon his cluftring locks,

With Ivy berries wreath'd, and his blithe youth, 55

Had by him, ere he parted thence, a Son

Much like his Father, but his Mother more,

Whom therefore (he brought up and Comits nam'd,

Who ripe, and frolick of his full grown age,

Roaving the Celtick, and Iberian fields, 60

At

13 Golden Key] ] golden key 14 Palace] ] palace Eternity:] ] /Eternity: 15 fuch] fnch] fuch 16 foil] ] foile Ambrofial] ] ambrofial weeds,]] weeds 17 rank]] ranck Sin-worn]]

Sin-worne 19 ftream,] Stream,] Streame 20 Took] ] Tooke by] ] my Jove,] ] love 23 boofom] ] bofome Deep,] ] Deepe, 24 tributary] ] tributarie 25 feveral] feverall] ] government,] goverment,] government 26 wear] ] weare 28 main] ] maine 31 Peer] ] Peere 33 haughty] ] haughtie Arms:] ] Armes: 34 fair] ] faire lore,] ] lore 35 coming] ] comming 36 Scepter,] ] ] Columbia note is wrong.

37 drear] ] dreare Wood,] ] wood, 38 fhady] ] fhadie

39 forlorn] ] forlorne 40 peril,] peril!, ] perill 41 Soveran] ]

Soveraigne Jove] ] love 42 guard;] ] guard, 43 you] ye] yee

45 modern] ] moderne Hall,] ] hall, JBowr.] ] bowre.

46 Grape,] ] Grape 47 Crufh't] ] Crufh t Most copies 1637 show no mark between h and t but Harvard, British Museum 1 61. d. 72, and Morgan copies show a small, faint apostrophe. All copies examined have space. 49 Coafting] ] Coafting, 50 knows] ] knowes 51 Whofe] ] whofe 52 tafted,] ] tafted 53 groveling] ] grovling 54 locks,] ] locks 55 Ivy] ] Ivie blithe] ] blith youth,] ] youth 58 therefore] therfore] therefore 59 grown] ] growne age,] ] age 60 fields,] ] fields

58

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(87)

At laft betakes him to this ominous Wood,

And in thick fhelter of black (hades imbowr'd,

Excells his Mother at her mighty Art,

Oifring to every weary Traveller,

His orient Liquor in a Oyftal Glafs, 65

To quench the dreuth of Phoebus, which as they tafte

(For moft do tafte through fond intemperate thirft)

Soon as the Potion works, their human count'nance,

Th'exprefs refemblance of the gods, is chang'd

Into Com brutifli form of Woolf, or Bear, 70

Or Ounce, or Tiger, Hog, or bearded Goat,

All other parts remaining as they were,

And they, fo perfect is their mifery,

Not once perceive their foul disfigurement,

But boaft themfelves more comely then before 75

And all their friends, and native home forget

To roule with pleafure in a fenfual (lie.

Therefore when any favour'd of high Jwet

Chances to pafs through this adventrous glade,

Swift as the Sparkle of a glancing Star, 80

I^hoot from Heav'n to give him fafe convoy,

As now I do : But firft I muft put off

Thefe my skie robes fpun out of Iris WoorT,

And take the Weeds and Hkcnes of a Swain,

F 4 That

85

90

(88) That to the fervice of this houfe belongs. Who with hisfoft Pipe, and fooooth dirtied Song. Well knows to ftill the wilde winds when they roar, And hum the waving Woods, nor of left faith, And in this office of his Mountain watch, Likelieft, and neareft to the prefent ayd Of this occaflon. But I hear the tread Of hatefull fteps, I muft be viewlcs now.

Comus enters with a Charming Rod in one hand, his Glafs in the other, with him a rout of Mon* fters, headed likefundry forts, of wilde Beafis, hut otherwife like Men and Women , their Af- farel glijlering, they come in making a riotous and unruly noife, with torches in their hands*

Comus. The Star that bids the Shepherd fold.

Now the top of Heav'n doth hold,

And the gilded Car of Day,

His glowing Axle doth allay

In the fteep Athmick^ ftream,

And the flope Sun his upward beam

Shoots againft the dusky Pole,

Pacing toward the other gole

Of his Chamber in the Eaft.

Mean while welcom Joy, and Fsaft,

Midnight

95

100

61 Wood,] ] wood, 62 imbowr'd,] ] imbowr'd 63 mighty] ] mightie Art,] ] Art 64 weary] ] wearie Traveller,] Travailer,] Travailer 65 Liquor] liquor]] Cryftal] ] Chryftall Glafs,] Glaffe,] glaffe 66 tafte] ] taft 67 do] ] doe tafte] ] taft

68 Soon] ] Soone human] ] humane count'nance,] ] count'nance

69 exprefs] ] expreffe gods,] ] gods 70 fom] ] fome form] ] forme Woolf,] ] Wolfe, Bear,] ] Beare 73 is] ] in mifery,] ] miferie, 74 foul] ] foule 76 friends,] ] friends; 77 fenfual] ] fenfuall 78 Therefore] Therfore] Therefore Jove,] ] love 79 pafs] paffe] ] 80 Star,] Star,] Starre 81 fhoot] ] fhoote Heav'n] ] heav'n give] ] giue 82 do:] ] doe: But] ] but

83 Wooff,] ] wooffe, 84 Weeds] ] weeds likenes] ] likeneffe Swain,] ] Swaine,

86 fmooth dittied] fmooth-dittied] ] Song.] Song,]] Certainly should be Song, as in both 1637 and 1645, as Columbia note and text are wrong. 87 wilde] ] wild roar,] ] roare, 88 Woods,] ] woods, lefs] leffe] ] 89 Mountain] ] Mountaine 90 neareft] neereft] ] ayd] ] aide 91 hear] ] heare 92 viewles] ] viewleffe Stage directions. 1 Rod] ] rod 2 Glafs] ] Glaffe 3 Monfters,] ] There was probably a comma here in 1637; but in none of the 10 copies examined was it clear, although in the Morgan Library copy it is almost certain. 4 Apparel] ] apparell 5 glittering,] gliftring, ] ] come] com] come

93 Star] ] ftarre Shepherd] ] Shepheard fold.] fold,] ]

94 Heav'n] ] heav'n 95 Car] ] Carre Day,] ] Day 96 allay] ] allay, 97 fteep] ] fteepe Atlantick] ] Atlantik ftream,] ] ftreame, 98 beam] ] beame 99 dusky] ] duskie 102 Mean] ] Meane welcom] ] welcome

A MASK (COMUS) — 1673

59

(B9)

Midnight (hour, and revelry,

Tipfie dance, and Jollity.

Braid your Locks with rofic Twine

Dropping odours, dropping Wine.

Rigor now is gon to bed,

And Advice with (crapulous head,

Strict Age, and (bwre Severity,

With their grave Saws in (lumber lie.

We that are of purer fire

Imitate the Starry Quire,

Who in their nightly watchfull Sphears,

Lead in fwift round the Months and Years.

The Sounds, and Seas with all their finny drove

Now to the Moon m wavering Morrice move,

And on the Tawny Sands and Shelves,

Trip the pert Fairies and the dapper Elves >

By dimpled Brook, and Fountain brim,

The Wood- Nymphs deckt with Paifies trim,

Their merry wakes and paftimes keep :

What hath night to do with deep?

Night hath better fweets to prove,

Venus now wakes, and wak'ns Love.

Com let us our rights begin,

*Tis onely daylight that makes S»w

105

no

115

120

125

Which

0°)

Which thefe dun fhad«s will ne're report,

Hail Goddefs of Nocturnal (port

Park vail'd Cotytto, t'whom the fecrct flame

Of mid-night Torches burns i myflerious Dame 130

That ne're art calPd, but when the Dragon woom

Of Stygian darknefs (pets her thickeft gloom,

And makes one blot of all the air,

Stay thy cloudy Ebon chair,

Wherin thou rid' ft with Heccaf, and befriend 135

Us thy vow'd Priefts, till utmoft end

Of all thy dues be done, and none left out,

Ere the blabbing Eaftern fcout,

The nice Morn on th' Indian deep

From her cabin'd loop-hole peep, 140

And to the tell-tale Sun difcry

Our conceal'd Solemnity.

Com, knit hands, and beat the ground,

In a light fantaftick round.

the Meafare.

Break off, break off, I feel the different pace, Of fom chart footing near about this ground. Run to your (hrouds, within thefe Brakes and T^ees, Our number may affright : Some Virgin fure

145

(For

103 revelry,] ] revelrie, 104 Jollity.] ] follitie. 105 Twine] ] Twine, 107 gon] ] gone 109 Severity,] ] Severitie no grave]] graue Saws]] Sawes lie.] ly.] lie. m fire]] fire, 112 Imitate] ] Immitate Starry] ] ftarrie Quire,] ] quire, 113 Sphears,] ] Speares, 114 Years.] ] Yeares. 115 finny] j finnie drove]] drove, 116 Moon]] Moone 117 Tawny]] tawny Sands]] fands Shelves,]] f helves, 119 Brook,]]

Brooke, Fountain] ] Fountaine 120 Wood-Nymphs] ] Wood-nymphs Dailies trim,] ] daifiestrim, In 1645, this line, at bottom of page 80, is usually out of line, but is straight in a few copies. 121 wakes] ] wakes, keep:] ] keepe, 122 do] ] doe fleep?] ] fleepe? 124 wak'ns] ] wakens 125 Com] ] Come begin,]] begin 126 'Tis] Tisl 'Tis

127 report,] report.] ] 128 Hail] ] Haile Goddefs] Goddeffe] ] Nocturnal] ] Nocturnall 129 Dark vail'd] Dark vaild] Dark-vaild 130 burns;]] burnes; 131 art]] at woom]] woome 132 darknefs] ] darkneffe gloom,] ] gloome 133 air,] ayr,] aire, 134 cloudy] ] clowdie Ebon] ] Ebon chair,] ] chaire,

135 Wherin] ] Wherein HeccaV,] Hecat',] ] But see 1673 errata.

136 Us] ] Vs Not in Columbia notes. 137 dues] ] ] Columbia note is wrongL out,] ] out 138 Eaftern] ] Eafterne fcout,] ]

] Morne fteep] ] fteepe 140 loop-hole] peepe, 141 tell-tale] tel-ta!e] ] beat]] beate ground,]] ground break] ] breake feel] ] feele pace,] ] pace

146 fom] ] fome near] neer] neere ground.] ground, Very clear as comma in some 1645 copies, but looks like period in others.] ]

147 Brakes] ] Brakes, Trees,] ] Trees 148 Some] Som] Some

fcout 139 Morn] loop hole] ] peep,] 143 Com,] ] Come, 145 Break] ] Breake

60

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(90

(For to I can diftinguifh by mine Art)

Benighted in thcfc Woods. Now to my charms, 150

And to my wily trains, I (hall e're long

Be well fiock't with as fair a herd as grai'd

About my Mother Circe. Thus I hurl

My dazling^pells into the fpungy ayr,

Of power to cheat the eye with blear illufion, 155

And give it falfe prefentments, left the place

And my quaint habits breed aftonifhraent,

And put the Damfel to fufpicious flight,

Which muft not be, for that's againft my courfe ;

I under fair pretence of friendly ends, ^0

And well plac't words of globing courtefie

Baited with reafons not uftplaufible

Wind me into the eafie-hearted man,

And hug him into fnares. When once her eye

Hath met the vertue of this Magick duft. 165

I (hall appear fome harmles Villager

And hearken, ifl may, her bufines here.

But here (he comes, I fairly ftep afide

The Lady enters.

This way the noife was, if mine ear be true,

My beft guide now, me thought it was the found 170

Of Riot, and ill manag'd Merriment,

Such

(90 Such as the jocond Flute, or gamefom Pipe Stirs up among theloofe unletter'd Hinds, When for their teeming Flocks, and granges full In wanton dance they praife the bounteous fan-, And thank the gods amifs. I (hould be loath To meet the rudenets, and fwill'd infolence Of fuch late Waflailers i yet O where els Shall I inform my unacquainted feet In the blind mazes of this tangl'd Wood ? My Brothers when they faw roe wearied out With this long way, refolving here to lodge Under the fpreading favour of thefe Pines, Stept as they fe'd to the next Thicket fide To bring me Berries, or fuch cooling fruit As the kind hofpitable Woods provide. They left me then, when the gray-hooded Eev'n Like a fad Votarift in Palmers weed Rofe from the hindmoft wheels of Tbtzbut wain. But where they are, and why they came not back, Is now the labour of my thoughts, 'tis likelieft They had ingag'd their wandring fteps too far, And envious darknes, e're they could return, Had ftole them from me, els O theevifli Night Whyfhouldft thou, butforfom fellonious end,

175

180

185

190

195 In

150 Woods.]] woods, charms,]] charmes 151 wily]] wilie 152 fair] ] faire herd] ] Heard 153 hurl] ] hurle 154 fpungy]] fpungie ayr,]] aire 155 cheat]] cheate blear]] bleare 157 quaint] ] queint 160 fair] ] faire pretence] ] praetents

161 well] ] wel 163 eafie-hearted] ] eafie hearted 164 hug] hugg] hug fnares.] ] fnares; When] ] when 165 duft.] duft,] ]

166 appear] ] appeare fome] fom] fome harmles] ] harmleffe

167 For this line, 1637 reads 'Whom thrift keepes up about his Country geare' and 1645 'Whom thrift keeps up about his Country gear,' and 1673 omits, but 'errata sheet calls for hear at end of this line, bufines] ] bufineffe And no comma after may according to 1673 errata, although 1637, 1645, and 1673 all have may,. In next line, there is no punctuation after afide in 1637, 1645, or 1673. Stage direction. Lady) ] Ladie

169 ear] ] eare true,] ] true

172 gamefom]] gamefome 173 unletter'd] unleter'd]] Hinds,] ] Hinds 176 thank] ] thanke amifs.] ] amiffe. 177 rudenefs,] rudeneffe,] ] 178 O] ] 6 els] ] elfe 179 inform] ] informe 180 tangl'd] ] tangled Wood?] ] wood? 183 Under] ] Vnder Pines,] ] Pines 186 Woods] ] woods

187 Eev'n]] Ev'n 188 weed]] weeds 189 wain.]] waine. 190 back,] ] back 193 darknes,] ] darkneffe, return,] ] returne, 194 ftole] ] ftolne els] ] elfe O] ] 6 195 fom] ] fome end, ] ] end

A MASK (COMUS) — 1673

61

(93)

In thy dark Lantern thusclofe up the Stars, That nature hung in Heav'n, and fill'd their Lamps With everlafting oil, to give due light To the mifled and lonely Traveller > This is the place, as well as I may guefs, Whence eev'n now the tumult of loud Mirth Was rife, and perfet in my lift'ning ear, Yet nought but fingle darknes do I find. What might this be > A thoufand fantafies Begin to throng into my memory Of calling (hapes, and beckning (hadows dire, And airy tongues, that fy liable mens names On Sands, and Shoars, and defert Wilderneflcs. Thefe thoughts may ftartle well, but not aftound The vertuous mind, that ever walks attended By a ftrong fiding champion Confcience. -

0 welcompure-ey'd Faith, white-handed Hope, Thou hovering Angel girt with golden wings, And thou unblemifh't form of Chaftity,

1 fee ye vifibly, and now believe

That he, the Supreme good, t'whom all things ill Are but as flavilh officers of vengeance, Would fend a gliftring Guardian if need were To keep my life and honour unaffail'd.

200

205

210

215

Was

(?4)

Was 1 deceived, or did a fable cloud Turn forth her filver lining on the night ? I did not err, there does a fable cloud Turn forth her diver lining on the night, And cads a gleam over this tufted Grove. I cannot hallow to my Brothers, but Such noife as I can make to be heard fartheft He venter, for my new enliv'nd fpirits Prompt me > and they perhaps are not far off.

SONG. Sweet Eeho.fweeteft Nymph that livft tmfcen Within thy airy fit til By flow Meander'/ margent green. And in the violet imbroider'd vale

Where the lovelorn Nightingale Nightly to thee her fad Song mourneth well. Cauft thou not tell me of a gentle Pair That lik$ thy NarcifTus are .?

O if thou have Hid them infomflowry Cave, Tell me but where Sweet gueen of Farly, Daughter of the Sphear9 So mjiji thou he tranflsted to the s\qesy And give refomding grace ts all Heav'nt HafmonUt,

220

225

230

235

240

£*fr

196 dark]] darke Lantern] lantern] lanterne 197 Lamps]] lamps 198 oil,]] oile 199 mifled]] mifled, Traveller?] Travailer?] Travailer. 200 guefs, ] ] gueffe 201 eev'n] ] even

202 perfet] ] perfect lift'ning] ] liftening ear,] ] eare,

203 darknes] ] daricneffe do] ] doe find.] ] find, 204 A] ] a 205 memory] ] memorie 207 airy] ] ayrie 212 welccm] ] welcome Hope,] ] Hope 1645 reads 'pure-ey'd Faith,' as do 1637 and 1673; Columbia note is wrong. 213 hovering] 1 flittering 214 form] ] forme Chaftity,] ] Chaftitie 215 ye] ] yee believe] beleeve] ] 217 vengeance,] ] vengeance

219 keep] ] keepe life] ] life,

221 Turn] ] Turne 222 err,] ] erre, fable] ] fables 223 Turn]] Turne night,] ] night 224 gleam] ] gleame 226 fartheft] ] fardeft 228 far] ] farre SONG.] ] Song. 229 Echo,] ] echo, unjeen] ] unfeene 230 airy] ] ayrie 231 Meander's] Meander's] ] green,] ] greene, 232 violet imbroider'd] violet-imbroider'd Columbia notes miss the faint 1645 hyphen.] ] 233 love-lorn] ] love-lorne 234 Note space below this line in 1637 for new stanza. 235 Pair] ] Paire 238 fom] ] fome flowry] ] flowrie 240 Parly,] ] Parlie, Sphear,] ] Sphxre,

62

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(95)

Com. Can any mortal mixture of Earths mould

Breath fuch Divine inchanting ravifhment ?

Sure fomthing holy lodges in that bred, 245

And with thefe raptures moves the vocal air

To teftifie his hidd'n refidence >

How fweetly did they float upon the wings

Of filence, through the empty-vaulted night

At every fall fmoothing the Raven doune 250

Of darknes till it fmil'd : I have oft beard

My Mother Circe with the Sirens three.

Amid 'ft the flowry-kirtPd Naiadet

Culling their potent hearbs, and balefull drugs,

Who as they fung, would take the prifon'd foul, 255

And lap it in Elyftum, Scylla wept,".

And chid her barking waves into attention,

And fell Charybdis murmur'd foft applaufe :

Yet they in plcafing (lumber lulFd the fenfe,

And in fweet madnes robM it of it (elf, 260

But fuch a facred, and home-felt delight,

Suchfober certainty of waking bli(s

I never heard till now. He fpeak to her

And (he (hall be my Qoeen. Hail forren wonder

Whom certain thefe rough (hades did never breed 265

UnlcG the Goddes that in rural (hiine

Dwell ft

270

275

(96)

Dweirft here with f oh, or SUvsn1 by bleft Song

Forbidding every bleak unkindly Fog

To touch the prolperous growth of this tall Wood*

La. Nay gentle Shepherd ill is loft that praifc That is addrcft to unattending Ears, Not any boaft of skill, but extreme (hift How to regain my (ever'd company Compell'd roe to awake the courteous Echo To give me anfwer from her moffie Couch.

Co. What chance good Lady hath bereft you thus ?

La. Dim daiknes, and this leavie Labyrinth.

Co. Could that divide you from neer-ufh'eiing guides?

La. They left me weary on a ^raffle terf.

Co. By falfhood, or difcour telle, or why > 280

La. To feek i'th vally fom cool friendly Spring.

Co. And left your fair fide all unguarded Lady ?

La. They were but twain, and purpos'd quick return.

Co. Perhaps fore- flailing night prevented them.

La. How eafie my misfortune is to hit ! 285

Co. Imports their lofs, befide the prefent need }

La. No lefs then if I (hould my brothers loofe.

Co. Were they of manly prime, or youthful bloom ?

La. As fmooth as Hebe's their unrazor'd lips.

Co. Two fuch 1 faw, what time the laboured Oxe 290

In

243 mortal] ] mortall 245 fomthing] ] fomething 246 air] ] aire 247 hidd'n] ] hidden 249 filence,] ] Silence, empty-vaulted] ] emptie-vaulted 250 doune] ] downe 251 darknes] ] darkneffe it] ] fhe 252 Mother] ] mother

three,] ] three 253 Amid'ft] Amidft] ] flowry-kirtPd] ] flowrie-kirtl'd 254 potent] Potent] ] drugs,] ] drugs 255 foul,] ] foule 259 fenfe,] ] fenfe 260 madnes] ] madneffe felf,] ] felfe, 262 blifs] ] bliffe 263 fpeak] ] fpeake

264 Queen.] ] Queene. Hail] ] Haile forren] ] forreine

265 certain] ] certaine 266 Unlefs] Unleffe] Vnleffe Goddes] ] Goddeffe rural] rurall] ]

268 bleak] ] bleake 269 Wood.] ] wood. 271 Ears,] ] Eares, 272 extreme] ] extreame 273 regain] ] regaine company] ] companie 276 Lady]] Ladie 277 darknes,]] darkneffe,

leavie] leavy] leavie 278 neer-ufhering] ] neere-ufhering

279 a graffie] ] agraffie terf.] ] terfe. 281 feek] ] feeke fom] ] fome cool] ] coole 282 fair] ] faire Lady?] ] Ladie? 283 and] ] & 284 prevented] ] praevented 286 lofs] ] loffe prefent] ] praefent 287 lefs] ] leffe loofe.] ] lofe. 288 bloom?] ] ] So all 1637 copies examined except Harvard's, which has no mark after 'bloom', all other copies having a bat- tered '?'. 289 Hebe's] ] Hebe's Columbia note is wrong, but the text is correct, unrazor'd] ] unrazored

A MASK (COMUS) — 1673

63

(97)

In his loofe trices from the furrow came,

And the fwink't hedger at his Supper fate »

I faw them under a green mantling vine

That crawls along the fide of yon fraall hill,

Plucking ripe clufters from the tender (hoots, 295

Their port was more then human, as they ftood >

I took it for a faery vifion

Of fom gay creatures of the element

That in the colours of the Rainbow live

And play i'th plighted clouds. I was aw- ftrook, 30o

And as I paft, I worfhipt > if thofe you feek

It were a journey like the path to Heav'n,

To help you find them. La. Gentle villager

"What readieft way would bring me to that place ?

Co. Due weft it rifes from this thrubby point. 305

La. To find out that, good Shepherd, I fuppofe,

In fuch a fcant allowance of Star-light,

Would overtask the beft Land- Pilots art,

Without the fure guefs of well-pracTiz'd feet*

Co. I know each lane, and every alley green 310

Dingle, or buftiy dell of this wilde Wood,

And every bosky bourn from fide to fide

My daily walks and ancient neighbourhood,

And if your ftray attendance be yet lodg'd,

G Or

(98) Or (hroud within thefe limits, I (hall know 3 1 5

Ere morrow wake, or the low roofted lark From her thatch't pallat rowfe, if otherwife I can conduct you Lady to a low But loyal cottage, where you may be fafe Till further queft\ La. Shepherd I take thy word, 320 And truft thy honeft offer'd courtefie, Which oft is fooner found ifi lowly flieds With fmoaky rafters, then in tapftry Halls And Courts of Princes, where it firft was nam'd, And yet is moft pretended : In a place 325

Lefs warranted then this, or lefs fecure I cannot be, that I fhould fear to change it, Eie me bleft Providence, and fquare my triall To my proportioned ftrength. Shepherd lead on. —

The two Brothers:

Eld. Bro. Un muffle ye faint Stars, and thou fair Moon

That wont ft to love the travellers benizon, 331

Stoop thy pale vifage through an amber cloud,

And difinherit Cbaos, that raigns here

In double night of darknefs, and of fhadesi

Or if your influence be quite damm'd up 335

With black ufurping mifts, fom gentle taper

Though

293 green] ] greene 296 human,] ] humaine; ftood;] ] ftood, 297 took] ] tooke faery] ] faerie 298 fom] ] fome 300 clouds.] j clouds, aw-ftrook,] ] aw-ftrooke, 301 feek] ] feeke 302 journey] ] journy Heav'n,] ] heav'n 303 help] ] helpe

305 fhrubby] ] fhrubbie 306 that,] ] that Shepherd,] ] fhepheard fuppofe,] ] fuppofe 307 Star-light,] ] ftarre light 308 Land-Pilots] ] land-pilots art,] ] art 309 guefs] ] gueffe 310 green]] greene 311 bufhy] ] bufhie wilde]] wild Wood,] ] wood, 312 bosky] ] boskie bourn] ] bourne 313 daily] ] dailie 314 lodg'd,] ] lodg'd

316 low roofted] low-roof ted Not in Columbia notes.] ] lark] ] larke 317 thatch't] thach't Not in Columbia notes.]] pallat] ] palate 318 Lady] ] Ladie 319 loyal] ] loyall 320 Shepherd] ] Shepheard 323 fmoaky] ] fmoakie tapftry] ] tapftrie Halls] ] halls 324 Courts] ] courts 325 pretended:] ] praetended: In] ] in 326 Lefs] ] Leffe lefs] ] leffe 327 fear] ] feare 328 Eie] ] Eye 329 Shepherd] ] Shepheard 330 Eld. Bro.]] Eld bro. Unmuffle] ] Vnmuffle ye]] yee faint Stars,] faintftars,] faint ftars, Moon]] moon 331 travellers] travailers] ] benizon,] ] benizon 332 Stoop] ] Stoope cloud,] ] cloud 334 darknefs,] darknes,] darkneffe, 336 fom] ] fome

64

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

t99>

Though a rufli Candle from the wicker hole Of fom clay habitation vifit us With thy long Ievejl'd rule of (teaming light, And thou (halt be our (Var of Arcady, 340

Or Tynan Cynofure. 2. Bro. Or if our eyes Be barr'd that happines, might we but hear The folded flocks pen'd in their watled cofes, Or found of paftoral reed with oaten ftops, Or whittle from the Lodge, or Village Cock 345

Count the night watches to his feathery Dames, Twouldbefom folace yet fom little cheanng In this clofe dungeon of innumerous bowes. But O that haples virgin our loft lifter Where may (he wander now, whether betake her 350 From the chill dew, amongft rude burrs and thiftlcs ? Perhaps fom cold bank is her boulfter now Or 'gainft the rugged bark of fom broad Elm Leans her unpillow'd head fraught with fad fears, What if in wild amazement, and affright, 355

Or while we fpeak within the direful gralp Of Savage hunger, Or of Savage heat f

Eld. Bra, Peace Brother, be not pver-exquifitc To caft the fafhion of uncertain evils j For grant they be fo, while they reft unknown, 360

G a What

(IOO.)

What need t man foreftall his date of grief,

And run to meet what he would moft avoid ?

Or if they be but falfe alarms of Fear,

How bitter is fuch felf-delufion ?

I do not think my lifter fo to feek, 365

Or fo unprincipl'd in vermes book,

And the fweet peace that goodnes bopfoms ever,

As that the fingle want of light and noife

( Not being in danger, as I truft (he is not )

Could ftir the conftant mood of her calm thoughts, 370

And put them into mif- becoming plight.

Vertue could fee to do what vertue would

By her own radiant light, though Sun and Moon

Were in the flat Sea funk. And Wifdoms (elf

Oft feeks to fweet retired Solitude, 375

Where with her beft nurfe Contemplation

She plumes her feathers, and lets grow her wings

That in the various busfle of refort

Were all to ruffl'd, and fomtimes impair'd.

He that has light within his own cleer breft 380

May (it i'th center, and enjoy bright day,

But he .that hides a dark foul, and foul thoughts

Benighted walks under the midday Sun >

Himfelf is his own dungeon.

2. Bm.

337 Candle]] candle 338 fom]] fome 339 light,]] light 340 ftar] ] ftarre Arcady,} ] Arcadie 341 2. Bro.) 2 Bro.]] 342 happines,] ] happineffe, hear] ] heare 345 Village Cock] village cock] ] 346 feathery] ] featherie 347 'Twould] T'would] ] fom] ] fome yet] yet,] ] fom] ] fome 349 O] ] 6 haples] ] hapleffe 351 burrs] ] burs 352 fom] ] fome bank] ] banke 353 bark] ] barke fom] ] fome Elm] ] Elme 354 fears,] fears.]] 355 affright,]] affright 356 fpeak]]

fpeake direful] direfull ] ] grafp] ] grafpe 358 Eld. Bro.]} Eld: bro. Brother,] brother,]] over-exquifite] ] over exquifite 359 uncertain] ] uncertaine 360 unknown,] ] unknowne

361 grief,] ] griefe 363 Fear,] ] Feare 364 f elf-delufion? ] ] felfe-delufion? 365 do] ] doe think] ] thinke feek,] ] feeke 366 book,] ] book 367 goodnes] ] goodneffe boofoms] ] bofoms ever,] ] ever 368 light] ] light, 370 calm] ] calme thoughts,]] thoughts 371 mif-becomirtg] ] mif-becomming

372 do] ] doe 373 own] ] owne 374 funk.] ] funke, And] ] and felf]]felfe 375 Solitude,] ] Solitude 378 busfle] ] buftle So in all copies of all three editions. Columbia text is wrong, and the only part of the note that is correct is 1645. 379 fomtimes] ] fometimes 380 own] ] owne cleer] ] cleere 382 dark] ] darke foul,] ] foule, foul] ] foule 383 Sun;] ] Sun, 384 Himfelf] ] Himfelfe Not in Columbia notes, own] 1 owne

A MASK (COMUS) — 1673

65

(101)

2. Bro, Tis mod true

That routing meditation rood arTc&s 385

The penfive fecrecy of defert cell,

Far from the cheerfull haunt of men, and herds,

And fits as Jafe as in a Senat houfe,

For who would rob a Hermit of his Weeds,

His few Books, or his Beads, or Maple Dim, 390

Or do his gray hairs any violence ?

But beauty like the lair Hefperian Tree

Laden with blooming gold, had need the guard

Of dragon watch with uninchanted eye,

To fave her bloflbms, and defend her fruit 395

From the ram hand of bold Incontinence.

You may as well fpred out>the unfun'd heaps

Of Mifers treafure by an out-laws den,

And tell me it is fafe, as bid me hope

Danger will wink on Opportunity, 400

And let a (ingle helplefs maiden pa(s

Uninjur'd in this wilde furrounding waft.

Of night, or lonelinefs it recks me not,

I fear the dred events that dog them both,

Left fom ill greeting touch attempt the perfon 405

Of our unowned lifter.

Eld. Bro* I do not, Brother,

G 3 Inferr,

(-102.)

Inferr, as if I thought my fitters ftate

Secure without all doubt, or controverfie:

Yet where an equal poife of hope and fear

D >es arbitrate th'event, my nature is 410

That I encline to hope, rather then fear,

And gladly banith (quint fufpicion.

My lifter is not fo derencelefs left

As you imagine, (he has a hidden ftrength «*

Which you remember not. 4*5

2. Bro. What hidden ftrength, Unlefs the ftrength of Heav'n, if you mean that ?

Eld. Bro. I mean that too, but yet a hidden ftrength Which if Heav'n gave it, may be term'd her own : 'Tis chaftity, my brother, chaftity : She that has that, is dad in compleat fteel, 420

And like a quiver'd Nymph with Arrows keen IVLy trace huge Forrefts, and unharbour'd Heaths, Infamous Hill?, and fandy perilous wildes, Where through the facred rayes of Chaftity, No Cmge fierce, Bandite,orMountaneer 425

Will dare to foyl her Virgin purity, Yea there, where very defolation dwels Ey grots5 and caverns lhag'd with horrid fhades, She may pafs on with unblench't majefty,

Be

384 Columbia note on 2. Bro. reading 2 Bro. is wrong. Tis] ] 'Tis 386 penfive] Penfive] ] fecrecy] ] fecrecie cell,] ] cell

387 Far] ] Farre cheerfull] ] cheerefull herds,] ] heards,

388 houfe, ] ] houfe 389 a ] ] an Weeds, ] ] weeds 390 Books, ] ] books, Beads,] ] beades, Maple] ] maple Difh,] ] difh,

391 do] ] doe 392 beauty] ] beautie fair] ] faire Tree] ] tree 394 eye,] ] eye 397 fpred] ] fpread 398 Mifers] ] mifers out-laws] ] outlaws den,] ] den 400 wink] ] winke Opportunity,] ] opportunitie 401 helplefs] ] helpleffe maiden] ] mayden pafs] ] paffe* 402 Uninjur'd] ] Vninjur'd Not in Columbia notes, wilde] ] wild 403 lonelinefs] lonelines] lonelyneffe not,] ] not 404 fear] ] feare 405 fom] ] fome. 406 do]] doe not,]] not Brother,] brother,] brother

407 Inferr,]] Inferre, 409 equal] equall]] hope]] hope,

fear] ] feare 411 fear,] ] feare 413 defencelefs] ] defenceleffe 415 ftrength,]] ftrength 416 Unlefs]] Vnleffe Heav'n,]]

heav'n, if you mean] ] if meane 417 mean] ] meane 418 Heav'n]] heav'n own:]] owne: 419 chaftity,]] chaftitie, chaftity:] ] chaftitie: 420 fteel,] ] fteele, 421 Nymph] j

nymph Arrows] ] arrowes keen] ] keene 422 Forrefts,] Forefts,] forrefts, Heaths,] ] heaths 423 Hills,] ] hills, fandy] ] fandie perilous] ] perillous wildes,] ] wilds 424 rayes] ] rays Chaftity,] ] chaftitie 425 Bandite,] ] bandite, Mountaneer] mountaneer] mountaneete 426 foyl] ] foyle

Virgin] ] virgin purity,] ] puritie 427 dwels] ] dwells 428 fhades,] ] f hades 429 pafs] ] paffe majefty,] ] majeftie

66

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(103)

Be it not don in pride, or in prefumption. 43°

Som fay no evil thing that walks by night

In fog, or fire, by lake, or moorifh fen,

Blew meager Hag, or ftubborn unhid ghoft,

That breaks his magick chains at curfeu time,

No Goblin, or fwart Faery of the mine, 435

Hath hurtfull power o'rc true Virginity.

Do ye believe me ycfj or fliall I call

Antiquity from the old Schools of Greece

To teftifie the arms of Chaftity >

Hence had the huntrefs Vian her dred bow 44o

Fair filver-fhafted Queen for ever chafte,

Wherewith (he tam'd the brinded lionefs

And fpotted mountain pard, but fet at nought

The frivolous bolt of Cupid, gods and men

Fear'd her ftern frown, and (he was queen cth'Woo4s.445

What was that thi ky-headect Gorgon fheild

That wife Minerva wore, unconquer'd Virgin,

Wherwith (he freez'd heir foes to corigeal'd (tone?

But rigid looks of Chaft aufterity,

And noble grace that dauYc brute violence 450

With fudden adoration, and blank aw.

So dear to Heav'n is Saintly chaflity,

That when a foul is found fincerely fo,

G 4. A

A thoufand liveried Angels lacky her, Driving far off each thing of fin and guilt, And in cleer dream, and folernn vifion Tell her of things that no grofs ear can hear, Till oft convers with heav'nly habitants Begin to cad a beam on th'outward (hape, The unpolluted temple of the mind, And turns it by degrees to the fouls efTence, Till all be made immortal ; but when luff By unchafte looks, loofe geftures, and foul talk, But mod by leud and lavifh ad of (in, Lets in defilement to the inward parts, The foul grows clotted by contagion, Imbodies, and imbrutes, till (he quite loofe The divine property of her firft being. Such are thofe thick and gloomy (hadows damp Oft feen in Charnel vaults, and Sepulchers Lingering, and fitting by a new made grave, As loath to leave the Body that it lov*d, And link't it felf by carnal fenfuality To a degenerate and degraded (late.

2. Bro, How charming is divine Philofophy ! Not hatfli, and crabbed as dull fools fuppofe, But muiical as is Apollo s lute,

455

460

465

470

475

And

430 don] ] done 431 Som] ] Some evil] ] evill 432 fen,] ] fen 433 Hag,] ] hag, ftubborn] ] ftubborne unlaid] ] unlayd ghoft,] ] ghoft 434 magick] ] magicke chains] ] chaines curfeu) ] curfeu time,] ] time 435 Goblin,] ] goblin, Faery] ] Faerie mine,] ] mine 436 Hath] ] Has o're] ] ore Virginity.] virginity.] ] 437 Do]] Doe ye]] yee believe] beleeve] ] 438 Schools]] fchools Greece] Greece]] 439 arms]] armes Chaftity?]] Chaftitie? 440 huntrefs] ] huntreffe 441 Fair] ] Faire Queen]] Queene chaf te, ]] chaft 442 Wherewith] Wherwith] Wherewith fhe] ] we lionefs] ] lioneffe 443 mountain] ] mountaine

445 ftern] ] fterne frown,] ] frowne and] ] & Woods.] ] woods.

446 fnaky-headed ] ] fnakie headed 447 Virgin,] ] virgin 44$ Wherwith] ] Wherewith 449 aufterity,] ] aufteritie 451 blank] ] blancke 452 dear] ] deare Heav'n] ] heav'n Saintly] ] faintly chaftity,] ] chaftitie 453 foul] ] foule

454 Angels] ] angels lacky] ] lackie her,] ] her 455 far] ] farre fin] ] finne, 456 cleer] ] cleere dream,] ] dreame, folemn] ] folemne 457 of things] ] ofthings grofs] ] groffe ear] ] eare hear,] ] heare, 458 convers] ] converfe 459 beam] ] beame fhape,] ] fhape 460 mind,] ] mind 461 turns] ] turnes ef fence,] ] effence 462 be] ] bee immortal:] ] immortall; 463 unchafte j < unchaft foul] ] foule talk,] ] talke 464 leud] ] leud, fin,] ] fin 466 foul] ] foule grows] ] growes 468 property] ] propertie 469 thick] ] thick, gloomy] ] gloomie 470 feen] ] feene Charnel] Charnell]] 471 Lingering,]] Hovering, grave,]]

grave 472 Body] body] ] 473 felf] ] felfe carnal] ] carnall fenfuality] fenfualty] fenfualitie 475 2. Bro.] ] 2 Bro. Philofophy!] ] Philofophie! 477 mufical] ] muficall Apollo's] ] Apollo's

A MASK (COMUS) — 1673

67

(105)

And a perpetual feaft of ne&ar'd fweets,

Where no crude furfet raigns. Eld. Brc. Lift, lift, I heat

Som far of hallow break the filent Air. 480

2. Bro. Me thought fo too > what fhould it be ?

E/<£ Br<?. For certain Either fom one like us night-foundcr'd here, Or els fom neighbour Wood-man, or at worft, Som roaving Robber calling to his fellows.

2. Bro. Heav'n keep my fifter, agen, agen, and neer,485 Beft draw, and (land upon our guard.

Eld. Bro. He hallow, If he be friendly he comes well, if not, Defence is a good caufe, and Heav'n be for us.

the attendant Spirit habited lily a shepherd.

That hallow I mould know, what are you ? fpeak » Com not too neer, you fall on iron ftakes elfe. 490

Spir. What voice is thaf,my young Lord? fpeak agen.

2. Bro. O brother, 'tis ray father Shepherd fure.

Eld. Bro. 7byrfis .? Whofe artful ftrains have oft delaid

The hudling brook to hear his madrigal,

And fweetn'd every muskrofe of the dale, 495

How cam'ft thou here good Swain ? hath any Ram

flipt from the fold, or young Kid loft his dam,

Or

Or ftraggling Weather the pen't flock fortbbk ? How couldft thou find this dark iequefter'd nook >

Spir. O my lov'd Matters heir, and his next joy, 500 I came not here on fuch a trivial toy As a ftray'd Ewe, or to purfue the fteahh Of pilfering Woolf, not all the fleecy wealth That doth enrich thefe Downs, is worth a thought To this my errand, and the care it brought. 505

But O my Virgin Lady, where is flic ? How chance {he is not in your company )

Eld. Bro. To tell thee fadly Shepherd, without Blame, Or our negledr, we loft ber as we came.

Spir. Aytne unhappy then my fears are true. 510

ELBro, What fears goodfhyrfu ? Prethee briefly (hew.

Spir. Ik tell ye, 'tis not vain or fabulous, (Though fo cfteem'd by (hallow ignorance) What the fage Poets taught by th'heav'nly Mute, Storied of old in high immortal vers 515

Of dire Chimera's and inchanted lies, And rifted Rocks whofe entrance leads to Hell, For fuch there be, but unbelief is blind.

Within the navilof this hideous Wood,

Immur'd in cyprefs (hades a Sorcerer d wels 520

Of Bacchus, and of Circe born, great Comw>

Deep

478 perpetual] ] perpetuall fweets,] ] fweets 479 Eld. Bro.} ] El: bro. Lift, lift,] ] Lift, lift hear] ] heare 480 Som] ] Some far] ] farre of] off] ] break] ] breake Air.] ] aire. 481 2. Bro.) ] 2 Bro. too;]] too, Eld. Bro.]] Eld: bro. certain]] certaine Columbia notes omit. 482 fom] ] fome night-f ounder'd ] ]

night founder'd 483 els] ] elfe Wood-man,] ] wood man,

worft,] ] worft 484 Som] ] Some Robber] ] robber 485 2. Bro. ] ] 2 Bro. keep] ] keepe agen, agen,] agen agen] ] neer,] ] neere 486 Eld. Bro.] ] Eld: bro. 487 not,] ] not Stage direction.

Shepherd.] ] fhepheard. 489 you?] ] you, fpeak;] ] fpeake,

490 Com] ] Come neer,] ] neere, 491 young] ] yong

492 2. Bro. I ] 2 Bro. brother,] ] brother Shepherd] ] Shepheard

493 Eld. Bro.] ] Eld: bro. Whofe] ] whofe artful] ] artfull delaid] ] delayd 494 hudling] huddling] ] hear] ] heare madrigal,]] madrigale, 495 fweetn'd]] fweeten'd

496 Swain?]] Swaine, Ram] ram]] 497 flipt] Slip't)] young] ] yong Kid] ] kid

498 Weather] weather darke 500 Mafters 501 trivial] ] trivial! wolfe, fleecy] ] fleecie Virgin]] virgin Lady,] companie? 508 Eld. Bro blame,] ] blame 509 we

I forfook?] ] forfook, 499 dark] ]

mafters]] heir,]] heire, joy,]] joy

502 ftray'd]] ftrayd • 503 Woolf,]']

504 Downs,] ] downs 506 O] ] 6

Ladie fhe?] ] fhe, 507 company?] ]

Eld: bro. Shepherd,] ] fhepheard,

. wel ] wee . . . wee 510 Ay] j

Aye unhappy] ] unhappie 511 El. Bro.] ] Eld: bro. Columbia text and note are wrpng. Prethee] ] prethee 512 ye,] ] you, vain] vain,] vaine fabulous,] ] fabulous 514 Poets] Poets] ] Mufe,] ] Mufe 515 immortal] ] immortall vers] ] verfe 516 Chimera's] ] Chimera's lies,]] lies 517 Rocks]] rocks Hell,] hell,]] 518 unbelief]] unbeliefe 519 navil] ] navill Wood,] ] wood 520 cyprefs] ] cypreffe dwels] ] dwells 521 born,] ] borne,

68

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

0°7)

Deep skill'd in all his mothers witcheries , And here to every thirfty wanderer, By fly enticement gives his baneful cup, With many murmurs mixt, whofe pleafing poifoa 525 The vifage quite transforms of him that drinks, And the inglorious likenes of a beaft Fixes inftead, unmoulding reafons mintage Chara&er'd in the face y this have I learire Tending my flocks hard by i'th hilly crofts, 530

That brow this bottom glade, whence night by night He and his monftrous rout are heard to howl Like flabl'd wolves, or tigers at their prey, Doing abhorred rites to Heeate

In their obfeured haunts of inmoft bowres, 535

Yet have they many baits, and guileful fpells To inveigle and invite th* unwary fenfe Of them that pafs unweeting by the way. This evening late by then the chewing flocks. Had ta'n their fupper on the favoury Herb 540

Of Knot-grafs dew-befprent, and were in fold, I fate me down to watch upon a bank "With Ivy canopied, and interwove With flaunting Hony-fuckle, and began Wrapt in a pleafing fit of melancholy 545

To

(io8)

To meditate upon my rural minftrelfie,

Till fancy had her fill, but ere a clofe

The wonted roar was up amidft the Woods,

And fill'd the Air with barbarous diffonance

At which I ceas't, and liften'd them a while, 550

Till an unufual flop of Hidden filence

Gave refpk to the drowfie frighted fteeds

That draw the litter of clofe curtain'd fleep »

At laft a foft and folcmn breathing (bund

Rofe like a ftream of rich diftill'd perfumes, 555

And ftole upon the Air, that even Silence

Was took e're (he was ware; and wiflit (he might

Deny her nature, and be never more

Still to be fo difplac'r. I was all ear,

And took in drains that might create a foul 560

Under the ribs of Death, but O ere long

Too well I did perceive it was the voice

Of my moft honour'd Lady, your dear fifter.

Amaz*d I flood, harrow'd with grief and fear,

And O poor haplefs Nightingale thought I, 565

How fweet thou fing'ft, how near the deadly fnare !

Then down the Lawns I ran with headlong haft

Through paths, and turnings oft'n trod by day,

Till guided by mine ear I foundihe place

Where

522 Deep] ] Deepe 523 thirfty] ] thirftie wanderer,] ] wanderer 524 fly] ] flie baneful] ] banefull cup,] ] cup 527 likenes] ]

likeneffe

532 howl]

Columbia

guilefull]

538 pafs]

herbe 541 fold,

544 Hony-fuckle, ]

530 crofts,] ] crofts 531 bottom] ] bottome

I howle 533 prey,] ] prey 535 bowres,] bowres.

note is wrong on 1645 reading.] ] 536 guileful]

537 To inveigle] ] T'inveigle unwary] ] unwarie

paffe 540 ta'n] ] ta'ne favoury] ] favourie Herb]]

fold 542 down] ] downe 543 Ivy] ] ivie

hony-fuckle,

546 upon] Not present in 1645 or 1637.] ] minftrelfie,] ] minftrelfie 547 fancy] ] fancie 548 roar] ] roare Woods,] ] woods, 549 fill'd] ] filld Air]] aire diffonance] diffonance,] diffonance 550 while,]] while 551 unufual] unufuall] ]

553 clofe curtain'd] clofe-curtain'd] ] fleep;] fleep.] fleepe.

554 foft] ] foft, folemn] ] folemne 555 ftream] fteam] fteame perfumes,] Perfumes,] Perfumes 556 Air,] ] aire, 557 took] ] tooke wifht] wifh'tj ] 559 Still]] Still In British Museum C.34.C.46. only, ear,] eare,] ] 560 foul] ] foule 561 Under] ] Vnder O] ] 6 563 Lady,] ] Lady dear] ] deare 564 grief] ] griefe fear,] ] feare, 565 O] ] 6 poor] ] poore haplefs Colum- bia note misspells the word.] ] hapleffe Nightingale] ] nightingale I,] ] I 566 near] neer] neere 567 down] ] downe Lawns] ] lawns 568 oft'n] ] often day,] ] day 569 ear] ] eare

A MASK (COMUS) — 1673

69

(109)

Where that damn'd wibrd hid in fly difguife 570

(For fo by certain figncs I knew) had met

Already, ere my belt fpced could prevent,

The aidlefs innocent Lady his wifli't prey,

Who gently ask't if he had fecn fuch two,

Suppofing him fom neighbour villager * 575

Longer I durft not flay, but (bon I guefi't

Ye were the two (he mean't, with that I fprung

Into fwift flight, till I had found you here,

But further know I not. 2. Br*. O night and (hades,

How are ye joyn'd with Hell in cripple knot 580

Againft th'unarmed weaknefs of one Virgin

Alone, and helplefs ! is this the confidence

You gave me Brother? Ell Br 0. Yes, and keep it (till,

Lean on it fafely, not a period

Shall be unfaid for me : againft the threats 585

Ofmaliceorof forcery,or that power

Which erring men call Chance, this I hold firm,

Vertue may be afTail'd, but never hurt,

Surpriz'd by unjuft force, but not enthrall'd,

Yea even that which mifchief meant mod harm, 590

Shall in the happy trial prove raoft glory.

But evil on it felf (hall back recoyl,

And mix no more with goodnefs, when at laft

Gathet'd

(no)

Gatherd like fcum, and fetl'd to it felf

It (hall be in eternal reftlcfc change 595

Self-fed, and felf confom'd, if this tail,

The pillar'd firmament is rott'nncft,

And earths bafe built on Aubblc. But com let's on.

Againft th'oppofing will and arm of Heav'n

May never this juft fword be lifted up, 600

But for that damn'd Magician, let himbe girt

With all the greifly legions that troop

Under thefooty flag of Acheron,

Harfyes and Hydra\ or all the monftrous forms

'Twixt Africa and Inde, He find him out, 605

And force him to reftore his purchafe back,

Or draghjm by the curls, to a foul death,

Curs'd as his life.

Spit. Alas good ventrou9 youth, t love thy courage yet, and bold Emprife, But here thy fword can do thee little ftead, 610

Far other arms, and other weapons mutt Be thofe that quell the might of hellifh charms, He with his bare wand can unthred thy joynts, And crumble all thy finews.

Eld. Bro. Why prethee Shepherd How durft thou then thy felf approach fo ncer 615

As

570 damn'd] ] dam'd fly] ] flie 571 fignes] ] figns

572 Already,]] Alreadie, prevent,] praevent,] praevent

573 aidlefs] ] aidleffe Lady] ] Ladie 574 feen] ] feene two,] ] two 575 fom] ] fome 576 foon] ] foone 577 Ye] ] Yee

578 flight,]] flight 579 further] furder] farther 2. Bro.] ]

2 Bro. fhades,] ] f hades 580 ye] ] yee Hell] hell]] tripple] triple]] 581 weaknefs] ] weakneffe Virgin]] virgin 582 helplefs!]] helpleffe! is] Is] is 583 Brother?]] brother? Eld. Bro.]] Eld: bro. 584 Lean]] Leane 585 me:]] me; 586 forcery, ] ] forcerie, 587 firm,] ] firme, 590 mifchief] ] mifchiefe harm,]] harme, 591 happy]] happie trial]] triall glory.]] glorie. 592 evil]] evill felf]] felfe back]] backe recoyl,] ] recoyle 593 mix] ] mixe goodnefs,] ] goodneffe,

594 felf] ] felfe 595 be] ] bee eternal] ] eternall reftlefs] ] reftleffe 596 Self-fed,]] Selfe-fed, f elf-conf um'd, ] ] felfe

confum'd, fail,] ] faile 597 rott'nnefs,] ] rottenneffe, 598 com] ] come 599 arm] ] arme Heav'n] ] heav'n 601 Magician,] magician,] ] 602 troop] ] troope 603 Under] ] Vnder Not in Columbia notes, footy] ] footie 604 Harpy es] Harpyies] ] Hydra's,] ] Hydra's, forms] ] bugs 605 Africa] Africa,] ] out,] ] out 606 back,] ] backe 607 curls,] ] curies, to a foul death,] ] and cleave his fcalpe 608 Curs'd as his life.] ] Downe to the hipps. 610 do] ] doe 611 Far] ] Farre 613 joynts,] ] joynts 614 finews.] ] finewes. Shepherd] ]

fhepheard 615 thou then]] thouthen felf]] felfe neer] ] nee re

70

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

Cm)

As Co make this Relation >

ISpir. Care and utmoft drifts How to fecure the Lady from furprifal, Brought to my mind a certain Shepherd Lad Of fmall regard to fee to, yet well skill'd In every vertuous plant and healing herb That fpreds her verdant leaf to th'morning ray, He lov'd me well, and oft would beg me ling, Which when I did, he on the tender graft Would fit, and hearken even to extafie, And in requital ope his leathern (crip, And (hew me iimples of a thoufand names Telling their ftrange and vigorous faculties » Amongft the reft a fmall unfightly root, But of divine ef&dr, he cull'd me out i The leaf was darkifti, and had prickles on if, But in another Countrey, as he faid, Bore a bright golden flowre, but not in this foyl : Unknown, and like efteem'd, and the dull Twain Treads on it daily with his clouted (hoon, And yet more med'cinal is it then that Moly That Hermes once to wife Vlyffes gave > He call'd it Htmony, and gave it me, And bad me keep it as of fov'ran ufe

620

625

630

635

'Gainft all inchantments, mildew blaft, or damp Or gaftly furies apparition > I purs't it up, but little reck'ning made, Till now that this extremity compell'd, But now I find it true > for by this mean* I knew the foul inchanter though difguis'd, EnterM the very lime-twigs of his (pells, And yet came off: if you have this about you (As I will give yon when we go) you may Boldly affault the necromancers hall i Where if he be, with dauntlefs hardihood, And brandifh't blade rufti on him, break his glafs, And (hed the lufhious liquor on the ground, But feafe his wand, though he and his curd crew Fierce figne of bat tail make, and menace high, Or like the Sons of Vulcan vomit fmoak, Yet will they (bon retire, if he but fhrink.

Eld, Bro, Thyrfit lead on apace, He follow thee, And (bm good angel bear a (hield before us.

640

645

650

655

the

'Gainft

616 Relation?] relation?]] 617 Lady]] Ladie furprifal,]]

furprifall 618 certain] ] certaine Shepherd] ] fhepheard

Lad] ] lad 620 plant] ] plant, herb] ] herbe 621 leaf] ] leafe 623 grafs] ] graffe 625 requital] requitall] ] leathern] leather'n]] 627 ftrange] ] ftrange, faculties;]] faculties,

630 leaf] ] leafe 631 Countrey,] ] Countrie, 632 foyl:] ]

foyle: 633 Unknown,] ] Vnknowne, fwain] fwayn] fwayne 634 daily] ] dayly fhoon,] ] fhoone, 635 med'cinal] ] med'cinall 636 Ulyffes] ] Vlyffes gave ;]] gave, 637 me,] ] me 638 keep] ] keepe fov'ran] fovran] foveraine

639 all inchantments,] allinchantments,] all inchantments, 641 made,] ] made 643 true;] ] true, 644 foul] ] foule 645 lime-twigs] ] limetwigs 646 off :] ] off, 647 we] ] wee go)] ] goe) 648 hall;] ] hall, 649 dauntlefs] ] dauntleffe hardihood,]] hardihood 650 break]] breake glafs,]] glaffe, 651 ground,] ] ground 653 Fierce] Feirce] ] battail] ] battaile 654 Sons] fons] ] fmoak,] ] fmoake, 655 foon] ] foone fhrink.] ] fhrinke 656 apace,] ] apace 657 fom] ] fome angel] ] angell bear] ] beare fhield] fheild] ]

A MASK (COMUS) — 1673

71

(113)

the Scene changes to afiately Palace , fit out with all manner of delicioufnefs :Jbft Mufic^ Tables fired with all dainties. Goraus appears with his rabble , dnd the Lady fet in an inchanted Chair , to whom he offers his Clafs , which /he puts by> and goes about to rife,

Comus. Nay Lady fit j if I but wave this wand, Your nerves are all chain'd up in Alablafter, And you a ftatue > or as Daphne was 66o

Root-bound, that fled Apollo^

La* Fool do not boaft, Thou can ft not touch the freedom of my minde With all thy charms, although this corporal rinde Thou hafte immanacl'd, while Heav'n fees good.

Co. Why are you vext Lady? why do you frown ?66s

Here dwell no frowns, nor anger, from thefe gates

Sorrow flies far : See here be all the pleafures

That fancy can beget on youthfull thoughts,

When the frefti blood grows lively, and returns

Brisk as the April buds in Primrofe-feafon. 670

And firft behold this cordial Julep here

That flames, and dances in hiscryftal bounds

With fpirits of balm, and fragrant Syrops mixt*

Not that Neptntbes which the wife of Ibone,

H In

C»4)

In Egypt gave to Jove-bom Helena 675

Is of loch power to ftir up joy as this,

To life fo friendly, or fo cool to thirft.

Why (hould you be fo cruel to your felf,

And to thofe dainty limms which nature lent

For gentle ufage, and foft delicacy > 680

But you invert the covenants of her truft,

And harflily deal like an ill borrower

With that which you received on other terms,

Scorning the unexempt condition

By which all mortal frailty muft fubfift, 685

Refrefhment after toil, eafe after pain,

That have been tir'd all day without repaft,

And timely reft have wanted, but fair Virgin

This will rcftoreall foon.

La. 'Twill not falfc traitor,

'Twill not reftore the truth and honefty 690

That thou haft baniuYx from thy tongue with lies,

Was this the cottage, and the fafe abode

Thou told'ft me of > What grim afpeds are thefe,

Thefe cughly-headed Monfters ? Mercy guard me !

Hence wi»h thy brew'd inchantments, foul ie cciver, 695

Haft thou bctrai'd my credulous innocence

With vifor'J fallhood, and bafe forgery,

And

Stage directions. I In B.M. copy C34.cl.46. only, see p. 287, 'The Scene Conges to a Jtately palace Jet out with all man- I . changes] ] Changes Except as noted above. Palace,] ] palace 2 delicioufnefs:]] delicioufneffe, Mufick,]] mujicke, Tables]] tables 3 appears ] ] appear es 4 Lady ] ] Ladie 5 Chair, ] ] chair e Glafs,] ] glaffe, 658 Lady] ] Ladie 659 nerves] ] nervs Alablafter,] ] alablafter, 660 ftatue,] ftatue;] ] 661 Root-bound,]] Rootbound Apollo,] ] Apollo. Fool]] Foole do] ] doe 662 freedom] ] freedome minde] ] mind 663 With all] Withall] ] corporal] ] corporall rinde] ] rind 664 hafte] ] haft Heav'n] ] heav'n 665 Lady?]] Ladie, do]] doe frown?] ] frowne? 666 dwell] dwel] dwell 667 far:] farr:] farre: See] ] fee pleafures] ] pleafurs 668 fancy] ] fancie thoughts,] ] thoughts 670 Primrofe-feafon.] ] primrofe feafon. 671 Julep] ] julep 672 cryftal] ] cryftall 673 balm,] ] balme, Syrops]] fyrops 674 Thone,]] Thone

675 Egypt] ] /Egypt Jove-born] ] Jew-borne 676 ftir] ] ftirre

677 cool] ] coole 678 cruel] ] cruell felf,] ] felfe, 679 dainty] ]

daintie 680 delicacy?] ] delicacie? 682 deal] ] deale

683 terms,] ] termes, 684 condition] ] condition,

685 mortal]] mortall 686 toil,]] toile pain,]] paine,

688 fair] ] faire Virgin] ] virgin 689 foon.] ] foone. 'Twill] ]

T'will 690 'Twill] ] Twill honefty] ] honeftie 693 What] ]

what Not in Columbia notes. 694 oughly-headed ] ]

ougly-headed Monfters?]] monfters? Mercy]] Mercie

695 brew'd]] brewd inchantments,]] inchantments foul]]

foule 696 betrai'd] ] betray'd 697 forgery,] ] forgerie,

72

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

And would'ft thou feck again to trap me here

With lickerifli baits fit to enfnare a brute?

Were it a draft for Juno when (he banquets, 700

I would not tafte thy treafonous offer •, none

But fuch as are good men can give good things,

And that which is not good, is not delicious

To a well>govem'd and wife appetite.

C$. O fbolithnes of men ! that lend their cars 705

To thofc budge Doctors of the Stokkfurr,

And fetch their precepts from the Cymc\ Tub,

P railing the lean and fallow Abftinencc.

Wherefore did Nature powre her bounties forth,

With fuch a full and unwithdrawing hand, 7i0

Covering the earth with odours, fruits, and flocks,

Thronging the Seas with fpawn innumerable,

But all to pleafe, and fate, the curious tafte ?

And fet to work millions of fpinning Worms,

That in their green (hops weave the fmooth-hiir'd (ilk

To deck her Sons, and that no corner might 7 1 6

Be vacant of her plenty, in her own loyns

She hutch's th'all-worfhipt ore, and precious gems

To (lore her children with > if all the world

Should in a pet of temperance feed on Pulfe, 720

Drink the clear dream, and nothing wear but Freize,

H a P Th'aH-

(11O

Th'all-giver would beunthank't, would bcunprais'd,

Not half his riches known, and yet defpis'd,

And we (hould ferve him as a grudging mafter,

As a penurious niggard of his wealth, 725

And live like Natures baftards, not her fons,

Who would be quite furcharg'd with her own weight,

And ftrangPd with her wafte fertility i (plumes,

Th'earth cumber'd , and the wing d air dark't with

The herds would over-multitude their Lords, 730

TheSeao'refraught would fwel,& th'unfought diamonds

Would fo emblaze the forhead of the Deep,

And fo beftudd with Stars, that they below

Would grow inur'd to light, and com at bft

To gaze upon the Sun with fhameles brows. 735

Lift Lady be not coy, and be not cofen'd

With that fame vaunted name Virginity,

Beauty is natures coyn, muft not be hoorded,

But muft be currant, and the good thereof

Confifts in mutual and partak'n blifs, 740

Unfavuiuy in th'injoyrnent of it felf

If you let flip time, like a neglected rofe

It withers on the ftalk with languiuYt head.

Beauty is natures brag, and muft be fhown

In courts, at fcafts, and high folcmni t ics 745

Where

698 would'ft] wouldft] ] again] ] againe 700 Juno] ] Iuno

Not in Columbia notes, banquets,] ] banquets 701 tafte] ] taft 704 well-govern'd ] wel-govern'd] ] 705 foolifhnes] ] foolifhneffe ears] ] eares 706 Doctors] doctors] ] Furr,] ] furre, 707 precepts] ] praecepts Tub,]] tub, 708 lean] ] leane, 709 forth,]] forth 711 flocks,]] flocks 712 Seas]] feas fpawn] ] fpawne innumerable,] ] innumerable 713 tafte?] ] taft? 714 Worms,]] worms, 717 plenty,]] plentie own]] owne 718 th'all-worfhipt ] ] th'all worfhipt Columbia note

on 1637 is wrong. 721 ftream,] ] ftreame, wear,] ] weare,

723 half] ] halfe 728 wafte] ] waft fertility;] ] fertilitie; 729 air] ] aire 730 herds] ] heards over-multitude] ] over-inultitude 731 Sea] ] fea o'refraught] ] ore-fraught

fwel,] fwell,]] &] ] and 732 forhead]] forehead 733 beftudd]] beftudde Stars,]] ftars 734 com]] come

735 fhameles] ] fhamelefs 736 Lady] ] Ladie 737 Virginity,] ] Virginitie, 738 Beauty] ] Beautie coyn,] ] coine,

740 mutual] ] mutuall partak'n] ] partaken blifs,] ] bliffe,

741 Unfavoury] ] Vnfavourie felf] ] felfe 743 ftalk] ] ftalke 744 Beauty] ] Beautie fhown] ] fhowne

A MASK (COMUS)— 1673

73

C»7) Where moft may wonder at* he workmanflvip » It is for homely features to keep home, They had their name thence > courfc complexions And cheeks of forry grain will ferve to ply The (ampler, and to teize the hufwifes wooll. 750

What need a vermeil-tin&ur'd Hp for that Love-darting eyes, or trefles like the the Morn ? There was another meaning in thefe gifts, Think what, and be adviz'd, you are but young yet.

La* I had not thought to have unlockt my Jips 755 In this unhallow'd air, but that this Jugler Would think to charm my judgement, as mine eyes Obtruding falfe rules pranckt in reafons garb. I hate when vice can bolt her arguments, And vertue has no tongue to check her pride : 760

Impoftor do not charge moft innocent nature, As if flic would her children mould be riotous With her abundance (he good cateres Means her proviOon only to the good That live according to her fober laws, 765

And holy dictate of fpare Temperance : If every juft man that now pines with want Had but a moderate and beieeming (hare Of that which lewdly-pamper'd Luxury

H 3 Now

c.18)

Now heaps upon Com few with vaft excels, 770

Natures full bleffings would be well difpenc't

In unfuperfluous ceven proportion,

And (he no whit encomber'd with her (tore,

And then the giver would be better thank't,

His praiie due paid, for fwiniih gluttony 775

Ne're looks to Heav'n amidft his gorgeous feaft,

But with beibtted bate ingratitude

Cramms, and blafphemes his feeder. Shall I go on >

Or have I (aid anow > To him that dares

Arm his profane tongue with contemptuous words 780

Againft the Sun-dad power of Chaftity;

Fain would I fomthing (ay, yet to what end ?

Thou haft nor Ear, nor Soul to apprehend

The fublime notion, and high myftery

That muft be utter M to unfold the fage 785

And ferious do&rine of Virginity,

And thou art worthy that thou (houldft not know

More happinefc then this thy prefent lot.

Enjoy your dear Wit, and gay Rhetorick

That hath fo well been taught her dazlmg fence, 790

Thou art not fit to hear thy felf convincV,

Yet fhould I try, the uncontrouled worth

Of this pure caufe would kindle my rap't (pints

To

747 keep] ] keepe 749 forry] ] forrie 752 the the] the]] Morn?]] Morne 754 Think] ] Thinke young] ] yong 757 think] ] thinke charm] ] charme 759 arguments,] ] arguments 761 do]

763 abundance] abundance,] ] cateres] caterefs] catereffe

764 only] onely] only 765 laws,] ] laws 766 Temperance:] ■ Temperance, 768 moderate] ] moderate,

769 lewdly-pamper'd] ] lewdy-pamper'd Luxury] ] Luxurie

grain] ] graine 753 gifts,] ] gifts? 756 air,]] aire, 758 garb.] ] garbe. doe nature,] ] nature

770 fom] ] fome excefs,] ] exceffe, 772 eeven] ] even 776 Heav'n]] heav'n 778 go]] goe 779 anow?] anough?] enough? To] ] to 780 Arm] ] Arme contempuous] ] reproachfull 781 Chaftity;] Chaftity,] Chaftitie 782 Fain]] Faine fomthing]] fomething 783 Ear,] Eare,]] Soul]]

Soule 784 myftery] ] myfterie 786 Virginity,] ] Virginitie,

788 happinefs] happines] hapineffe prefent] ] prafent

789 dear] deer] deere 790 been] ] beene 791 hear] ] heare fell 1 ] felfe 792 try,]] trie.

74

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

f»9)

To fuch a flame of (acred vehemence,

That dumb things would be mov'd to fympathize, 795

And the brute Earth would lend her nerves, and (hake,

Till all thy magick ftru&ures rear'd fo high,

Were (hatter'd into heaps o*re thy falfe head.

Co. She fables not, I feel that I do fear Her words fet off by fom fuperior power ', 8oo

And though not mortal, yet a cold (huddring dew Dips me all o're, as when the wrath of Jove Speaks thunder, and the chains of Erebus To fom o( Saturns crew. I mull difTemble, And try her yet more ftrongly. Com, no more, 805

This is meer moral babble, and direct Againft the canon laws of our foundation •, I rauft not fuffer this, yet 'tis but the lees And fetlings of a melancholy Wood i But this will cure all ftreight, one fip.of this 816

Will bathe the drooping fpirits in delight Beyond theblifs of dreams. Be wife, and tafie.--—

H|

rk

(120)

the Brothers ruJJj in with Swords drawn, wrefi his Glafs out of his hand, and breaks it againft the ground j hk rout make fign of refijiance but are all driven in j The attendant Spirit comes in.

Spir. What, have you let the falfe Enchant«r fcape ? O ye miflook, ye fhould have fnatcht his wand And bound him faft > without his rod revers't, 815

And backward mutters of diffevering power, We cannot free the Lady that fits here In (tony fetters fixt, and motionlefs i Yet flay, be not difturb'd, now I bethink me, Som other means I have which may be us'd, 820

Which once of Mdibeus old I learnt The footheft Shepherd that ere pip't on plains.

There is a gentle Nymph not far from hence, That with moift curbfway9 the fmooth Severn ftream, Sabr'ma is her name, a Virgin pure, Whilom (he was the daughter of Locrine, That had the Scepter from his Father Brute. The guiltkfs damfel flying the mad purfuit Of her enraged (kpdam Gwendolen, Commended her fair innocence to the flood That ftay'd her flight with his crofs- flowing courfe,

825

830

The

797 high,] ] high 798 o're] ] ore 799 feel] ] feele do] ] doe fear] ] feare 800 fom] ] fome 801 mortal,] ] mortall, 802 Jove] ] love Not in Columbia notes. 803 chains] ]

chaines 804 fom] ] fome 805 Com,] ] Come; 806 meer] ] meere moral] ] morall direct] ] direct' Not in Columbia notes.

807 foundation;] ] foundation, 812 blifs] ] bliffe tafte. ]]

taft —

Stage directions. 1 Brothers] ] brothers Swords] ] swords

drawn,]] drawne, 2 Glafs]] glajje break]] breake 3 fign] figne] ] 4 The] ] the Not in Columbia notes. 813 Enchanter] enchanter]] 814 ye]] yee miftook, ] ] miftooke, ye]] yee 816 power,] ] power 817 We] ] Wee Lady] ] Ladie 818 ftony] ] ftonie motionlefs;] ] motionleffe; 819 bethink] ] bethinke 820 Som] ] Some Not in Columbia notes, means] ] msanes 822 Shepherd] ] fhepheard pip't] ] pipe't 823 Nymph] ] nymph far] farr] farre hence,] ] hence 825 Virgin] ] virgin 826 Whilom] ] Whilome fhe] ] fhee 827 Scepter] ] fcepter Father] father] ] 828 The] She] ] guiltlefs] ] guiltleffe damfel] damfell]] 829 Guendolen,]]

Guendolen 830 fair] 1 faire 831 crof s-flowing ] ] croffe-flowing

A MASK (COMUS) — 1673

75

(121)

The water Nymphs that in the bottom plaid, Held up their pearled wrifts and took her in, Bearing her ftraight to aged Nereus Hall, Who piteous of her woes, rear'd her lank head, And gave her to his daughters to imbathe In ne&ar'd la vers ftrew'd with Afphodil, And through the porch and inlet of each fenfc Dropt in Ambrofial Oils till fhe reviv'd, And underwent a quick immortal change Made Goddefs of the River > ftill (he retains Her maid'n gentlenes, and oft at Eeve Vifits the herds along the twilight meadows, Helping all urchin blafts, and ill luck fignes That the (hrewd medling Elfe delights to make, Which (he with pretious viold liquors heals. For which the Shepherds at their feflivals Carrol her goodnes lowd in ruftick layes, And throw fweet garland wreaths into her dream Of pancies, pinks, and gaudy Daflfadils. And, as the old Swain faid, (he can unlock The clafping charm, and thaw the numming fpcli, 14 (he be right invok't in Warbled Song, For maid*nhood(heloveSjand will befvvitt To aid a Virgin fuch as was her felf

835

840

845

850

855 In

(l22)

In hard befetting need, this will I try And adde the power of fom adjuring verfc.

SONG.

Sabrina fair

Liften where thou art fitting VndertbeglaJJie, cool, tranfluqentwave,

In twifted braids ofUllih fitting 'fhe loofe train efthy amber-droning bairt

Liften for dear honours fak^-,

Goddefs of the ftlver lake-,

Liften andfave.

Liften and appear to us In name of great Oceanus, By the earth-fhaking Neptune's mace, And fethys grave majeftick pace, By hoary Nereus wrincled look, And the Carpathian wifards hook, By fcaly Tritons winding (hell, And old footh-faying Glaums fpell, By Leucothea's lovely hands, And her Ion that rules the (hands, By Ibew tinfel-flipper'd feet, And the Songs of Sirens fweet,

860

865

870

875

By

tooke s rear'd] ] ftrewd AfphoTlil, ] ] 839 Ambrofial] ] ambrofial immortal]] immortall river; retains] ] retaines gentleneffe, Eeve] ] eve

832 bottom] ] bottome plaid,] ] playd 833 too 834 ftraight] ] ftraite Hall,] ] hall 835 woes/ reatd lank] ] lanke 837 ftrew'd] afphodil, 838 porch] ] porch, Oils] ] oyles 840 quick] ] quicke,

841 Goddefs]] goddeffe River;]

842 maid'n] ] maiden gentlenes,]

843 herds] ] heards 844 luck] ] lucke 845 Elfe] ] elfe 846 pretious]] precious heals.]] heales. 847 Shepherds]] fhepheards feftivals]] feftivalls 848 Carrol]] Carroll goodnes] ] goodneffe ruftick] ] rufticke 849 ftream] ] ftreame 850 gaudy] ] gaudie Daffadils.] \ daffadills.

851 Swain] | Swaine unlock] ] unlocke 852 charm,] ] charme, 854 maid'nnood] ] maidenhood 855 Virgin] Virgin,] virgin

felf] 1 felfe

856 try] ] trie 857 fom] ] fome Title. SONG.] ] Song. 858 fair}] fair e 860 Under] ] Vnder Not in Columbia notes. glaffie,}} glafsie, cool,]] coole, 861 Lillies] } lillies 862 train] ] traine hair,] } haire, 863 dear] ] deare fake,] ] fake 864 Goddefs] ] Goddeffe lake,] ] lake 866 appear] j appeare 868 the earth-fhaking] ] th earth fhaking Neptune's] ] Neptun's mace,] ] mace 869 majeftick] ] majefticke 870 hoary] ] hoarie look,] ] looke, 871 hook,] ] hooke, 872 fcaly] ] fcalie fhell,] ] fhell. 873 footh-faying] ] footh faying 874 Leucothea's] ] Leucothea's Columbia note on 'lovely' 1637 is wrong. 876 feet,] ] feet;

76

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(123)

By dead Tarthenopes dear tomb,

And fair Ligeas golden comb,

Wherewith (he fits on diamond rocks 880

Sleeking her Toft alluring locks,

By all the Nymph that nightly dance

Upon thy ftreams with wily glance,

Rife, rife, and heave thy rofie head

From thy coral -pav'n bed, 885

And bridle in thy headlong wave,

Till thou our fummons anfwerd have.

Liften and fave.

Sabrina rifes, attended by water-Nymphs , &fogs.

By the rufby-fringed ban\->

Where groves the Willow and the Ofier dank^ 890

MyJIiding Chariot fiayes,

ctkickjet with Agat, and the azurnjbeen

OfTurtys blew, and Emrauld green

'that in the channel Prayer,

Whilft from off the waters fleet 895

'thus Ifet my printlefs feet

O're the Cowflips Velvet head,

That bends not as I tread,

Gcmlff&ain at thy requefi

I am here* 900

Spin

C«4)

Spit. Goddefcdear We implore thy powerful hand To undo the charmed band Of true Virgin here diftreft, Through the force, and through the wile Of unbleft inchanter vile.

Sab. Shepherd 'tis my office bet? To help infnared chaftity > Brighteft Lady look on me, Thus I fprinkle on thy breft Drops that from my fountain pure, I have kept of pretious cure, Thrice upon thy fingers tip, Thrice upon thy rubied lip, Next this marble venonYd feat Smear'd with gumms of glutenous heat I touch with chafte palms moift and cold, Now the fpell hath loft his hold > And I mutt hafte ere morning hour To wait in Ampbitriu*s bowr.

905

910

915

920

Sabrina defcends,and the Lady rifes out of her feat

Sptr» Virgin, daughter of Locrine Sprung of old Anchifes line

May

878 Parthenope's] ] Parthenope's dear] ] deare 879 fair] ]

faire Liged's] ] Ligea's 880 Wherewith] Wherwith] Wherewith 881 1645 only, foftalluring 883 Upon] ] Vpon wily] ] wilie glance,]]] 884 rife,]] rife 885 coral-pav'n] ] coral-paven 886 wave,] ] wave 887 anfwerd] anfwer'd] anfwerd Stage directions: Sabrina] Sabrina] ] rifes,]] rifes water -Nymphs,]] water Nimphes &] ] and 889 rufhy -fringed] ] rufhie fringed bank,] ] banke, 890 grows] ] growes Willow] ] willow Ofier] ] ofier dank,]] dancke 891 Chariot] ] chariot 892 Thick] ] Thicke Agat, \\ agat, azurn]] azurne fheen]] fheene

893 Turkis] ] turkkis Emrauld] ] Emrould green] ] green e

894 channel] cfiannell] ] 896 printlefs] ] prinlleffe 897 O're] ] Ore Cowflips] ] cowflips Velvet] ] velvet 899 fwain] ] fwaine

901 Goddajs] ] Goddeffe dear] ] deare 902 We] ] Wee powerful jBpowerfull 903 undo] undoe] ] 904 Virgin])

virgin 907 Shepherd]] Shepheard 'tis]] tis 908 help]] helpe chaftity;] ] chaftitie; 909 Lady] ] Ladie look] ] looke 910 fprinkle]] fprinckle 911 fountain]] fountaine pure,]] pure 912 pretious] ] precious 915 feat] ] feate 916 gumms]] gummes heat]] heate 917 chafte]] chaft

palms] ] palmes 918 hold;] ] hold. 919 hafte] ] haft hour] ] houre 920 wait] ] waite Amphitrite's] ] Amphitrite' s bowr.] ] bowre. Stage directions: Sabrina] Sabrina] ] defcends,] ] descends Lady]] Ladie feat.]] feate. 922 line] line,] line

A MASK (COMUS) — 1673

77

("5) May thy brimmed waves for this Their full tribute never mifs From a thoafand petty rills, That tumbled down the fnowy hills : Summer drouth, or finged air Never fcorch thy trefles fair. Nor wet Ottobtrs torrent flood Thy molten cryftal fill with mudd, May thy billows row! afhoar The beryl, and the golden ore, May thy lofty head be crown'd With many a tower and terras round, And here and there thy banks upon "With Groves of myrrhe, and cinnamon. Com Lady while Heaven lends us grace, Let us fly this curfed place, Left the Sorcerer us entice With fom other new device. Not a waftc, or needlefs found Till we com to holier ground, I (hall be your faithfull guide Through this gloomy covert wide, And not many furlongs thence Is your Fathers refidence,

925

930

935

940

945

Wher-

(126)

Where this night are met in ftatc

Many a friend to gratulate

His wiftVt prefence, and befide

All the Swains that there abide, 950

With jiggs, and rural dance rcforf,

We (hall catch them at. their fport,

And our fudden coming there

Will double all their mirth and chere*

Com let us hafte, the Stars grow high, 955

But night fits monarch yet in the mid sky.

The Scene changes y prefinting Ludlow Town and the Vrefidents Caflle , then com in Countrey* Dancer r, after them the attendant Spirit, with the two Brothers and the Lady.

SONG.

Spir. BacJ^Shepherdt^ bac]^ anough your play.

Till next Sun/bine holiday ,

Here be without duck^or nod

Other trippings to be trod 960

Of lighter toes, andfuch Court guife

As Mercury didfirji devife

With the mincing Dryades

On the Livens^ and on theLejs.

This

924 mifs] ] miffe 925 petty] ] pettie 926 tumbled] tumble] ]

down] ] downe fnowy] ] fnowie 927 air] ] aire t 928 fair,] ]

faire Octpbers]] Octobers 930 cryftal]] cryftall mudd,]]

mudde 931 billows] ] billowes rowl] ] rowle afhoar] ]

a fhoare 932 beryl,] ] beryll, 933 lofty] ] lof tie 934 tower]]

tower, terras] terrafs] terraffe 936 Groves] ] groves

937 Com]] Come Lady]] Ladie Heaven]] heaven 1637 and

1645 extra leaded this line to show change of person addressed.

939 Sorcerer] ] forcerer entice] intice Not in Columbia notes.] ]

940 fom]] fome 941 wafte,] ] waft, Columbia notes omit comma, needlefs] ] needleffe 942 com] ] come holier] ] holyer 944 gloomy] ] gloomie The catchword Where is badly printed in all copies, the second e being dropped down in some copies and scarcely or not printing at all in others examined.

948 friend] ] freind 951 Jiggs,] ] Iiggs, Not in Columbia

notes, rural] ] rurall 952 We] ] Wee 953 fudden] ] fuddaine coming]] comming 954 mirth] ] mirth, chere;]] chere, 955 Com] ] Come hafte,] ] haft Stars] ] ftarrs grow] ] are high,] ] high 956 sky.]] skie. Stage directions.

1 changes, ] changes] ] Ludlow] ] Ludlow Town] ] towne

2 com] ] come Countrey-Dancers,] ] Countrie dancers,

3 Spirit,] ] Spirit 4 Lady.] ] Ladie. Title. SONG.] ] Song. Columbia note omits this. 957 Shepherds,] ] fhepheards, back,] ] back anough] ] enough 959 nod] ] nod, 964 Lawns,] ] lawns, Leas.] ] leas.

78

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

This fecond Song preients them to their Father and Mother.

Noble Lorh and Lady bright, I have brought ye new delight, Here behold fo goodly grown 'three fair branches of your ewny 'Heav'n hath timely tr'id their youth, Their faith, their patience, and their truth. Andfent them here through hard affays With a crown ofdeathlefs Praife, To triumph in viftorieus dance tfrefenfual Folly, and Intemperance'

The dances ended^ the Spirit Epilogui%es.

Spir. To the Ocean now I fly, And thofe happy climes that ly Where day never (huts his eye, Up in the broad fields of the sky ; There I fuck the liquid air All amidft the Gardens fair Of Hefperuf, and his daughters three That fing about the golden tree : Along the crifped (hades and bowres Revels the fpruce and jocond Spring

965

970

975

980

'o>

fh:

(138) The Graces, and the rofie-boofom'd Howres,. Thither all their bounties bring, That there eternal Summer dwels, And Weft winds, with musky Wing About the cedar'n alleys fling Nard, and Carta's balmy (mel&r Iris there with humid bow, Waters the odorous banks that blow Flowers of more mingled hew Then her parfl'd fcarf can (hew, And drenches with Elyfian dew ( Lift mortals if your ears be true) Beds of Hyacinth, and Rofes Where young Adonis oft repofes, Waxing well of his deep wound In flumber foft, and on the ground Sadly (its ftiAffyrian Queen \ But far above in fpangled (heen Celeftial Cipher fam'd Son advanc'f, Holds his dear Pyfche fweet intranc't After her wandring labours long, Till free content the gods among Make her his eternal Bride, And from her fair unfpotted fide

985

990

995

1000

1005

Two

Stage directions, prefents] ] praefents Father] ] father Mother.] ] mother. 966 ye] ] yee 967 grown] ] growne. 968 fair]] faire own,]] owne, 970 truth.]] truth, Not in Columbia notes. 971 affays] ] affays Morgan copy only reads, perhaps, affaye. 972 crown] ] crowne deathlefs] ] deathleffe 974 O're] ] Ore fenfual] ] fenfuall Stage directions. Epiloguizes. ] ] Epilogizes. 975 fly,]] flie, 976 happy]] happie ly] ] lie 978 Up] ] Vp sky:] ] skie: 979 air] ayr] ayre 980 Gardens]] gardens fair]] faire 982 tree:]] tree, 983 fhades] ] fhades, 984 Revels] ] Revells In the catchword, the e is broken in some copies examined and clear in others.

985 boofom'd] ] bofom'd Howres,]] Howres In most 1673 copies es, scarcely prints, but is clear enough in others. Co- lumbia has no note on the punctuation. 987 eternal] ] aeternall dwels,] ] dwells 988 Weft] ] weft musky] ] muskie

990 Ca//7a's] ] Cafsia's balmy] ] balmie fmels.] ] fmells.

991 bow,] ] bow 994 fcarf] ] fcarfe 996 mortals] mortals,] mortalls, ears] ] eares 997 Rofes] rofes] rofes) 999 deep] ] deepe 1001 Queen;] ] Queene; 1002 far] farr] farre fheen] ] fheene 1003 Celeftial] ] Celeftial 1 1004 dear] ] deare 1007 eternal] ] aeternall 1008 fair] ] faire

A MASK (COMUS)

PSALM 1 — 1673

79

(129)

Two blifsfal twins are to be born, Youth and Joy > fo Jove hath fworn.

But now my task is fmoothly don, I can fly, or I can run Quickly to the green earths end, Where the bow'd welkin flow doth bend, And from thence can (bar as foon To the corners of the Moon.

Mortals that would follow me, Love vertue, (he alone is free, She can teach ye how to clime Higher then the Sphcary chime » Or if Vertue feeble were, Heav'n it felf would ftoop to her.

IOIO

1015

1020

?S AL. I. t>ont intoVerfe, 1653.

BLefs'd is the man who hith not walk'd aftray In counfel of the wicked, and ith* way Of finners hath not flood, and in the feat Of fcorners hath not fate. But in the great Jehovahs Law is ever his delight, And in his Law he ftudies day and night. He fball be as a tree which planted grows By watry ftreams, and in his feafon knov/s To yield his fruit, and his leaf (hall not fall, And what he takes in hand (hall profper all. Not fo the wicked, but as chaff which fann'd The wind drives, fo the wicked (hall not (land In jugdment, or abide their tryal then, Nor finners in th'affembly of juft men. For the Lord knows th' upright way of the juft, And the way of bad men to ruine mufl.

10

15

f

tfa:

tSAL

1009 blifsful] ] hlifsfull born,] ] borne( ioio Youth] ] Youth, Joy;] ] Ioy; Not in Columbia notes. Jove) ] love Not in Columbia notes, fworn.] ] fworne. ion task] ] taske don,] ] clone, 1013 green] ] greene 1015 foar] ] foare foon] ] foone 1016 Moon.] ] Moone. 1017 Mortals] ] Mortalls 1019 ye] ] yee 1020 Spheary] ] Sphaerie 1021 Vertue] ] vertue were,] ] were 1022 felf] ] felfe ftoop] ] ftoope The signature letter, I, is worn in all copies examined, and looks like merely a spacer mark in some.

Psalms I-VIII and LXXX-LXXXVIII. The only text for the Psalm paraphrases that follow is that of 1673. 13 jugdment,]

So, all copies. Columbia text reads judgment, and no note.

80

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

030

PS At. It Done Aug. 8. 1655. T*r**ttu

WHy do the Gentiles tumult, and the Nations mufe a vain thing, the Kings of th' earth up- With power,and Princes in their Congregations (ftand

Lay deep their plots together through each Land,

Againft the Lord and his Meffiah dear 5

Let us break off, fay they,by ftrength of hand

Their bonds, and caft from us, no more to wear, Their twifted cords : he who in Heaven doth dwell Shall laugh, the Lord (hall feoff them, then fevere

Speak to them in his wrath, and in his fell And fierce ire trouble them j but I faith hee anointed have my King (though ye rebell)

On Sion my holi* hill. A firm decree I will declare > the Lord to me hath fay'd Thou art my Son I have begotten thee

This day i ask of me, and the grant is made , As thy pofTeflfion I on thee beftow Th* Heathen, and as thy conqueft to be fway'd

Earths utmoft bounds : them (halt thou bring fall low With Iron Scepter bruis'd, and them di'fperfe

Like to a potters veftel (hiver'd fo.

I 3 Aix

10

15

20

(132)

And now be wife at length ye Kings averfe Be taught ye Judges of the earth > with fear Jehovah ferve, and let your joy converfe

With trembling s kifs the Son leaft he appear In anger and ye perifh in the way If once his wrath take fire like fuel (ere.

Happy all thofe who have in him their ftay.

PSAL. 3. Aug. 9. 1653. When he fled' front Ablalorn.

LOrd how many are my foes How many thofe That in arms againft me rife Many are they That of my life diftruftfully thus fay, No help for him in God there lies. But thou Lord art my (hield my glory, Thee through my ftory Th' exalter of my. head I count Aloud I cry'd Unto Jehovah, he full foon reply M And heard me from his holy mount*.

25

10

Hay

2 mufe] So, all copies. Columbia prints Mufe and has no note.

PSALM PARAPHRASES — 1673

81

f lay and flepf,I wak'd again, For my fuftain Was the Lord. Of many millions The populous rout I fear not though incamping round about They pitch againft me their PaviUions. Rife Lord, fave me my God for thou Haft fmote ere now On the cheek-bone all my foes, Ofmenabhor'd Haft broke the teeth. This help was from the Lord Thy bleffing on thy people flows.

15

20

PSAL. IV. Aug. 10. 1653.

ANfwer me when I call God of my righteoufnefs In ftraights and in diftrefs Thoudidftrnedifmthrall And fet at large » now fpare,

Now pity me. and hear my earneft prai'r. Great ones how long will ye My glory have in fcorn How long be thus forborn

13

ScU

034)

Still to love vanity,

To love, to fcek, to prhe

Things falfe and vain and nothingelfe but lies ? Yet know the Lord hath chofe Chofe to himfelf a part The good and meek of heart ( For whom to chufe he knows ) Jehovah from on high

Will hear my voyce what time to him 1 crie« Be avv'd, and do not fin, Speak to your hearts alone, Upon your beds> each one, And be at peace within. Oifer the offerings juft

Of righteoufnefs and in Jehovah truft. Many there be that fay Who yet will (hew us good ? Talking like this worlds brood > But Lord, thus let me pray, On us lift up the light

Lift up the favour of thy countenance bright . Intc my heart more joy And gladnefs thou haft put Then when a year of glut

10

15

20

25

30

Their

82

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

035.)

Their (lores doth over-cloy

And from their plenteous grounds 35

With van* incrcafe their corn and wine abounds In peace at once wilt t Both lay roe down and flieep For thou alone doft Keep

Me (afe where ere I lie 40

As in a rocky Ceft

Thou Lord alone Irifafcty mak'ft trie dwell.

T8AL.V. Jug. 12. 1655.

JEhovah to my words give ear My meditation waigh The voyce of my complaining hear My King and God for unto thee I pray. Jehovah thou my early voyce 5

Shalt in tne morning hear - Ith* morning I to thee with choyce Will rank m$ Prayers, and watch till thou appear* For thou art not a God that takes

In wickednefs delight 10

Evil with thee no biding makes Fools or madmen (land not within thy fight,

(13©

All workers of iniquity

Thou hat'ft i and them unblcft Thou wilt deftroy that fpeak a ly The bloodi' and guileful man God doth deteft. But I will in thy mercies dear

Thy numerous mercies go Into thy houfe j I in thy fear Will towards thy holy temple worfhip low Lord lead me in thy righteoufnefs Lead me becaufe of thofe That do obferve If I tranfgrefs Set thy wayes right before, where my ftep goes. For in his faltring mouth unliable No word is firm or footh Their infide, troubles miferable j An open grave their throat, their tongue they fmooth God, find them guilty, let them fall

By their own counfels quell'd i Pu(h them in their rebellions all Stil! on j for againft thee they have rebcll'd i Then all who truft in thee (hall bring

Their joy, while thou from blame Defend'ft them, they (hall ever fmg And (hall triumph in thee, who love thy name.

15

20

25

30

35

For

PSALM PARAPHRASES — 1673

83

(»37) For thou Jehovah wilt be found

To blefs the juft man ft ill, As with a fhield thou wilt furround Him with thy lifting favout and good wifi) 40

PSAL. VI. Aug. 13. 1653.

LOrd in thine anger do not reprehend me Nor in thy hot difpleafure me correct » Pity me Lord for I am muds de je&

Am very weajc and faint > heal and amend me, For all my bones, that even with anguilh ake ,

Are troubled, yea my (bul is troubled fore And thou O Lord how Iorig> turn Lord, reftore

My foul, O fave me for thy goodnefs (ake For in death no remembrance is of thee s

Who in the grave can celebrate thy praife ? Wearied I am with ilghingout my dayes,

Nightly my Couch I make a kind of Sea i My Bed I water with my tears » mine Eie

Through grief confumes, is waxen old and dark Ith' mid'ft of all mine enemies that mark. 15

Depart all ye that work iniquitic

10

20

Depart

O38)

Depart from me, for the voice of my weeping

The Lord hath heard, the Lord hath heard my prai*r My fupplication with acceptance fair

The Lord will own, and have me in his keeping* Mine enemies (hall all be blank and da(h't

With much confufion j then grow red with (hame They (hall return in haft the way they came

And in a moment (hall be quite abauYt.

PSAL. VIL Aug. 14. 1*53.

Vpoft the words of Chufh the Bepjamite againft him.

LOrd my God to thee I (lie Save me and fecure me under Thy protedion while t crie, Lcaft as a Lion (and no wonder) He haft to tear my Soul afunder 5

Tearing and no refcue nigh.

Lord my God if I have thought Or done this, if wickednefs Be in my hands, if I have wrought 111 to him that meant me peace, 10

Of

Psalm V. 40 will.] In most copies surviving, the 1. of this word and the punctuation mark following it are so badly printed, or smeared, that it is not possible to tell exactly what was in- tended. Some copies fail to catch the 1. at all, and others seem to have the same characters so badly smeared that the . looks like a smeared comma. But in IU 821M64L 16732, copy 3 and in 16732, copy 2 the printing is clearly will.

84

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

039)

Or to him have render'd lefs^ And not fre'd my foe for naught V

Let th' enemy purfue my foul And overtake it, let him tread My life down to the earth and soal In theduft my glory dead, In the duft and there out fpread Lodge it with difhonour fouL

Rife Jehovah in thine ire Rouze thy felf amidft the rage Of my foes that urge like fir e> And wake for me, their furiVaflfoage » Judgment here thou didftingage And command which I defire.

So th' afTemblies of each Nation Will furround thee,feekingtigjit, Thence to thy glorious habitation Return on high and in their fight. Jehovah judgeth moft upright All people from the worlds foundation.

Judge me Lord, be judge in this According to my righteoufnels And the innocence which is

15

20

25

30

<«4*0

Upon me : eaufe at length to ceafe

Of evil men the wickedness And their power that do amife.

But the juft eftablifh faft,

Since thou art the juft God that tries

Hearts and reins. On God is caft

My defence, and in him lies

In him who both juft and wife

Saves th' upright of Heart atlaft.

God is a juft Judge and (evere.

And God is every day offended >

If th' un juft will not forbear,

His Sword he whets, his Bow hath bended

Already, and for him intended

The tools of death, that waits him near.

(His arrows purpofely made be For them that perfecute.) Behold He travels big with vanjtie, Trouble he hath conceav'd of old As in a womb, and from that mould Hath at length brought forth a Lie.

He dig'd a pit, and delv'd it deep, And fell into the pit he made,

35

40

45

50

Upon

55

His

PSALM PARAPHRASES— 1673

85

(140

His mifchicf that due courfe doth keep,

Turns on his head, and his ill trade

Of violence will undelay'd

Fall on his crown with ruine deep.

Then will I ]ehovah*s praife According to his juftice raife And ting the Name and Deitie Of Jehovah the moft high.

6o

TSAL. VIII. Aug. 14. 1653.

O Jehovah our Lord how wondrous great And glorious is thy name through all the earth ? So as above the Heavens thy praife to fet Out of the tender mouths of lateft bearth,

Out of the mouths of babes and fucklings thou 5

Haa founded ftrength becaufe of all thy foes

To flint th' enemy, and flack th'avengers brow That bends his rage thy providence te oppofc

When I behold thy Heavens, thy Fingers art,

The Moon and Stairs which thou fo bright haft fet, 10

In the pure firmament, then faith my heart,

O what is man that thou remerabreft yet,

And

Aid think'ft upon him v or jL man begot That him thou vifrVfi and of him art found 9

$carce to be lets then Gods, thou mad'ft his lot, 15

With honour and with ibte thou haft himaown'di

O're the works of thy hand thou mad'ft him Lord,

Thou haft put all under his lordly feet, AU Flocks, and Herds, by thy commanding word,

All beafts that in the field or forrcft meet, 20

Fowl of the Heavens, and Fifli that through the wet Sea-paths in (hoalsdo Aide. Andknow no dearth,

O Jehovah our Lord how wondrous great And glorious is thy name through all the earth.

April,

13 And] The n is broken and smeared in all copies examined.

86

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(H3)

April. 1648. J.M.

Nine of the Vfalms done into Metre , wherein all but what is in a different Char after , are the very words of the Text, tranjlated front the Original*

*-|-»]

PSAL. LXXX.

'Hou Shepherd that doft Ifrael kfep Give ear in time of need, Who leaded like a flock of (hcep

Thy loved Jofephs feed, That fitt'ft between the Cherubs bright 5

Between their wings ont-fpread Shine forth, and from thy cloud give light, And on our foes thy dread

2 In Ephraims view and Benjamins,

And in Manaffe's fight 10

Awake * thy ftrength, come, and he (ten * Gnorera. To fave us by thy might,

3 Turn us again, thy grace divim

To us O God vouchfafe >

Caufe thou thy face on us to fhine 15

And then we (hall be fife.

4 Lord

(«44)

4 Lord God of Hofts, how long wilt thqu,

How long wilt thou declare Thy * fmoaking wrath, and angry brow * Gnajhantat Againft thy peoples praire. 20

5 Thou feed'ft them with the bread of tears,

Their bread with tears they eat, And mak'ft them * largely dri nk the tears * Sbalijh. Wherwith their cheeks are wet. 5 Aftrifethoumak*frusW<*/>rey 25

To every neighbour foe, Among themfelves they * laugh, they * play, And * flouts at us they throw * Jilgnagu*

7 Return us, and thy grace divine >

O God of Hofts vouchfafe 30

Caufe thou thy face on us to (hioe, And then we (hall be fafe.

8 A Vine from iEgypt thou haft brought^

Thy free love made it thine,

And drov'ft out Nat ions proud and haut 35

To plant this lovely Vine.

f Thou did'ft prepare for it a pla<£

And root it deep and faft

That it began to grow apace,

And fill'd the land at lajh 40

?o With

PSALM PARAPHRASES — 1673

87

(H5)

10 With her green made that covcr'd all? The Hills were ovcr-fpread

Her Bows as high as Cedars tall Advancd their lofty bead.

1 1 Her branches on the wcjiern fide Down to the Sea (he fent,

And upward to that river wide Her other branches went.

12 Why haft thou laid her Hedges low And brok'n down her Fence,

That all may pluck her, as they go, With rudefi violence ?

13 The tuskgd Boar out of the wood Up turns it by the roots,

Wild Beads there brouze,and make their food Her Grapes and tender Shoots.

14 Return now, God of Hofts, look down From Hcav'n, thy Seat divine,

Behold «/, but without a frown> And vifit this thy Vine.

15 Vifit this Vine, which thy right hand Hath fet, and planted long,

And the young branch, that for thy felf Thou haft made firm and ftrong.

45

50

55

60

(14O

16 But now it is confum'd with firea And cut with Axes down,

They perifh at thy dreadfull ire, At thy rebuke and frown.

17 Upon the man of thy right hand Let thy good hand be laid,

Upon the Son of Man, whom thou Strong for thy felf haft made.

18 So (hall we not go back from thee *to wayes of fin and fhame,

Qujck'n us thou, then gladly wee

Shall call upon thy Name.

Return us, and thy grace divine

Lord God of Hofts voutfafey

Caufe thou thy face on us to (hine,

And then we (hall be fafe.

65

70

75

80

16 But

PSAL. LXXXI.

'O God our ftrength fing loud, and clear

Sing loud to God our King-,

To Jacobs God, that all may hear

Loud acclamations ring.

2 Prepaie

T

73 thee] The second e failed to print in many of the copies examined.

88

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

047) 9 Prepare a Hymn, prepare a Song

The Timbrel hither bring

The cheerfuU Pfaltry bring along

And Harp with pleafant firing,

3 Blow, as is wont, in the new Moon

With Trumpets lofty feund, Th' appointed time, the day wheron Our folemn Feaft comes round*

4 This was a Statute givn of old

For Ifrael to obftrvt A Law of Jacobs God, to bold From whence thy might notfwerve*

5 This he a Teftimony ordain'd

In Jofeph, not to change, When as he pafs'd through iEgypt land J The Tongue I heard, was ftrange.

6 From burden, and from flavijh toyle

I fet his (boulder free > His hands from pots, audmiriefoyle Deliver'd were by me*

7 When trouble did thee foreaffaile,

On me then didft thou call,

And I to free thee did notfaile,

And led the out of thrall*

K 2

043)

I anfwer'd thee in * thunder deep * Be Setber ragnafi.

With clouds encompafs'd round i

I tri'd thee at the water Jree/>

Of Meriba renown d.

8 Hear O my people, hearl(n mil-, 10 I teftifie to thee

Tbou antientfloskjoflfady If thou wilt lift to mee,

9 Throughout the land of thy abode

No alien God (hall be 15 Nor (halt thou to a forein God In honour bend thy knee.

10 I am the Lord thy God which brought Thee out of iEgypt land

Ask large enough, and I, befougbt, 20 Will grant thy full demand.

I I And yet my people would not bear, Nor hearken to my voice »

And Ifrael whom I lovdfo dear

Miilik'd me for his choice.

25 12 Then did I leave them to their will

And to their wandring mind i

Their own conceits they followed ftill

Their own devifes blind.

30

35

40

45

50

13 O

PSALM PARAPHRASES— 1673

89

C*4f)

13 O that ray people would be wife To ferve me all their dates ;

And O that Ifrael would advife To walk my rigbteout waies.

14 Then would I foon bring down their foes That now Jo proudly rife,

And turn my hand againft all thofe That an their enemies.

15 Who hate the Lord fl:ould then he fain To bow to him and bend,

But they-, his Feople,Jbould remain, Their time (hould have no end. \6 And we would feed them from thejhoc]^

With flowr of fineft wheat, And fatisfie them from the rock With Honey for their Meat.

55

60

65

PSAL. LXXXII.

1 f*] Od in the * great * affembly ftands

V. T Of Kings and lordly States, * Bagnadath- eh

f Among the gods f on both his hands f Bekgrev.

He judges and debates. 4

K 3 a How

05°)

2 How long will ye * pervert the right ^Ttfhphem

With * judgment falfe and wrong gnaveU

Favouring the wicked by your might* Who theme grow bold andfirong

3 * Regard the * weak and fatherlefs ¥ Shiphtu ■ dah

* Difpatch the * poor mans caufe, 10

And f raife the man in deep diftrefs By f juft and equal Lawes. \ Hatzdihp*

4 Defend the poor and defolate,

And refcue from the hands Of wicked men the low eftate 15

Of him that help demands.

5 They know not nor will underftand,

In darknefs they walk on The Earths foundations all are * movM 19

And * out of order gon. * Jimmottu

6 I faid that ye were Gods, yea all

The Sons of God moft high

7 But ye (hall die like men, and fall

As other Princes die.

8 Rife God, * judge thou the earth in might, 25

This wicked earth * redrels, * Shfphta*

For thou art he who (halt by right

The Nations al! poflefs.

PSAL,

The page numbering] The 9 is clogged with ink in its loop in all copies examined.

90

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

B

psal. Lxxxrir.

E not thou filent now at length O God hold not thy peace, Sit not thou (nil O God of firengtb We cry and do not ceafe.

2 For lo thy furious foes now * fwell

And * ftorm outragcoufly, And they that hate thee proud and fell Exalt their heads full hie.

3 Againft thy people they f contrive

t Their Plots and Counfels deep, -f sod. 10

* Them to enfnare they chiefly ftrivc *Jithjagnatsugnal.

* Whom thou doft hide and keep. * Tfephmeca.

4 Come let us cut them off fay they,

Till they no Nation be That Ifraels name for ever may 15

Be loft in memory.

5 For they confult f with all their might, f Levjachdatt*

And all as one in mind Themfelves againft thee they unite

And in firm union bind. 20

6 The tents of Edom, and the brood

Of fcotnful Nhmael,

* Jebemajun*

f Jagnarimn fSod.

K4

Moab,

. ("15s)

Moab, with f hem of Hagars blood That in the Vefart dwell,

7 Gebal and Ammon there confpire,

And hateful Amalec, The Philiitims, and they of Tyre Whofe hounds the Sea doth cheeky

8 With themgreat Afshuralfo bands

4ad doth confirm the tyot, All thefe have lent their armed hands To aid the Sons of Lot.

9 Do to them as to Midian hold

That wafted all the CojJI ToSifera, and as is told Thoudidft to Jabins haft, When at the brook of Kiflion old They wire repulfi andflnn,

10 At Endor quite cutoff, and rowl'd As dung upon the plain.

1 1 As Zcb and Oreb evil fped So let their Princes fpeed

As Zeba,and Zalmunna£/ei So let their Princes bleed*

12 For they amidft their pride have faid By right now &all we feize

25

30

35

40

45 Gods

9 (margin) ]Jagnarimu ] All copies examined lack period following.

PSALM PARAPHRASES — 1673

91

(153)

Gods houfes,and will now invade

f Their (lately Palaces. f Neotb Elohim

13 My God, oh make them as a wheel bears both. No quiet let them find, 50

Giddy and reftlefi let them reel Like ftubble from the wind.

14 As when an aged wood takes fire Which on a fudden jhaiest

The greedy flame runs hier and hier 55

Till all the mountains blaze,

1 5 So with thy whirlwind them purfue, And with thy tempeft chafe i

\6 * And till they * yield thee honour duei * Theyfee^ Lord fill with ftiame their face. thy Name, Hcb.

17 Atham'd and troubl'd let-them be, 61 Troubl'd and (ham'd for ever,

Ever confounded, and fo die With fhame, andfcape it never.

18 Then (hall they know that thou whofe name 65 jchova is alone,

Art the moft high, and thou the fame O're all the earth art one.

PSAL.

Ci54> PSAL. LXXXIV, ]

1 How lovely are thy dwellings fair !

O Lord of Hoafts, how dear The pleafant Tabernacles are ! Where thou dofi dwell fo near.

2 My Soul doth long and almoft die

Thy Courts O Lord to fee, My heart and flefti aloud docrie, O living God, for thee.

3 There ev'n the Sparrow freed from wring

Hath found a houfe of refty The Swallow there, to lay her young

Hath built her brooding neft, Ev'n by thy Altars Lord of Hoafts

Ihey find their fafe abode-, *And home they fly from round the Coafis

'toward thee, My King, my God.

4 Happy, who in thy houfe refide

Where thee they ever praife,

5 Happy, whofe ftrength in thee doth bide,

And in their hearts thy waics- <$ They pafs through Baca's thirfiie Vale, 'that dry and barren ground

10

15

20

As

92

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

055)

As through a fruitfull watry Dale Where Springs and Showrs abound.

7 They journey On from ftrength to ftrength

Withjoy andgladfom cheer Ttill all before our God at length In Sion do appear.

8 Lord God of Hoafts hear new my praier

O Jacobs God give ear, p Thou God our fhield look on the face

Of thy anointed dear. io For one day in thy Courts to be Is better, and more bieft Then in the joy es of Vanity, A thoufand daies at beft. I in the temple of my God Had rather keep a dore, Then dwell in Tents, and rich abode With Sin for evermore.

1 1 For God the Lord both Sun and Shield Gives grace and glory brighty

No good from them (hall be with- held Whofe waies are juft and right*

1 2 Lord God of Hoafts that raign*(l on high, That man is truly bleft,

25

30

35

40

45

Who

(150

Who only on thee doth relie, And in thee only *eft.

PSAL. LXXXV.

1 r~ | "*Hy Land to favour gracioufly

1 Thou haft not Lord been flack, Thou haft from hard Captivity Returned Jacob back.

2 Th' iniquity thou didft forgive 5

'that wrought thy people woe,

[ And all their Sin?that did thee grieve

Haft hid where nonejhall kyow.

3 Thine anger all thou hadft removed,

And calmly didft return 10

From thy f fierce wrath which we had prov'd + Heb. Far worfc then fire to burn. ^hebufningheat

4 God of our faving health and peace, of thy wrath.

Turn us, and us reftore, Thine indignation caufe to ceafe Toward us, and chide no more.

5 Wilt thou be angry without end,

For ever angry thus

Wilt thou thy frowning ire extend

from age to age on us ? 20

6 Wilt

15 !

44 right+] Note star shaped period in all copies. errata page, 1673.

See line 1 1 of

Psalm LXXXV. 7 And] A few copies have spacer mark like a square bracket before the word, thus [And but only a half dozen of the 40 to 50 copies examined, the others lacking the mark.

PSALM PARAPHRASES — 1673

93

6 Wilt thou nor * turn, and bear our voice * Heb. Tttrt

And us again * revive, to quicken us.

That fo thy people may rejoyce By thee preferv'd alive.

7 Caufe us to fee thy goodnefs Lord, 25

To us thy mercy fhew Thy faving health to us afford And life in us renew,

8 And mw what God the Lord will fpeak

I will goftrait and hear, 30

For to his people he fpeaks peace

And to his Saints/*// dear, To his dear Saints he will fpeak peace,

But let them never more Return to folly, butfurceafe 35

1

fotrefpafs as before.

9 Surely to fuch as do him feat

Salvation is at hand And glory (hall erelong appear to dwell within our Land. 40

10 Mercy and Truth that long were mifs'd Nowjay/w/Zyaremet

Sweet Peace and Righteoufnefs have kifs'd And band in band are feu

Truth

(158)

1 1 Truth from the earth Hf^ to afiowi\ 45 Shall bud and bloflbm then,

And Jultice from her heavenly bowr look down on mortal men*

12 The Lord will alfo thenbeftow

Whatever thing is good 50

Our Land mail forth in plenty throw Her fruits to be our food.

13 Before him Righteoufnefs (hall go His Royal Harbinger,

Then * will he come, and nQt be flow 55

His footfteps cannot err.

* Heb. He wiUfet bis fieps to the way*

PSAL. LXXXVI.

1 *"" "^Hy gracious ear, O Lord, encline,

1 O hear me 1 thee pay, For I am poor, and almoft pine

with need, and fad decay. 4

2 Preferve my foul, for f I have trod f Heb. Iamgood,

Thy waits, and love the juft, loving , a doer of

Save thou thy fervant O my God good and holy

Who Ull in thee doth tiuft. things.

3 P«fy

94

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

0595

3 Pitty me Lord for daily thee I call > 4. O make rejoyce Thy Servants Soul > for Lord to thee I lift my foul and voice,

5 For thou art good, thou Lord art prone

To pardon, thou to all •Art full of mercy, thou alone To them that on thee call.

6 Unto my fupplication Lord

give ear, andtothecrie

Of my incejfant praiers afford

Thy hearing gracioufly*

7 I in the day of my diftrefs

Will call on thee for aid* For thou wilt grant me free accefs And anfwer, what I pray d, $ Like thee among the gods is none O Lord, nor any works Of all that other gods have done Like to thy glorious works. £ The Nations all whom thou haft made Shall come, and alljhall frame To bow them low before thee Lord, And glorifie thy name.

10

15

20

25

30

10 For

10 For great thcu art, and wonders great

By thy ftronghand are done, Thou in thy everlafiing Seat Remained God alone.

11 Teach me O Lord thy way moft right, I in thy truth will bide,

To fear thy name my heart unite So Jhall it never flide

12 Thee will I praife O Lord my God 'thee honour , and adore

"With my whole heart, and blaze abroad Thy name for ever more.

13 For great thy mercy is toward me, And thou haft free'd my Soul

Eev'n from the lovveft Hell fet free From deepeft darkgefs fold.

14 O God the proud againft mz rile And violent men are met

To feek my life, and in their eyes

No fear of thee have Cct. 5 But thou Lord art the God moft mild

Readieft thy grace to fhew, Slow to be angry, and art jliVd

Mcft merciful), moft true.

35

40

45

50

55

\6 O

26 Lord,] All copies have italic L. Columbia has no note, and text reads 'Lord,'.

PSALM PARAPHRASES— 1673

95

(161)

16 O turn to me thy fact at length* And me have mercy on,

Unto thy fervant give thy ftrength, And fave thy hand-maids Son.

17 Some fignefgood to me afford. And let my foes then fee

And be afham'd, becaufe thou Lord Do'ft help and comfort me.

PSAL. LXXXVIL

1 A Mong the holy Mountains high jfV Is his foundation faft,

there Seated in hh SanUmry, His temple there Uplac't.

2 Sions fair Gates the Lord loves more

Then all the dwellings fsire Of Jacobs Land, though there hefiore, And, all within hit core*

3 City of God, moft glorious things

Of thee abroad are /poke ;

4 I mention Egypt, where proud Kings

Did our forefathers yok$y

60

10

I mention Babel to my friends,

FhWifth full of [corn, And Tyre with Ethiops tttmojl ends,

Lo this man there was born :

5 But wife that praifejhall in our car

Be faid of Sion laft This and this man was born in her, High God mall fix her faft.

6 The Lord (hall write it in a Scrowle

That ne're (hall be out- worn When he the Nations doth enrowle That this man there was born.

7 Both they who fing, and they who dance

With J 'acred Songs are there, In thee frejh brooks, and foft f reams glance And all my fountains clear.

15

20

25

I rntn^

PSAL. LXXXVIII.

Ord God that doft me fave and keep, All day to thee I cry i And all night long, before thee weep Before thee frojlrate lie*

L

2 Into

Psalm LXXXVI. 60 Son.] The S drops below the line of the rest of the type in all copies examined.

96

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

2 Info thy prefence let my praier

With fighs devout afcend AM to my cries, that ceafdefs are, Thine ear with favour bend.

3 For cloy'd with woes and trouble (tore

Surcharg'd my Soul doth lie, My life at deaths mtcherful dore Unto the grave draws nigh.

4 ReckVd I am with them that pafs

Down to the difmal pit I am a * man, but weak alas * Heb. A man without And for that name unfit. manly firength,

5 From life difch'arg'd and parted quite

Among the dead tojkep, And like the flain in bloody fight

That in the grave lie deep. Whom thou remembered no more,

Doft never more regard, Them from thy hand delivered o're

Deaths hideous houfe bath barr*d.

6 Thou in the loweft pit profound

Haft fet me all forlorn, Where thickeft darknefs hovers round. In honid deeps to mourn.

10

14

20

25

L a

7 Thy

(1*0

7 Thy wrath/row which no Jhelter faves

Full fore doth prefs on me i 30

* Thou break'ft upon me all thy waves, * The Hebr.

* And all thy waves break me. bears both*

8 Thou doft my friends from me eftrange,

And mak'ft me odious, Me to them odious,/or they change, 35

And I here pent up thus. o Through forrow, and affliction great Mine eye grows dim and dead, Lord all the day I thee entreat, My hands to thee I fpread. 40

10 Wilt thou do wonders on the dead, Shall the deceased arife

And praife thee from their loatbfom bed With pale and hollpw eyes ?

1 1 Shall they thy loving kindnefs tell 45 On whom the grave hath hold,

Or they who in perdition dwell Thy faithfulnefs unfold>

12 In darknefs can thy mighty band

Or wondrous a#si>e known, 50

Thy juftice in the gloomy land

Of darj^ oblivion >

13 But

PSALM LXXXVIII— 1673 97

(16$)

13 But I to thee O Lord do cry E'reyet my life beffenu

And $tp to thee my praier doth hie 55

Each morn, and thee prevent.

14 Why wilt thou Lord my foul forfakc, And hide thy face from me,

15 That* am already bruis'd, and f (hake \Heb. Prd With terror fent from thee i Gmwffiont. 60

Bruz'd, and afflicted and fo low

As ready to expire, While I thy terrors undergo

AftoniuYd with thine ire.

1 6 Thy fierce wrath over me doth flow 65 Thy threatnings cut me through.

17 All day they round about me go,

Like waves they me perfue.

18 Lover and friend thou haft remov'd

And fever'd from me far. 70

They/7y me now whom I have Iov'd, And as in darkncfs are.

FINIS.

There is no signature on this page though it should normally be signed L3.

98 THE LATIN AND GREEK POEMS— 1673

THE LATIN AND GREEK POEMS— 1673

MILTON'S LATIN POEMS present a much simpler textual problem on the whole than do the English. In 1645 ne printed all but one of the serious poems written in Latin, printing them again in 1673 with the addition of the two poems, Apologiis dc Rustico et Hero and Ad Joannem Rousiiim, probably but not certainly the first of these having been written even before the appearance of the first edition of his poems in 1645. There are also the scattered light and scurrilous fragments found in the controversial Latin prose pieces of the 1650's, none of which Milton saw fit to include in the 1673 edition of his poems. There is one notable fact about the text of his Latin poetry that needs emphasizing. This is the fact that we possess no manuscripts of any of it that are certainly authentic copies made either by Milton or under his di- rection. There is one possible, but not probable exception, viz., the manuscript now in the Bodleian Library at Oxford that contains Ad Joannem Rousium. This, however, is probably but not nec- essarily in some other hand than Milton's. That is, the handwriting is unlike any writing known to be Milton's own. It is possible, the copy being in a large, set hand, that the writing represents the kind of handwriting Milton employed for formal, fair, and final copy. But we cannot be cer- tain that this document is actually in Milton's handwriting. That is, we have no holograph copies of any of the Latin poems.

Milton preserved and printed three poems in Greek. They occur in the 1645 edition and again in the 1673, but one of them, In Effigiei, is engraved under the portrait at the beginning of the 1645 edition, but printed in the text of 1673. There is little point in collating the engraved and printed texts. The text of Psalm CXIV occupies an entire page in both editions; see page 69 of the 1645 Latin poems. The Greek type of the 1673 edition is smaller than that found in the 1645 edition, but 1673 is a nttle more clearly printed. The Greek characters used are not quite the same, 1673 using a standard 0 medially, and 1645 using a character for 6 that looks like d. The rough breathing at the beginning of a line in 1645 usually follows its vowel, and in 1673 indiffer- ently may precede the vowel at the top, be set directly over the vowel, or, as in lines 16 and 21, precede its vowel at its foot. The accent marks are so small and broken in both editions that not all differences which can be pointed out are worth pointing out, as there can be little certainty about some of them, especially several breathings and straight accents. Combinations of breath- ings and accents are all but impossible to determine. Some of them may be other than they appear even under great magnification. The tilde, with or without breathing or accent, is very difficult to determine.

Philosophus ad regent occurs in both 1645 and 1673 editions. The fourth line was rewritten and is different in 1673. Aside from this line, there are few apparent variants between the two editions; but again, as in the preceding poem, the type and markings used in each edition are of a different size and font, and both sets of type are so small and so worn that satisfactory collations are almost impossible.

In Effigiei. These are the lines that were engraved under the unflattering portrait in the 1645 edition; see page 153. Because of the presence of this piece in the text of 1673, but not in the text of 1645, the pagination of the two editions begins to diverge at this point.

LATIN TITLE PAGE— 1673 99

Joannis Miltoni P O E M A T A:

Quorum pleraque intra Annum " aetacis Vigefimum Confcripfit.

3\(unc primum Edita.

LONDINI,

Excudebat W. R. Anno 1675,

Note the retention of the line from 1645, Nunc primum Edita. The printer W.R. has been identified earlier as William Rawlins, see pages 7 and 8. The page should carry the signature letter L4 but as on the preceding page, it is lacking. The Latin poems were certainly printed continuously with the Eng- lish, as the four leaves following this title-page are conjugate with it and the three leaves preceding it.

100

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

C?)

(4)

****&*Swj<r/ ^X**:^&7.$*&tog^?*

JEc quae fequuntur de Authore teftimonia , tametfi ipfe intelli- gebat non tarn de fe quam fupra fe efle di&a , eo quod praclaro ingenio viri , nee non amici ita fere fblent laudare , ut omnia fuis potius vir- tutibus , quam veritati congruentia nimis cupide affingant , noluit tamen horum egre- giam in fe voluntatem non efle notam 3 Cum alii praefertim ut id faceret magnopcre fiiade- rent. Dum enim nimice Iaudis invidiam totis ab fe viribus amolitur, fibique quod plus a?quo eft non attributum efle mavult , judi- cium interim hominum cordatorum atque il- luftrium quin fiimmo fibi honori ducat, negare non poteft.

foannes Baptifla Manfus, Marchio

Villenfis mafolitanus ad Joannem Miltonium Anglunu

T7T mens, forma, decor, fades, mos, fi pietas fie, ▼ Non Anglus, verum hercte Angelus ipfe fores. ■

Ad Joannem Miltonem Anglum triflici

poejeos laurea coronandum Gr£ca ntmirum^

Latina , atque Hetrufca , Epjgramma

Joannif SalJilU Komanu

Ede Meles, cedat deprefla Mincius urna i 10

Sebetus Tartu m definat ufque loqui i At Thamefis vi&or cun&is ferat altior undas, Nam per te,Mi!to, par tribus unus erit.

c

15

"jcannes

Ad Joannem Miltonum.

/^Rscia Masonidem, ja&et fibi Roma Maronem, Anglia Miltonum jadat utrique parem.

SelvaggJ.

15

Al

The collations here are between 1673 and 1645. 3 quam]

quam 4 eo] eo quod] quod praeclaro] preclaro 7 quam] quam 8 cupide] cupide

The collations are between 1673 and 1645. 4 Vt] Ut

7 laurea] laured Graeca] Grxcd 8 Latina,] Latind, Hetrufca,]

Hetrujcd, 12 undas,] undas 13 te, Milto,] te Milto

DE AUTHORE TESTIMONIA— 1673

101

AlSignor Gio. Miltoni Nobile Inglefe. ODE.

ERgimi aW Etra q Clio Ferche difielle intrecciero corona Non piu del Biondo Dh La Fronde eterna in Findo, e in Elicona, Dienji a merto maggior, tnaggiori i fregi, A'celefte virtu celefii pregi.

NonpHo del tempo edace Kimaner pnda, eterno alto valore Nonpuo I'tblio r apace Furar dalle memorie eccelfo onore, Su l*arco di mia cetra un dardo forte Virtu m'addatti, eferiro la morte.

Del Ocean profondo

Cinta dagli ampigorgbi Anglia rifiede

Separata dal mondo,

Fero cbe il fuo valor Vumano eccede :

Qnefta feeonda fa produrre Eroi,

€tf banno a ragion del fwrnman tra no'u

10

i5

CO

Alia virtu shandita

Damo ne ipttti hrfido ricettt,

Quella gli e fol gradita,

Fercbe in lei fan trovargina, t diletto >

Kidillo tu, Giovanni, e moftra in tanto

Con tua vera virtu, vero ilmio Canto:*

Lungi dal F atria lido

Spinfe Zeuft rindujire ardente branta i

Ch* udio £ Helena il grida

Con aurea trombarimbombar lafama,

Eperpoterla effigiare alparo

Dalle pin belle Idee traffe ilpr'm raro.

Cofi XApe Ingegnofa

'trae con induftria il fuo liquor pregiato

Dalgiglio e data rofa,

E quanti vagbifiori ornano ilprato ',

Formano un dolcefuon diverfe C horde,

Fan varie voci mtlodia concorde*

Di bella gloria amante

Milton dal Ciel natio per varie parti

20

25

30

35

he

Alia

i o] b 2 intrecciero] intreccierb 3 piu] piu 6 virtu] virtu 9 puo] pud 12 Virtu] Virtu m'addatti,} m'adatti, feriro] ferirb 16 Pero] Perb 17 fa] fa

19 virtu] virtu 21 e] ^ 23 tu,] lu Giovanni,] Giovanni 24 virtu,] virtu, 28 Con] The C is from a different and larger type font in all copies examined. 30 piu] piu priu] priu 38 natio] natio

102

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(7)

Le peregrine piantt Volgejii a ricercarfcienze, ed arti > Del Gallo tegnator vedefii i Kegniy E del? Italia ancorgf Eroipiu degni*

Fabrs quafi divim

Sol virtu rintracciando il tuopenftero

Videinognicsnfino

Chi di nobil valor calca il fent'uro >

Vottimo dal miglior dopo fcegliea)

Perfabbricar d%ogni virtu V Idea,

Quanti nacquero in flora

0 in lei delparlar Tofco apprefer f artet

La cui memoria ottora

II mondofatta eterna in done carte ,

Volefii ricercar per tuo teforo,

E parlafii con lor ttell* opre loro*

Nell' altera Babelle

Per te il parlar confufe Giove in vano,

Che per varie favelle

Di fe fieffa trofeo cadde ful piano :

40

45

50

55

(8)

Ch* Ode oW all Anglia il fuopiu degno Idiom* Spagna, Francis cfofccmai e Grecia e Roma*

Ipiuprofondi arcani

Ch' occulta la natura e in cielo e in terra

Ch' a Ingegni fovrumani

'iroppo avara tal* hor gliebiude, eferra,

C hiaramente conofci, egtmgi alfine

Delia moral virtude al gran confine*

Non batta il tempo fale,

Fermifi immoto, e in un fcrminfi gF anniy

Che di virtu immortak

Scorron di troppo uigiuriofi a i damn ;

Che s'opte degne di Poemaeftoria

Furongia, Vhaiprcfcnti alia memoria,

Dammi tna dolce Cetra

Se vuoi cVio dica del tuo dolce canto,

Cb'ittalzandoti all* Etra

Di farti huomo ce!e(le ottiette il vantoy

II Tamigi ildira cbe gV e concejjo

Per tefuo cigw pareggiar Permefi.

6o

65

70

75

cfy

n

42 degni.] In all copies of 1673 examined, the dot over the i looks like a grave accent; but may well be a battered dot. 44 virtu] virtU

63 Ch'a] Ch'd 68 fermin fi] ] 69 virtu] virtil 71 e] o

73 Cetra] In all 1673 copies examined, the C is above the line.

76 celefte] The I barely printed in all 1673 copies examined.

77 dira] dird gl'e] gl'Z

DE AUTHORE TESTIMONIA— 1673

103

(9)

IocbeinrivadelArtto

T'ento fpiegar tuo mrto alto, epreclaro

So cbe fatlco indarno>

E ad ammirari non a lodarh impara\

Frew dunque la lingua, e afcolto il con

Cbe tiprende a lodar con loftupore*

Del fig. Antonio Francini gentilhuomo

Fiorentino.

8o

JO ANN I

(10.)

«Wr trtt3 «!*» «\J»» ci&a t$£

10

JO ANN I ML70 N I

LONDINENSi,

3uvetii Patria, vircutibus eximio,

" Iro qui mult a. peregrinatione , fludio cunclat orbis terrarutn loca perfpexit , at novas Utyjjes omnia ubique ab omnibus apprebendcrct.

Polyglotto , in cu)us ore lingua jam deperdita fie revi' vifatnt, utidiomata omnia (int in ejus laudibus infaeunda; Er jure ea percallet ut admirationes & plaufus populorum ab propria* fapientia excitatos, intelligat.

Mi, cuius animi dotes corporifque, fenfus adadmirationemtom- movent , & per ipjam motum cuique auftrunt ■■> cujus opera ad plaufus bortantur, fid venuftate voctm laudatoribus adimunt.

Cut in Memoria tot as Orbis : In Intelleclu Sapientia : In volun- tas ardor gloria : In ore Eloquentia : Harmonicos collegium Sphte- 15 rarum fonitns Aponomia Due; audienti > Cbaracleres mirabilium natura per quos Dei magnitttdo defcribitux magiflra Vhilofophia le- genti *, Antiquitatnm laiebras , vetuftatis excidia , truditienis am* bages comit: affdua ant or urn Lefiione.

Exquinnti, rcftduranti, percurrenti. At cur nit or in aiduum ? Illi in cu)us zirtutibus cvulgandis ora Fama von fufficiant , nee hominum (iupor in laudandis fatis e[t. Reverentia &■ amoris ergo htc ejus. memis\deb$tum admirationis tributm ojfert Carolus Dolus t Mucins Florevtinut.

20

25

tanto homhii fervus, tanta virtutis atttator.

Elegiarum

79 / o] ] Most editors have printed this Io 80 fpiegar] spiegar

1 MLTONI) MILTONI 2 LONDINENSI.] Londinensi. 4 cuncta,] cuncta terrarum] terra-rarum 13 venuftate] vaftitate 14 Intellectu] intelleclu Sapientia:] Sapientia. 15 glorix:] glorix. In] in Harmonicos] Harmoni cos cceleftium] celeftium 16 audienti;] audieuti, 23 eft.] eft,

104

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

Cm)

'»y«y#yi

ELEGIARUM

Liber Primus*

Elegia prima ad Carolum Diedatum.

TAndem, chare, tua? mihi pervencre tabell*, Pertdlit & voces nuncia charta tuas, Pertulit occidui Devs Ceftienits ab ora Vergivium prOno qui petit amne falunu Multiim crede juvat terras aluiffe remotas

Pe&us amaris noftri, tamque fidele caput, Quodque mihi lepidum tellus longinqUa fodalem

Debet, at unde brevi reddere jufla vclrt. Me tenet urbs reftua~ quam tfhamefis alluit undS,

Meque nee invitum patria dulcis habet. Jam ncc arundiferum mihicura revifere Camum,

Nee dudum vetiti melaris angit amor. Nuda nee am p!acent,ujnbrafque negantia moUcs,

Quam male Pbcebicolis corivenit ille locus! Ncc duri libet ufque mmas perferre magiftri tcraquc ingenianonfubcujida meo.

M Si

10

i5

,:eu>

Si fit hoc exilium patrios adiiffe penates,

£t vacuum cur is otia- gtatta-ftq&i, Non ego vel profugi nomen, fortemve recufo,

Lastus & cteilirconctfrionefru&u O utinam vates nunquam graviora tuliffet

Ille Tomitano flcotffrexifl agttr", Non tunc Jonip quicquam ceffiflet Homero

Neve fbreVvi&o tail's tibi prima Maro. Tempqra nam licet hicpfecjdis dare libera- Mtffo;

Et totum rapiunt me raea vita librh Excipit hinc fefliim firoefi jj?j£>ropa theatric

Et vocat ad plaufusgarrula fcena fuosw Seu catus auditor fenior, feu prodigusjiaeres*

Seu procus, aut pofitacaffide miles adeft, Sive decennali fqeeundus lite patronuS;

Detonat inculto harbata verba foro, Sa:pe vafex gnatofuccurrit feivus atnanti,

Et nafum rigidi fallit ubiquc Patris j Saepe novos.illic vtrgomirata calores

Q^jd fit amor nefcit, dum quoque ndfc«,amat. Sive cruentatum (yriofa Tragofdia fcejjtrttm

QjafTat, & effufis crinibus ora rotafj Et dolet, & fpe&o, juvat & fpedaffedolehdo,

Intredum & lacry mis dulcis amaror inert :

20

25

30

35

40

Seu

In the row of ornaments at the top of the page, the ornament that is eleventh from the left is a large question mark in all copies examined. In the second line of the book title Primus.] primus. The text of the first Latin elegy was first printed in 1645, and was printed again in 1673. No other primary texts exist. The collations are between 1673 and 1645. 2 nuncia] nuntia 12 me laris] melaris 13 molles,] There are three different states of the 1645 text, viz., molles, molles molle See note to this line with 1645 text p. 221.

24 tibi] The second i is broken in all 1673 copies examined. 30 Seu procus,] Seuprocus, 36 Quid] In all 1673 copies

examined, the u failed to print clearly, due to the presence of the heavy horizontal kern on the Q. This is the first of several such cases in the Latin poems of the kern of the upper case Q preventing the letter following, always u of course, from printing clearly. But in many other occurrences of these same letters, the u printed clearly. 38 Quaffet,] In all 1673 copies examined the u failed to print clearly.

ELEGIA PRIMA— 1673

105

Seupucr infelix indelibata reliquit

Gaudia, & abrupto flendus amore cadif, Seu ferus e tenebris iterat Styga criminis ultor

Confcia funcreo pe&ora tone movens, Seu maeret Pelopeia domus, feu nobilis Hi, 45

Aut luit inceftos aula Creontis avos. Sed neque Tub te&o temper nee in uxbe latemus,

Irrita nee nobis tempore veris cunt. Nos quoque lucus habet vicma confitus ulmo

Atque fuburbani nobilis umbra loci* 50

Sspius hie blandas fpirantia fydera flammas

Virgineos videas priteriifle choros. Ahquoties dignae ftupui miracula forms

Quae poffit fenium vel reparare Jo vis j Ah quoties vidi (uperantia lumina geaimas, 55

Atque faces quotquot volvit uterque polus i Collaque bis vivi Fdopis quae brachia vincant,

Quaeque fluit puro neotoe tin&a via, £t decus eximium frontis, tremulofque capillos,

Aurea quae fallax retia tendit Amor. 60

Pellacefque genas, ad quashyacinthinafordet

Purpura, $c ipfe tui floiis, Adoni, rubor.

Cedite laudataetoties Heroides olim,

Et quscunque vagum cepir arnica Jovem.

M a Cedite

(14)

Cedite Achasmenia: tuuita fronte puell*,

Et quot Sufa colunt, Memnoniamque Ninon. Vos etiam Danaae fafces fubmittite Nymphat, *

Et vos Iliacat, Romuleaeque nurus. Nee Pompeianas Tarpeja Mufa columnas

Jacket, & Anfoniis plena theatra ftolis. Gloria Virginibus debetur prima Britannis,

Extera fat tibi fit fcemina poffc fequi. Tuque urbs Dardaniis Londinum ftru&a colonis

Turrigerum late confpicienda caput, Tu nimium felix intra tua mcenia claudis

Quicquid formofi pendulus orbis habet. Non tibi tot ca?lo fcintillant aftra fereno

Endymioneae turba miniftra dese, Qjot tibi confpicus formaque auroque puella?

Per medias radiant turba videnda vias, Creditur hue geminis venhTe invedta columbis

Alma pharetrigero milite cin&a Venus, Huic Cnidon, & riguas Simoentis'flumine valles,

Huic Paphon, & rofeam pofthabitura Cypron. Aftego,dum puerk Unit indulgentia cacci,

Mcenia quam fubito linquere faufta paro j Et vitare procul malcfidse infamia Circes

Atria, divini Molyos ufus ope.

65

70

75

80

85

Stat

43 e] e 54 poffit] poffet Jovis;] Iovis;

69 Tarpeia] The mark over the e is a circumflex with the top cut off. 78 Endymioneae] The ae ligature is upside down in all 1673 copies examined. 79 Quot] In all 1673 copies examined, the u failed to print clearly. 80 vias,] vias.

106

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

05)

S;at quoque juncofas Cami remeare paludes,

Atque iterum rauot murmur adire Schols . go

Inferea fidi parvum cape munus amid, t Paucaque in alternos verba coa&a modos.

Elegia fccunda, Anno statis i/«

In obitum Prjeconis Academici Cantabrigienfis.

TE, qui confpicuus baculo fulgente folebas Palladium toties ore ciere gregem, Ultima prajconum prsconem te quoque facva

Mors rapit, officio nee favet ipfa fuo. Candidiora licet fuerint tibi tempera pluoris 5

Sub quibus accipimus delituhTe Jovem, O dignus tamen Hxmonlo juvenefcere fucco,

Dignusin iEfonios vivere pofTc dies, Dignus quern Stygiis medica revocaret ab undis

Arte Coronides, faepe rogante dea, 10

Tu fi jufTus eras acies accire togatas,

£t celer a Phcebo nuntius ire tuo.

Talis in Iliaca ftabat Cyllenius aula

AHpcSj stherca muTus abarce Patris.

M 3 Talis

15

20

00

Talis & EurybatesanteorafurentisAchillei

Rettulit Afridae juffa fevera ducis. Magna fepulchrorum regina, fatelles kverni

Sxva nimis Mufis, Palladi faeva nimis, Q^in illos rapias qui pondus inutile terras

Turba quidem eft telis ifta petenda tuis. Veftibus hunc igitur pullis Academia luge,

Et madeant iachrymis nigra feretra tuis, Fundat & ipfa modos querebunda Elegeia trifies,

Perfonet & totis naenia moefta fcholis.

Elegia tertia, Anno astatis 17, In obitum Vr<efilis Wintonknp*

MOeftus cram, & tacitus nullocomitante fedebam, Hxrebantque animo triftia plura meo, Protinus en fubiit funeftae cladis Imago

Fecit in Angliaco quam Libitina folo i Dum procerum ingreffa eft fplendentes marmore tusres 5

Dira fepulchrali mors metuenda face \ Pulkviique auro gravidos & jafpide muros,

Nee metuit fatrapum ftanere falec gwges. Tunc memini cfcrique ducis, fratrifque verendi

Intempeftivis ofTa crcmata rogts. 10

Et

Elegy II. Title. Praeconis] In all 1673 copies examined the first two letters P r are out of line and given too much space. 5 plumis] In all 1673 copies examined, the s is slightly above the line of type. 12 a] a tuo, ] tuo

Elegy II. 19 Quin] In all 1673 copies examined, the u has failed to print clearly. 23 Elegeia) This is one of many

similar cases in all of which the diacritical marking is not clear. Usually, the case concerns, as here, the diaeresis or the much more rarely intended circumflex. All cases represent attempts to use accent marks from inadequate and badly worn type fonts. The diaeresis that is usually called for is most frequently a circumflex with the top cut off. Then often, as here, the circumflex was badly mangled, and often only one side or the other of it remained; or a single dot appeared above the vowel. This was especially apt to happen if the letter either side of the one accented was an i as here, for the dot over the i could and often did interfere with the accent mark.

Elegy III. 1 Moeftus] Moeftus 3 Imago] imago

ELEGIA TERTIA— 1673

107

07) Et memini Heroura quos vidic ad setheia iaptos.,

Flevit & amiflbs Belgia cota duces. At te prsecipue luxi digniffime prgeful,

Wintoniaeque olim gloria magna tuse i Delicui flctu, & tiifti fie ore querebar, i5

Mors fera Tartareo diva fecunda Jovi, Nonne fatis quod fylva tuas perfentiat iras,

Et quod in herbofos jus tibi detur agros, Quodque afflata tuo marcefcant lilia tabo,

Et crocus, & pulchra? Cypridi facra rofa, 20

Nee finis ut Temper fluvio contermina quercus

Miretur lapfus praetereuntis aqua? ? Et tibi fuccumbit liquido quae plurima ccelo

Evehitur pennis quamlibet augur avis, Et qua; mille nigris errant animalia fylvis, 25

Et quod alunt mutum Proteos antra pecus. Invida, tanta tibi cum fit concefla poteftas >

Quid juvat humana tingere caede manus ? Nobileque in pe&us certas acuifle fagittas,

Semideamque animam fede fugafTe fua ? 30

Talia dumUcryrnans alto fub pe&ore volvo,

Rofcidus otciduis Hefperus exit aquis, Et Tartefliaco fubmerferat aequore currum

Phoebus, ab eoo littore menfus iter.

M 4 Nsc

(18)

35

Nee mora, membra cavo pofui refovenda cubili,

Condiderant oculos noxque foporque meos. Cum mihi vifus cram lato fpatiarier agro,

Heu nequit ingenium vifa referre meum. Illic punicea radiabant omnia luce,

Ut matutino cum juga fole rubent. 40

Ac vcluti cum pandit opes Thaumantia proles,

Vcftitu nituit multicolore folum. Non dea tarn variis ornavit floribus hoxtos

Alcinoi, Zephyro Chloris amata levi. Flumina vetnantes lambunt argentca campos, 45

Ditior Hefperio flavet arena Tago. Serpit odoriferas per opes levis aura Favoni,

Aura fub innumeris humida nata rolls. Talis in extremis terras Gangetidis oris

Luciferi regis fingitur cflfe domus. 50

Ipfe racemiieris dum denfas vitibus umbras

Et peHucentes miror ubique locos, Ecce mihi fubito Praeful Wintonius aftat,

Sydereum nitido fulfrt in ore jubar i Veftis ad auratos defluxit Candida tabs, • 55

Infula divinum cinxerat alba caput.

Pumque fenex tali incedit,venerandus amidJu,

Intremuit laeto florea terra fono.

Agmina

23 cceIo] caelo 28 Quid] In all 1673 copies examined, the u failed to print clearly. 34 Phoebus,] Phoebus

53 Praeful] praeful 57 incedit] Spacer mark after the word in all 1673 copies examined. Not a punctuation mark.

108

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

09)

Agmina gemmatis plaudunt caelefiia pennis,

Pura triumphal] perfonat a?thra tuba. 6o

Qujfquc novum amplexu comitem can tuque falutaf,

Hofqae aliquis placido mifit ab ore fbnos j Nate veni, & patrii felix cape gaudia regni,

Semper ab hinc duro, nate, labore vaca. Dixit, & aligerae tetigerunt nablia turmae, 65

At mihi cum tenebris aurea pulfa quies9 Flebam turbatos Cephaleia pellice fomnos,

Taliacontingant fomnia faepe mihi.

Elegia quarta. Annoaetatis i8.

Ad Thomam Junium pr^ceptorem fuum, apudmercatores Anglicos Hamburg*

agentes, Taftoris mnnere fungentem.

GUrre pet immenfum fub'to mea littera pontum, I, pete Teutonicos laeve per asquor agros, Segncsrumpe moras, & nil, preco'r, obftet eunti,

Etfeftmantisnil remoretur iter. Ipfe ego Sicanio fhenantem carcere ventos 5

iEolon, & virides follicftabo Deos> Csruleamque fuis comitatam Dorida Nymphis,

Ut tibi dent placidam per fua regna viam.

At

(20)

At tu, fi poteris, celeres tibi fume jugalqf ,

Veda quibus Colchis fugit ab ore viri. Aut queis Triptolemus Scythicas devenit in oras

Grams Eleufina miflus ab urbe puer. Atque ubi Germanas flavere videbis arenas

Ditisad Hamburgh moenia flecle gradum, Dicitur occifo quae ducerc nomen ab Hama,

Cimbrica quern fertur clava dedifle neci* Vivit ibi antique clarus pietatis honore

Prseful Chrifticoias pafcere do&us oves i Ille quidero eft animae plufquam pars altera nofirr,

Dimidio vita? viveie cogor ego. Hei mihi quot pelagi, quot montes inter jefti

Mc faciunt alia parte carere mei I Chaiior ille mihi quam tu do&iffime Graium

Cliniadi, pronepos qui Telamonis erat. Qaaraque Stagirites generofo magnus alumno,

Qjem peperit Libyco Chaonisalms Jcvi. Qualis Amyntorides, qualis Philyreius H'.ros

Myrraidonum regi, talis & ille mihi. Primus ego Aonios illo praeeunte receflfus

Luftrabam, & bifidifacra vireta jugi, Pieriofque haufi latices, Clioque Tavente,

Caftalio fparli lacta ter ora mero.

10

15

20

25

30

Flammeus

Elegy IV. Title. 1 fuum,] fuum 3 agentes,] agentes 2 I,] In all 1673 copies examined, the I only, not the comma also, has dropped below the line of type.

25 Quamque] The u after the Q has failed to print clearly in all 1673 copies examined. 26 Quern] The u has failed to print clearly in all 1673 copies examined. 27 Philyreius] The ac- cent here is clearly a decapitated circumflex, in all 1673 copies examined.

ELEGIA QUARTA— 1673

109

(21)

Flammeus at fignum ter viderat arietis ffithon,

Induxitque auro lanea terga novo, Bifque novo terram fparfirii Chlori fenilem 35

Gramine, bifque tuasabftulit Aufter opes : Necdum ejus licuit mihi lumina pafcere vultu,

Aut linguae dulces aure bibiffe fonos. Vade igitur, curfuque Eurum prsverte fonorum,

Quam fit opus monitis res docet, ipfa vides, 40

Invenies dulci cum conjuge forte fedentem,

Mulcentem gretnio pignora chara fuo, Forfitan aut veterum praelarga volumina patrum

Verfantem, aut veri biblia facra Dei. Caeleftive animas faturantern rore tenellas, 45

Grande falutifers religionis opus. Utque folet, multam, fit dicere cura falutem,

Dicere quam decuif, fi modo adeiTet, her urn* Haec quoque paulum oculos in humum defixa modeftos,

Verba verecundo fis memor ore loqui : 50

Hasc tibi, fi teneris vacat inter prxlia Mufis

Mittit ab Angliaco littore fida roanus. Accipe 11 nee ram, quamvis fit fera, falutem >

Fiat & hoc ipfo gratioi ilia tibi.

Sera quidem, fed vera fuit, quam carta recepit 55

Icaris a knto Penelopeia viro«

Aft

Aft ego quid volui manifeftum tollere crimen,

Ipfequodexomni parte levare nequit. Arguitur tardus merit6,noxamque fatetur>

Et pudet officium deferuifTe fuum. 60

Tu modo da veniam fafTo, veniamque roganti,

Crimina diminui,quae patuere, folent. Non fcrus in pavidos rictus diducit bianfes8

Vulnifico pronos nee rapit ungue leo. Safpe far iffiferi crudelia pe&ora Thracis 65

Supplicis ad maeftas delicuere preces. Extenfaeque raanus avertunt fulminis iclus,

Placat & iratos hoftia parva Deos. Jamque diu fcripfiiTe tibi fust impetus illi,

Neve moras ultra ducere paflus Amor. 70

Nam vaga Fama refert, heu nuntia vera malorum !

In tibi fmitimis bella tumere locis, Teque tuamque urbem truculento milite cingi,

Et jam Saxonicos arma paraffe duces. Te circum late campos populatur Enyo, 75

Et fata came virum jam cruor arva rigaf. Germanifque fuum conceffit Thracia Martem,

Illuc Odryfios Mars pater cgit equos. Perpetuoque comans jam deflorefcit o!iva3

Fugit & aerifonam Diva perofa tubam, 80

Fugit

34 Induxitque] Jnduxitque 53 falutem;] falutem

61 faffo,] ] Columbia text is wrong. 76 virum] virum

110

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

03)

Fugit io terris, & jam non ultima virgo

Creditur ad fuperas ji'rta volafle domos, Te tamen interea belli ckcumfonat horror,

Vivis & ignoto folus inopfque folo i Ef, tibi quam patrii non exhibuere penates

Sede peregrina quaeris egenus opem. Patria dura parens, & faxis fa?vior albis

Spumea quae pulfat lit'toris unda tui, Siccine te decet innocuos exponere faetus i

Siccine in externam ferrea cogis humum, Et finis ut terris quaerant alimenta remotis

Quos tibi profpiciens miferat ipfe Deus, Et qui laeta ferunt de caelo nuntia, quiquc

Qase via poft cineres ducat ad aftra, docent ? Digna quidem Stygiis quae vivas clauTa tenebris,

iEteinaque animae digna perire fame ! Haud aliter vates terrae Thesbitidis olim

Preflit inaffueto dcvia tefqua pede, Defertafque Arabumfalebras, dum regis Achabi

Effugit atque tuas, Sidoni dira, manus. Talis & horrifono laceratus membra flagello..

Paulus ab iEmathia pellitur urbe Cilix- Pifcofseque ipfumGergeiTaecivis Jefum

Ftoibus ingratus ju(fit abire fuis,

85

90

95

100

At tii fume animos, nee fpescadat anxta curls

Nee tua concutiat decolor ofla metus. Sis etenim quamvis fulgentibus obfitus armis,

Intententque tibi millia tela necem, At nullis vel inerme latus violabitur armis,

Deque tuo cufpis nulla cruore bibet. Namque eris ipfe Dei radiante fub aegide tutusa

Ule tibi cuftos, & pugil ille tibi i Hlc Siona?se qui tot fub moenibus arcis

Aflyrios fudit node filente viros i 'nque fugam vertit quos in Samaritidas oras

Mifitab antiquis prifca Daraafcus agris, Terruit & denfas pavido cum rege cohortcs,

Aere dum vacuo buccina clara fonat, Cornea pulvereum dum verberat ungula campum,

Currus arenofam dum quatit a&us humum, Auditurque hinnitus equorum ad bella ruentum,

Et ftrepitus fcrri, murmuraque alta virum. Et tu (quod fupereft miferi; fperare memento,

Et tua magnanimo peftore vince mala. Necdubitesquandoque frui melioribus annis,

Atque ifeium pa trios poiTe videre lare?.

105

no

115

120

125

Elegia

94 Quae] In all 1673 copies examined, the u is not clearly printed. 103 Jefum] Jefum There is a single dot over the 'e' in every 1645 copy examined. See notes to this word in 1645.

109 latus] latus This is the same T for 1 encountered before. It should not be read as T but as 1 for in every case, the intent is clear enough; the type font was at fault. 115 Inque] In every 1673 copy examined the I is raised above the line of type. 123 miferi)] miferis) The Columbia note explains it very well. 126 The Columbia note is worthless and misleading, based as it is on a copy worn at this point. Other copies make the note valueless.

ELEGIA QUINTA— 1673

111

j (*5)

Elegia quinta, Anno abatis 20. In adventum verts,

IN fe pcrpetuo Tcmpus revolubile gyro Jam revocat Zephyros vere fepente noVos. Induiturque brevem Tellus reparata juventam

Jamque foluta gelu duke virtfcit humus. Fallor ? an & nobis 1 edeunt in carmina vires,

Ingeniumque mihi munere veris adeft ? Munere veris adeft, iterumque vigefcit ab illo

(Quisputet) atque aliquod jam fibi pofcitopus. Caftalis ante ocu!os,bifidumque cacumen oberrat,

Et mihi Pyrencn fomnia node ferunf. Concitaque arcano fervent mihi pe&ora room,

Et furor, & fonitus me facer intus agit. Dclius ipfe venit, video Peneide lauro

Implicitos crines, Delius ipfe venif. Jam mihi mens liquidi raptatur in ardua cceli,

Perque vagas nubes corpore liber eo, Perque umbras, perque antra feror penetralia vatum

Et mihi fana patent interiora Deum. lntuiturque animus toto quid agatur Olympo,

Nee fugiunt oculos Tartan cseca meos.

10

15

20

Quid tarn grande fonat diftento fpiritus ore ?

Quid psrit hacc rabies, quid facer ifte furor > Ver mihi, quod dedit ingenium, cantabitur illo i

Profuerint ifto reddita dona modo. Jam Philomela tuos foliis adoperta novellif

Inftituis modulos, dum filet omne nemus f Urbe ego, tu fylvi fimul incipiamus utrique,

Et firnul ad ven turn. veris uterque canat. Veris io rediere vices, celebremus honores

Veris, & hoc fubeat Mufa perennis opus.; Jam fol iEthiopas fugiens Tithoniaque arva,

Fle&it ad Ar&oas aurea lora plagas. Eft breve nodtis iter, brevis eft mora no&is opacae

Horrida cum tenebris'exulat ilia fuis. Jamque Lycaonius plauftium caelefte Bootes

Non longa fequitur feftus ut ante via, Nunc etiamfolitas circum Jovis atria toto

Excubias agitant fydera rarapolo. Nam dolus, & cedes, & vis cum node receffk.,

Neve Giganteum Dii timuere fcelus. Forte aliquis fcopuli recubans in vertice paftor,

Rofcida cum primo fole rubefcit humu?, Hac, ait, hac certe caruifli node puella

Phoebe tua, ccleres qu* retincret equos.

25

l...iu -

30

35

40

Qj}d

txu

Title, quinta,] The u is broken in all copies of 1673 examined. 16 eo.] The punctuation mark here should be noted carefully, as it, or a mark much like it, occurs several times in 1673. It is a smashed period ; a smashed comma used as period ; or actually a piece of type with a face like the modern plus sign. When it is used, almost invariably a period seems to be intended.

26 filet] The 1 is raised above the line of type in all 1673 copies examined, nemus.] The mark at the end of the line in all 1673 copies examined is an ink smear only. 30 perennis]

quotannis 39 dolus,] dolus, The comma is clear in most

1645 copies under magnification, and the imprint of a comma shows in all other 1645 copies examined.

112

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

Lseta fuas repettt fylvas, pharetramque refumit 45

Cynthia, Luciferas ut videt alfa rotas, Et tenues ponens radios gaudere videtur

Officiura fieri tarn breve fratris ope. Defere, Phoebus ait, thalamos Aurora feniles,

Quid juvat erTceto prccubuiflfe toro > 50

Te manet iEolides viridi venator in herba,

Surge, tuos ignes altus Hymettus habet. Flava verecundo dea crimen in ore tatetur,

Et raatutinos ocyus urget equos. Exuit invifam Tellus rediviva ftnedam, 55

Et cupit amplexus Phoebe fubire tuos "> Et cupit, &: di^na eft, quid cnim formofius ilia,

Pandit utomniferos luxuriofa fir.us, Atque Arabum fpirat meltes. Sc ab ore venufto

Mitia cum Paphiis fundit amoma rofis. 60

Ecce coronatur facro frons ardua luco,

Cingit ut Ida?arn pinea turris Opira * Et vario madidos intexit flore capillos,

Floribus & vifa eft pofle placere fuis. Floribus crTufos ut erat rcdimita capillos 65

Tenario placuit diva Sicana Dto.

Afpice Phoebe tibi faciles hortantur amores,

Mellitafque movent flamina verna pieces.

N Cinnamca

(s3)

Cinnamea Zephyrus leve plaudit odorifer ala,

Blanditiafque tibi ferre videntur aves. Nee fine dote tuos temeraria quaerit amores

Terra, nee optatos pofcit egena toros, Alma falutiferum medicos tibi gramen in ufus

Prsebet, & hinc ticulos adjuvat ipla tuos. Quod 11 te pretium, fi te fulgentia tangunt

Munera, (muneribus faepe coemptus Amor) Ilia tibi oftentat quafcunque fub asquore vafto.

Et fupcrinjedis montibus abdit opes. Ah quoties cum tu clivofo feffus Olympo

In vefpertinas prsecipitaris aquas, Cur te, inquit, curfu languentem Phoebe diurno

Hefperiis rccipit Cserula mater aquis ? Q_ud tibi cum Tethy ? Qjid cum Tartefiide lympha,

Dia quid immundo perluis ora falo ? Frigora Phoebe mta melius captabis in umbra,

Hue ades, ardentes imbue rore comas. Mollior cgelida veniet tibi fomnus in herba,

Hue ades, & gremio lumina pone meo. Quaque jaces circum mulcebit lene fufurrans

Aura per humentes corpora fufa rofas. Nee me (crede mihij terrent Semeleia fata,

Nee Phaetonteo fumidus axis equo j

70

75

80

85

90

Cum

66 Tenario] Tsenario

74 ticulos] titulos 83 Quid] The u is not clearly printed in any 1673 copy examined. 92 Phaetonteo] Phaetonteo

ELEGIA QUINTA— 1673

113

Cum tu Phoebe tuo fapientius uteris igni,

Hue ades & gremio lumina pone mco. Sic Tellus Iafciva fuos fufpira t amores » 95

Matris in exemplum cetera turba ruunt. Nunc etenim foto currit vagus orbeCupido,

Languentefque fovet folis ab igne faces. Infonuere novis lethalia cornua nervis,

Trifle micant ferro tela corufca novo. 100

Jamque vel invidiam tentat fuperaffe Dianam,

Qusque fedet facro Vefta pudica foco. Ipfa ieneicentem reparar Venus annua formam,

Atque iterum tepidocreditur orta mari. Marmoreas juvenes clamant Hymensec per urbes, 105

Litus 10 Hymen, & cava faxa fonant. Cultior ille venit tunicaque decentior aptS,

Puniceum redolet veftis odora crocum. Egrediturque frequens ad araoeni gaudia veris

Virgineos auro cinema puella finus. 1 10

Votum eft cuique fuum, votum eft tamen omnibus unum

Ut fibi quern cupiar, det Cytherea virum. Nuncquoque feptena modulatur arundine paftor,

Et fua quae jungat carmina Phyllis habet.

Natvia nodrurno placat fua fydera cantu, 1 15

Delphinafque leves ad vada fumma vocaU

N 2 Jupitef

120

(30)

Jupiter ipfe alto cumconjuge ludit Olympo,

Convocat & famulos ad fua fefta Deos. Nunc etiam Satyri cum fcra crepufcula furgunf,

Pervolitant celeri florea rura choro, Sylvarufque fua CyparhTi fronde revindtus,

Semicaperque Deus, femideufque caper. Quseque fub arboribus Dtyadcs laiuere vetuftis

Per juga, per folos expatiantur agros. Per fata luxuriat fruticetaque Maenalius Pan, 125

VixCybclc mater, vix fibi tuta Ceres, At que aliquam cupidus pratdatur Oreada Faunus,

Conlulit in trepidos dum fibi Nympha pedes, Jamque later, latitanfque cupit male tecla videri,

Et fugit, & fugiens pervelit ipfa capi. 130

Diiqucquertondubitant caelo priponere fylvas,

Et fua quifque fibi numina lucus habet. Et fua quifque diu fibi numina lucus habeto,

Ncc vos arborea dii precor ite domo. Te refcrant miferis te Jupiter aurea terris 135

Saecla,quid ad nimbos afpera tela redis > Tu faltcm lenterapidos age Phoebe jugalcs

Qua potes, & fenfim tempora veris eanr. Brumaque produdhs tarde ferat hifpida nodtes,

Ingmat & nofiro faior umbra polo.

140 Elegia

102 Quaeque] The first u is not clearly printed in any 1673 copy examined. 106 Litus] Littus no Virgineos] Virgineas 115 Natvia] Navita

114

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(30

Elegia fexta.

Ad Carolum Diodatum ruri com- morantem.

gui cum i dibits Decern b. firipfijfet , d* fid carmina excufari pojlulajfet ft folito mimts ejfent bona. , quod biter lautitias quibus crat ab amijis exceptus , hand fatis felicem Qpe~ ram Mufis dare fe pojfe ajfirmabat , hunc habuit refponfum.

MItto tibi fanam non pleno ventre falutera, Q^a tu diftento forte carere potes. At tua quid noftram prole&at Mufa camoenam,

Nee Unit optatas poire fequi tencbras ? Carmine fcire vtlis quam te redamemque colamque, 5

Crede mihi vix hoc carmine fcire queas. Nam neque nofter amor modulis includitur ardfris,

Nic venit ad claudos integer ipfe pedes. Qjam bene folennes epulas, hilaremque Decembrim

Feftaque ccelifugam quoe coluere Deum, Deliciafque refers, hyberni,gaudia ruris,

Hauftaque per Iepidos Gallica mufta focos.

Qui^ queretis refugam vino dapibufqut poelm ?

Carmen amat Bacchum, Carmina Bacchus amaf.

N 3

10

Nee

(3*)

Nee puduit Phoebtlm virides geftaffe corymbos, 15

Atque hederam lauro praspofuiffe tus. Saepius Aoniis clamavit collibus Euoe

Mifta Thyoneo turba novena choro. Nafo Coralheis mala carmina. mifit ab agris:

Non illic epulje non fata vitis erat. 20

Quid nil! vina, rofafque racemiferufnquc Lyaeum

Cantavit brevibus Teia Mufa modis, Pindaricofque inflat numeros Teumefius Evan,

Et redolet fumptum pagina quaeque merum. Dum gravis everfo currus crepat axe fupinus, 25

Et volat Eleo pulvere fufcus cques. Qjadrimoque madens Lyricen Romanus Iaccho

Dulce canit Glyceran, flavicomamque Chloen* Jam quoque lauta tibi generofo menfa paratu,

Mentis alif vires, ingeniumque fovet. 30

Maffica fcecundam defyumant pocula venam,

Fundis & ex ipfo condita metra cado. Addimus hisartes, fufumque per intima Phoebum

Corda, favent uni Bacchus, Apollo, Ceres. Scilicet haud mirum tarn dulcia carmina per te 35

Numine compofito tres peperifTe Dcos.

Nunc quoqoe ThreiTa tibi caelato barbitos auro

Infonat arguta molliier icla manu 5

Auditurque

Title. 4 fua] ] Columbia note stating that 1673 reads 'suae' is wrong. 6 quod] quod 7 amijis] amicis 2 Qua] The u is not clearly printed in any 1637 copy examined. 5 quam]

quam 9 Quam] The u is not clearly printed in any 1673 copy examined. 13 queretis] quereris

21 Quid] The u is not clearly printed in any 1673 copy examined.

22 modis,] modis2 This should be a question mark in both texts. The Columbia note on this is excellent. The 1673 printer took the broken question mark of 1645 for a misplaced comma.

23 Evan,] Euan, 24 merum.] ] The Columbia text is wrong. 27 Quadrimoque] The first u is not clearly printed in any 1673 copy examined. Iaccho] Jaccho

ELEGIA SEXTA — 1673

115

(33) Auditurque chelys fufpenfa tapetia circum,

Virgineos tremula qua? regat arte pedes. 40

Ills tuas faltem teneant fpedhcula Mufas,

Et revocent, quantum crapula pellit iners. Crede mihi dum pfallit ebur, comitataque ple&rum

Implet odoratos fefta chorea tholos, Percipies taciturn per pedrora ferpere Phcebum, 45

Quale repentinus permeat ofTa calor, Perque puellares oculos digitumque fonantem

Irruet in totos lapfa Thalia finus. Namque Elcgia levis multorumcura deorum eft,

Et vocat ad numcros qucmlibet ilia fuos i 5°

Liber adeft elegis, Eratoque, Cerefque, Venufquc,

Etcum purpurea matre tenellus Amor. Talibus inde licent convivia larga poetis,

S?epius & veteri commaduifle mero. At qui bella refert, &. adulto fub Jove coelum, 55

Heroafque pios, (emideofque duces, Et nunc fandla canit fupcrum confulta deorum,

Nunc latrata fcro rcgna profunda cane, Hie quidem parce Samii pro more magiftri

Vivat, & innocuos prsebeat hcrba cibos * 60

Stet prope fagineo p Jlucida lympha catillo,

Sobriaque e puro pocula fonte bibat.

N 4 Additur

GO

Additur huic feelerifque vacans, & carta juventus,

Et ri^idi mores, & fine labe manus. Qualis vefte nitens facra, & Iuftralibusundis 65

Surgisad infenfos augur iturc Dcos.' Hoc ritu vixiflTe ferunt port rapta fagacem

Lumina Tirefian., Ogygiumque Linon, Et lare devoto profugum Cakhanta, fenemque

Orpheoncdomitis Tola per antra ferisi 70

Sic dapis exiguus, fie rivi potor Homerus

Dulichium vexit per freta longa virum, Et per Monitrificam Perfete Phoebados aulam,

Et vada foe-mineis infidiofa fonis, Perque tuas rex ime domes, ubi fanguine nigro 75

Dicitur umbrarum detinuifTe greges. Diisetenim facer eft vates, divumque facerdos,

Spirat & occultum pectus, & ora Jovem. At tu fi quid 3gam, fcitabere ( fi modo faltem

EfTc putas tanti nofcere fiquid agam) 80

Paciferum cani^us cselcPi femine regem,

Fauftaque facratis faecula pa&a libris, Vagitumque Dwi, & fhbulantem paupere te&o

Qm fuprcma fuo cum patre regna colit. Stelliparumque polum, modulantefquesthereturmas, 85

Et fubico elites ad ilia fana Deos.

Dona

48 finus.] ] Columbia note is wrong. 62 puro] ] Columbia note is wrong.

55 coelum,] caelum,

73 Monitrificam] inonftrificam 79 fi quid] fiquid

116

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(35)

Dona quidem dedimus Chrifti natalibus ilia

Ilia fub auroram lux mihi prima tulit. Te quolque prefla manent patriis meditata cicutis,

Tu mihi, cui recitem, judicis inftar eris. 90

Elegia feptima, Anno aetatis undevigefimo.

NOndum blanda tuas leges Amathufia noram, Et Paphio vacuum pectus ab igne fuit. Sxpc cupidineas, puerilia tela, fagittas,

Atque tuum fprevi maxime, numen, Amor. Tu puer imbelles dixi franshge columbas, 5

Conveniunt tenero mollia bella duci. Aut de paflferibus tumidos age, parve, triumphos, .

tfec funt militiae digna trophaea tuae : In genus humanum quid inania dirigisarma?

Non valet in fortes ifta pharetra viros. 10

Non tulit hoc Cyprius, (neque enim Deus ullus ad iras

Promptior) & duplici jam ferus igne calet. Ver erat, & fummae radians per culmina villa?

Attulerat primam lux tibi Maie diem ;

At mihi adhuc refogam qusrebant lumina no&em 15

Nee matutinum fuftinuere jubar.

Aftat

(36)

Aftat Amor le&o, pi&is Amor impigcr alls,

Prodidit aftantem mota pharetra Deum ; Prodidit & fades, & dulec minantis ocelli,

Et quicquid puero, dignum & Amore fuit. Talis in aeterno juvenis Sigeius Olympo

Mifcet amatori pocula plena Jovi i Aut qui formolas pellexit ad ofcula nymphas

Thiodamantxus Naiade raptus Hylas > Addideratque iras, fed & has decuiffe putares,

Addideratque truces, nee fine felle minas. Et mifer exemplo fapuifles tutius, inquit,

Nunc meaquid poffit dextera teflis eris. Inter & expertos vires numerabere noftras,

Et faciam vero per tua damna fidera. Ipfe ego fi nefcis ftrato Pythone iuperbum

Edomui Phoebum, ceffit & ille mihi » Et quoties meminit Peneidos, ipfe fatetur

Certius & gravius tela nocere mea. Me nequit addu&um curvare peritius arcum,

Qui poft terga folet vincere Parthus eqaes. Cydon'mfque mihi cedit venator, & ille

Infcius uxori qui necis author erat. Eft etiam nobis ingens quoque vi&us Orion,

Herculeaeque manus, Hcrculeufque comes.

20

25

30

35

40

Jupiter

Elegy VI. 87 ilia] ilia,

Elegy VII. 1 noram,] noram, 2 fuit.] ] The construction calls for fuit. 8 tuae:] tuae.

21 aeterno] aererno

ELEGIA SEPTIMA— 1673

117

07)

Jupiter ipfe licet fua fulmina torqueat in me,

Hsrebunt lateri fpicula noftra Jovis. Cartera quae dubitas melius mea tela docebunf ,

Et tua non leviter corda petenda mini. Nee te ftulte tuae poterunt defendere Mufae, 45

Nee tibi Phcebaeus porriget anguis opem. Dixit, & aurato quatiens mucrone fagittam,

Evolat in tepidos Cypridos ille finus. At mihi rifaro tonuit ferus ore minaci,

Et mihi de puero non metus ullus erat, 50

Et mod6 qua noftri fpatiantur in urbe Quirites

Et modo villarum proxima rura placent. Turba frequens, facieque fioiillima turba dearum

Splendida per medias itque reditque vias. Au&aque luce dies gemino fulgore corufcat, 55

Fallor ? an & radios hinc quoque Phoebus habet. Wxc ego non fugi fpe&acula grata feverus,

Impetus & quo me tert juvenilis, agor. Lumina luminibus male providus obvia mifi

Neve oculos potui continuifle meos. 60

Unam forte aliis fupereminuifle notabam,

Principium noftri lux erat ilia mali.

Sic Venus optaret mortalibus ipfa videri,

Sic regina Deum confpicienda fuif.

Hanc

08)

Hanc memor objecit nobis malus ille Cupido, 65

Solus & hos nobis texuit ante dolos. Nee procul ipfe vafer latuit, multaeque fagittar,

Et facis a tergo grande pependit onus. Nee mora, nunc ciliis harfit, nunc virginis ori,

Infilit hinc labiis, infidet inde genis : 70

Et quafcunque agilis partes jaculator oberrat,

Hei mihi, mille locis pectus inerme ferit. Protin: .s infoliti fubierunt corda furores, .

ilror amans intus, flammaque totus eram. Interea mifero quae jam mihi fola placebat, 75

Ablata eft oculis non reditura meis. Aft ego progredior tacite qucrebundus, & *xcors,

Et dubius volui (aepe referre pedem. Findor, & hxc remanet, fequitur pars altera votum,

Raptaque tarn fubitd gaudia flere juvat. 80

Sic dolet amiffum proles Junonia ccelum,

Inter tfemniacos praecipitata focos. Talis & abreptum folem relpexit, ad Orcum

Ve&us ab attonitis Amphiaraus equis. Quid faciam infelix, & luctu viclus, amores 85

Nee licet inceptos ponere, neve fequi.

O utinam fpe&are femel mihi detur amatos

Vultus, & coram triftia verba loqui !

Forfitan

50 erat,] erat. 59 mifi] mifi,

72 ferit.] In all 1673 copies examined, the e is from a different font. 88 loqui!] loqui;

118

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(39)

For fi tan & duro non ell adamante create,

Forte nee ad noftras furdeat ilia preces. Crede mihi nullus fie infcliciter arfir,

Ponar in exemplo primus & unus ego. Parce precor teneri cum fis Deus ales amoris,

Pugnent officio nee tua fa&a tuo. Jam tuas O certe eft mihi formidabilis arcus,

Nate dea, jaculis nee minus igne potens : £t tua fumabunt noftris altaria donis,

Solus & in fuperis tu mihi fummus eiis. Dcme meos tandem, verum nee deme furores,

Nefcio cur, mifer eft fuaviter omnis amans : Tu modo da facilis, pofthasc mea fiqua futura eft,

Cufpis amaturos figat ut una dues.

90

95

100

HiEc ego mente olim teva, ftudioque fupino Nequitia? pofui vana trophaea mea?. Scilicet abreptum fie me malus impulit error,

Indocilifque aetas prava magiftra fuit. Donee Socraticos umbrofa Academia rivos 5

Pr£buit,admiffum dedocuitque jugum. Protinus extindtis ex illo tempore flammis,

Cincta rigent multo pe&ora noftra gelu. Unde fuis frigus metuit puer ipfe Sagittis, 9

Et Diomedeam vim timet ipfe Venus. J»

(40.)

In Proditionem Bombardicam,

CUm fimul in regem nuper fatrapafque Britannos Aufus es infandum perfideFauxe nefis, Fallor } an & mitis voluifti ex parte videri,

Et penfare mala cum pietate fcelus i Scilicet hos alti miffurus ad atria caeli,

Sulphureo curru flammivolifque rotis. Q^aliter ille feris caput inviolabile Parcis Liquit Jordanios turbine raptus agros.

In eanitm%

SIccine tentafti caelo donaffe Jacobum Qua? feptemgemino Belua monte lates ? Ni meliora tuum poterit dare munera numen,

Parce precor donis infidiofa tuis. Ille quiJem fine te confortia ferus adivic

Aftra, nee inferni pulveris ufus ope. Sic potius faedos in aelum pelle cucullos,

Et quot habet brutos Roma profana Dcos, Namquehac aut alia nifi quemquc adjuveris arte

Crede mihi csli vix bene fcandet iter.

10

In

The lines after 102 of Elegy VII. should be separately numbered. They were set apart by Milton both times he printed them, and are not a part of the elegy they accidentally follow. 10 ipfe] ipfa

In Proditionem Bombardicam. Title. Proditionem) proditionem

7 Qualiter] The u is not clearly printed in any 1673 copy examined.

In eandem. 1 Jacobum] Jacobum 2 Belua] Bellua

8 Deos,] Deos, Columbia note to this line states that in 1645 the punctuation is a period. In all copies examined, it extends below the line of type, and under magnification appears to have been a broken comma.

IN PRODITIONEM III & IV— 1673

119

(40

In eaniem.

PUrgatorem animae derifit Iacobus ignem, Et fine quo fuperum non adeunda domus. Frenduit hoc trina monftrum Latiale corona

Movit & horiificum corona dena minax. Et nee inultus ait temnes mea facra Britanne,

Supplicium fprefa relligionc dabis. Et fi ftelligeras unquam penetraveiis arces,

Non nifi per flammas trifle patebit iter. O quam funefto cecinifti proxima vero,

Verbaque ponderibus vix caritura fuis ! Nam prope Tartareo fublime rotatus ab igni Ibat ad sthereas umbra perufta plagas.

In tandtm.

QUem modb Roma fuis devoverat impia diris, Et Styge damnarat Tsnarioque finu, Hunc vice mutata jam tollere geftit adaftra, Et cupit ad fuperos evchere ufque Deos.

10

In

(40

In inventorem Bombard*.

JApetionidem laudavit caeca vetuftas, Qui tulit aetheream folis ab axe faccm > At mihi major eric, qui lurida cr^dicur arma, Et trifidum fulmen furripaiiTe Jovi.

Ad Leonoram Roma cantntem*

ANgelus unicuiquc fuus (fie credite gentes) Obtigit aethereis ales abordinibus. Quid mirum ? Leonora tibi 11 gloria major,

Nam tua prcefentem vox fonat ipfa Deum. Aut Deus, aut vacui certe mens tertiacceli

Per tua fecreto guttura ferpit agens \ Serpit agens, facilifque docet mortalia corda

Senfim immortali aflPuefcere poflt fono. Quod fi cunda quidem Deus eft, per cun&aque fufus,

In te una loquitur, cstcra mutus habet.

Ad tandem.

ALtera Torquatum cepit Leonora Poetam, Cujus ab infano ceflit amore furens. Ah mifer i!le tuo qiunto ftlicius xvo Perdites, & propter te Leonora forct I

10

Et

In eandem. I. i Iacobus] Jacobus 4 horrificuml horrificum corona] cornua 12 1645 indents this line.

In inventorem. 4 furripuiffe] The two r's are from different fonts in all 1673 copies examined.

120

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(43)

Et te Pieria fenfiflet voce canentam

Aurea maternas fila movere lyra?, Quamvis Dircsco torfiflet lumina Pentheo

Savior, aut totus defipuliflet iners, Tu tamcn errantes cseca vertigine fenfus

Voce eadem poteras compofuiife (ua i Et poteras £gro fpirans fub corde quietem

Flexanimo cantu reftitujffe fibi.

Ad eandem.

CRedula quid liquidam Sirena Neapoli ja&as, Claraque Parthenopes fana Achel(6iados> Littoreamque tua defunctam Naiada ripa Corpora Chalcidico facra dediffe rogo ? Ilia quidem vivitque, & amoenaTibridisunda _

Mutavit rauci murmura Paufilipi. Illic Romulidum fiudiis ornata fecuhdis, Atquc homines cantu detinet atque Dcos.

10

(40

Apologus de Rujiico (? Hero.

RUfticus ex Malo fapidiffima poma quotannis Legit, & urbano ledta dedit Domino : Hie incredibili fru&us dulcedine Captus

Malum ipfam in proprias tranftulit areolas. Hactenus ilia ferax, fed longo debilis sevo,

Mota folo aflueto, protinus aret iners. Quod tandem ut patuit Domino, fpe lufus inani,

Damnavit celeres in fua damna manus. Atque ait, Heu quanto fatius fuit ilia Coloni

(Parva licet) grato dona tuliiTe animo ! 1

PofTem Ego avaritiam froenare, gulamque voracem :

Nunc pericre mihi & foetus & ipfa parens.

Aplogus

Elegiarum Finis.

Ad eandem I. Run over. 5 canentam] canentem 1673 errata call for canentem 8 def ipulif f et ] Errata call for defipuiffet

1645 edition has no catchword; but prints Elegiarum Finis, after Ad eandem II.

There is only this 1673 text for this poem.

1673 edition prints Elegiarum Finis, after this poem, and the page carries no catchword.

IN OBITUM PROCANCELLARII— 1673

121

«$5

<4s;

dW» tW? eW? tflte cW9 tflfcr tSIfr dp?

Syl

varum

Lib

cr.

Anno setacis 16. In obitum

Procancellarii medici.

PArere fati difcite legibus, Manufque Parcas jam date fupplices, Qui pendulum telluris orbem lapeti colitis nepotes. Vos fi relicto mors vaga Ta?naro Semel vocarit flebilis, heu moras Tentantur incaflum dolique » Per tenebras Stygis ire certum eft. Si deftinatain pellere dextera Mortem valeret, non ferus Hercules Neffi venenatus cruore iEmathia jacuiflet Oeta. Nee fraude turpi Palladis invids VidiflTct occifum Ilion He&ora, aut Quem larva Pelidis peremit . £nfe Locro, Jove lacrymante.

O 2

10

15

(4fl

Si tiifte fatum verba Hecateia FugarepofIint,Telegoni parens Vixiffet infamis, potentique iEgiali foror ufa virga. Numencjue trinum faltere Ir queant Artes medentum, ignotaque grammar, Non gttariis herbarum Machaort Eurypyli cecidiffet hafta. LsefilTet & nee ie Philyreie Sagitta echidnae perlita fanguine, Nee tela te fulfnerique avitum Csefe puer genitricis alvo. Tuque O alumno major Apolline, Gentis tOgatae cui regimen datum, Frondofa quem nunc Cirrha luget, Et mediis Helicon in undis, Jam praefuilTes Palladio gregi Lsetus, fuperftes, nee fine gloril, Nee puppe luftrafTes Charontis Horribiks barathri receffus* At fila rupit Perfephone tua Irata, cum te vidait arribus Succoque pollenti tot atris Faufibus eiipuiffe mortis.

20

25

30

35

4c

Colende.

This is page 44 in the 1645 edition; but otherwise, the two editions return to complete agreement at this point with page numbering and content. 1 PArere] PArere 4 lapeti] Japeti Catchword] The letters of the short word Si are out of line in all 1673 copies examined.

40 Faufibus] faucibus

122

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

a?)

Cotende grasfes, membra precor tua Molli quiefcant cefpite, &C ex tuo Crefcant rofae, calthseque bufto, Purpureoque hyacinthus ore. Sit mite de te judicium iEaci, 45

Subrideatque iEtnara Proferpina, Interque felices perennis Elyfio fpatiere campo.

In quintumNovembris, Anno aecatis 17.

T Am pius extrerha veniens lacobus ab ardto

Teucrigenas populos, lateque pafentia regna

Albionum tenuit, jamque inviolabile foedus

Sceptra Caledoniisconjunxerat Anglica Scotis :

Pacificufque novo felix divefque fedebat 5

In folio, occultique doli fecurus & hoftis :

Cum ferus ignifluo regnans Acheronte tyrannus,

Eumenidum pater, asthereo vagus exul Olympo,

Forte per immenfum terrarum erraverat orbem,

Dinumerans fceleris focios, vernafque fideles, 10

Participes regni poft funera moefta futuros i

Hie tempeftates me<lio ciet aere diras,

O 3 Hlic

Illic unamimes odium ftruit inter amicos, Armat & invi&as in mutua vifcera gentes » Regnaque olivifera vertit florentia pace, Etquofcunque videt purae virtutis amantes, Hos cupit adjicere imperio, fraudumque magifte* Tentat inacceflum fceleri corrumpere pectus, Infidiafque beat tacitas, caflfefque latentes Tendit, ut incautos rapiat, feu Cafpia Tigris Iniequitur trepidam deferta per avia praedam Node fub illuni, & fomno nidtantibus aftris. Talibus infeftat populos Summanus & urbes Cindrus caerukos fumanti turbine flammae. Jamque fluentifonis albentia rupibus arva Apparent, & terra Deo diledta marino, Cui nomen dederat quondam Neptunia proles Amphitryoniaden qui non dubitavit atrocem lEquore tranato furiali pofcere bello, Ante expugnatas crudelia farcula Troia?.

At fimul hanc opibufque & fefta pace beatam Afpicit, & pingues donis Cerealibus agros, Qupdque magis doluif, venerantem numina veri Sandra Dei populum, tandem fufpiria rupit Tartareos i ^nes & luridumolentiafulphur. Qulia Trinacria trux ab Jove claufus in iEtna

15

20

25

30

35

EfflaC

In quintum Novembris. 1 lacobus] Jacobus

13 unamimes] unanimes The 1645 reading is correct. Columbia text silently corrects, but furnishes no note.

IN QUINTUM NOVEMBRIS— 1673

123

(49)

Efflat tabifico monftrofus ab ore Tiphceus.

Ignefcunt oculi, ftridetque adamantius crdo

Dentis, ut armor unci fragor, i&aque cuTpide cufpis.

Atque pererrato folum hoc lacrymabiie mundo 40

Inveni, dixit, gens ha?c mihi fola rebcllis,

Contemtrixque jugi,noftraque potentior arte.

Ilia tamen, mea fi quicquam tantamina poffunt;

Non feret hoc impune diu, non ibit inulta,

Ha&enus j & piceis Jiquido notat aere pennis \ 45

Qua volat, adverfi praecurfant agmine venti,

Denfantur nubes, & crebra tonitrua fulgent.

Jatnque pruinofas velox fuperaverat alpes,

Et tenet Aufoniae fines, a parte finiftrS

Nimbifer Appenninus erat, prifcique Sabini, 50

Dextra veneficiis infamis Hetruria, nee non

Te furtiva Tibris Thetidi videt ofcula dantem i

Hinc Mavortigenaeconfiftit in arce Quirini.

Reddiderant dubiam jam fera crepufcula lucem,

Cum circumgreditur totam Tricoronifer urbem, 55

Panificofque Deos portat, fcapulifque virorum

Evehitur, praeeunt fubmiffo poplite reges,

Et mendicantum feries Iongiifima fratrum >

Gereaque in manibus geftant ftfnalia cseci,

Cimmeriis nati in tenebris, vitamque trahentes. 60

O 4 Tempi*

C50)

Templa dein rrmltis fubeunt lucentia tsedis

( Vefper erat facer ifte Petro) fremitufque canentum

Sspe tholos impkt vacuos, & inane locorum.

Qualiter exululat Bromius, Bromiique caterva,

Orgia cantantes in Echionio Aracyntho, 65

Dum tremit attonitus vitreis Afopus in undis,

Et procul ipfe cava refponfat rupe Cithaeron.

' His igitur tandem folenni more pera&is,

Nox fenis amplexus Erebi taciturna reliquir,

Prscipitefque impellit equos ftimulante flagello, 70

Captum oculis Typhlonta, Melanchaetemque ferocem,

Atque Acherontseo prognatam patre Siopen

Torpidam, & hirfutis horrentem Phrica capillis.

Interea regum domitor, Phlegetontius haeres

Ingreditur thalamos (neque enim fecretus adulter 75

Producit fteriles molli fine pellice nodes)

At vix compofitos fomnus daudebat ocellos,

Cum niger umbrarum dominus, reclorque filentum,

Praedatorque hominum falsa fub imagine te&us

Aftitir, afTumptis micuerunt tempora canis, 80

Barba finus promiiTa tegit, cineracea longo

Syrmate verrit humum veftis, penaetqus cucullus

Venice dt rafo, & ne quicquam difitad artes,

Cannabco \ umbos cenftrinxit fune falaces,

Tarda

37 Tiphceus.]] Columbia text omits the period, and there is no note. 38 adamantius] adamantinus The 1673 errata call for the 1645 reading. 43 tantamina] tentamina poffunt.]

poffunt, 45 notat] natat The 1673 errata call for natat. 57 fubmiffo] fummiffo 60 trahentes.] trahentes, The 1645 punctuation is uncertain at best.

62 fremitufque] fremitufque line. 84 falaces.] falaces,

75 1645 does not indent this

124

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

Tarda feneftrads figcns veftigia calceis. 85

Talis uti fama eft, vafia Francifcus eremo

Tetra vagabatur folus per luftra ferarum,

Sylveftrique tulit genti pia verba falutjs

Irnpius, atque lupos domuit, Lybicofque leones.

Subdolus at tali Serpens velatus amkflu go

Solvit in has fallax ora execrantia voces;

Dormis nate > Etiamne tuos fopor opprimit artus >

Irnmeraor O fidei, pecorumque oblite tuorum !

Dum cathedram venerande tuam, diademaque triplex

Ridet Hyperboreo gens barbara nata fub axe, 95

Dumque pharetrati fpcrnunt tua jura Britanni :

Surge, age, furge piger, Latius quern Gefax adorat, ,

Cui referata patet convexi janua cseH,

Turgentes animos, & faftus frange procaces,

Sacrilegique fciant, (ua quid maledi&ro poffif, 100

Et quid Apoftolrcas poflit cuftodia clavis >

Et memor Hefperisc disje&am ulcifeere claflTem,

Merfaque Iberorum lato vexilla profundo,

San&orumque cruci tot corpora fixa probroGe,

Thermodoontea nuper regnante puella. 105

At (u fi tcnero mavis torpefcere le&o

Crefcentefque negas hofti contundere vires,

Tyrrhenum impkbit numerofo mifite pontum,

Signaquc

Signaque Aventino ponet fulgentia colle : Relliquas veterum franget, flammifque cremabit, Sa'craque ealcabit pedibus tua colla proianis, Cujus gaudebant foleis dare bafia reges. Nee tamen hunc bellis & aperto Marte lace(Tes, Irritus ille labor, tu callidus utere fraude, Qjaeiibet haereticis difponere retia fas eft > Jamque ad confilium extremis rex magnus ai> oris Patricios vocat, & procerum de ftirpe creates, Grandaevofque patres trabea, canifque verendosi Hos tu membratim poteris con(pergere in auras5 Atque dare in cineres, nitrati pulveris igne iEdibus injedro, qua convenere, fub imis. Protinus ipfe igitur quofcunque habet Anglia fidos Propofiti, fadique mone, quifquamne tuorum Audebit fummi non jufla faceffere P;ipae. Pereulfofque metu fubito, cafumque ftupentes Invadat vel Gallus atrox, vel fsevus Iberus. Sa?cula fie illic tandem Mariana redibunt, Tuque in belligeros iterum dominaberis Anglos* Et nequid timeas, divos diva(que fecundas Accipe, quotque tuis celebrantur numma faftis. Dixit & adfeitosponens malefidusami&us Fugit ad infindim, regniim illaetabile, Lethen.

no

"5

120

125

130

Jam

86 Talis] Talis, 92 artus?] artus 93 tuorum!] tuorum, 96 Britanni:] Britanni; 108 pontum,] Pontum,

no Relliquas] Relliquias The 1673 errata call for Relliquias 112 foleis]] In this case, the cut off circumflex serving as a diaeresis is over the i. 122 quofcunque] quofcumque

125 cafumque] cafiique

IN QUINTUM NOVEMBRIS— 1673

125

(53)

Jam rofea Eoas pandens Tithonia portas Veftit inauratas redeunti lumine terras i Maeftaque adhuc nigri dcplorans funera nati 135

Irrigat ambrofiis montana cacumina guttis > Cum fomnos pepulit ftellatae janitor aulas No&urnos vifus, & lomnia grata revolvens*

Eft locus sterna feptus caligine nodis

Vafta ruinofi quondam fundamina tedi, 140

Nunc torvi fpelunca Phoni, Prodotaeque bilinguis

Eflfera quos uno peperit Difcordia partu.

Hie inter caementa jacent prapruptaque faxa,

Ofla inhumata virum, & traje&a cadavera ferro i

Hie Dolus infortis Temper fedet ater ocellis, 145

Jurgiaque, & ftimulis armata Calumnia fauces.

Et Furor, atque viae moriendi mille videntur

Et timor, exanguilque locum circumvolat Horror,

Perpetuoque leves per muta filentia Manes

Exululat, tellus & fanguine confeia ftagnar. 150

Ipfl etiam pavidi latitant penetralibus antri

Et Phonos, & Prpdotes, nulloque fequente per antrum

Antrum horrens, feopulofum, atrum feralibus umbris

Diffugiunt fontes, 2. retro lumina vortunt,

Hos pugiles Roma; per faecula longa fideles 155

Evocat antiftes Babylonius, atque ita fatur,

Finibus

(54)

Finibus occiduis circumfufum incolit aequo*

Gens exofa mihi, prudens natura negavit

Indignam penitus noftro conjungere mundo :

IUuc, fie jubeo, celeri cantendke greiTu, 160

Tarfareoque leves difflentur pulvere in auras

Et rex & pariter fatrapse, fGelerata propago

Et quotquot fidei caluere cupidine vera:

Confilii focios adhibete, operifque miniftros.

Finierat, tigidi cupide paruere gemelli. 165

Interea longo flectens curvamine coelos Defpicit aetherea dominus qui fulgurat arce, VanaquepeTverfae ridet conamina turbae, Atque fui caufam populi volet ipfe tueri.

Eflfe femnt fpatium, qua diftat ab Afide terra 170

Fertilis Europe, & fpe&at Mareotidas undas >

Hie turris pofitaeft Titanidos ardua Famae

JErea, lata, fonans, rutilis vicinior aftris

Quam fuperimpofitum vel Atlios vel Pelion Oflae

Mille fores aditufque patent, totidemque feneftrse, 175

Amplaque per tenues tranflucent atria muros,

Excitat hie varios plebs agglomerata fufurros j

Qualitcr inftrepitant circum mul&ralia bombis

Agmina mufcarunij aut textoper ovilia junco,

Dum Canisa^Puvum cceli petit ardua oilmen 180

Ipfa

13,5 nati] In New York Public 1673 only the t is out of line. 143 praeruptaque ] femifractaque 146 fauces.] fauces,

148 timor,] Timor, 149 Manes] 1673 errata call for Manes,. 150 Exululat,] Exululant, Again, the 1673 errata call for Exululat This change makes it difficult to retain any claims for the superiority of the 1645 text, except, of course, senti- mental ones.

159 penitus] penitus mundo:] mundo; 166 ccelos] caelos

178 inf trepitant ] In all 1673 copies examined, the second i is broken.

126

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(55)

Ipfa quidem fumma fedet ultrix rftotris in arce, Auribus innumeris cinclum caput cminet olli, Queisfonitum exiguum trahir, atque leviffiraa captat Murmura, ab extremis patuli confinibws orbis. Nee tot Ariftoride fervator inique juvencar Ifidos, imrnitivolvebasJumina vuku, Lum.na non unquam tacjto nutantia fomno, Lumina fubje&as late fpe&antia terras. ift is ilia fblet loca luee carentia fspe Perluftrare, etiarn radianti imperriafoli. Millenifque loquax auditaque vifaque linguis Cuilibet effundit temeraria, veraque mendax Nunc minuit, modo confi&is fermonibus auget. Sed (amen a noftro meruifti carmine laudes Fama, bonum quo non aliud yetacius ullum, Nobis digna canv, nee te memoraffe pigebit Carmine tarn longo, fervati fcilicet Angli Officiis vaga diva tuis, tibi reddirous $qua. Te Deus aeternos motu qui temperat ignes, Fulmine prsmiffo alloquitur, tenaque tremente : Fama files ? an te latet impia Papiftarum Conjurata cohors in meqae meofque Britannos, Et nova fceptrigero cjedes meditata Ialcobo : Nee plura, ilia ftatim feniit mandata Tonactis,

($*)

185

190

195

200

205

210

215

Et fatis ante fugax ftridentes induit alas, Induit & variis exilia corpora plumis -, Dextra tubam geftat Temefaeo ex acre (bnoram. Nee mora jam pennis cedentes remigat auras, Atque parum eft curfu celeres pracvertere nubes,, Jam ventos, jam folis equos poft terga reliquit : Et primo Angliacas fblito de more per urbes Ambiguas voces, incertaque murmura fpargif, Mox arguta dolos, & deteftabile vulgat Proditionis opus, nee non fadta horrida di&u, Authorefque addit fceleris, nee garrula caecis Infidiis loca ftrucla filet i ftupuere relatis, Et pariter juvenes, parher tremuere puella?, Effetique fenes pariter, tantaeque ruinae Senfas ad astatem fubito penetraverat omnem Attamen interea populi miferefcit ab alto ffithereus pater, & crudelibus obftitit aufis Papicoliim > capti pcenas raptantur ad acres j At pia thura Deo, & grati folvuntur honores 3 Compita laeta focis genialibus omnia fumant > Turba choros juvenilis agit : Quintoque Novertibris 225 Nulla Diestoto occurrit celebratior anno.

Anno

220

Et

203 Iacobo:] Jacobo:

214 Proditionis] The Columbia note on this word is wrong, the word in 1645 in most copies being perfectly clear, except in the copy Professor Patterson was using.

IN OBITUM PRAESULIS— 1673

127

($7)

Anno starts 17. In obkum. Praefulis Elienfis.

ADhuc madentes rore (qualebant gen&, £t ficca nondum lumina » Adhuc Hquentis imbre turgebant falis,

Quern nupcr efFudi pius, Dum msefta charo jufta pafolvi rogo

Wintonienfis praefulis. Cum centilinguis Fama (proh femper mali

Cladifque vera nuntia) Spargit per urbes divitis Britannia?,

Populoique Neptuno iatos, Ceffiffe mortij & ferreis fororibus

Te generis humani decus, Qui rex facrorum ilia fuifii in infula

Quae nomen Anguillse tenet. Tuncinquietum pectus ira protinus

Ebullicbat fervida, Tumulis potentem fape dkvovens deam :

Nee vota Nafo in Ibida Concepit alto diriora peftore,

Graiufque vates parcius

10

15

20 Turpem

Turpem Lycambis execrams eft dolutri,

Sponiamquc Neobolen fuam. At ecce ditas ipfe dum fundo gtaves,

Etimprecor neci necem, Audifle tales videor attonitusfonos

Leni, i'ub aura, flaminc : Ca»cos furores pone, pone vitrearn

Bilemque & irritas minas, Qaid temere violas non nocenda numma,

Subitoque ad iras ptrcita. Non eft, ut arbitraris elufus mifer,

Mors atra Nodris lilia, Erebove patre crefa, five Erinnye,

Vaftove nata fub Chao : Aft ilia cdo mifTa ftellato, D:i

McfTcs ubique colligit > Animafque mole carnca reconditas

In lucem & auras evocat : tit cum fugaces excitant Hor;c diem

Themidos Jovifque fil'ix ; Et fempiterni ducit ad vultus patris j

At jufta raptat impios Subregna lurvi lucluofa Tartari,

Scdtfque fubtcrranc^s

25

30

35

40

Hans

Title. 1 obitum.] obitum 2 lumina;] lumina 15 ira] ira

22 Sponfamque] Sponfamqne In the 1645 edition, the u is upside down in all copies examined. 29 Quid] In no 1673 copy examined is the u clearly printed.

128

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(59) Hanc ut vocantem Ixtm audivi, cito 45

Foedum reliqui carcerem, Volatilefqiie fauftus inter milites

Ad aftra fublimis fcror : Vates ut olim raptus ad coelum fenex

Auriga currus ignei, 50

Non me Bootis terruere lucidi

Sarraca tarda frigore> aut Formidolofi Scorpionis brachia,

Non enfis Orion tuus. Praetervolavi fulgidi folis globum, 55

Long6que Tub pedibus deam Vidi triformem, dum coercebat fuos

Frsenis dncones aureis. Erraticorum fyderurri per ordines4

Per la&eas vehor plagas, 60

Vclocitatem fsepe miratus novafn,

Donee nitentes ad fores Ventum eft Olympi, & regiamChryftallinam, &

Stratum fmaragdis Allium. •

Sed hie tacebo, nam quis efTari queat 65

Oriundus humano patre

Amcenitates illius loci, mihi

Sat eft in sternum frui,

P Naturam

(,6c)

Natftram non pati fenium,

HEu quam perpetuis erroribus a&a fatifcit Aviamcnshominum, tenebrifq; immerfa profun- Oedipodioniam volvic fub pe&ore nodtem ! ( dis

Qua ve(ana fuis metiri fa&a deorum Audet, & incifas leges adamante perenni 5

Affimilare fuis, nulloque folubile frclo Confilium fati periturisalligat horis.

Ergone marcefcet fulcantibus obfita rugis Nature fades, &; rerum public3 mater Omniparum contract uterum fterikfeet ab <evo? 10 Et fefaffa fenem male certis paffibus ibit Sidereum tremebunda caput ? num tetra vetuftas Annorumquc sterna fames, fqualcrque fkufque Sidera vexabunt? an & infatiabile Tempus Efurict Cx !ura, rapietque in vifcera patrem ? 15

Heu, potuitne fuas imprudens Jupiter arces Hoc contra muniife nefas, & temporis itto Exemiflfe malo, gyrofque dedifle perennts ? Ergo erit ut quandaque (bno dtlapfa tremendo Convexi tabulata ruant, atque obvius i&u 20

Stridat uterque polias, fuperaque ut Olympius aula

Decidat, horribilifque rete&i Gcrgone Pallas.

Qualis

63 Chryftallinam, ] Cryftallinam,

1 quam] ] The Columbia note is wrong. 2 tenebrifq;] tenebrifque 17 muniffe] muniffe temporis] Temporis 18 perennes?] perennes3 In 1645, the punctuation is the same mark encountered in Elegy VI-.22.

NATURAM NON PATI SENIUM — 1673

129

(61)

Qualis in iEgseam proles Junonia Lexnnori

Deturbata (aero cecidit de limine cxYu

Tu quoque Phoebe tui cafus imitabere nati

Prxcipiti curru, fubitaquc fexere ruina

Pronus, & exindH fumabit lampade Nereus,

Et dabit attonito feralia fibila ponto.

Tunc etiam aerei divulfis fedibus Hsmi

Diflultabit apex, imoque allifa barathro

Terrebunt Stygium deje&a Ceraunia Ditem

In fuperos quibus ufus erat, fraternaque bella.

At pater omnipotens fundatis fortius aftr is

Confuluit rerum fummse, certoque peregit

Pondere fatorum lance?, atque oidine fummo-

Singula perpetuum juflit fervare tenorem.

Volvitur hinc lapfu mundi rota prima diurnoi

Raptat & ambit os focia vertigine caelos.

Tardior haud folito Saturnus, S£ acer ut olim

Fulmineum rutilat criftata cafiide Mayors.

Floridus aeterpum Phoebus juvenile corufcatf>

Nee fovet effcetas loca per dcclivia terras

Divexo temone Deus > fed Temper arnica

Luce potens eadem currit per figna rotarum,

Surgitodoratis pariter formofus ab Indis

JEthexeum pecus albenti qui eogit OJympo m P a

25

30

35

40

45

Mane

(«0

Mane vocans, & ferus agens in pafcua cod'f,

Temporis & gemino difpertit regna colore.

Fulget, obitque vices alterno Delia cornu,

Casruleumque ignem paribus compledfcitur ulnis. 50

Nee variant elementa fidem, folitoque fragore

Luridi perculfas jacuhntur fulmina rupes«

Nee per inane furit leviori murmure Corus,

Stringit & armiferos cequali horrore Gelonos

Trux Aquilo, fpiratque hyemem, nimbofque volutaf . 55

Utque folet, Siculi diverberat ima Pelori

Rex maris, & rauca circumftrepit acquora concha

Oceani Tubicen, nee vafia mole minorem

ff gaeona fcrunt dorfo Balearica cete.

Sed neque Terra tibi faedi vigor ille vetufli 60

Prifcus abeft, fervatque fuum Narciffus odorem,

Et puer ille fuum tenet & puer ille decorem

Phcebe tuufque & Cypri tuus, nee ditior olim

Terra datum fceleri celavit montibus aurum

Confcia, vel fub aquis gemmas. Sic denique in aevum 65

Ibit cun&arum feries juftiflima rerum,

Donee flammaorbem populabitur ultima, late

Grcumplexa polos, & vaftt culmina caeli \

Ingentique iogo flagtabit machina mundi.

V*

33 pater] Pater 38 Raptat] Raptat, ambit os] ambitos 40 Fulmineum] Fulmineum

47 coeli,] caeli, 51 elementa] The center descender of the m is broken in all 1673 copies examined. 67 populabitur] The 1 is badly worn in all 1673 copies examined. 69 mundi.] The i is broken at the bottom in all 1673 copies examined.

130

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

Bt Idea Platonica quemadmodum Ariftoteles intdlexit.

DIcitc facrorum prsfides nemoium dear. Tuque O noveni perbcata numim's Memoria mater, quseque in iramenfo procul Antro recumbis otiofa iEternitas, Monumenta fcrvans, & ratas leges Jovis, Caclique faftos atque ephemeridas Dcum, Quis ille primus cujus ex imagine Natura folers finxit humanum genus, iEternus, incorruptus, squaevus polo, Unufque & univerfus, exemplar Dei* Haud ille Palladis gemellus innubac Interna proles infidel menti Jovis > Sed quamlibet natura fit communior, Tamen feorsus extat ad morcm unius, Et, mira, certo ftringitur fpatio loci i ' Seu fempiternus ille fyderum comes Cacli pererrat ordines decempUcis, Citimumve terris incolit Lunar globum : Sive inter animas corpus adimras fedens Obliviofis tor pet ad Lcthes aquas :

P3

10

15

20 Sive

(64) Sive in remo(a forte terrarum plaga Incedit ingens hominis archctypus gigas, Et iis tremendus erigit cdfum caput Atlante major portitore fyderum. Non cui profundum caecifas lumen dedit 25

Dircxus augur vidit hunc alto finu > Non hunc filenti node Pleiones nepos Vatum fagaci praepes oftendit choro*, Non hunc facerdos novit AfTyrius, licet Longos vetufii commemoret atavos Nini, 30

Prifcumque Belon, inclytumque ORridem. Non ille trino gloriofus nomine Ter m2gnus Hermes (ut fit arcani fciens) Talem reliquit Ifidis cultoribus.

At tu perenne ruris Academi decus 35

(H<ec monftra fi tu primus induxit fcholis) jam jam pdetas urbis exules tuae Revccabis, ipfe fabulator maximus, Aut infiitutor ipfc migrabis foras.

Ad Patnm%

line mca Pierios cupiam per pc&ora fontes Irrigius tcrquere vias, totumque per ora

▼olvere

S folers] fullers ji innubse] in nub se

De Idea Platonica Run over. 23 iis] cliis 27 Pleiones] ] Columbia note is needless here, as magnification clearly shows that in 1673 a diaeresis with the top cut off was used, and 1645, a broken diaeresis was used, as in several other instances. 36 induxit] induxti 37 poetas] ] Cf. note to line 27 supra.

AD PATREM — 1673

131

(*5) Volvere laxatum gemino de vertice rrVum v lit tenues oblita fonos audacibus alis Surgat in officiura venerandi Mufa parentis 5

Hocutcunque tibigratum ptteroptime carman Exiguum meditatur opus, nee novimus ipfi Aptius a nobis quae pofllint munera donis Refpondere tuts, quamvis nee maxima poflmt Refpondere tuis, nedum ut par gratia donis io

Effe queat, vacuis qua? redditur arida verbis. Sed tamen hxc noftros oftendit paging cenfys, Et quod habemus opum charta numeravimus ifta. Quae mihi funt nujlac, nifi quas dedit aurea Clio Quas mihi femoto fomni peperere fub antro, 15

Et nemoi is laureta facri Parnaflides umbrae.

Nee tu vatisopus divinum defpice carmen, Quo nihil aethereos ortus, & femina caeli, Nil magis humanam commendat originc mentem, Sandra Prometheae ret inens veftigia flammae. 20

Carmen amant fuperi, tremebundaque Tartara carmea Ima ciere valet, divofque ligare profundos, Et triplici duros Manes adamante coercet. Carmine fepofiti retegunt arcana futuri Pheebades, & tremulae pallantes ora Sibylhe i 25

Carmina (acrificus follennes pangit ad aras

P 4 Aurea

(66)

Aurea feu (remit motantem cornua taurumi

Seu cum fata fagax fumantibus abdita fibris

Confulit, & tepidis Parcam fcrutafur in extis.

Nos etiam patrium tunc cum repetemus Olympum, 30

iEternaeque morae ftabunt immobilis aevi,

Ibinsus auratis per caeli templa coronis,

Dulcia fuaviloquo fociantes carmina pjedho,

Aftra quibus, geminique poli convex* fonabunt.

Spirifus & npidos qui circinat igneus orbes, 35

Nunc quoque fydereis infercinit ipfe choreis

Immortale melos, & inenarrabile carmen •,

Torrida dum rutilus compefcit fibila ferpens,

DemifTcque feicx gladio manfueftit Orion i

Stellarum ncc fentit onus Maurufius Atlas. 40

Carmina rrgaiescpulas ornare folebant,

Cum nondum luxus, vaftceque immenfa vorago

Nota gulae, & modieo fpumabat ccena Lyaeo.

Turn de more fedens fefta ad convivia vates

iEfculea intonfos redimitus ab arbore crines, 45

Heroumque actus, imitandaque geflacanebaf,

Et chaos, & poHfi late fundamina mundi,

Reptanfcfque Dem, & alemes numina glandes,

Ef nondum iEtneo quaefimm fulmen ab antro.

Dcuiquc quid vocis modulamen inane juvabif, 50

Veiborum

5 officium] offlicium 8 poffunt] poffint 13 ifta,] ifta In 1645 there is a spacer mark like a square bracket at the end of the line, but no punctuation in any copy examined. The Co- lumbia note is misleading.

35 orbes,] orbes, See 1645 notes on this line and the 1645 punctuation. 49 jEtneo] ALtxvxo

132

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

Verborum fenfufque vacans, numerique loquacis > Silveftres decet ifte choros, non Orphea cantus, Qui tenuit fluvios & quercubus addidit aures Carmine, non cithara, fimulachraque fun&a cancndo Compulit in Jacrymas j habet has a carmine Iaudes.

Nee tu perge precor facras contemnere Muds, Nee vanas inopefque puta, quarum ipfe peritus Munere, mille fonos numeros componis ad aptos, Millibus & vocem modulis variare canoram Doctus, Arionii merito fis nominis hasres. Nunc tibi quid mirum, fi me genuifle poetam Contigerit, charo fi tarn prope fanguine jun&i Cognatas arfes, ftudiumque affine fequamur: Ipfe volens Phoebus fe difpertire duobus, Altera dona mihi, dedit altera dona parent!, Dividuumque Deum genitorque puerque tenemus.

Tu tamen ut fimules teneras odiffe camoenas, Non odiffe reor, neque enim, pater, ire jubebas Qua via lata patet, qua pronior area lucri, Certaque condendi fulget fpes aurea nummi : Nee rapis ad leges, male cuftoditaque gentis Jura, nee infulfis damnas clamoribus aures. Sed magis excultam cupiens ditefcere raentem, Me procul urbano ftrepitu, feceffibus altis

(68)

Abdu&um Aonias jucunda per otia ripse 75

Fhoebaeo lateri comitem finis ire beatum. Officium chari taceo commune parentis, Me pofcunt majora, tuo pater optime fumptu

55 Cum mihi Romulcae patuit f*cundia lingua:,

Et Latii veneres, & quae Jovis ora decebant 80

Grandia magniloquis elata votabula Graiis, Addere fuafifti quos ja&at Gallia flores, Et quam degerferi novus Italus ore loquelam

60 Fundit, Barbaricos reftatus voce tumultus,

Quaeque Pateftinus loquitur myfterla vates. 85

Denique quicquid habet coelum, fubjecfaque Ccelo Terra parens, terrsque & ccelo interfluus aer, Quicquid & undategif, pontiqueagitabilcmarmor,

65 Per te node licet, per te, fi nolle libebif.

Dimotaque venit fpedtanda fcientia nube, 90

Nudaque confpicuos inclinat ad ofcula vultus, Ni fugiife velim, ni fit libafiTe moleftum.

I nunc, confer opes qujfquis malcfanus avitas

70 Auftriaci gazss, Pcraanaque regna prasoptas.

Qm£ potuit inajora pater tribuiiTc, vel ipfe 95

Jupiter, execpto, donaffet ut omnia, ccelo ?

Non pociora dedit, quamvis & tuta fuiffent,

Publica qui juveni commifit lumina nato Ab- Atque

58 Munere,] ] The Columbia note is wrong. 69 Qua] The u is not clearly printed in any 1673 copy examined.

86 coelum,] caelum, 90 Dimotaque] Dimotaque

AD PATREM

PSALM CXIV (GREEK) — 1673

133

(*9)

Atque Hyperionioscurrus,&: fraena diei, Et circum undantem radiata luce tiaram. Ergo ego jam do&ae pars quamlibet ima catcrv® Vi&rices hederas inter, laurofque fedebo, Jamque nee obfeurus populo mifcebor inerti, Vitabuntque oculos veftigia noftra profanos. Efte procul vigiles curs, procul efte querela, Invidiaeque acies tranfverfo tortilis hirquo, Sasva neC anguiferos extende Calumnia rictus * In me trifle nihil fsdiffima turba poteftis, Nee veftri Turn juris ego i fecuraque tutus Pedrora, vipereo gradiar fublimis abidfru.

At tibi, chare pater, poftquam non a:qua merenti PofTe referre datur, nee dona rependere factis, Sit memorafTe fatis, repetitaque muncra grato Percenfere animo, fidaeque reponere menti.

Et vos, O noftri, juvenilia carmina, lufus, Si modo perpetuos fperare audebitis annctf, Et domini fupereflfe rogo, luce'mque tueri, Nee fpiflb rapient oblivia nigra fub Oreo, Forfitan has laudes, decantatumque parentis Nomen, ad exemplum, fero fcrvabrtis aevo.

100

105

no

115

120

(7?)

5

X*X*SSX3)<E** &X*X^!R&Jwwwj3w'>3i5

PSALM CXIV.

ISgjuiX. on wtwJif, oV iy\eti #)C httuS&f A» tdt» /<»»» tm i'tnov >«»©>• tjtt K<At. ET<A ^ tvryimJto QuytF *#a»«r« $w\a««t

E* #' opttt (rvAfftfjubim infy'tain x\t»««vT8> Of Y-ejLli (rwpwmt ii/TgjtpjgjB w aX»n»

Kuftpri ukv^JH g?3»» ; ti f £f \svtt\tx%Mi I&t Ioy <Atv» •ztbti ipyugnfia. "mtyi* 5 TrsT o^s* 0"^5t^/Mjemi «V«p4fl7* x\ov««&»

Batcrigti tl <?' dp vju/Mf eLvsMnuprxortr \^/.nt«x% 'Out 7ra.fcu aiySyi pix« vtk fwrneA «£WC» 2«sa ydket tpvtort Stof fwytX* cMtvTriarm Two. Ston Tf«sr' vTmmv tri@*« 'levttxiJko X)f Tf 19 c«. cm\dJhn "mttt/uif %t /mpp/j^na-i » K/niwyr aivaov mrpm >sstp <fax/wsflra?>

ro

15

20

fhilofophus

PSALM.

100 circum circum

As stated in the Introduction, accent and breathing marks are difficult and sometimes impossible to make out with certainty. Therefore, only differences between 1673 and 1645 words are recorded here for this and the following Greek poem. In both 1673 and 1645, the ligature « is ov. Title. PSALM CXIV.]

PJalm II4. 2 ' kLyVTTTOv] AlJVTTTlOV 15 <TKa(j>fXOi<TLv] aKapdpoiaiv

1 6 <j<t>pi.y6uvTr)s) affapiyowvTts 1 8 /j,rjTr)pi] p.r)Ttpi

134

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(70

Pbilojopbuf ad regem qmndam qui mm ignotum & in tern inter reos forte captum infcius damnaverat

'CI aim h foUnt fu t im/MY, *<fi «»' *»f&>t Toiov f at, m\ios jt$eA<iwfMV «Ajyef bxievui.

J« E$gei £/»/ Scnlptorem

$*iff t«^' ay, <»■£;? A(T@j etUTB^wc @k*Tm» Toy <T* otfuTrnm we 1<3»),v6vtk p*\o{

^^/ Salfilhtm pott Am Romam/m tgrotantem.

SCAZONTES.

OMufa greffum quae volens trahis claudum, Vulcanioque tarda gaudes inceffu, Nee fentis illud in loco minus gratum, Quam cum deccntes flava Deiope fura^ Atternat aureum ante Junonis k#um,

Adefdum & haec s'is verba pauca Salfillo

Refer,

(70

Refer, camoena noftra cui tantum eft cordi, Quamque ille magnis praetulit immerito divis. Haec ergo alumnus tile Londini Mil to, Diebushifce quifuum linquens nidum Polique tra&um, (peffimus ubi ventorum, Inlanientis impotenfque pulmonis Pernix anhela fub Jove exercet flabra) Venit feraces Itali foli ad glebas, Vifum fupcrbS cognitas urbes fama Virofque dodteque indolem juventutfc, Tibi optat idem hie fauna multa Salfille, Habitumque feflb cotpori penitus fanum % Cui nunc profunda bilis infeftat renes, Praecordiifque flxa damnofum fplrat. Nee id pepercit impia quod tu Romano Tarn cultus ore Lesbium condis melos. O duke diviicn munus, Ofalus Hebes Germana! Tuque Phoebe morborum terror Pythone cajfo, five tu magis Pa?an Libenter audis,hic tuus facerdos eft. Querceta Fauni, vofque rore vinofo Colks benigni, mhis Evandri fedes, Si quid falubre vallibus frondet veftri% Levamen aegro fertc ceitatirn vati.

10

15

20

25

30

Sic

Philosophus. Title. End of first line in / In most 1673 copies, the right hand ends of the first two lines of the title have suffered mutilation of some kind, and the end of the first line in most copies seems to be in / though it is obvious that the word should be infon /tern as in 1645. In British Museum 1076 f 19, Cam- bridge Trinity College Cap. W. 31, and Harvard 14485.12 copies, however, there is a trace after the n of the bottom of the / and measurement of all copies indicates that something is missing. 2 damnaverat,] Again, most 1673 copies seem to lack the comma, and only in the three copies mentioned above is it present. Text. 4 The entire line is different in 1673 and 1645. See 1645 Latin p. 70. 5 t6\ios] jnJXeojs In Effigei. All copies examined read Effigei and in all but one or two copies, the liga- ture ffi is battered. Ad Salsillum. The title in italics is set in a single line in 1673, and in two lines, with the type a little smaller in the second, in 1645. Romanum] In several 1673 copies examined, there is a heavy blob of ink between the R and the 0 but most copies examined are free from it. 5 lectum, ] lectum.

28 Evandri] Euandri

AD SALSILLUM

MANSUS — 1673

135

(73> Sic ille charts redditus rurfum Muds Vidnadulci prata mulcebit cantu. Ipfe inter atros emiirabitur lucos Numa, ubi beatum dcgit otium £ternurqv Suam redivis Temper iEgeriam fpedans, Tumidufque & ipfe Tibris hinc delinifus Spei favebit annuae colonoxum ; Nee in fepulchris ibit obftflum reggs Nimium feniftro laxus irruens loro : Sed fra?na melius temperabit undarum, Adufquecurvi falfa regna Poitumni.

35

40

Manfus.

(74.) Manfus,

Joannes Baptifta Manfus Marcbio Vitienfu vir ingenii laude, turn liter arum fiudio , nee mn & bellies virtute apud Italos clarus in frimis eft. Ad quern Torquati tfafji dialogus extat at Amicitia fcriptus * erat mint lafft amicifjimus » ab quo etiam inter Cam- 5 fani£ principes celebratur , in illopoemate cut titultts Gerulalemme conquiftata, lib. 20.

Fra cavalier magnanimi, e cortcfi Rifplende il Manib ■

Is author em Neapoli commoranum fumma bcnevolentia 10 profecutus eJi , multaque ei detulit humanitatis ojfi- cia. Ad bum itaque bofpes ille antequam ab ea urbe difcedereti ut ne ing* atum fe ojienderet , hoc carmen mifit.

HiEcquoque Manfe tu£ meditantur carmina laudi Pierides, tibi Manfe choro notUfime Phoebi, Q^andoquidem ille alium haud aequo eft dignatus ho- Poft galli cineres,~& Mecacnatis Hetrufci. Cnore,

Tu quoque fi noftrae tantum vakt aura Camoenav 5

Vidrrices hederas inter, laurofque fedebis. Te pridem magno felix concoidia Taflb Junxir, & aeternisinferipfic nomina chartis. Mox tibi dulcilcquum non infeia Mufa Marinum Tradidit, i'.le tuum dicife gaudet alumnum,

Durn

10

Introduction. 2 bellica] bellied 4 Amicitia] Amicitid 10 fumma] fumma benevolentia] benevolentid 12 ea] ed 2 choro notiffime] choronotiffime 4 galli] Galli

136

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

.. (75)

Dum canit AfTyrios divum prolixus amores ,

Mollis & Aufonias ftupefecit carmine nymphas.

IIlc itidem moriens tibi foli debita vates

'Ofla tibi foli, fupremaque vota reliquir.

Nee manes pietas tua chara fefellit amici, 15

Vidimus arridentem operofo ex acre poetam.

Nee (atis hoc vifum eft in utrumque, & nee pia cefTant

Qfficia in tumulo, cupis integros rapere Oreo,

Qja potes, atqiie avidas Parcarum eludere leges :

Amborum genus, & varia Tub forte ptradtam 20

Defcribis viram, morefque, &dona Minervse>

iEmulus illius Mycalen qui natus ad altam

Rettulit iEolii vitam facundus Homeri.

Ergo ego te Clius & magni nomine Phcfcbi

Manfe pater, jubeo longum falvere per sevum 25

Miflfus Hyperborco juvenis peregrinusab axe.

Nee tu longinguam bonus afpernabere raufam,

Quae nuper gelidi vix enutrita fub Ar&o

Imprudens Italas aufa eft volitare per urbes.

Nos etiam in noftro modulantes flumine cygnos 30

Credimus obfeuras nocYis fenfiffe per umbras,

Qua Thamefis late puris argenteus urnis

Oceani glaucos perfundit gurgite crines.

Quin & in has quondam pervenit Tityrus oras.

a.

Sed

Sed neque nos genus incultum, nee inutile Phoebo, 35

Quia plaga fepteno mundi fulcata Trione

Brumalem patitur longa fub no&e. Booten.

Nos etiam colimus Phcebum, nos raunera Phoebo

Flaventes (picas, & lutea mala caniftris,

Halantemque crocum Cperhibet nifi vana vetuftas) 40

Mifimus, & ledlas Druidum de gente choreas.

C Gens Druides antiqua facris operata deorum

Heroum laudes imitandaque gefta canebant )

Hinc quotiesfefto cingunt altaria cantu

Delo in herbosa Graia? de more puellae 45

Carminibus laetis memorant Corinsida Loxo,

Fatidicamque llpin, cumflavicoma Hecacrgc

Nuda Caledonio variatas pedrora fuco.

Fortunate fenex, ergo quacunque per orbem

Torquati decus, 5c nomen celebrabitur ingens, 50

Claraque perpetui fuccrefcet fama Marini,

Tu quoque in ora frequens venies plaufumquc virorum,

Et parili carpes iter immortale volatu,

Dicetur turn fponte tuos habitafle penates

Cynthius, & famulas venifle ad limina Mufas : 55

At non fponte domum tamen idem, & regis adivit

Rura Pheretiada?coeb fugitivus Apollo i

Ille licet magnum Alciden fufceperat hofpes »

Tantutri

19 Qua] Qua 27 longinguam] longinquam mufam,] Mufam, 28 gelida] ] Columbia note is wrong. 32 late] late 34 oras.] ] In some 1673 copies examined, the period is smeared, but in all copies examined there is no doubt that it is a period, though it requires a clear copy to make a smeared one certain.

46 Corineida] Corineida This is a typical example of several apparent differences set up by the Columbia notes that are mis- leading and raise unnecessary problems. Magnification here shows clearly, that in 1673, the attempt was made to put a diaeresis over the e in the usual fashion, by using a circumflex with the top cut off. The result was a mark that shows only the left hand part of the original circumflex, the i following, with its own dot, -no doubt causing the defective printing of the mutilated circumflex. In 1645, a diaeresis was used, but it was worn, and the following 'i' troubled it enough that only the right hand dot of the diaeresis printed. The result is only an apparent difficulty that is clear enough under magnification. Both texts were trying to get a diaeresis over the e.

47 Hecaerge] The same result, with variations in 1673, has occurred here as in line 46. 54 habitaffe] habitaffe

57 coelo] caelo

MANSUS— 1673

137

07) Tantnm ubidamofos placuit vitare bubulcos, Nobile manfueti ceffit Chironis in antrum, 6o

Irriguos inter faltus frondofaque tcdta Peneiuxn prope rivum : ibi faepe fub ilice nigra" Ad cithars (trepitum blanda prece vi&us amici Exilii duros lenibat voce labores. Turn neque ripa fuo, barathro nee fixa fub imo, 65

Saxa fietere loco, nutat Trachinia rupes, Nee fentit folitas, imrmnia pondera, filvas, Emotasque fuis properant de collibus orni, Mulcenturque novo maculoii carmine lynces. Diis dile&e fenex, te Jupiter aequus oportet 70

Nafcentem, & miti luftrarit lumine Phoebus, Atlantifque neposj heque enim nifi charus ab orttf Diis fuperis poterit magno faviffe poet a?. Hinc Iongaeva tibi lento fub flore fene&us Vernat, & iEfonios lucratur vivida fufos, 75

Nondum deciduos fervans tibi frontis honores, Ingeniumque vigens, & adultum mentis acumen. O mihi fi mea fors talem concedat amicum Phccbaeos decoraffe viros qui tarn bene norit, Si quando indigenas rcvocabo in carmina reges, 80

Arturumque etiam fub terris bella moventem >

Ant dkam invi&ae foeiali foedere menf»,

Qjt Magnammos

(78) Magnaniinos Heroas, &. ( O modo fpiritus ad fit ) Frangam S.xonicas Britonum fub Marte phalanges. Tandem ubi non tacitae permenfus tempora vita?, 85

Annorumque faturcineti fua jura relinquam, Ille mihileclo madidis aftaret bcellis, Aftanti fat erit fi dicam fim tibi curae > I le meos artus liventi morte folutos Curaret parva componi molliter urna. 90

Forfitan & noftros ducat de marmore vultus, Nedrens aut Paphia myrti aut Parnaflide lauri Fronde comas, at egofecura pace quiefcam. Turn quoque, fi qua fides, fi praemia certa bonorum, Ipfe ego caelicolum femotus in sthera divuro, 95

Quo labor & mens put a vehunt, atque ignea virtus Sccreti hxc aliqua mundi de parte videbo ( Quantum fata finunt ) & tota mente ferenum Ridens purpureo fuffundarlumine vultus Et fimul anhereo plaudam mihi laetus Olympo.

100

EPITAPHIUM

79 n6rit,] norit, 82 Ant] Aut The n in 1673 and in all copies examined is an inverted u rather than a true n. The Columbia text has emended this and carries no note.

83 ad fit) ] ] Columbia text reads adfit and has no note.

138

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(79)

■.(*>)

HtBSSSS!

a&? ttto cW» «W» tAB» <flW> (JtfP ;

1 >S eJS! sis s^&§5§& '

EPITAPHIUM

DAMON1S.

ARGUMENTUM.

THyrfis & Damon ejufdem vicinias Paftores , eadem ftudia fequuti a pueritia amici erant , ut qui plurimum. Thyrfis animi caufa pro- fcftus peregre de obitu Damonis nuncium 5 accepit. Domum poftea reverfus, & rem ka effe comperto, fe, fuamque folitudi- nem hoc carmine deplorac. Damonis au- tem fub perfona hie intelligitur Carolus Deodatus ex urbe Hetruria* Luca Paternoio genere oriundus, castera Anglus ; ingenio, do&rina, clariffimifque ceteris virtutibus, dum vivcret, juvenis egregius.

Q_5

Epitaphium

f*V»

EPITAPHIUM

DAMONIS-

HImerides nymphas ( nam vos & B*phnin & Hy- Et plorata din meminiftis fata Bionis) (la*1' Dicite Sicelicum Thamefina per oppida carmen: Quas mifer effudit voces, qua: murmura Thyrfis, Et quibus afliduis exercui t antra querelis, 5

Fluminaque, fonrefque vagos, nemorumque receffus, Dum fibi prgereptum queritur Damona, neque altam Lu&ibus exemit noc>em loca foh perrerans. Et jam bis viridi (urgebat culmus arifta, Et totidem flavas numerabant horrea raefles, 1 0

Ex quo fumraa dies tulerat Damona fub umbras, Nee dum aderat Thyrfis *, paftorem feiheet ilium Dulcis amor Mufar Thufca retincbat in urbe. Aft ubi mens expleta domum, pecorifque reli&i Cura vocat, fimul afTueta feditque fub ulmo, 15

Turn vero ami (Turn turn denique fen tit amicum,

Ccepit

The collation is of 1673, 1645, and ca. 1640. The collation of the ca. 1640 text presented in Columbia vol. XVIII., pages 642-43, is extremely unreliable. Title. EPITAPHIUM/ DAMONIS./ ARGUMENTUM.]] EPITAPHIVM/ DAMONIS./ ARGVMENTVM./ 1 THyrfis] ] THyrfis, ejufdem] ] eiufdem 2 Paftores,] ] paftores, 3 pueritia] pueritia] ] 4 plurimum] plurimum] ] caufa] caufa] ] 5 peregre] ] peregre 9 perfona] perfona] ] 10 Paterno] paterno] ] 11 oriundus, ] ] onundus, 12 clariffimifque]]

clarifsimifque 13 juvenis] ] iuvenis Catchword Epitaphium] ] DAMON

Title. EPITAPHIUM/ DAMONIS./]] DAMON. 1 Hy-~| Hy-~| Hy- 3 carmen:] ] carmen 5 querelis,] ] (lan»J (Ian J (Ian

querelis 6 Fluminaque,] ] Fluminaque nemorumque] The first m is broken or smeared in all 1673 copies examined, receffus, ] ] receffus 8 perrerans.] pererrans. ] ] 11 umbras,] ] umbras 12 Thyrfis;] ] Thyrfis, 16 verd] vero] ]

EPITAPHIUM DAMONIS— 1673

139

20

(8l> Ccepic & immenfum fie exonerate dolorem.

Ire domum impafti, domino jam non vacat, agni. Hci mihi ! quat ferris, quae dicam numina coclo, Poftquam te imrniti rapuerunt funere Damon i Siccinc nos linquis, tua fie fine nomine virtus Ibit, & obfcurisnumerofociabrlur umbris? At non ille, anion's virga qui dividit aurei, Ifta velit, dignumque tui te ducat in agmen, Ignavumque procul pecus arceat omne filentum, 25

Itc domum impafti, domino jam non vacat, agni. Quicquid erit, cette nifi me lupus ante videbrt, Indeplorito non comminuere fepulehro, Conftabit<jue tuus tibi honos, longumqOe vigebit nter paftores : Illi tibi vota fecundo 30

Solvere poft Daphnin, poft Daphnin dicere laudes Gaudebunt, dum rura Pales, dumFaunus aroabit: Si quid id §ft, prifcamque fidem coluiiTe, piumque, Palladiafque attes, fociiimque habuifle canorucn.

Ife domum impafti, domino jam non vacat, agni. 35 Ha?c tibi certa manenf, tibi erunt ha:c prscmia Damoq, At mihi quid tandem net modo? quis mihi tfdus Hacrcbit lateri comes, ux tu faepe folebas Frigoribus duris, & per loca fceta pruinis, Aut rapido fub fole, fiti morientibus hcrbis I 40

CL4 Sire

Sive opus in magnos fuit eminus ire leones Aut avidos terrere bpos prasfepibus altis> Quis fando fopire diem, cantuque folebit >

Ite domum impafti, domino jam non vacat, agni. Peclora cui credam } quis me lenire docebit 45

Mordaces curas, quis longam fallcre no&em Dulcibus alloquiis, grato cum fibilat igni Molle pyrum, & nucibus ftrepitat focus, at malusaufter Mifcet curxfh foris, & defuper intonat ulmo.

Itc domum impafti, domino jam non vacat, agni. 50 Aut asftate, dies medio dum vertitur axe, Cum Pan aefculea fomnum capit abditus umbra, Et repetunt fub-aquis fibi nota fedilia nymphae. Paftorefquc latent, ftertit fub fepe colonus, Qus mihi bhnd.itiafque tuas, quis turn mihi rifus, 55 Cecropiofque fales referet, cultofque lepores >

Ice domum impafti, domino jam non vacat agni. At j:m folus agios, jam pafcua folus oberro, Sicubi ramofae denfantur vallibus umbrae, Hie fcrum expe&o, fupra caput imber & Eurus 60

Trifle (onanf, fradteque agitata crtpufcula filva?.

Ite domum impafti, domino jam non vacat, agni.

Heu qium culta mihi priiis aiva procacibus heibis

Involvuntur, & ipfafitu feges alta f atifcit !

Innuba

17 Coepit] ] Caepit 18 jam] ] iam 19 mihi!] ] mihi ccelo,] ] coelo? 20 Damon ; ] ] Damon ! 23 aurea, ] ] aurea 24 agmen,] ] agmen 26 jam] ] iam 28 fepulehro,] fepulcro,] ] 29 vigebit In all 1673 copies examined, the last four letters of this word are above the line of type. 30 Inter In all 1673 copies examined, the I is above the line of type. Illi] ] illi, 38 comes,] ] comes 39 fceta] ] facta 40 herbis?] ] herbis

42 lupos] ] But there is a space for the comma in 1645. lupos, praefepibus] ] prefepibus This is the first of these e. See note to the ca. 1640 text, p. 356. 44 jam] ] iam 49 ulmo.] ] ulmo 50 jam] ] iam 52 umbra,] ] umbra 53 nymphae.] ] nymphae, 55 Quis] In no 1673 copy examined is the u clearly printed. rifus,] ] rifus 57 jam] ] iam vacat] vacat,] ]

58 jam . . . jam] ] iam . . . iam oberro,] ] oberro

59 umbrae,] ] umbrae 62 jam] ] iam 63 quam] ] quam

140

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

C8?)

Innubi neglefto marcefcit & uva racemo, 65

Nee myrteta juvant i ovium quoque taedef, at ills Moerent, inquefuum convertunt ora magiftrurn.

Ite domurn impafti, domino jam non vacat, agni. Tityrus ad corylos vocat, Alphcfiboeus ad ornos, Ad falices AegOn, ad flumina pulcher Amyntas, 70

Hie gelidi fontes, hie illita gram ina mulco, Hie Zephiri, hie plaeidas interftrepit arbutus undas > Ida canunt furdo, frutkes ego na&us abibam.

Ite domum impaftj, domino jam non vacat, agni. Mopfus ad hate, nam me redeuntem forte notarat 75 ( £t callebat avium linguas, & fydera Mopfus ) Thyrfi quid hoc i ^ixit, quae te coquit improba bills ? Aut te perdit amor, aut te male fafcinat aft rum, Saturni grave fa?pe fuit paftoribus aftrum, Intimaque obliquo figit praecordia plumbo. 80

Ite domnm impafti, domino jam non vacat, agni. Mirantur nymphae, & quid te Thyrfi futurum eft ? Quid tibi vis > aiunt, non haec folet efle juventas Nubilafrons, oculique truces, vultufque feveri, Ilia choros, lufufque leves, & femper amorem 85

Jure petit, bis ille mifer qui ferus amavit.

Ite domum impafti, domino jam non vacat, agni.

Venit Hyas, Dryopeque, & filia Baucidis Aegle

Dofta

<84)

Do&a modos, citharaque fciens, fed perdita faftu,

Venit Idumanii Chloris vicina fluenti >

Nil me bland ids, nil me folantia verba,

Nil me, fi quid adeft, mover, aut fpes ulla futuri.

Ite domum impafti, domino jam non vacat, agni* Hei mihi quam fimiles ludunt per prata juvenci, Omnes unanimi fecum fibi lege fodales, Nee magis hunc alio quifquam fecernit amicum De grege, fie denfi veniant ad pabula thoes, Inque vicem hirfuti paribus junguntur onagri > Lex eadem pelagi, deferto in littore Proteus Agmina Phocarum numerat, vilifque volucrum Paffer habet femper quicum fit, & omnia circum Farra libens volitet, fero fua tec^a revifens, Qiiem fi fors letho objecit, feu milvus adunco Fata tulit roftro, leu ftravit arundine foflbr, Protinus ille alium focio petit inde volatu. Nos durum genus, & diris exercita fatis Gens homines aJiena animis, & pe&ore difcors, Vix fibi quifque parem de millibu* invenit unum, Aut fi fors dederic tandem non afpera votis, Ilium inopina dies qua* non fperaveris hora Surripit, sternum linquens in farcula damnum.

Ite domum impafti, domino jam non vacat, agni.

90

95

100

105

I-IO

Heu

66 juvant;] ] juvant, 67 Moerent,] ] Maerent, magiftrurn.] ] magiftrurn 72 Zephiri,] Zephyri,]] 75 notarat] ] notarat 78 aftrum,] ] aftrum 80 plumbo.] ] plumbo 83 aiunt,] ajunt,] ] 84 feveri,] ] feveri 86 Jure] ] lure 88 &] ] et

90 fluenti;] ] fluenti, 91 verba,] ] verba 94 juvenci,] ] juvenci 98 onagri;] ] onagri, 102 volitet,] ] volitet 107 Gens homines] ] Gens, homines, difcors,] ] difcors

EPITAPHIUM DAMONIS— 1673

141

Heu quis me ignotas traxit vagus error in eras

Ire per aereas rupes, Alpemque nivofam !

Ecquid erat tanti Romam vidifle fepultam > 1 15

Quamvis ilia foret, qualem dumviferet olim,

Tityrus ipfc fuas $c oves & rura reliquit y

Ut te tamdulci poflem caruiffe fodale,

Poffem tot maria alta, tot interponere montes,

Tot fylvas, tot fax* tibi, fluviofque fonanfes. 120

Ah certe extremum licuhTet tangere dextram,

Et bene compofitos placide morientis ocellos,

Et dixifle vale, noftri memot ibis ad aftra.

Itedomum impafti, domino jam non vacaf, agnu Quamquam eiiam veftri nunquam meminifle pigebit 125 Paftores Thufci, Mufis operata juventus, Hie Charis,.atque Lepos » & Thufcus tu quoque Damon* Antiqua genus unde petis Lucumonis ab urbe. O ego quantus eram, gelidi cum ftratus ad Ami Murmura, populeumque nemus, qua mollior herba, 130 Carpere nunc violas, nunc fummas carpere myrtos, Et potui Lycidae certantem audire Menalcam. Ipfe etiam tcntarc aufus fum, nee puto multum Difplicui, nam funt & apud me munera veftra Fifcellae > calathique & cerea vincla cicutae, 135

Quin & noftrafuas docuerunf nominaTagos

Et

(80

Et Datis, & Francinus,erant & vocibus ambo Et ftudiis noti, Lydorum fanguinis ambo.

Ite domum impafti* domino jam non vacat, agni. Haec mihi turn laeto di&abat rofcida luna, 140

Dum folus tcneros claudebam cratibus hoedos* Ah quoties dixi, cum te cinis ater habebat, Nunc canit, aut lepori nunc tendit retia Damon, Vimina nunc texit, vaiios fibi quod fit in ufus > Et qua* turn facili fperabam mente futura 145

Arripui voto levis, & piaefentia finxi, Heus bone numquid agis ? nifi te quid forte retardat, Imus> & arguta paulum recubamus in umbra, Aut ad aquas Col hi, aut ubi jugera Caflibelauni > Tu mihi percurres medicos, tua gramina, fuccos, 150 Helleboiumque,humileTque crocos,foliumque hyacinthi> Qjafque habet ifta palus herbas, artefque medentum, Ah pereant herbs, pereant artefque medentum Gramina, poftquara ipfi nil profecere magiftro. Ipfe etiam, nam nefcio quid mihi grande fonabat 155 Fiftula, ab undecima" jam lux eft altera node, Et turn forte novis admoram labra cicut is, DiiGluere famen rupta compage, nee ultra Ferre graves potuere fonos, dubito quoque ne Gin Turgidulus, tamen & referam, vos cedite Glva?. 160

Ite

114 aereas]] aereas 118 Ut] ] Vt fodale,] ] fodale 127 Damon.] Damon,] Damon. 129 eram,] ] eram 131 myrtos,] ] myrtos 132 Menalcam.] ] Menalcam, 135 Fifcellae;] Fifcellae,] ]

139 jam] ] iam 141 hoedos.] ] haedos. 147 retardat,] ] retardat 151 foliumque] foliflmque] foliumq; hyacinthii]

All 1673 copies examined have the comma out of line. 152 medentum,]] medentum, 153 Ah]] (Ah medentum]] medentum 154 magiftro.]] magiftro.) 156 jam]] iam 160 filvae.] ] filvae

142

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

(*7)

Ire domum impafti, domino jam non vacat, agni. Ipfe ego Dar danias Rutupina per aequora puppes Dicam, & Pandrafidos regnum vetus Inogeniae, Brennumque Arviragumque duces, prifcumque Beliniv Et tandem Armor icos Britonum fub lege colonos > 165 Turn gravidam Arturo fatali fraude Jogernen Mendaces vultus, aflurnptaque Gorlois arma, Merlini dolus. O mihi turn fi vita fuperfit, Tu procul annofa pendcbis flftula pinu Mnltum oblita mihi, aut patriis mutata camcenis 170 Brittonicum (hides, quid enim ? omnia non licet uni Non fperaffe uni licet omnia, mi fatis ampla Merces, & mihi grande decus (fim ignotus in sevurn Turn licet, externo penitiifque inglorius orbi) Si me flava comas le^at Ufa, & potor Alauni, 175

Vorticibufque frequcns Abra, & nemus omne Treantae, Et Thamefis raeus ante omnes, & fufca metallis Tamara, & extremis me difcant Orcades undis.

Ite domum impafti, domino jam non vacat, agni.

Ha?c tibi fervabam lenta fub cortice lauri, 180

Ha?c, & plura fimul, turn quae mihi pocula Manfus,

Manfus Chalcidica? non ultima gloria ripae

Bina dedit, mirumartis opus, mirandus & ipfe,

Et circum gemino caclaverat argumento :

In

(88)

In medio rubri maris unda, & odoriferum ver 185

Littora longa Arabum, & fudantes balfama filvs,

Has inter Phoenix divina avis, unica terris

Caeruleum fulgens diverfieoloribus alis

Auroramvitreisfurgentem rcfpicit undis.

Parte alia polus omnipatens, & magnus Olympus, 190

Quis putet? hie quoq i Amor, pidteqi in nube pharetrae,

Arma corufca faces, gc fptrula tincta pyropo »

Nee tenues animas, pe&iifque ignobile vulgi

Hinc ferif, at circum flammantia lumina torquens

Semper in ere&um fpargit fua tela per orbes 195

Impiger, & pronos nunquam collimat ad ictus,

Hinc mentes ardere facra?, formajque dcorum.

Tu quoque in his, nee me fallit fpes lubrica Damon,

Tu quoque in his ceite cs, n2m quo tua dulcis abiret

Sandtaque fimplicitas, nam quo tua Candida virtus ? 200

Nee te Lethsco fas quaefiviffe fob orco,

Nee tibi conveniunt lacryma?, nee flebimus ultra,

Ite procul lacryma?, puiumcolit aethers Damon,

iEthera purus habct, pluvium pede reppulit arcum?

Herciimque animas inter, divofque perennes, 205

fEthereos haurit latices & gaudia potat

Ore Sacro. Qjin tu cceli poft jura rcccpta

Dexter ades, pJacidvifque fave quicunque vocaris,

ncS

161 jam]] iam agni.]] agni 162 aequora] ] equora 163 Inogeniae,] ] Inogeniae 164 Brennumque] Brennumque]] prifcumque] prifcumque] ] Belinum, There are two states of 1673: the one, in which neither the m or comma printed, though both were intended and set; the other, in which the m failed to print, but in which the comma printed following the space occupied by the m which failed to print. The Columbia note is inadequate, as every 1673 copy examined shows traces under magnification of comma; all show space for both m and comma; and some show vestiges of the m.] ] Belinum 166 Jogernen] ] Iogernen 167 Gorlois] ] Gorlois arma,] ] arma 170 Mnltum] Multum] ] camcenis]] camaenis 172 fperaffe] fperaffe]] 175 Ufa,] ] Vfa, 178 undis.] ] undis 179 jam] ] iam 180 Haec] ] Hgc lauri,] ] lauri 181 Manfus,] ] Manfus 183 dedit,] ] dedit 184 circum] ] circum

186 filvae,] ] filvae 188 Caeruleum] ] Caeruleum 190 polus] Polus 191 quoq;] quoque] ] Amor,] ] Amor pictaeq;] pictaeque] ] pharetrae,]] pharetrae 192 pyropo;] ] pyropo

197 formaeque] ] formeque 202 lacrymae, ] ] lachrymae, 203 lacrymae,]] lachrymae, aethera] ] ethera 204 JEtheTa.} Aethera arcum;] ] arcum 205 perennes,] ] perennes 206 .flJthereos] ] Aethereos The Columbia note in appendix is meaningless, as there are no capitalized ligatures, JE, in the entire ca. 1640 edition. 208 quicunque]] quicunque Catchword ueS] Backwards in all 1673 copies examined.

AD JOANNEM ROUSIUM— 1673

143

(89) Seu tu nofter eris Damon, five sequior audis Diodotus, quo te divino nomine cundti Ccelicola: norint, fylvifquc vocabere Damon. Quod tibi purpureus pudor, & fine labe juventu'? Grata fuit, quod nulla tori libata voluptas, En etiam tibi vir§inci fervantur honores i' Ipfe caput nitidum cin&us rutihnte corona, Letaque frondentis geftans umbiacula palma: £temum perages immortales hymenals i Cantus ubi,choreifque furit lyra mifta beatis, Fefta Sionaeobacchantur & Orgia Thyrfo.

210

215

Jan. 23

(90)

Jan. 25. 1646,

Ad Joannem Roufium Oxonienfis Acade- mic Bibliothccarium.

De libro Voematum amijfo, quern illeftbi denuo mitti pojiulabat , ut cum aliis nofiris in Biblietheca publico, rcponeret. Ode.

1

Strophe i.

GEmelle cultu fimpiici gaudens liber, Fronde licet gcmina, Munditieque nitens non operofa, Quain manus attulit

Juvenilis olim, 5

Sedula tamen baud nimii Poefae ; Dum vagus Aufonias nunc per umbras • Nunc Britannica per vireta Iufit Infons populi, barbitoque devius Indulfit patrio, mox itidem pe&ine Daunio 10

Longinquum intonuit melos Vicinis, Sc humum vix tetigit pede >

Antijlrophe*

209 aequior] ] ?quior 211 Coelicolae] ] Celicolae norint,] norint,]] 212 Qudd] ] Quod 214 honores;]] honores, 216 Letaque] ] Probably should be 'Laetaque'. Letaque umbracula] ] umbtacula 217 Sternum] Sternum] Aeternum hymenseos;] ] hymeneos 218 beatis,] ] beatis 219 Sionseo] ] Sioneo Orgia] Orgia] ]

The only text ever printed by Milton so far as we know is the 1673. The well-known manuscript copy in the Bodleian Library, often spoken of as if it had been written by Milton himself, is reproduced on p. 458ff. As a matter of fact, the ms. is in a set hand, and has no known textual value.

144

POEMS, &c. UPON SEVERAL OCCASIONS — 1673

oo

Antiftrophe.

Quis te. parve liber, quis te fratribus Subduxit reliquis dolo ? Cam tu miflus ab urbe, Dodto jugiter obfecrante amico, Illuftrc tendebasiter Tharatfis ad incunabula Csemlei patris, Fontes xh\ !i npidi Aonidum, thyafufque facer Orbi notus per imrocnfos Tcmporum lapfus rcdeuntc ceelo, Celeberque futurus in svum>

t 2.

Modb quis deus, aut editus dco

Priftinam gentis mifcratus indolem

( Si fatis noxas luimus priores

Mollique luxu degener otium )

Tollat nefandosciviumtumultus,

Almaque revocet ftudia fan&us

£t rekgatas fine fede Mufas

Jam pene tods finibus AngHgenuna >

R

15

20

25

30

Immnn-

GO

Immundafque volucres

Unguibus imminentcs

Figat ApoilimapharetiS, 35

Phin^amque abigat peftem procul amne Pegafco*

Antifirophe.

Quin *u, libclle, nuntii licet mala

Fide, vel ofcitantia

Semel erraveris agmine fratrurn,

Seu quis te teneat fpecus, 40

Seu qua te latebra, forfan unde vili

Callo tereris inftitoris infulii,

1

Laetare felix, en iterum tibi

Spes nova fulget pofle profundam

Fugere Lethen, vehique Superam 45

In Jovis aulam remigc penna i

Strophe 3.

Nam te Roufitis fui

Opt.it peculi, numeroqne jufto

Sibi pollicitum qderitur abeflfe,

Rogatque venias ille cujus inclyta 50

Sunt data virum monumenta cura? s

Tcque adytis etiam facris

VoluiC

AD JOANNEM ROUSIUM— 1673

145

(93)

Voluit reponi quibus & ipfe pr*fideC

JEternorum opeTum cuftos fidclis,

Quarftorque gaza? nobilioris,

Quam cui prxfuit Ion

Clarus Erechtheidcs

Opulenta dei per templa parentis

Fulvofque tripodas, donaque Delphica

lonAdrsa genitus Creufa.

Antiftropbe.

Ergo tu vifae lucos

Mufarum ibis arnocnos,

Diamque Phcebi rurfus ibis in domum

Oxonia quam valle colit

t)Jo poAhabita,

Bifidoque Parnaffi jugo :

Ibis honeftus,

Poftquam egregiam tu quoque foitem

Nidus abis, dextri prece follicitatus amici.

IUic legeris inter alta nomina

Authorum, Graiae fimul & Latinae

Ar.uqua gentis lumiria, & verum decus.

B 2

55

6o

65

70

Efodfa

(9*) Epoctos.

Vos tandem haud vacui mei labores,

Quicquidjhoc fterile fudit ingenium,

Jam fero placidam fperare jubeo 75

Perfun&am invidia requiem, fedefque beatas

Quas bonus Hermes

Et tutela dabit folers Roiifi,

Quo neque lingua procax vulgi penetrabit, atquc longc

Turba legemum prava Eaceflfet » - 80

At ultimi nepotes,

Et cordatior aetas

Judicia rebus asquiora foifitan

Adhibebit integro finu.

Turn livore fepulto, 85

Si quid meremur fana pofteritas fciet

Roiiflo favente.

Ode tribus conftat Srrophis, totidemque Antiftrophis una demum epodo clau(i$,quas,tamct fi omnes nee verfuum numero , nee certis ubique colis exadte refpondeant , ita tamen fecuimus, commode legendipotius, quam ad an- tiquos concinendi modos rationem fpe&antes. Alioqum hoc genus re&ius fortaiTe dici monoilrophicum debue- rat. Metra partim funt \?%m partim &n\ixi«#«. Pha- leacia quae lunt, fpondasum tertio loco bis admittunt, quod idem in fecundo loco Catullus ad libitum fecit.

O F

The Latin poems end at the foot of this page, and the next page in the volume, page 95, is the beginning of Of Education as the catchword on page 94 indicates.

POEMS

BOTH ENGLISH AND LATIN

(1645)

147

POEMS, BOTH ENGLISH AND LATIN, 1645

INTRODUCTION

MILTON PRINTED in 1645 m°st, perhaps all, of the poems, English, Greek, Italian, and Latin, which he had written up to that time and which he wished to preserve and acknowl- edge. This small volume, now a great rarity in sound condition, was printed and pub- lished in London, by Ruth Raworth and Humphrey Moseley, respectively. We cannot be certain of its precise date of publication within some months. It was entered in the Stationers Register 6 October 1645; the title page bears the date 1645; the Thomason copy, British Museum E.1126., has the manuscript date Jan. 2 before the word LONDON, near the foot of the page. Those are the facts; but the book might have appeared at any time between August, 1645, and January 2, 1645 O.S. or 1646 as we would write it today.

The relationships between the publisher, Moseley, and Milton are unknown, and this book is the only publishing Moseley ever did for Milton. Probably he was selected because he had already published many volumes of poetry and other literary works. The printer, Ruth Raworth, is another story. There is some reason to believe that her husband, John Raworth, printed Comus for Henry Lawes in 1637; see page 262. John Raworth died, according to Plomer's Dictionary of Printers, in July, 1645, and his will was filed in August of the same summer. Milton was then living in Aldersgate Street, only a short distance from the bookseller, George Thomason, with whom he was already well acquainted; see Sonnet XIV. John Raworth, made free of the Sta- tioners Company according to Plomer, about 1632, had printed books for Thomason, though no poetry so far as is known. What more natural than the selection of the widow of the recently deceased John as the printer of the volume of poems registered for Moseley about the time Raworth's will was filed?

Although over twenty different actual copies of this edition have been examined, it is today scarcely possible to describe bibliographically the exact form in which the book first appeared. But the only persistent uncertainty is concerned with the end papers and binding. No copy ex- amined (Harvard, Boston Public Library, New York Public Library, Texas, Yale, Cambridge, Bodleian, British Museum, Folger, Illinois, Pershing) can be certainly designated as being now bound as it was originally. There are apparently only about a dozen copies extant that are in sound enough condition with all printed matter present to constitute a basis on which to erect a description of the contents, and no copy examined seemed to be in its original binding, i.e., in a binding that certainly was as old as the middle of the seventeenth century. But aside from the end papers, the remainder of the book can be very accurately described bibliographically. There are four leaves bound before the text of the English poems. The first of these leaves, but present in less than half the copies examined, has its apparent recto blank, with the crudely cut, but well drawn portrait by William Marshall on the apparent verso. The second leaf recto contains the title page, with its verso blank, then leaves 83 and SL4 follow, containing the four pages in order of Moseley's The Stationer to the Reader. There are no Table of Contents or errata leaves or pages in this edition. The text of the English poems begins on the recto of signature A on page 1, and continues through page 120, signature [H4V] ; after which, in most but not all copies extant, the Latin title page appears on signature [A] and page [1], continuing through page 84, signa- ture [F4v], with no omissions. The signatures are in double fours, or ordinary small octavo gatherings, the printed sheet having been folded three times. That is, both English and Latin poems were separately paginated and signatured. They may or may not have been sepa- rately printed. In the English poems, page [67], signature [E2r] bears a separate title page for

149

150 POEMS, BOTH ENGLISH AND LATIN — 1645

[Comus], page [68], signature [E2v], being blank. There is no blank leaf between the English and Latin poems in any copy examined. There can be no doubt that the poems were issued and sold in three different bindings or forms, namely, with English and Latin poems bound together as in most copies extant, with the English poems followed by the Latin, although Boston Public Library B.4178.14 has the Latin poems bound before the English. Secondly, the English poems were bound and issued separately, though rarely so found extant today, and usually treated as a defective copy, though it is doubtful if British Museum G. 18844. should be so treated. Thirdly, the Latin poems were bound and issued separately, (see Milton's letter to Dati, 21 April 1647, Fam. Ep. 10, Columbia 12:45) as the Illinois copy and one or two others testify.

The paper used for this edition is mainly single cap which ranges in size before trimming from twelve by fifteen inches to about fourteen by seventeen inches. Perhaps an occasional sheet of double cap paper was used, but no sheet in any copy examined had its watermark in a position that would prove the sheet a double cap one. Most of the paper carries a foolscap watermark, similar to, but not identical with Heawood number 46, and always without Heawood's superimposed ini- tial carrying device. But some of the paper, frequently the preliminary leaves, and sometimes a gathering or two in the text itself, usually in the Latin poems, bears a watermark about two inches square similar to Briquet's (1907) numbers 15,925-15,950, the double tower with peaked roof between the two towers. No copy examined carried the foolscap watermark in the preliminary leaves. The watermarks throughout the volume, including preliminary leaves and both parts, usually appear at the top of the bound edges of the paper, making the double tower difficult to identify, as it appears on leaves 2 and 3 and then on their conjugates, 6 and 7 respectively. The paper with either watermark is probably -French, Flemish, or Dutch. The size of the finished book would argue for the regular use of single sheets of cap paper, with occasional use of half sheets, and perhaps even less frequently a double cap sheet may have been used, though no such sheet was found in any copy examined. The single cap sheets were probably originally about thirteen by seventeen inches folded three times after recto and verso printings. No copy examined showed untrimmed edges anywhere. The chain lines are vertical on the page, and orientation of the original sheet is therefore fairly easy. In one or two copies examined, the watermark, in both cases the double tower, occurs on the portrait leaf. As the fragment of watermark on these two portraits is on the outer, not the inner margin of the leaf, it is obvious that the portrait leaf was originally printed recto with the title page, then cut, and the print made to appear as a verso print- ing in order that it might face the title page. In both cases, the other quarter of its watermark appears at the top inner edge of the title page leaf.

This 1645 volume was relatively carefully printed, and few variants between different copies of the edition are to be found. The text of the English poems, as might perhaps be expected, is somewhat better than that of the Latin ; but neither English nor Latin is entirely free from defects, though there is no errata list. Titles occur for each poem, except the sonnets, which are num- bered only.

The type of the 1645 edition is of some interest here. The font was a poor one, though better than many of its day. Little enough is known of its history; but apparently it had been designed, like most English roman face type, as a copy of Garamond roman face in Flanders, Holland, or France, and may be traced back a number of years before 1645, Dut only in England. It was cer- tainly cut, if not as certainly cast abroad. The type, or at least its matrices, may have been in England as early as 1580, or have reached there any time before 1630. John Raworth, Ruth's husband, was made free of the Stationers Company in 1632, according to Plomer's Dictionary. Brerewood's Logic of 1638 printed by John is the earliest of his printings consulted, and contains much of the same type found in Milton's 1645 Poems, obviously not new type even then.

INTRODUCTION— 1645 151

The type and the manner in which it has been used have some peculiarities. There is a tend- ency, soon noticeable with careful reading, to put a comma before the word 'and' whenever and wherever the word occurs and without much regard to any other factor. The compositor also tended to set too little space between words; but frequently set too much space before a punctua- tion mark. Many pages exhibit in the tilt of the lines the exact amount of type which the com- positor could conveniently hold in his stick, the alignment often being by a 'handful' of eight or ten lines.

The font of type used, as already implied, was almost ancient. Worn and broken letters abound, as the notes herein indicate. But most noticeable are the frequent curled s's, smaller than the nor- mal curled s's of the font. These small curled s's occur time after time throughout the book, there being probably two hundred of them. The long f's never exhibit this deviation from the one font. The ligatures generally and ae in particular are frequently from another and usually smaller font, except oe which usually looks larger than it should, but which was probably normal to this font. Elegy VII, page 37 of the Latin poems, line 46, presents both ae too small and ce too large in the same word, Phcebaeus. There are in fact three different ae ligatures employed, one being to all appearances normal and properly belonging to the font being used; the second, the one already mentioned that is smaller than normal; and a third that is larger than normal, found on page 53 of the Latin poems, In quintum Novembris, line 168, turbae, in this case the a element is some- what distorted, but in other cases, the ligature ae is remarkable only for its size. The capital W's tend to be too large, or to descend below the line of the type. Occasionally a small r is used ; but on the whole, aside from the ligatures, the type is fairly regular.

The rules and small ornaments employed, probably uniformly made of metal because of their small size, had probably had about the same history as the type. Decorated capitals are used very little, only one decorated open block appearing in the English poems, page 75> with letter B inserted, and one in the Latin poems, page 11, with letter T inserted, this same open block having been used also on page 69 of the English poems at the beginning of the Lawes letter. The true decorated initials, each probably a zinc cut, are the I on English 831-, the I (entirely different) on English page 71 opening the Wotton letter, and the H beginning the Latin foreword on page 3 of the Latin poems. The decorations proper are to be found on page Ql$t at the top of the page, a two part border; English page 1, above the text, a ( ?) metal ornament about three inches wide and an inch high, with Tudor rose in the center and all over decoration; English page 65, balancing the lower half of the page, the top row of the border on page cL$t upright above the large capital E signature evenly spaced below with the same row of the same ornament reversed below the E; English page [67], the same ornament that appeared on page 1 appears again here near the bottom of the page, but above the line Anno Dom. 1645.; English page 69, a single row of different ornaments but of the same size as here- tofore appears at the top of the page; English page 74, a single line of small ornaments, mostly stylized thistles, appears at the top of the page; English page 75, at the top of the page appears a quadruple row of ornaments, rows 1 and 4 being the same ornaments as appeared on page 67, the top row upright, and the bottom row reversed, with rows 2 and 3 forming a pat- tern; English page 120, single row of small ornaments identical with the top of the double row on 331-; Latin title page, another metal (?) cut, different from that on English page 1, Tudor rose with allover design, about one and five-sixteenths inches wide by one and one-half inches high; Latin page 3, a single row of small ornaments as on English page 120 at the top of the page; Latin page 9, a single row of ornaments unlike any used before them; Latin page 10, single row of ornaments like the bottom row of the two rows at the top of 831-; Latin

152 POEMS, BOTH ENGLISH AND LATIN— 1645

page II, at the top of the page, a single row of ornaments like rows i and 4 on English page 75; Latin page 43, a single row of ornaments like those on Latin page 9, but reversed; Latin page 44, at the top of the page, a single row of ornaments as on Latin page 11 ; Latin page 77, at the top of the page, a single row of ornaments as on Latin page 44, but slightly larger castings ; Latin page 78, at the top of the page, a single row of ornaments like those on Latin page 9.

There are two slightly different states of the English title page, probably only the last line having been reset, and there is probably no way in which the priority of the one over the other can ever be determined. The entire last line has been moved from its position in the other state ; but no other part of the page has been changed.

The Latin title page is of no special interest, and, unlike that of the 1673 Poems, introduces no new problem of printer, the initials R.R. of 1645 without doubt standing for Ruth Raworth.

The collations are based on eight actual and twenty-five photostat and film copies of the 1645 Poems, a list of which copies follows.

The copy reproduced is Illinois Spencer for text, and Illinois Gannon for portrait and 'other' title page.

LIST OF 1645 COPIES USED IN THIS EDITION

Originals. IU: 1645; ID45, copy 2; Gannon 6993/3 ; Baxter, Latin Poems only; Drexel- Pen- rose; McLeish; Maggs; Spencer.

Photostatic Copy. British Museum E.1126.

Film Copies. Bodleian Library: 8°.S.8.Art.BS. ; Douce M. 483. Lacks Comus and Latin Poems. Boston Public Library: G.177.8. ; B.4178.14. Latin Poems bound before the English. British Museum: C.i2.d.20. Lacks Comus; G.18844. Lacks Comus and Latin Poems. California, Uni- versity of, at Los Angeles: Clark Copy. Cambridge, Trinity College Library: C.11.151. Folger Library: 272; 534. Huntington Library: 105740. Harvard University: Aldrich 155.10.; 14485. 11. 5.; 14485. 1 1. Johns Hopkins University: 352. Morgan Library. Newberry Library: Case Y. 185. M. 6364. New York Public Library. Pershing, James Hammond, Denver, Colorado. Princeton University: Ex. 3859.3698.14. Texas University: Stark; Wrenn. Wellesley College Library. Yale University Library: Elizabethan Club.

MARSHALL PORTRAIT — 1645

153

Ajiabeij/evfioLfyoaj-YsiQ ruvoe u£y six oven. (poUHS t<x^ <k\y, uj^os s'icos <xuTo<pue~s CXettuji/ Top o^' ' £KTV7roo7o\> 'Sk \7nyv0vns <pf\o-i If Xcx rf cp cx.uXy a u (Tlu'll h llo( ^ooyrdcv b .

WM- fculp

This portrait is one of the two completely authentic ones that we have of John Milton. This one, W.M. fculp. if the signature at the bottom of the verse applies as it probably does also to the portrait and its adornments, was well drawn; but the cut, almost certainly copper, is very bad. Masson (Life, 3:459 and note) translated Milton's Greek lines below it as follows: 'That an unskillful hand had carved this print/ You'd say at once, seeing the living face;/ But, finding here no jot of me, my friends,/ Laugh at the botching artist's mis-attempt./' That is, Milton himself (Cf. Pro Se Defensio (1655) Columbia 9:124-5) thought it was a poor picture. That portion of the inscription which reads ANNO ^TATIS ViGefs: Pri: is puzzling. Masson as- sumed (op. et loc. cit.) that Marshall used the so-called Onslow original portrait in completing the 1645 portrait; but nothing is known with certainty of the relationship between the two portraits. The Onslow original has disappeared long since, although two eighteenth century copies of it survive. It is possible, though improbable, that the two portraits bear some relation- ship to each other.

154

POEMS BOTH ENGLISH AND LATIN — 1645

c

OF

Mr. fohn ^Milton ,

BOTH

ENGLISH and LATIN,

Composed at feveral times.

^Printed by his true Copes.

The Songs were fet in Mufick by

Mr. Henry Lawes Gentleman of the Kings Chappel, and one

of His M A I E $ T I B s

Private Mufick.

•Baccare frontem

Cingite, fte vati noccat mala lingua future,, Virgil, Eclog. 7.

Printed and publi^ d according U ORDER.

LONDON,

Printed by Ruth RaWorth for Humphrey Mefcley^

and are to be fold at the figne of the Princes

Arms in S> Fault Church-yard, 164J-

OEMS

OF

Mr. f ohn ^Milton \

BOTH

NGLISH and LATIN

Composed at feveral times.

T tinted by his true Copies.

The Songs were fet in Mufick by

Mr. Henry Lawes Gentleman of

the Kings Chappel5andone

of His M a 1 e s t 1 e s

Private Mufick.

■Baccare frontem

Cingite, ne vati noceat mala lingua futKro^ , Virgil, Eclog. 7.

i- _— — — — — — — — — - — — — »

Printed and publijh'd according U ORDER.

LONDON,

Printed by Ruth Ratoorth for .Humphrey Mofclej\

and are to be fold at the figne of the Princes

Arms in Pauls Church-yard, t6tf>

In the last line on the page, about two thirds of the copies examined read S. Pauls and the remainder of the copies examined or a little over a third of the total, read Pauls. In all other respects the title pages of all copies examined are identical. It is doubtful if more than the last line on the page was reset at any time during the process of running the edition off the press.

The quotation from Virgil is from Eclogue 7:27-28. Fairclough (Loeb, Virgil, volume 1:51) translates this as 'wreathe my brow with foxglove, lest his evil tongue harm the bard that is to be.' Virgil here refers to the idea that a tongue voicing extravagant praise may be 'evil' because the praise may excite the envy of the gods. Foxglove guarded against this. Milton perhaps was thinking of the extravagant praise of Moseley's preface.

MOSELEY'S PREFACE — 1645

155

III

m

THE

STATIONER

TO THE

READER.

\T is not any pri- vate rejfieft of gain, Cfentle Reader , for the jlighteft. 'Pamphlet is now adayes more vendible then the Worh^tf learnedejl men ; hut it is the loye I have to our own 'Language that hath made me diligent t6coHt30 and fet forth

a 5 fuch

fuch Peeces both in Trofe and Vers0 as may renew the wonted honour and ejleem of our Englifh tongue-.andits the worth o/thefe both Snglijh and Latin Poems3 not the fourifh of any prefixed encomions that can invite thee to buy them , though thefe are not without the highefl Commendati* ons and Jpplaufe of the karnedjl

Academicks, both domejlick^

andforrein : And amongH tho/e of our own Qountrey , the unpa- ralleledattejlation of that renown^ ed Trovotf of paton, Sir Henry Wootton : / kgw not

thy palat how it relifies fuch dainties y nor how harmonious thy

foul

The Stationer to the Reader.] This statement by Moseley is not in 1673.

156

POEMS BOTH ENGLISH AND LATIN — 1645

foul is * perhaps more trivial Airs may pleafe thee better. But howfoeyer thy opinion is ffent upon thefe, thatincouragement I haye already recehed from the mofiin- genious men in their clear and courteous entertainment of Mr. Wallers late choice Teeces , hath once more made me adven- ture into the World, prefentingit with thefe ever-green, and not to he hi a/led Laurels, The Authors more peculiar excellency in thefe Jludies, was too wcllkflown to con* ceal his Tapers , or to l^eep me from attempting to follicit them from him. Let the event guide it felf w hich way it mil, Ifloallde-

a 4 fene

ferye of the age, by bringing into the Light as true a Birth, as the JAujes haye brought forth fince

cur famous Spencer wrote ; ypbofe Toems in thefe Snglifh ones are as rarely imitated, asfweetly excetfd, \ Trader if thou art Eagle^eied to cenfure their worth, I am not fearful to expofe them to thy exaUejlperufal.

Thine to command

Humph. Moseley.

On

ON THE MORNING OF CHRIST'S NATIVITY — 1645

157

0)

On the morning of Christs Nativity. Compos'd 1629.

I.

fmm y^ Kis is the Month, and this the happy morn

V/hcrin the Son of Heav'ns eternal King, Ol wedded Maid, and Virgin Mother born/

Our great redemption from above did bring >

For fo the holy fages once did flng,

That he our deadly forfeit fhould releafe/

And with his Father work u; a perpetual peace.

II. That glorious Form, that Light unfurrerabfe,

And that far-beaming blaze of Majeftyj

Wherwith he wont at Heav'ns high Councel- Table,,

To fit the midft of Trinal Unity,

He laid afide ; and here with us to be;

Fotfook the Courts of everlafting Day,

And chafe with us a darkfom Houfe of mortal Clay* '

A III. Say

10

III. Say Heav'nly Mufe, (hall not thy facred vein Afford a prefentto the Infant God ? Haft thou no vers, no hymn, or folemn ftrein, To welcom him to this his new abode. Now while the Heav'n by the Suns team untrod.

Hath took no print of the approching light, Andallthcfpanglcdhoft[kecp watch in fquadrons bright ?

IV. See how from far upon the Eaftern rode The Star-led Wizards hafte with odours fwect : O run, prevent them with thy humble ode, And lay it lowly at his blefled feet j Have thou the honour rirft, thy Lord to greet, And joyn thy voice unto the Angel Quire, From out his fecret Altar toucht with hallow'd fire.

15

20

25

The Hymn.

1.

IT was the Winter wilde. While the Heav'n-born-childe, All meanly wrapt in the rude manger lies $ Nature in aw co him

30

Had

2nd line of title. Compos'd 1629.] Not in 1673.

21 hoft keep] Note imprint of spacer between the two words, present in all copies examined.

158

POEMS BOTH ENGLISH AND LATIN — 1645

(3)

Had doff't her gawdy trim,:

With her great Matter fo to fympathize s tt was no feafon then for her 35

To wanton with the Sun her lufty Paramour*

II.

Onely with fpeeches fair

She woo's the gentle Air •

To hide her guilty fron{ with innocent Snow, And on her naked fhame, ■• .40

Pollute with finfall blame,

The Saintly Vail of Maiden white to throw*

Confounded, that her Makers eyes

Should look fo neer upon her foul deformities.

Iil. But he her fears to ceafe, 45

Sent down the meek-eyd Peace,

She crown'd with Olive green, came foftly Aiding Down through the turning fphear His ready Harbinger,

With Turtle wing the amorous clottds dividing, 50

And waving wide her mirtle wand, She ftrikes a univerfall Peace through Sea and Land

IV.

No Wan, or Battails found

Was heard the World around :

h. 2

£h *

The idle fpear and fliield were high up hung j The hooked Chariot flood Unftain'd with hoflile blood,

The Trumpet fpake not to the armed throng. And Kings fate ftill with awfull eye, As if they furely knew their fovran Lord was by,

V. But peacefull was the night

Wherin the Prince of light

His raign of peace upon the earth began j The Windes with wonder whiff. Smoothly the waters kill,

Whifperiog new joyes to the milde Ocean, Who now hath quite forgot to rave, While Birds of Calm fit brooding on the charmed wave.

VI.

The Stars with deep amaze

Stand fax, in fledfaft gaze,

. Bending on« way their pretious influence. And will not take their flight, Tor all the morning light,

Or Lucifer that often warn'd them thence 3 But in their glimmering Orbs did glow, Umfll their Lord himfelf befpake, and bid them go.

vn

55

60

65

70

75

after line 36 II.] The second I is out of line in all copies examined. 39 Snow,] All copies examined show comma, the top of which is sometimes smeared, causing Columbia to print a semi-colon in the notes.

ON THE MORNING OF CHRIST'S NATIVITY — 1645

159

VIL And though the fliady gloom

Had given day her room,

The Sun himfelf with-held his wonted fpecd, And hid his head for fhame, 80

As his inferiour flame,

The new-enlightn'd world no more mould need; He faw a greater Sun appear Then his bright Throne, or burning Axletrec could.bcaf,

VIII.

The Shepherds on the Lawn, 85

Or ere the point of dawn,

Sate (imply chatting in a ruftick row 5 Fall little thought they than. That the mighty Pan

Was kindly com to live with them below; 90

Perhaps their loves, or els their flieep, Was all that did their filly thoughts fo bufiekeep.

IX.

When fuch mufick fweet

Their hearts and ears did greet,

As never was by mortall finger flrook, ' 95

Divinely-waibled voice Anfwcring the ftringed noife,

As all their fouh in blisfull raptuie toofe *

(6) The Air fuch pleafure loth to lofe, Withthoufand echo's flill prolongs each heav'nly dole,

X.

Nature that heard fuch found

Beneath the hollow round

Of Cynthia's feat, the Airy region thrilling, ' Now was almoft won To think her part was don.

And that her raign had here its lad fulfilling ; She knew fuch harmony alone Could hold all Heav'n and Earth in happier union,

XI.

At laft furrounds their fight

A Globe of circular light,

That with long beams the fhame-fac't night array'd, The helmed Cherubim Andfworded Seraphim,

Are feen in glittering ranks with wings difplaid. Harping in loud and folemn quire. With unexprcffive notes to HeaY*ns new-born Heir.

XI I.

Such Mufick (as 'tis faid)

Before was never made,

But when of old the fons of morning fung t W^le the Creator Great

100

105

no

115

120

A

His

Signature marks A3. In some copies the A is exactly under the p of the word rapture immediately above it, and in others it, with the number 3 has shifted, or been shifted, to the left about one en.

103 thrilling] Columbia note states that [1673] thrilling,] [1645] thrilling. But high magnification, see special cut, shows clearly that the punctuation mark is a broken comma, not a period.

160

POEMS BOTH ENGLISH AND LATIN — 1645

(?) " His conftellations fcf »

And the well-ballanc't world on hinges hung t And caft the dark foundations deep. And bid the weltring waves their oozy. channel keep.

XIII.

RingoutyeCryftallfphears, 125

Once blefs our human ears,

(If ye have power to touch our fenfes fo) And let your filver chime Move in melodious time »

And let the Bafe of Heav'ns deep Organ blow, 130

And with your ninefold harmony Make up full confort to th'Angelikc iymphony.

XIV. For if fuch holy Song

Enwrap our fancy long.

Time will run back, and fetch the age of gold, 135

And fpeckl'd vanity W ill ficken foon and die.

And leprous fin will meit from earthly mould, And Hell it felf will pafs away, And leave her dolorous manfions to the peering day. 140

XV.

Yea Truth, and juftice then

Will down return to men

A4

Th'eflameW

w

T h'enameld tA rm of the Rainbow wearing. And Mercy fet between, Thron'd in Celeftiall flieen, H5

"With radiant feet the tiffued clouds down (tearing, And Heav'n as at fom fcftivaW, WiU open wide the Gates of her high Palace Hall.

XVI.

But wifeft Fate fayes rio,

This muft not yet be fo, 150

The Babe lies yet in finiling Infancj,.

T hat 0 n the bitter crofs

Muft redeem ourlofs ;

So both himfelf and us to glorifie i

Yet firft to thofe ychain'd in fleep, 155

The wakefoll trump of doom muft thunder throng the

(deep,

XVII. With fiich a horrid clang

As on mount Sinaifing

While the red fire, and fmouldring clouds out brake 1 The aged E arth, agaft 1 60

With terrour of that blaft,

Shall from the furface to the center fliake ; When at the worlds Iaft feffion, The dreadful! Judge in middle Air fhall fpiead his throne,

XV III.

125 Cryf tallf phears, ] So, all copies examined, there is no space, or very little, between the two words. No note in Columbia. 129 time;] What is the punctuation? It is either a comma with the head split horizontally, or a semi-colon more worn and smaller than most, but not all others, in this edition. See page 36, V Allegro 142; page 39, // Penseroso 60; and page 41, ibid. 115. It need not be other than comma.

147 feftivall,] Most copies lack the bottom of the letters 11, although the comma shows clearly in all copies. Morgan copy shows both letters plainly, top and bottom. Other copies are irregularly faint and lacking; but none except Morgan is clear.

ON THE MORNING OF CHRIST'S NATIVITY — 1645

161

(9)

XVIII, And then at laft our blrfs 1 65

Fullandperfeftis,

Butnow begins; forfrom this happy day Th'old Dragon underground In ftraiter limits bound,

Not half fo far calls his ufurpcd fway, 170

A»d wrath to fee his Kingdom fail, Swindges the fcaly Horrour of his fouldcd tail

XIX. The Oracles are dumtn,

No voice or hideous humm '

Runs through the arched roof, in words deceiving. 175

Apollo from his ibrine Can no more divine.

With hollow fhreik the fteep of Detpbos leaving. No nightly trance, or breathed fpell, Infpi*e's the pale-ey'd Prieft from the prophetic cell. 180

XX,

The lonely mountains o're,

And the refounding fhore,

A voice of weeping heard, and loud lament e From haunted fpring, and dale E dg'd with poplar pale. 1 85

T he parting Genius is with fighing fent,

With

(10) With flowre-inwDv'n treflfes torn The Nimphs in twilight Chade of tangled thickets mourn.

XXI. In confecrated Earth,

And on the holy Hearth, Igp

The Lars, and Lemures moan with midnight plaint.

In Urns, and Altars round,

A drear, and dying found Affrights the Flamins at their fervice quaint ;

And the chill Marble feems to fweat, 195

While each peculiar power forgoes his wonted feat,

XXII.

Peofi and Baalim,

Forfake their Temples dim,

With that twife batter'd god of Paleliine, And mooned Afhtantb, 200

Hcay'ns Queen and Mother both.

Now fits not girt with Tapers holy fliine, 1 he Ijbyc Hammon {brinks his horn, In vain the Tynan Maids their wounded Ybam:i% mourn,

XXIII.

And fullen &Mocb fled, 205

Hath left in fhadgws dred,

His burning Idol all of blackeft hue,

In vain with Cymbalsiing,

They

162

POEMS BOTH ENGLISH AND LATIN — 1645

en;

They call the grifly king,

In difmall dance about the farnace blue. The brutifli gods of title as fait, Sjts and Orui, and the Dog Ambit haft.

XXIV.

Nor is ofirit feen

In Mempbian Grove, or Green,

Trampling the unfhowr'd Grafie with lowings loud ? Nor can he be at reft Within his facred cheft,

Naught but profoundeft Hell can be his fiiroud. In vain with Timbrel'd Anthems dark The fable-ftoled Sorcerers bear bis Vorfljipt Ark.

XXV.

J Ie feeL from $ui£s Land

The di edded Infants hand,

The rayes of Bethlehem blind his dusky eyn • Nor all the gods befide, Longer dare abide,

Not Typhen huge ending in fnaky twine : ' Our Babe to (hew his Godhead true, Can in his fwadling bands conttoul the damned crew.

XXVI.

So when the Sun in bed,

Cunain'd with cloudy red,,

210

215

220

225

(n)

Pillows his chin upon an Orient wave, The flocking fhadows pale, Troop to th'infernall jail ,

Each fetter'd Ghoft flips to his feverall grave, And the yellow-skirted Fayct, Fly after the Night-fteeds,leaying their Moon-Iov'd mare.

' XXVII. But fee the Virgin bleft,

Hath laid her Babe to reft.

1 Time is our tedious Song fiiould here have ending, .

Heav'ns youngeft teemed Star,

Hath fixt her polifht Car.

Her fleepingLord with Handmiid Lamp attending.

And all about the Courtly Stable,

Bright-harneft Angels fit in order ferviceable.

235

240

Pillow

230

A Paraphrafe on Ffalm 114.

This and the following Pfalm were don ,by the Author at fifteen yeers old.

WHen the bleft feed of Terah's faithfull Son, After long toil their liberty had won. And pad from Pharian fields to Canaan Land,

Led by the ftrength of the Almighties hand,

fihovah's

Psalm 114. 4 of] The f is from a different font from that of the other type, or is so badly worn as to be unlike most others. But the whole line is carelessly set, both for type and alignment.

PSALM 136—1645

163

Jehovah's wonders were in Ifrael fliown,

H is praifc and glory. Was in Ifrael known. i .

That faw the troubl'd Sea, and fhivering fled.

And fought to hide his froth-becurled head

Low in the earth, Jordaris clear ftreams recoil,

As a faint hoft that hath received the foil.

The high, huge- bellied Mountains skip like Rams

Amongft their Ews, the little Hills like Lambs.

Why fled the Ocean ? And why skipt the Mountains f

Why turned Jordan toward his Cryflall Fountains >

Shake earth, and at the prefence be agaft

Of him that ever was, and ay (hall laP,

That glafly flouds from rugged rocks can cruih;

And makefofc rills from fiery flint-Hones gufli.

Ffalm i%6.

I

Et us with a gladfom mind *> Praife the Lord, for he is kind,

For his mercies ay endure,

Everfaitfifull, ever fure.

Jet u< bhze his Name abroad, For of gods he is the God ^

For.err.

10

i5

O let us his praifes tell, That doth the wrathfull tyrants quelL For, &c.

That with his miracles doth make Amazed Heav n and Earth to fliake. For, (fc.

That by his wifdom did create The painted Heav'ns fo full of ftattf. For his, (?c.

That did the folid Earth ordain To rife above the watry plain. For his, &v.

That by his all-commanding might, Did fill the new-made world with ligrrf. For his, (?c.

And caus'd the Golden-trefled Sun, All the day long his cours to run. For his, (fc.

The horned Moon to fliine by night, Amongft her fpangled filters bright. Forhis,&fc

He with his thunder- clafping hand, motethefirft bomoi Ey$t Land, Foihis,^-.

10

i5

20

25

30

And

Psalm 136. 1 There is a daub of ink, probably from a raised spacer, appearing at the end of this line in all copies examined.

164

POEMS BOTH ENGLISH AND LATIN — 1645

(15)

And ii\ deipight of Fhirzo fell, He brought from thence his Ifntl. For, e^c.

The ru Jdy waves he cleft in twain, Of the Kryihrxxn main. For, &-v.

The floods flood fiill like Walls of Glafs,

While the Hebrew Bands did pafs. For, grv .

H.'C M\ feon they did devout the Tavt'j King with all his power For <$c.

'i lis ch'o&n people he did bkfs .. In the waflfull Wilderncs.

For.e/f.

Iii bloody battail he brought down Kings of provv'eG and renown. For, ^c

He foild bold Scon and hivhofr, ^ 1 hat rul'd the JmrrwicoaR. For.tfv-

And large- Hm'd 0^ he didliibJae, With all his over- hardy crew. For, c>v.

35

40

45

50

55

(16) «

And to his fervant 7/ke/, He gave their Land therin to dwell For, <&c .

He hath with a piteous eye Beheld us in our naifery. For, t#z.

And freed us from the flavery Of the invading eniroy. For, (?c. ,

All living creatures he doth feed, And with full hand fupplies their need. For, &e.

let us therfore warble forth His mighty Majefty and worth.

That his manfion hath orrhigh Above the reach of mortall ey.

For his mercies ay endure, »•

Ever faithfull, ever fur e.

60

65

70

E

The Paffion. 1.

Re-while of Mufick, and Ethereal mirth, Wherwith the ftage of Ayr and Earth did ring.

An.',

Ami

54 over-hardy] Several copies show faint trace of hyphen between the two words. Should certainly read over-hardy Not in Columbia notes.

THE PASSION — 1645

165

(17) And joyous news of heav'nly Infants birth,

My mufe with Angels did divide tc fmg s

But headlong joy is ever on the wing, 5

In Wintry folftice like the {hortn'd light

Soon fwallow'dupindarkandlong out-liying night.

II. For now to forrow mull; I tune my fong, And fct my Harpe to notes of faddeft wo, Which on our deareft Lord did feafe ere long, 10

Danger?) and fnares, and wrongs, and worfe then Co., Which he for us did freely undergo.

Moft perfect Heroe, try'd in heavieft plight Of labours huge and hard, too hard for human wight,

III.

He fov'ran Prieft (looping his regall head 15

That dropt with odorous oil down hi> fair eyes,

Poor fleihly Tabernacle entered,

His (larry front low-rooft beneath the skie; j

O what a Mask was there, what a difguife !

Yet more ; the ftroke of death he muft abi- 'e, 20

Then lies him meekly down faft by his Brethren* fi<ie

IV. Thefe latter fcencs confine my roving vers, To this Horizon is my Phoebus bound

(it)

Hi* Godlike afts, and his temptations fierce. -1

And former fuffcrings other where are found ; 25

loud o're the reft Cremona's Trump doth found j

Me fofter airs befit, and fofter firings Of Lute, or Viol ftill, more apt for mournful things.

•V. Befriend me night beft Patroncfc of grief, Over the Pole thy thicket! mantle throw, 30

And work my flatten! fancy to belief, That Heav*h and Earth are colour'd with my wo j My fbrrows are too dark for day to know :

The leaves fhould all be black wheron I write. And letters where my tears have waflit a wannifh white. 35

VI.

See fee the Chariot, and thofe rufhing wheels

That whirl d the Prophet up at Chebar flood,

My fpirit fom tranfporting Cherub feels,

To bear me where the Towers of Salem flood,

Once glorious Towers, now funk in guiltles blood ; 40

T here doth my foul in holy vifi<Mi fit In penfive trance, and anguifh, and ecftatick fit.

VII.

Mine eye hath found that fad Sepulchral rock

1 hat was the Casket of Heay'ns richeft flore,

• And

Passion. 20 abide,] The d is smashed in all copies examined except the Morgan copy, in which the letter may have been restored.

Passion. 24 acts] Again, the punctuation may be either a comma or a semi-colon. See notes to page 7, 1645. Some copies examined looked like a comma, others like a semi-colon. Magnifi- cation shows clearly that a badly worn semi-colon was used.

166

POEMS BOTH ENGLISH AND LATIN — 1645

(*9)

And here though grief my feeble hands up-locjfc' 45

Yet on the foftned Quarry would I fcore My plaining vers as lively as before ;

For furc fo well inftru&ed are my tears* That they would fitly fall in order'd Characters-

viti.

O r fhould 1 1 hence hurried on vie wles wing, 50

Take up a weeping on the Mountains wilde, 1 The gentle neighbourhood of grove and fpring Would foon unboofom all thir Echoes milde, And I (for grief is eafily beguild)

Might think th'infeftion of my forroWs load, 55

Had got a race of mourners on fom pregnant cloud.

ThU Subjetf the AutUr finding to be Above the jeers he had, when be wrote it, and nothing fatisfd with what wM begun, Ufi it unfinijht.

On Time.

FLy envious Time, till thou run out thy race* Call on the lazy leaden-ltepping hours, Wliofe fpeed is but the heavy Plummets pace ; And gh?s thy felf with what thy womb devours,

(20) Which is no more then what is falfe and vain, And meerly mortal drofs j So little is our lofs, So little is thy gain.

For when as each thing bad thou had entomb'd, And lad of all, thy greedy felf confum'd, Then long Eternity (hall greet our blifs With an individual kifs >„ And Joy (hall overtake us as a flood, When every thingthat is fincerely good And perfectly divine,

With Truth, and Peace, and Love (hall ever fiiine About the fupreme Throne Of him,t*whofe happy-making fight alone, When once our heav'nly-guided foul (hall clime. Then all this Earthy grofnes quit, Attir'd with Stars, we (hall for ever (it, Triumphing over Death,and Chance, and thee O Time.

10

15

20

Y

Wbwfe

Upon the Circumcifion.

E flaming Powers, and winged Warriours bright, That erlt with Mufick, and triumphant fong

Firfi

UPON THE CIRCUMCISION

SOLEMN MUSIC — 1645

167

(21)

tirft heard by happy watchful Shepherds ear. So fweetly fung your Joy the Clouds along Through the loft filence of thelift'ning night; Now mourn, and if fad fhare with us to bear Your fiery eflence can diftill no tear, Burn in your fighs, and borrow Seas wept from our deep forrow. He who with all Heav'ns heraldry whileare Enter'd the world, now bleeds to give us eafe ; Alas, how foon our fin Sore doth begin

His Infancy to feafe ! O more exceeding love or law more juft t juft law indeed, but more exceeding love 1 For we by rightfull doom remediles Were loft in death, till he that dwelt above High thron'd in fecret blifs, for lis frail duft Emptied his glory, ev'n to nakednes j And that great Cov'nant which we (till tranfgrefs • IntirelyiatisrVd, And the full wrath befide Of vengeful Juftice bore for our excels, And feals obedience firft with wounding fmarc This day, but O ere long

B % Hj;-

io

i5

20

25

(**)

Huge pangs and ftrong

Will pierce more neer his heart.

At a folemn Mufick.

BLeft pair of Sirens, pledges of Heav'ns joy, Sphear born harmonious Sifters, Voice, and Vers, Wed your divine founds, and mixt power employ Dead things with inbreath'd fenfe able to pierce , And to our high-rais'd phantafie prefent. That undifturbedSong of pure content. Ay fung before the fcphire-colour d throne To him that fits theron With Saintly fhout, and folemn Jubily, Where the bright Seraphim in burning row Their loud up-lifted Angel trumpets blow. And thp Cherubick hoft in thoufand quires Touch their immortal Harps of golden wires. With thofe juft Spirits that wear victorious Palms, Hymns devout and holy Pfalms Singing everlaftingly ; That we on Earth with undifcording voice May rightly anfwer that melodious noife ;

10

15

As

168

POEMS BOTH ENGLISH AND LATIN — 1645

As once we did, lilldifproportion'd fin

Jarr'd againft natures chime, and with harfh din

Broke the fair mufick that all creatures made

To their great Lord, whofe love their motion fway'd

In perfecl Diapafon, whilft they flood

In firft obedience, and their ftate of good.

O may we foon again renew that Song,

And keep in tnne with Heav'n, till God ere long

To his celeftial confort us unite,

To live with him, and fing in endles morn of light.

20

25

An Epitaph on the Marchionefs of Winchefter.

THis rich Marble doth enterr The honour'd Wife of lyinckcfleri A Vicoiints daughter, an Earls heir, Befides what her vertues fair Added to her noble birth, More then (he could oWn from Earth, Summers three times eight fave one She had told, aias too foon. After fo fhort time of breath.

To fooufe with darknes, and with deatk»

B 4

. ;«

Y«

10

Yet had the number of her days Bin as compleat as was her praife, Nature and fate had had no fhife In giving limit to her life. Her high birth, and her graces fweec, Quickly found a lover meet ; The Virgin quire for her requefl The God that fits at marriage feafl j He at their invoking came But with a fcarce-wel lighted flame j And in his Garland as he flood, Ye might difcern a Ciprefs bud, Once had the early Matrons run To greet her of a lovily fon, And now with fecond hope fhe goes. And calls Lucina to her throws ; But whether by mifchance or blame J tropes for Lucina came; Ar.d with remorfles cruelty, Spoil'd at once both &uit and tree : The haples Babe before his birth Had burial, yet not laid in earth, And the Ianguifht Mothers Womb 'as not long a living Tomb.

•it

i5

20

25

30

SO

The page number at top of page] The 2 is smeared black in many (most?) copies, but clear in others as if it had been re-set.

EPITAPH ON MARCHIONESS OF WINCHESTER — 1645

169

So have I fcen fom tender flip Sav'd with care from Winters nip, The pride of her carnation train, Pluck't up by fom unheedy fwain, Who onely thought to crop the flow: New (hot up from vernall fliowr j But the fair bloflbm hangs the head Side-ways as on a dying bed, And thoie Pearls of dew fhe wears, Prove to be prefaging tears Which the fad morn had let fall On her haft'ning funerall. Gentle Lady may thy grave Peace and quiet ever have j After this thy travail fore Sweet reft feafe thee evermore, That to give the world encreafe, Shortned haft thy own lives leafe, Here befides the forrowing That thy noble Honfe doth bring, Here be tears of perfect moan Weept for thee in Helicon, And fom Flowers, and fom Bays, For thy Hears :o ftrew'the ways.

35

40

45

50

55

(16) Sent thee from the banks of Came,

Devoted to thy vertuous name ;

Whilft thou bright Saint high fit'ft in glory.

Next her much like to thee in ftory,

That fair Syrian Shepherdefs,

Who after yeers of barrennes,

The highly favour'd Jofepb bore

To htm that ferv'd for her before,

And at her next birth much like thee,

Through pangs fled to felicity.

Far within the boofom bright

Of blazing Majefty and Light,

There with thee, new welcom Saint,

Like fortunes may her foul acquaint,

With thee there clad in radiant flieen,

Nt Marchionefs, but now a Queen.

6o

65

70

Sen:

SONG On Maj morning.

NOw the bright morning Star, Dayes harbinger. Comes dancing from the ? aft, and leads with her 1 he Flowry May, who from, her green lap throws I he yellow Cowflip, and the pile Primrofe.

May Morning. 2 Eaft,] The E is broken in all copies examined.

170

POEMS BOTH ENGLISH AND LATIN — 1645

(*7)

Hail bounteous May that doll infpire Mirth and youth, and warm defire. Woods and Groves, are of thy dreffing, Hill and Dale, doth boaft thy bleffing. Thus we falute thee with our early Song, And welcom thee, and wifh thee long,

On Shafyjpear. 1630.

WHat needs my Shak$car for his honour'd Bones, The labour of an age in piled Stones, Or that his hallow'd reliques flieuld be hi4 Under a Star-ypointing Tyrxmid} Dear fon of memory, great heir of Fame, What need'ft thou fuch, weak witnes of thy name } Thou in our wonder and aftonifhraent Haft built thy felf a live-long Monument. For whilft toth'fhamc of flow- endeavouring art, Thy eafie numbers flow, and thateach heart Hath from the leaves of thy unvalu'd Book, ThofeDelphick lines with deep impreflion took , Then thou our fancy of it fclf bereaving, Doft make us Marble with too much conceiving j And fo Sepulcher'd in fuch pomp doft lie,

That Kings for fuch a Tomb would wifli to die.

On

10

10

15

(>8)

On the Univerfity Carrier who

fickn'd in the time of his vacancy, being

forbid to go to Londe»t by reafon cf

the Plague.

HEre lies old Hobfon, Death hath broke his girt, A here alas, hath laid him in the dirt, Or els the ways being foul, twenty to one, He's here (Kick in a Hough, and overthrown. ,Twas fuch a fiiifter,that if truth were known, Death was half glad when he had got him down j For he had any time this ten yeers fullj, Dodg'd with him, betwixt Cambridge and the Bull. And furely. Death could never have prevaiPd, Had not his weekly cours of carriage fail'd; But lately finding him fo long at home. And thinking now his journeys end was come. And that he had tane up his Iateft Inne, In thekind.office of a Chamberlin Shew'd him his room where he mull lodge that night, Puird off his Boots, and took away thcliyht : If any ask for him, it {hall be fed, Hobfon. has fupt, and's newly gon to bed.

Another

10

15

On Shakespear. 9 toth'fhame] No space, so all copies examined. Not in Columbia notes.

2 A here alas, hath laid him in the dirt,] See 1673 reading. All editors have accepted the 1673 reading; but here may be a noun, and means, Oxford English Dictionary, 'army, host, com- pany.' The line then makes sense as it stands. The word here occurs as a noun in Spelman's Glossary, 1626, and in Blount's Law Dictionary, 1670.

HOBSON II

L'ALLEGRO — 1645

171

(29)

Another on the fame.

HEre lieth one who did raoft truly prove, ' That he could never die while he could move, So hung his deftiny never to rot While he might ftill jogg on, and keep his trot. Made of fphear- metal, never to decay Untillhis f evolution was at ftay. Time numbers motion, yet (without a crime: 1 •Jainft old truth) motion number'd out his time % And like an Engin mov'd with wheel and waight. His principles being ceaft, he ended ftrait, Reft that gives all men life, gave him his death, And too much breathing put him out of breathy Nor were it contradiction to affirm Too long vacation haftned on his term. Meerl> to drive the time away he ficka'd, Fainted, and died, nor would with Ale be quickn'd; Nay, quoth he, on his fwooning bed outftretch'd, If I may not carry, fure Ik ne\e be fetch'd, But vow though the crofs Doctors all flood hearers, For one Carrir. put down to make fix bearers. Eafe wa\ his chi-S difcafe, and to judge right. He di d for h<?avincs that his Cart went light.

10

15

20

(S<>)

His leafure told him that hb time was com, And lack of load, made his life bunienfom. That even to his Iafl breath (ther be that fay't) As he were preft to death, he cry*d more waigh* * Buc had his doings lafted as they were. He had bin an immortaJl Carrier. Obedient to the Moon he fpent his date In cours reciprocal, and had his fate linkt to the mutual flowing of the Seas, Yet (Grange to think) his wain was his increafe : His Letters are deliver 'd all and gon, Ouely remains this fuperfcription.

L* Allegro.

H

Hit

Ence loathed Melancholy

Of Cerberus, and blackcft midnight bornj In Stygian Cave forlorn

'Mongft horrid fliapes,and ilirciks,3nd fights Unholy, Find out fom uncouth cell,

Wher brooding darknes fpreadshis jealous wings, And the night-Raven fings ;

There under Ebon (hades, and low brow'd Rocks, As ragged as thy Locks,

In dark C'mmaln defcrtevcF dtf ell.

Bat

25

30

10

Hobson. 32 increafe:] In some copies the colon is very faint.

172

POEMS BOTH ENGLISH AND LATIN — 1645

(V)

But com thou Goddes fair and free,

In Hcav'n ycleap'd Eupbrofym,

A nd by men, heart-eafing Mirth,

Whom lovely Verm at a birth

With two fifter Graces more

To Ivy-crowned Baccbtu bore;

Or whether (as fom Sager f\ng)

The frolick Wind that breathes the Spring,

Zepbir with Aurora playing,

As he met her once a Maying,

T here on Beds of Violets blew,

And frefli-blown Rofes waiht in Jew,

Fill'd her with thee a daughter fair.

So buckfom, blith, and debonair.

Haflethee nymph, and bring wich the?

Jeft and youthful Jollity,

Quips and Cranks, and wanton Wiles,

£7ods, and Becks, and Wreathed Smiles,

Such as hang on Hebe's cheek.,

And love to live in dimple fleek ;

Spoit that wrincled Care derides,

And Laughter heading both his fid?"

Com, rind t:ip k as ye go

On the !j>ht fanrafiicii ror,

15

20

25

30

(9>)

And in thy right hand lead with thee,

The Mountain Nymph, fweet Liberty 1 And if I give tbee honour due, Mirth* admit me of thy crue To live with her, and live with thee, ' In unreproved pleafurcsfree; To hear the Lark begin his flight. And finging ftartle the dull night, From his watch-towre in the skiev Till the dappled dawn doth rife ; *« Then to com in fpight of forrow. And at my window bid good morrow, Through the Sweet-Briar, or the Vine, Or the twilled Eglantine. While the Cock with lively din. Scatters the rear of darknes thin, And to the flack, or the Barn dore, Stoutly firms his Dames before, Oft lift ning how the Hounds and horn, Chearly roufe the flumbring morn, From the fide of fom Hoar Hill, Through the high wood echoing fliriU. Som time walking nottinfeen By Hedge -row Elms, on Hillocks green,

35

40

45

50

55

Ax4

Right

L'ALLEGRO — 1645

173

Right againft the Eaftern gate, Wher the great Sun begins his Irate, Rob'd in flames, and Amber light* The clouds in thoufand Liveries dight While the Plowman ncer at hand, Whittles ore the Furrow'd Land, And the Milkmaid fingeth blithe,

And the Mower whets his fithe, And every Shepherd tells his tale Under the Hawthorn in the dale. Streit mine eye hath caught new pleafutes Whilft the Lantskip round it meafures, RuiTct Lawns, and Fallows Gray, Where the nibling flocks do ftray, Mountains on whofe barren breft The labouring clouds do often reft i Meadows trim with Dailies pide. Shallow Brooks, and Rivers wide. Toners, and Batdements it fees Boofom'd high in tufted Trees, Wher perhaps fona beauty lies, The Cynofure of neighbouring eyesa Hard by, a Cottage chimney fmokefv

From betwixt two aged Qkes, •» C

Vflte*.

(H)

Where Coryhii and Tbyrfis met, Are at their favory dinner fet Of Hearbs, and other Country Mefles, Which the neat-handed Fbillk drefies j And then in hafte her Bowre (he leaves, With Theftjik to bind the Sheaves j 65 Or if the earlier feafon lead

To the tann'd Haycock in the Mead, Som times with fecure delight The up-land Hamlets will invite, When the merry Bells ring round, 70 And the jocond rebecks found

To many a youth, and many a maid. Dancing in the Chequer d (hade j And young and old com forth to play On a Sunfliine Holyday, 75 Till the live-long day-light fail,

Then to the Spicy Nut-bgpwn Ale, With ftories told of many a feat, How Faery Mab the junkets eat, She was pincht,and puli'd fiie fed, go And he by Friars Lanthorn led

Tells how the drudging Goblin fwet, To em his Crcara-bowle duly fet,

85

90

95

100

105

\YVr«

174

POEMS BOTH ENGLISH AND LATIN — 1645

(35)

When in one night, ere glimps of morn,

His (hadowy Flale hath thrcfli'd the Corn That ten day- labourers could not end. Then lies him down the LubbarFend. And ftretch'd out all the Chimney's length, Basks at the fire his hairy ftrength ; And Crop full out of dorcs he flings, Ere the firft^Cock his Martin rings. Thus don the Tales, to bed they creep, By whifpering Windes foon lull'd afleepf* . Towred Cities pleafe us then, And the bufie humm of men, Where throngs of Knights and Barons bold. In weeds of Peace high triumphs hold, With ftore of Ladies, whofe bright exes Rain influence, and judge the prife Of Wit, or Arms, while both contend To win her Grace, whom all commend. There let Hymen oft appear In Saffron robe, with Taper deaf, A nd pomp, and feaft, and revelry, • ' V/ith mask, and antique Pageantry, Such fight: as youthfull Poets dream

On Summer seyes by haunted ftream,

C %

no

"5

120

125

Then to the well -trod ftage anon„

If Jonfons learned Sock be on,

Or fwceteft Sb*ke]f>M fancies childe,

Warble his native Wood-notes wilde3

And ever againft eating Cares,

Lap me in foft Lydkn Aires,

Married to immortal vcrfe

Such as the meeting foul may pierce

In notes, with many a winding bout

Of lincked fweetnes long drawn out.

With wanton heed, and giddy cunning,

The melting voice through mazes running

UntwiHing all the chains that ty

The hidden foul of harmony.

That Orpbeta felf may heave his head

From golden flumber oii a bed

Of heapt Elyjlan flowres, and h«ar

Such ftreins as would have won the cas

Of PlutOi to have quite fet free

His half regaind Eury&ice.

Thefe delights, if thou canft give,

Mixth with thee, I mean to live.

135

140

145

150

Then

130

11

IL PENSEROSO — 1645

175

(%n

II Fen

HEnce vain deluding joyes, The brood of folly without father bred. How Lttle you befled,

Or fill the fixed mind with all your toyes j Dwell in fom idle brain,

And fancies fond with gaudy (hapes pofTefs,

As :hick and numberlefs

As the gay motes that people the Sun Beams, Or liked hovering dreams

The fickle Penfioners of Morpheus train,

But hail thou Goddes, fage and holy,

Hail divineft Melancholy,

Whofe Satnuy vifage is too bright

To hit the Senfe of human fight j ,

And thcrfore to our weaker view,

Ore laid with black (laid Wifdoms hue.

Black > but fuch as in efteem.

Prince Memnons fifter might befeem,

Or that Starr'd Eibiope Queen that flrove

To letter beauc'.cs praife above

The Sea Nymphs, and their powers offended.

Yet thou art higher far defcended.

C r

10

i5

20

Thee bright -hair'd Vefta long of yore,

To folitary Saturn bore';

His daughter flie (in Sat urns raign,

Such mixture was not held a ftain)

Oft in glimmering Bowres, and glades

He met her, and in fecret fliades

Of woody lias inmoft grove.

While yet there was no fear of Jove.

Com penfive Nun, devout and pure., -i

Sober, ftedfalr, and demure,

All in a robe of darkeft grain,

Flowing with majeftick train,

And fable flole of cipres Lawn,

Over thy decent fhoulders drawn.

Com, but keep thy wonted ftate,

With eev'n flep, and mufing gate,

And looks commercing with the skies..

Thy rapt foul fitting in thine eyes :

There held in holypaflion ftill,

forget thy felf to Marble, till

With a fad Leaden downward cafV

Thou fix them on the earth as fair.

And joyn with thee calm Peace, and Quiet,

Spare Fart, that oft with gods doth diet,

25

30

35

.40

45

Tiip

And

176

POEMS BOTH ENGLISH AND LATIN — 1645

(

$9 J

And hears the Mufes in a ring, Ay round about fives A*tar fing. Andadde to thefe retired Icafiire, That in trim Gardens takes his pleafure j But firft, and chiefeft, with thee bring, Him that yon foars on golden wingi Guiding the fiery-wheeled throne. The Cherub Contemplation, And the mute Silence hift along, Xcfs Philomel will daign a Song, Td her fweeteir, faddeft plight. Smoothing the rugged brow of night. While Cynthia checks her Dragon yoke. Gently o're th'accuftom'd Oke ; Sweet Bird that fhunn'ft the noifeof folly Moft muficall, raofl melancholy ! Thee Chauntrefs oft the Woods among I woo to hear thy eeven Song ; And miffing thee, I walk unfeen On the dry fmooth-fhaven Green.. To behold the wandring Moon,, Hiding user her higheft noon., Like one that Jud bin led aftray Through the Heav nswide pathies way .;

Cs

50

55

60

65

70

M4

(4°)

And oft, a$ ii her Lead (he bow'd,

Stooping through a fleecy cloud.

Oft on a Plat of rifing ground,

1 hear the far-off Curfeu found,

pver fom wide- water'd fhoar,

Swinging flow with fullen roar j

Or if the Ayr will not permit,

Som fUll removed place will fit.

Where glowing Embers through the room

Teach light to counterfeit a gloom,

Far from allrefort of mirth,

Save the Cricket on the hearth*

Or the Belmans droufie charm.

To blefs the dores from nightly harm s

Orlet my Lamp at midnight hour,

Be feen in fom high lonely Towr,

Where I may oft out- watch the Bar,

With thrice great Hermes, or unfphear

The fpirit of Pluto to unfold

What Worlds, or what vafl Regions hold

The immortal mind that hath forfook

Her rnanGon in this flefhly nook :

And of thofc Damons that are found

In fire, air, flood, or under ground.

75

80

85

90

Wfcofe

The page number occurs in two different ways, (39) with 9 up- right, and sometimes, IU copy [1] and Morgan copy, with 9 nearly lying on its side. 57 Id] In every copy examined, this was corrected in ink in manuscript to In and it may well be that a few copies exist in which the correction was made in the type. A few copies examined looked very much like type corrections; but they had been washed, and the change had skillfully been made in inked manuscript. 70 way;] In IU copy [1] the let- ters in this word are off their feet; i.e., the bottoms of the letters do not print. No other copy examined shows this; but alto- gether, this page has been slightly altered during the printing process. Catchword And This word occurs in various alignments of the letters, some copies having the word in normal alignment, and others with any one or two of the letters thrown up.

84 harm:] Note italic colon found in all copies examined. Is it in all others?

IL PENSEROSO — 1645

177

f4i;

Whofe power hath a true confene With Planet, or with Element. Som time let Gorgeous Tragedy In Scepter'd Pall com fweeping by, Prcfenting Tbebs, or Pelofrs line, Or the tale of Troy divine. Or what (though rare; of later age. HnnoMed hath the Buskind fhge. But, O fad Virgin, that thy power Might raife Mufaus from his bower, Or bid the foul of Orpheus flog Such notes as warbled to the firing, Drew lion tears down Pluto'i cheek, And made Hell grant what Love did fcek. Or c?.!l up him that left half told The ftory of Cambufixn bold. Of Cmball, and of Algarjife9 Ana' who had Ca.na.ce to wife,

That own'd the vertuous Ring and Glafs, And of the wondrous Hors of Brafs, On which the Tartar King did ride j And if ought t U, great Bards beilue. In iage and fofcmn tunes have fang, Oj T$t.:e-": and of Troph.iejhiing;

95

ioo

105

no

"5

(V)

Of Forcfls, and inchantments drear.

Where more is meant then meets the ear. Thus night oft fee me in thy pale career, *TiU civil-fuited Morn appeer, Not trickt and frounc't as fhe was wont, With the Attick Boy to hunt. But Cherchef 't in a comly Cloud, While rocking Winds are Piping Ioud^ Or ufher d with a fliower flill, When the guft hath blown hi; fill, Ending on therufsling Leaves, With minute drops from off the Eaves, And when the Sun begins to fling His flaring beams, me Goddes bring To arched walks of twilight groves, And fhadows brown that Sylvan loves Of Pine, or monumental Oake, Where the rude Ax with heaved ftroke, Was never heard the Nymphs to daunt, Or flight them from their hallow'd haunt. There in clofe covert by fom Brook, Where no profaner eye may look, Hide me from Day's gariin eie. While the Bee with Honied thie,

120

125

130

i35

140

O:

That

106 faring,] The comma is clear, but only under magnification, in all copies examined. Columbia note is wrong. See note to this in 1673.

120, 124, 126, 130, 140 The first letter W in each of these lines drops down a little in all copies examined. 122, 139 The first letter T is set a little high in each of these lines.

178

POEMS BOTH ENGLISH AND LATIN — 1645

That at her flowry work doth (log,

And the Waters murmuring

With fuch confort as they keep,

Entice the dewy-feather'd Sleep;

And let fom flrange myfterious dream,

Wave at his Wings in Airy ftream,

Of lively portrature difplay'd,

Softly on my eye-lids laid.

And as I wake, fweetmufick breath

Above , about, or underneath,

Sent by fom fpirit to mortals good,

Orth'unfeen Genius of the Wood,

But let my due feet never fail,

To walk the ftudious Cloyfters pale,

And love tie high embowed Roof,

With antick Pillars maflfy proo£

A nd tforied Windows richly dight, "

Cafiinga dimm religious light.

There let the pealing Organ blow,

To the full voie'd Q^uire below,

In Service high, and Anthems cleer,

As may with fweetnes, through mine ear,

DirTolve me into extafies,

And bung all Heav'n before mine eyes,

i45

150

155

160

165

(M)

And may atlaft my weary age Find out the peacefull hermitage, The Hairy Gown and MolTy Cell, Where I may fit and rightly fpell. Of every Star that Heav'n doth fhewt

1

And every Herb that fips the dew j Till old experience do attain To fomthinglike Prophetic ftrain. Thefe pleafures Melancholy give, And I with thee willchoofe to live. •

And

SONNETS.

1.

O Nightingale, that 6n yon bloomy Spray Warbrft at eeve, when all the Woods are Rill, Thou with frefli hope the Lovers heart doft fill, "While the jolly hours lead on propitious May, Thy liquid notes that clofe the eye of Day, Firft heard before the fliallow Cuccoo's bill Portend fuccefc in love ; O if Jove's will Have linkt that amorous power to thy foft lay.

Now timely fing, ere the rude Bird of Hate Foretell my hopeles doom in fom Grove ny :

As thou from yeer to yecr haft fung too late

170

175

10

For

Page number (44) in several copies examined, Trinity College C.II.151; Huntington 105740; Bodleian Douce, the second 4 is clean and clear; in all other copies examined, it is broken or battered.

Sonnet I. 5 Day,] The y is smaller in all copies examined than the other printings of the same letter on the page, and is either a battered and partly broken piece of type, or is from a smaller font. It may have been changed in some copies; but is the same in all copies examined. 9 Now] Broken w in all copies examined.

SONNETS — 1645

179

(is)

f or my relief $ yet hadft no reafon wh y,

"Whether the Mufe, or Love call thee his mate, Both them I ferve,and of their train am L

II.

Donna leggiadra il cui bel nmc honor a

L'herbofa vol di Rbenof e il nobil varcof

Ben e colui Xogni valorefcarco

Sgual tuo jpirto itntil non innmora, Che dokemcnte mofira ft di fuora

T>e fuoi atti foavi giamai parco,

E i don\ cbefon d'amorfactteedarco,

La ondel'alta tua virtu s'infiora. SZuaniotuvagaparli, olktacxnu

Che mover pojja dun alpeftre legno,

Guard: ciafcun a gli occhi, ed a gli oreccbi L'entrata, chi di tefi truova indegno ;

Gratia fola di/iigli vaglia, in ami

the' I difio amtrofo al cuor sinveccb'u

III.

Qual in coUe afpro, al imbrunir difera. VavT{xa giovinetta pafiorella Va bagnando fbcrfetta firana e betla Che malfjpande a difufata ]b(r&

10

(tf)

tuor difua natia alma primavera, Co.fi 4^or meco infu la lingua fnella Defia il fiqr novo di (irania favella, Mentreio di tetvewofamnte altera,

Canto, dal mio buonpopotnonintefo E'l bel Tatnigzcangio col bel Arm. Amor lo volfe, ed io a Valtruipefo

Seppi cfiAmor cofa mat volfe tndarno. Deb! fofil mio cuor lento c*l duro fern A cbi pianta dal cieUfi bnon terreno^

- Canzone. "D Idonfi donne e giovani amorofi M'accofiandofi attorno, e percbe fcrivi,

Fercbe tufcrivi in lingua ignota e (Irana Verfeggiaudo d'amor, e come t'ofi? Dinne,fe la tuafpemefia maivand,- E depenfieri lo miglior ? arrivi * Coji mi van burlando, altri rivi Altri lidi t'afpcttan, ^ altre onde Helle cui verdi fponde Spuntati ad hor,ad hor a la tua cbioma Vimmortal guiderdon iTeterne frondi Percbe atle fpalle tue foverchia foma } Ctn\on dirottit e tuper me rifpondi

io

io

Fuor

?;((.

Canzone. 6 de penjieri] Too little space between the two words in all copies examined.

180

POEMS BOTH ENGLISH AND LATIN — 1645

(Al)

Vice mia Donna, el fua dir, e il mio cucrs guefta c lingua di cui/i vanta Amore.

IV.

Viodati, e til dirb con maraviglia, #uel ritrofo io t]y amor fpreggiar folei E dcfuoi laccrfpejjb mi ridea Giii caddi,ovbuom dabbentalhor simpiglia.

He treccie d'oro, neguancia vermiglia. M'abbaglian si, ma fotto nova idea

1 Pctlcgrin a beUetf* cbe'l cusr bea, Portamenti alti honefti, e nolle ciglia

Quel [ercno fulgor d'amabilnero, Parole adorne di lingua pin d'tnia, E'l canur the di me\\o I'bemifpers

Traviar ben pud lafaticofa Luna, E degli occbifuoi auventa fi gran fuoco Che Vinccrarglioreccbi mifia peco,

. V.

Per ccrto i bei voflr'cccbi Donna mia Ejfer nonpiio cbenonfianlo mo [vie Si mi percuoton forte, come ei fuolt Per tarev.e dj L ilia chi nnvix?

i5

10

Mttirt

Mcntrc uu caldo vapor (ne fenti pria) Va quel lata fifpinge ove mi duole, Cbeforfe amanti nelle lor parole Chiamanfofpir •, io non fo cbe fifia 1

Parte rincbiufa, e turbida fi cela Scojfo mi il petto, e / ci nufu-ido poco X^uivi (Tatter no 0 s,agghiaccia, 0 singieU }

Ma auanto a gli occhi giuttgc a trovar loco "fuz-telenottia mcfuolftr piovofe Fincbc mia Alba rivicn colma di rofc,

VI.

Giovane piano, efcmplicetto amante

Poi cbefuggir meficjfo in dubbiofono, ZMadonna a vol del mio cuor tbumil dono Faro divoto j io ccrto a prove tame

Vhcbbi fedcle, intrepido, coftante, Vcpenfieri leggi&dro, accorto,e buono; SZuando rugge il gran mondo, efcocca il UionOj S'ama dife, e £ intcro diamante,

Tanto delforfe, e £ invidiaficuro, Ditimori, e fperan\e al popol ufe Quantofingegno, e d'alto valor vigo,

£ di cetrafonora, e delle mufe : Sol trcverete in tal parte men dura Ove Amofmife fivfaubil Ago.

10

10

VII.

SONNETS — 1645

181

(49)

VII. How foon hath Time the fuctle theef of youth,

Stoln on his wing my three and twentith yeer !

My hafling dayes flic on with full career,

But my late fpring no bud or bloiTom fhcw'ch.

perhaps my femblance might deceive the truth, That I to manhood am arriv'd fo near, And inward ripenes doth much lefs appear, 1 hatfom more timely-happy fpirits indu'th,

Yet be it lefs or more, or foon or flow, It mail be frill in ftri&eft meafure eev'n, To that fame lot, however mean, or high,

Toward which Time leads me, and the will of Heav'n -t All is, if I have grace to ufe it fo, As ever in my great task Matters eye.

VIII. Captain or Colonel, or Knight in Arms, 1

Whofe chance on thefedefcncelefs dores may feafir,

If ever deed of honour did thee pleafe,

Guard them, and him within protect from harniiSy

He can requite thee, for he knows the charms

That call Fame on fuch gentle ads as theft,

And he can fpred thy Name o're Lands and Seas,

What ever clime the Suns bright circle warms.

10

(50)

Lift not thy fpear againft the Mufes Bowrc ,

The great Ematbun Conqueror bid fpare 10

The houfe of Pindartts, when Temple and Towre Went to the ground : And the repeated air

Oi fad Eleftra's Poet had the power

To fave th* Athenian Walls from ruine bare.

IX.

Lady that in the prime of earlieft youth,

Wifely haft fhun'd the broad way and the green.

And with thole few art eminently feen,

That labour up the Hill of heav'nly Truth, The better part with Mary, and the Rutb, 5

Chofen thou haft, and they that overween,

And at thy growing vertues fret their fpleen,

No anger find in thee, but pity and ruth. Thy care is fixt, and zealoufly attends

To fill thy odorous Lamp with deeds of light, 1 0

And Hope that reaps not (hame. Therefore be fure Thou, when the Bridegroom with his feaftfull fiiends

Pafles to blifs at the mid hour of night,

Haft gain'd thy entrance, Virgin wife and pure.

Lift

Sonnet IX. 5 the Ruth,] So all copies examined. Morgan copy has correction in manuscript in margin, perhaps contemporary.

182

POEMS BOTH ENGLISH AND LATIN — 1645

(n)

X.

Daughter to that good Earl, once Prefident Of EngUnds Counfel, and herTreafury, "Who liv'd in both, unftain'd with gold or fee. And lefc them both, more in himfelf content,

Till the fad breaking of that Parlament Broke him, as that diChoncft victory At Cbaronea, fatal to liberty Kil'd with report that old man eloquent,

Though later born, then to have known the dayes Wherin your Father flonriflit, yet by you Madam, me thinks I fee him living yet ;

So well your words his noble vermes praifi^ That all both judge you to relate them true1. And to poffefs them, HonoUr'd !Ma,rgiret.

Arcades,

Part of an entertainment pf efented to

the Counttfs Dowager of Darby at Harepld9

byfom Noble perfonsof her Family, who

sppear on the Scene in paftoral habit, moving

toward the feat of State, with this Song,

10

i. SONG.

L

Ook Nymphs, and Shepherds look,

What fuddeo blaze of majefty

D ?

(5*)

I<; that which we from hence defcry Too divine to be miftook :

. This this is (he To whom our vows and wiflies bend, Heer our folemn fearch hath end.

Fame that her high worth to raife, Seem'd erft fo lavifh and profufe. We may juftly now accufe Of detraction from her praife, Lefs then half we find expreft, Envy bid conceal the reft.

Mark what radiant ftate {he fpreds, In circle round her fhiriing throne, Shooting her beams like filverthreds, This this r> (he alone, .

Sitting like a Goiides bright,

In the center of her light.

Might (he rhe wife Latonx be, Ot the towred Cybele, Mother of a hunderd gods ; $uvo dare's not give her odds $

Who had thought this clime had held

A deity fqunpara'crd ?

10

i5

20

25

13

As

ARCADES — 1645

183

(SI)

As they.com forward, the Genius of the Wood appears, and turning toward them, fptaks. ^

fZEn. Stay gentle Swains, for though in this difguife, I Ice bright honour fparkle through your eyes, Of famous Arcadj ye are, and fprung Of that renowned flood, fo often fung, Divine Jlphan, who by fectet flufe, 30

Stole under Seas to meet his Arybufc ; And ye the breathing Rofes of the Wood, Fair filver-buskind Nymphs as great and good, I know this queft of yours, and free intent Was all in honour and devotion ment 35

To the great Miftres of yon princely fhrine. Whom with low reverence I adore as mine, And with all helpful fervice will comply To further tfrs nights glad folemnity; . . And lead ye where ye may more neer behold 40

What fhallow.fcarching Fame hath left untold j Which I full oft amidfl thefe dudes alone Have fare to wonder at, and gaze upon : For know by lot from Jove I am the powr Of this fair Wood, and live in Oakn bowr, 45

Dj To

To nurfe the Saplings tall, and curl the grove

With Ringlets quaint, and wanton windiogs wove.

And all mV Plants I fave from nightly ill,

Of noifom winds, and blafiing vapours chill.

And from the Boughs bruih ofF the evil dew. 50

And hfal the harms of thwarting thunder blew.

Or what the crofs dire-looking Planet fmites,

Or hurtfull Worm with canker d venom bites.

When Eev'ning gray doth rife, I fetch my round

Oyer the mount, and all this hallow'd ground, " 55

And early ere the odorous breath of morn

Awakes the flumbring leaves, or tafTeld horn

Shakes the high thicket, hafte I all about.

Number my ranks, and vifit every fprouc •

With puiflant words, and murmurs made to blefs, 60

But els in deep of night when drowfines

Hathlockt up mortal fenfe, then liften \

To the celeflial Sirens harmony,

,That fit upon the nine enfolded Sphears,

And fing to thofe that hold the vital fhears, 65

And turn the Adamantine fpindle round.

On which the fate of gods and men is wound.

Such fweet compulfion doth in mufick lv.

To lull the daughters of Ncccjpt/,

And

184

POEMS BOTH ENGLISH AND LATIN — 1645

T55)

And keep unfleddy Nature to her law, And the low world in meafurd motion draw After the heavenly tune, which none can hear Of human mould with grofle unpiirged ear » And yet fuch mufick worthieft were to blaze The peerles height of her immortal praife, Whofe luftre leads us, and for her raoft fit, If my inferior hand or voice could hie Inimitable founds, yet as we go, What ere the skill of lefTer gods can (how, I will aflay, her worth to celebrate, And fo attend ye toward her glittering ftate^ Where ye may all that are ot noble flemm Approach, and kifs her facred veflures hemm.

2. SONG.

GRe the fmooth enameld green Where no print of ftep hath been„

Follow me as I fing, And touch the warbled firing. Under the (hady roof Of branching Elm Star-prooK Follow me,

J> 4

70

75

8o

85

I wil! bring you where (he fits, Clad in fplendor as befits

Her deity. Such a rural Queen All Arcadia hath not feen.

3. SONG.

T^TYmphs and Shepherds dance no more

By fandy kaions Lillied banks. On old Lycxtti or CyUcnc hoar,

Tiip no more in twilight ranks. Though 'Erymantb your lofs deplore,

A better loyl {hall give ye thanks. From the ftony Manalus, Bring your Flocks, and live with us, Here ye (hall have greater grace, To ferve the Lady of this place.

Though Syrinx your Pans Miftres were, Yet Syrinx well might wait on her, t Such a rural Queen All Arcadia hath not feen-

95

100

105

90

I will

ju'Jm*

71 low] For low and so in all copies examined.

Catchword] In most copies the catchword is Lycidas. but in a few, notably IU Penrose and also Spencer, the L failed to print, and the catchword is ycidas.

LYCIDAS— 1645

185

($7)

Lycidas.

In this Monody the Author bewails a

learned Friend, unfertunatly drown'd in his Pa£fig£

from Cbrftcr on the Irijb Seas, 1637. And by

occafion foretels the mine of our corrupted

Clergy then in their height.

YEt once more, O ye Laurels, and once more Ye Myrtles brown, with Ivy never-fear, I com to pluck your Berries harfli and crude. And with forcd fingers rude, , Shatter your leaves before the mellowing year. Bitter conftraint,and fad occafion dear, Compels me to difturb your feafon due : For Lycid.x is dead, dead ere his prime Young Lycidas, and hath not left his peer : Who would not fing for Lycidas ? he knew Kiir.felf to fing, and build the lofty rhyme, He mufl not floteupon his watry bear Unwept, and welter to the parching wind. Without the meed of fom melodious tear.

Begin then, Sifters of the facred. well, That from beneath the feat of Jove doth tyring,

Begin, and fomwhat loudly l\veep the firing.

Hence

10

15

Hence with denial vain, and coy excufe,

So may fom gentle Mufe

With lucky words favour my deftin'd Urn, 2o

And as he pafles turn,

And bid fair peace be to my fable (hrowd.

For we werenurft upon the fdf-fame hill,

Fed the fame flocki by fountain, (hade; and rill.

Together both, ere the high Lawns appear 'd 25

Under the opening eye-lids of the morn, We drove a field, and both together heard What time the Gray-fly winds her fultry horn, Batt*ning our flocks with the frefli dews of night, Ofttill the Star that rofe, at Ev'ning, bright 30

Toward Heav'ns defcent had flop'd his weftering wheel. Mean while the Rural ditties were not mute, Temper'd to th'Oaten Flute, Rough Satyrs dane'd, and Vaunt with clov'n heel, From the glad found Would not be abfent long, 35

And old Damcetas lov'd to hear our fong.

But O the heavy change, now thou art gon»

Now thou art gon, and never mufl return !

Thee Shepherd, thee the Woods, and defert Caves,

With wilde Thyme and the gadding Vine o'regrown, 40

And all their echoes mourn.

The

186

POEMS BOTH ENGLISH AND LATIN — 1645

(59) The Willows, and the Haxle Copfes green, Shall now no more be feen. Fanning their joyous Leaves to thy fofc layes. As killing as the Canker to the Rofe, 45

Or Taint-worm to the weanling Herds that gra*e. Or Froft to Flowers, that their gay wardrop wear. When firf! the Wh ice thorn blows ; Such, LycidM, thy lofs to Shepherds ear.

Whei e were ye Nymphs when the remorfelefs deep 50 Clos d o're the head of your lov'd Lycidas? For neither were ye playing on the fteep, Where your old Bards, the famous Druids ly, Nor on the fhaggy cop of flta^higb,

Nor yet where Devi fpreads her wifard ftream : 55

Ay me, I fondly dream I

Had ye bin there -for what could that havedon > What could the Mufe her felf that Orpheta bore. The Mufe her felf, for her inchanting fon Whom Univerfal nature did lament, 60

When by the rout that made the hideous roar, His goary vifage down the dream was fenf* Down the fwift Hebrta to the Letbian fhore.

Alai ! What boots it with unceflant care

To tend the homely flighted Shepherds trade, 65

And

(€0) And ftri&ly meditate the thankles Mufe, Were it not better don as others ufe, To fport with \4mxryllk in the fhade, Or with the tangles of Nexra's hair ? Fame is the fpur that the clear fpii it doth raife (That laft infirmity of Noble mind) To fcorn de lights, and live laborious dayes; Bat the fair Guerdon when we hope to find, A id think ro burftour into fudien bhze, Co nesthe blind Fury with ih abhorred (hears, And fl ts the thin fpun life . But not the praife, Pbxbxs rcpli'd,and touch'd my trembling ears j Fame is no plant that grows on mortal foil, Nor in theghftering foil Set off to th'world, nor in broad rumour lies. But lives and fpreds aloft by thofe pure eyes, And perfet vvitnes of all judging feve j As he pronounces laflly on each deed. Of fo much fame in Heav'n expect thy meel

O Fountain Arcthufe, and thou honour a floud, Smooth-Aiding Mmwj, crown d withvocall reeds, That (train I heard was of a higher mood : But now my Oat proceeds, Andlifttnsto the Herald of th: Sea

70

75

80

85

Thit

63 Letbian) So in all 1645 copies examined.

LYCIDAS— 1645

187

That came in Neptune s plea.

He ask'd the Waves, and ask'd the Fellon winds.

What hard mithap hath doom'd this gentle (wain ?

And queftion'd every guft of rugged wings

That blows fiom off each beaked Promontory,

They knew not of his ffory,

And fag* Hippotadcs their answer brings,

Thar nor a blafl was from his dungeon ftray'd.

The Ayr was calm, and on the level brine.

Sleek fanope with all her filters play'd.

It was that fatall and perfidious Bark

Built in th'eclipfe, and rigg'd with cuifes dark,

pTh.it funk fo low thatfacred head of thine.

Next Cawi, reverend Sire, went footing flow, His Mantle hairy, and his Bonnet fedge, Inwrought with figures dim, and on the edge Like to that fanguine flower inferib'd with woe. Ah ! Who hath reft 'quoth he) iny dearefr pledge } Lair came, and hft did go, The Pilot of the Galilean lake, Two mafly Keves he bore of metals twain, (The Golden opes, the Iron (huts amain; Hefhook his Miter'd locks, and ftern befpake, How well could J luye fpar'd for thee young fwain.

A-iow

(6i)

9° Anow of fuch as for their bellies fake,

Creep and intrude, and climb into the fold ? "5

Of other dare they little reck'ning make,

T hen how to fo amble at the (hearers feaft,

And (hove away the woithy bidden gueft. 95 Blind mouthes ! that fcarcethernfelves know how to hold

A Sheep-hook, or have Iearn'd ought eh the lead 1 20

That toths faithfull Herdmans art belongs 1

What recks it them ? What need they ? They are fped ;

And when they lift, their lean and fiafhy fongs 100 Grate on their fcrannel Pipes of wretched ftraw,

The hungry Sheep look up, and are not fed, 125

But fwolu with wind, and the rank mift they draw,

Rot inv; ardly, and foul contagion fpread :

Bt lides what the grim Woolf with privy paw I05 Daily devours apace, and nothing fed, <

But that two-handed engine at the door, 130

Stands ready tofmite once, and finite no more. Return Alpbtm, the dread voice is pad,

That (hrunk thy dreams ; Return Sicilian Mufe, 1 10 And call the Vales, and bid them hither caft

1 heir Bels, and Flourets of a thoufand hue?. 135

Ye valley* low wherethe milde whifpers ufe,

Of (hades and wanton winds, and gu(hing brcois»

On

119 hold] In about one third of copies examined, the d is out of line, dropped down, probably because it is at the extreme end of a long line.

188

POEMS BOTH ENGLISH AND LATIN — 1645

On whofe frefh lap the fwart Star fparely looks?

Throw hither all your quaint enameld eyes,

That on the green terf fuck the honied fhowres,

And purple all the ground with vernal flowres.

Bring the rathe Primrofe that foriaken dies.

The tufted Crow-toe, and pale GciTamine,

The white Pink, and the Panfie freakt with jeat,

The glowing Violet.

The Musk-rofe,and the well attir'd Woodbine,

With Cowflips wan that hang the penfive hed,

And every flower that fed embroidery wears ;

Bid Amxnmbm all his beauty fhed,

And Daflfadillies fill their cups with tears,

To fhew the Laureat Herfe where Ljcii lies.

For fo to interpofe a little eafe,

let our frail thoughts dal!y with falfe furmifc.

Ay me ! Whilft thee the fhores, and founding Seas

Wa(h far away, where ere thy bones are hui Id,

Whether beyond the ftormy Hebrides,

Where thou perhaps under the whelming tide

ViGt'ftthe bottom of the monfirous world/?

Or whether thou to our raoift vows denyU

ikep'R by the fable of Bcllm* old,

Where the great vifior. of the yarded Mount

140

i45

150

i55

160

(**) L ooks toward Mamancos and Btyonxs hold -t Look homeward Angel now, and melt with ruth. And, O ye Dolphins, waft the rpples youth.

Weep no more, woful Shepherds weep no more, For LjcHm your fbrrow is not dead, Sunlc though he be beneath the wafry floar, So finks the day-ftar in the Ocean bed, And yet anon repairs his drooping head, And tricks his beams, and with new fpangled Ore, Flarnes in the forehead of the morning sky : So LjcUtis funk low, but mounted high, ThroMgh the dear might of him that walk'd the waves W here other groves, and other dreams along, With Ncftlr pure his oozy Locks he laves, And hears the unexpreffive nuptiall Song, v;

3 n theblcft Kingdoms meek of joy and love. 1 here entertain him all the Saints above, In folemn troops, ancj fweet Societies That fipg, and finging in thdr glory move, And wipe the tears for ever from his eyes. Now LycidM the Shepherds weep no more; Hence forth thou art the Genius of the fhore, In thy large recompenfe, and flialt be good To all that wander in that perilous "flood.

'65

170

175

180

Look?

Thus

185

173 waves;] The punctuation here should certainly be a semi- colon as in 1638. In IU Gannon copy and one or two others, the uninked impression of a semi-colon is clearly defined; but in all other copies examined, every trace of the impression is gone, probably due to washing. 178 Note that this line is indented one letter in all copies examined.

LYCIDAS

A MASK (COMUS)— 1645

189

Thus fang the uncouth Swain to th'Okes and rills, While the flill morn went out with Sandals gray, He touch'd the tender flops of various Quills, With eager thought warbling his Vvtk\ lay : And now the Sun had flretch'd out all the hills, And now wasdropt into the Weftern bay j At laft he rofe, and twitch'd his Mantle blew : To morrow to frefh Woods, and Paftures new.

&M.t

ms

E

«?*

fflw 3j

W

!&

mm

190

A

ASK

Of the fame

AUTHOR

Presented

At LVD LO r-Caftle,

I 6 34.

Before

The Earl oFBridgewateh Th^n Prefident of Walks.

Anno Dom. 1645.

The collation is between 1645 and 1637 printings of the Mask. For the reproductions of the 1637 edition, see p. 262ff. 2 MASK] MASKE 2 & 3 1637 lacks. 6 LUDLOW-Cattle,] Ludlow Caftle, 7 1634.] 1634: From this point on, the two title-pages are so different that collation is profitless. See page 263 for the 1637 title.

190

POEMS BOTH ENGLISH AND LATIN — 1645

To the Right Honourable,

John Lord Vicount Bracly,

Son and Heir apparent to the Earl

of Bridgemttr^ ire.

My Lord,

His Poem, which receivdits jirjl occasion of Birth from your Self and others of jour Noble Family , and much honour from your own Perfon in the ^performance, now returns again to make afinall De- dication of it felf to you. Although not openly acknowledgd by the Author ^ yet it is a legitimate ojf-Jpring, fo lovely, andfo much de fired, that the often Copying of it hath tird my Pen to give my fever all friends fat is faSiion^ and brought me to a neceffity of pro- ducing it to the publike view ; and

E 2 now

10

i5

(7*) now to offer it up in all tight full devo- tion to thofe fair Hopes, and rare En- dowments of your wuch-promifiw Toutb, which give a full ajfurance, te all that know you, of a future excel- lence. Live fweet Lord to be the honour of your Name, and receive this as your own, from the hands of him », who hath by many favours been lona Migdtoyourmofl honour d Parents^ and as in this reprefentation your at- tendant Thy rfis , fo now in all reatt exprejpon

Tour faith full, andmoU humble Servant

H. Lawes,

The

20

25

30

i To the Right Honourable, ] TO THE RIGHT/ HONOURABLE, 2 JOHN] IOHN Lord Vicount] Lord Vicount BRACLY,] BRACLY, 3 Heir] heire Earl] Earle

4 of] of 6 Poem,] Poem, 7 Birth] birth 8 Self,] felfe, 9 Noble] noble Family,] familie, 11 again] againe Dedication] dedication 12 felf] felfe 16 Copying] copying Pen] pen 18 neceffity] necefsitie The double / in both edi- tions is a ligature, but each ligature is different from the other.

21 Hopes,] hopes, 27 own,] owne, 28 been] beene

30 reprefentation] reprxfentation 33 Your faithfull, and most]

Your faithfull, and moft 34 Servant] Servant,

A MASK (COMUS) — 1645

191

(11)

The Copy of a Letter Written

By Sir Henry Wootton,

To the Author, upon the

following Poem.

From the Colledge9 this 1$. of April, 1^38.

SIR,

||.T was a fpecial favour, when you lately bellowed upon me here, the firft tafte of your acquaintance, though no longer then to make me know that I wanted more time to value it, and to enjoy it rightly ; and in truth, if I could then have imagined your farther ft ay in thefe parts, which I understood afterwards by Mr. H. , I would have been bold in our vulgar pi rife to mend my draught (for you left me with an extreme thiiftj and to have begged your conver- fation again, joyntly with your faid learned Friend, at a poor meal or two, that we might have banded together fom good Authors of the antient time: Among which,I obferved you to have been familiar. Since your going, you have charg'd me with new Obligations, both for a very kinde Letter from you. dated the fixth of this Month, and for a dainty peece of entertainment which came therwith. Wherin I mould much commend the Tragical part, if the Lyrical did not ravifli me with a certain Dorique delicacy in your Songs and Odes, wherunto I mud

E 4 plainly

plainly confefs to have feen yet nothing parallel in our Language : Ipfa moMities. But I muft not omit to tell you, that I now onely owe you thanks for 30 intimating unto me (how modeftly foever) the true Artificer. For the work it felf, I had view'd fom good while before, wirh Angular deliehr, ha- ving receiv'd it from our common Frimd Mr. R. 5 in tr.e very clofe of the late R's Poems, Printed at 35 Oxford, wherunto it wa6 added (as I now fup- pofe) that the Acceffory might help out the Princi- pal, according to the Art of Stationers , and to leave the Reader Con U bocca dolce.

Now Sir, concerning your travels, wherin I 40 fnay chalenge a little rnorepriviledgeof Diicours

10 with you j I fjppofe you will not blanch Paru in your way ; therfore I have been bold to trouble you with a few lines to Mr. M, B. whom you (hall eafily find attending the young Lord S. as his Gover- 45 pour, and you may furely receive from him good

15 directions -for the fhaping of your farther journey

into Italy, where he did refide by my choice fom

lime for the King, after mine own recefs from

Venice, 50

1 (hould think that your btft Line will be thorow

20 the whole length of France to Marfeilles^VoA thence by Sea to genoa , whence the paflage into Tufcanj is as Diurnal as a Graieftnd Barge : 1 haften as you do to. Florence, or Siena, the rather to teilyoua 55 fliort ftory from theintertft you have given me in

25 your fafcty.

At Siena I was tabled in theHoufeof one^f- Itrtp Scipiotii an old Roman Courtier in dangerous

times

15 phrafe] Note how the right hand side of h and left hand side of a are broken or do not print in all copies, except Morgan, in which, almost certainly, the two letters have been restored by pen and ink. The difficulty is caused by the r which is higher than the two pieces of type on either side.

192

POEMS BOTH ENGLISH AND LATIN — 1645

(n)

times, having bin Steward to the Daca di Pagliant, 60 who with all his Family were ftrangled, fave this ©ntly man that e(cap'd by forefight of the Tempeft : With him I had often much chat of thofe affairs j Into which he took pleafure to look back from his Native Harbour ; and at my departure toward 65 Rome (which had been the center of his experience) I had wonn confidence enough co beg his advice, how I might carry my fclf iecurely there, without t.f£iice of others, or of mine own confeience. Sivnor Arrigomio (Taytshe) 1 pen fieri fir etti, & il 70 infofciolto will go fafely over the whole World : Of which Delphian Oracle (for fo I have found it) your judgement doth need no commentary; and therfore (Sir J I will commit you with it to the beft of all iecurities, Gods dear love, remaining 75

Your Friend as much at command as any. of longer date Henry WoottoK*

Poflfcript.

SIR, / have exprc fly fenifhis my Foot-hoy to pre- 80 vent jvttr departure toitbout fom a: lew*' Lodgement from me of the receipt of your obliging Later, hiving my fclf thrcngh fom bu fines ', / know not how, nrglttljd thi ordinary conveyance. In any part where J (J.;, ill Uft- Airftand you fixed, I fhallbe a lad, and diluent to en- 85 tertainyouVi'ith Homc-Novelti's ; (ten for Jsm fo- mentation of oHrfriendfn?) too (oca interrupted in the Cradle.

The

(74)

The Perfons. <

The attendant Spirit afterwards in

in the habit of 'Thyrfis. Comm with his crew. The Lady.

1. Brother.

2. Brother. Sabrina the Nymph.

The cheif perfons which prefented , were

The Lord Brady,

Mr. Thomas Egertonhh Brother,

The Lady Alice Egerton.

A.

A MASK (COMUS) — 1645

193

tte

(75)

IS. fifeSflS W <x£> '^ *ffl* «£i *W*eS5b *fi»»ei£> *$S?a&!»

M AS

Presented

At L u d l o w-Caftle 1634. e£v.

The firft Scene difcovers a wilde Wood.

The attendant Spirit defcends or enters*

^|Eforethe ftarry threfhold of Joves Court

My manfion is, where thofe immortal fliapes

Of bright aereal Spirits live infphear'd

In Regions milde of calm and fercne Ayr,

Above the fmoak and itirr of this dim fpot,

Which men call Earth, and with low-thoughted care

Confia'dj

Confin'd, and pcfter'd in this pin-fold here, Strive to keep up a frail, and Feaverifli being Unmindfullof the crown that Vertue gives After this mortal change, to her true Servants Amongll the enthrond gods on Sainted feats. . Yet fom there be that by due fteps afpire Tolay their juft hands on that Golden Key Tharope's the Palace of Eternity : To fnch my errand is, and but for fuch, I would not foil thefe pure Ambrofial weeds. With the rank vapours of this Sin-worn mould.

But to my tasje. Nqtunc befides the fway Of every fait Flood, and each ebbing Stream, Took in by lot 'twixt high, ahd neather Jove, Imperial rule of all the Sea-girt lies That like to rich, and various gemms inlay The unadorned boofom of the Deep, Which he to grace his tributary gods By courfe commits to feverall goverment. And gives them leave to wear their Sapbire crowns., And weild their little tridents, but this lie The greateft, and the beft of all the main He quarters to his b!u haired deities, And all this traft that front, the falling Sun

10

15

20

25

30

15 fnch] So all copies examined, with Morgan corrected with pen and ink.

194

POEMS BOTH ENGLISH AND LATIN — 1645

(71) A noble Peer of mickie craft, and power

Has in his charge, with temper'd awe to guide An old, and haughty Nation proud in Arms : Where his fair off-fpring nurs'tin Princely lore, Are coming to attend their Fathers flare, And new-entrufted Scepter, but their way Lies through, the perplex't paths of this drear Wood, The nodding horror of whofe fhady brows T hreats the forlorn and wandring Paffinger. And here their tender age might fufFer perill, But that by quick command from Soveran Jove I was difpatchc for their defence, and guard ; And liften why, for I will tell ye now What never yet was heard in Tale or Song From old, or modern Bard in Hall, or Bowr. Bacchus that firft from out the purple Grape, Crulh t the fweet poy fon of mif-ufed Wine After the Tufcan Mariners transform'd Coafting the Tyrrhene fhore, as the winds lifted. On Circes Hand fell (who knows not Circe The daughter of the Sun ? Whofe charmed Cup Whoever tafted,loft his upright fhape, And downward fell into a groveling Swine) This Nymph that gaz'd uponhis cluftring locks,

35

40

45

50

With Ivy berries wreath'd, and his blithe youth.

Had by him, ere he parted thence, a Son

Much like his Father, but his Mother more,

Whom therfore fhe brought up and Coram nam'd,

Who ripe, and frolick of his full grown age,

Roaving the Celtic^, and Iberian fields,

At laft betakes him to this ominous Wood,

And in thick (belter of black {hades imbowr'd,

Excells hL Mother at her mighty Art,

OfFring to every weary Travailer,

His orient liquor in a Cryftal Glafle,

To quench the drouth of Phoebus, which as they tafte

(For moft do tafte through fond intemperate thirft)

Soon as the Potion works, their human countenance,

Th'exprefs refemblance of the gods,ischang'd

Into fom brutifh form of Woolf, or Bear,

Or Ounce, or Tiger, Hog, or bearded Goat*

All other parts remaining as they were,

And they, fo perfect is their mifery,

Not once perceive their foul disfigurement.

But boaft themfeives more comely then before

And all their friends , and native home forget

To roule with pleafure in a fen fiial (He. ,

Therfore when any favour' d of. high Jivct

55

6o

65

70

75

With

Chances

The entire page is noticeably out of alignment in several places. 46 Baccbus] The b is not absolutely certain, as the h in this italic font is almost closed at the bottom. The letter in ques- tion may well be the h battered to look like the b. There can be little doubt that the intent here was to print h.

A MASK (COMUS) — 1645

195

(79)

Chances to paffe through this adventrous glade,

Swift as the Sparkle of a glancing Star, 8o

I flioot from Heav'n to give him fafe convoy,

As now I do : But firft I muft put off

Thefe my skie robes fpun out of Irk WoofF,

And take the Weeds and likenes of a Swain,

That to the fervice of this houfe belongs, 85

Who with hisfoft Pipe, and fraooth-dittied Song,

Well knows to flill the wilde winds when they roar,.

And huih the waving Woods, nor of lefle faith.

And in this office of his Mountain watch,

likelieft, and neereft to the prefent ayd 90

Of this occafion. But I hear the tread *

Of hatefull fteps, I muft be viewlcs now.

Com us enters Kith a Charming Rod in one band, his Glafs in the other, with him a rout of Mon- gers headed like fundry forts of wilde Beaftf% but other-wife like Men and Women, their Ao- parel glislring, they com in making a riotous and unruly noife, Kith Torches in their hands.

Comus. The Star that bids the Shepherd fold, Now the top of Heav'n doth hold,

And the gilded Car of Day, , 95

His glowing Axle doth allay

(Zo)

m

In the fteep Atlxmc\ ftrcam,

And the flope Sun his upward beam *

Snoots againft the dusky Pale,

Pacing toward the other gole

Of his Chamber in the Eaft.

Mean while welcom Joy, and Feaft*

Midnight fhout, and revelry,

Tipfie dance, and Jollity.

Braid your Locks with rofie Twine

Dropping odours, dropping Wine.

Rigor now is gon to bed,

And Advice with fcrupulous head.

Strict Age, and fowre Severity,

With their grave Saws in flumberly.

We that are of purer firej

I mitate the Starry Quire,

Who in their nightly watchfull Sphears, '

lead in fwift round the Months and Years.

The Sounds, and Seas with all their finny drove"

Now to the Moon in wavering Morrice move,

And on the Tawny Sands and Shelves,

Trip the pert Fairies and the dapper Elves ;

By dimpled Brook, and Fountain brim.

The Wood-Ny^hs deckt with Dairies trim.

100

105

no

115

Their

120

120 In all but one of the copies examined, IU 1645, the word Nymphs has the letters mph out of line thrown up with p even higher than the other two; and the h of high also thrown up. In IU 1645, the alignment is proper and there is the imprint of a spacer block under the h of the word high. There are no doubt other copies in which this line is in alignment.

196

POEMS BOTH ENGLISH AND LATIN — 1645

Their merry wakes and pafrimes keep ;

What hath night to do with flcep ?

Night hath better fweets to prove,

I'cnm now wakes, and wak'ns Love,

Com let us our rights begin,

Tis onely day- light that makes Sin

Which thefe dun (hades will ne're report,,

Hail Goddefle of No&urnal fport ■

Dark vaild Cotytto, t'whom the fecret flame

Of mid-night Torches burns ; myfterious Dame

That ne're art call'd, but when the Dragon woom

Of Stygian darknesfpets her thickeft gloom,

And makes one blot of all the ayr,

Stay thy cloudy Ebon chair,

Wherin thou rid'ft with Hectt\ and befriend

Us thy vow'd Priefts, till utmoit end

Of all thy due; be done, arid none fcfc out,

Ere the blabbing Eaftern fcout,

The nice Morn on tWlndiuH tteep

From her cabin d loop hole peep*

And to the tel-tale Sun difcry

Ourconceal'd Solemnity.

Com, knit hands> and beat the grouad,

In a light fantsftick round,

125

130

135

140

Thi

The Meafure. Break off, break off, I feel the different pace, 145

Of fom chaft footing neer about this ground, Run to your (hrouds, within thefe Brakes and Trees, « Ournumber may affright: Som Virgin fure (For fo * can diflinguiih by mine Kxt) Benighted in thefe Woods. Now to my charms, 150

And to my wily trains, I (hall e're long Be well ftock't with as fair a herd as graz'd About my Mother Circe. Thus I hurl My dating Spells into the fpungy ayr, Of power to cheat the eye with blear illufion, rss

And give it falfe prefentments, left the place And my quaint habits breed aftonifhment, And put the Damfel to fufpicious flight, Which muft not be, for that's againft my courfc ; I under fair pretence of friendly ends, x 60

And well plac't words of gloziug courtefie Baited with reafons not unplaufible Wind me into the eafie -hearted man, And hugg him into f.:ares. When once her eye Hath met the vertue of this Magick duft, 165

I fhall appear fom harmles Villager

W horn thrift keeps up about his Country gear,

But

137 dues) The s is so faint in all copies and almost not printing in some that any single copy may seem to lack it. This is the usual small s from a font slightly smaller than the regular type of this edition.

A MASK (COMUS) — 1645

197

But here (he comes, I fairly itep a Ude And hearken, it I may, her bufines here,

The L.idj enters,

This way the noife was, if mine ear be true.

My bell guide now, me thought it was the found

Of Riot, and ill manag'd Merriment,

Such as the jocond Flute, orgamefom Pipe

Stirs up among the toofe unleter d Hinds,

V\ hen for their teeming Flocks, and granges full

In wanton dance they praife the bounteous Pin,

And thank the god. amifs. I mould be loath

To meet the rudencflfe, and fwill'd infolence

Of luchlate Waffailers ; yet O where els

Shall I inform my unacquainted feet

In the blind maze, of this tangl'd Wood ?

My Brothers when they faw me wearied out

W ith this long way, refolving here to lodge

Under the fpreadii.b favour of thefe Pines,

Stept as they fe'd to the next Thicket fide

To bring me Berries, or fuch cooling fruit

As the kind hofpitable Woods provide.

They left me then, when the gray. hooded Eev'n

like % fad Votarift in Palmers weed

F a

?>ofe

( 84; Rofe from the hindmoft wheels of Fbcebtu wain. But where they are, and why they came not back, Is now the labour of my thoughts, 'tis likelieft They had ingag'd their wandring fteps too far, 170 And envious darknes, e re they could return, Had Hole them from me, els O theeviih Night Why fhouldft thou, but for fom fellonious end, * In thy dark lantern thus clofe up the Stars, That nature hung in Heavn, and fill'd their Lam ps 1 75 With e verlafting oil, to give due light To the mifled and lonely Travailer ? This is the place, as well as I may guefs. Whence eev'n now the tumult of loud Mirth Was rife, and perfetin mylihYning ear, 180 y€t nought but fingle darknes do I find.

What might this be ? Athoufand fantafies Begin to throng into my memory ©f calling (hapes, and beckning fhadows dire, And airy tongues, that fyllable mens names l85 On Sands, and Shoars,and defert Wilderneffes, Thefe thoughts may ftartle well, but not aftound T he vertuous mind, that ever walks attended By a ftrongfiding champion Confcience — — - O wtlcom pure ey "d Faith, white-handed Hope,

190

195

200

205

210

Tkou

198

POEMS BOTH ENGLISH AND LATIN — 1645

(*5)

Thou hovering Angel girt with golden wings.

And thou unblemifti'tform of Chaftity,

I fee ye viiibly, and now beleeve

That he, the Supreme good, t'whom all things ill

Are but as flavifli officers of vengeance,

Would fend a gliftring Guardian if need were

To keep my life and honour unaflail'd.

Was I deceiv'd, or did a fable cloud

Turn forth her filver lining on the night ?

I did not err, there does a fable cloud

Turn forth her fiiver lining on the night,

And calls a gleam over this tufted Grove.

I cannot hallow to my Brothers, but

Such noife as I can make to be heard fartheft

lie venter, for my new enliv'nd fpirits

Prompt me } and they perhaps are not far off.

SONG. .

Sweet Echo, freetcft Nympb that livfi uvfeen Within thy airy fall By pre Meander's mar gent green,

And in the violet imbrtiderd vale

Wlxre the love-lorn Nightingale

Nightly to thee her fad Song mournetb veeU. *' 5

215

220

225

230

Canfi

235

(U)

Can ft thou mt tell me of a gentle lair That lilpft thy Narciflus are ?

C if thou have Hid them in fom flowry Cave,

7 ell me but where 240

Sweet $ueen of Parly, Daughter of the Sphear, So maifi thou be trar.jlated to theses, And give refunding grace to all Heavm Harmonies

Com. Can any mortal mixture of Earths mould Breath fuch Divine inchanting raviftiment ? 245

Sure fomthing holy lodges in that breft, And with thefe raptures moves the vocal air To teftifie his hidd'n refidence ; How fweetly did they float upon the wing* Of iilence, through the empty.vaulted night 250

At every fall fmoothing the Raven doune Of darknes till it fmil'd : I have oft heard My Mother cine with the Sirens three, Amidftthef!owr>-.kirtl'dN^W« ■

Culling their Potent hearbs, and balefull drugs, 255

Who as they fung, would take the prifon'd foul, ■ And lap it in Elyfium, ScyUa wept, '

And chid her barking waves into attention,

•*-—..- And

The signature.] The F is italic, and the 3 is smashed in all copies examined.

A MASK (COMUS) — 1645

199

260

265

And fell chxryhXh murmur 'd foft applstife j

Yet they in pleaflng ilurnber lull'd the fcnfcf

And in fweet madnes rob'd it of it fclf,

But fuch a facred, and home-felt delight,

fuch fober certainty of waking blifs

I never heard till now. He fpeak to her

And (he (hall be my Queen. Hailforren wonder

Whom certain thefe rough (hades did never breed

Unl flfe the Goddes that in rurall (hrine

Dwell ft here v ith Tin, or Silvan, by blefl Song

Forbidding every bleak unkindly Fog

To touch the profperous growth of this tall Wood*

La. Nay gentle Shepherd ill u loft that praife That is addreft to unattending Ears, Not any boaft of skill, but extreme fhifc How to regain my fever'd company CompelFd me to awake the courteous Echo To give me anfwer from her moffie Couch.

Co. What chance good Lady hath bereft you thus ?

La. Dim darknes, and this leavy Labyrinth.

Co. Could that divide you from neer-uflieiing guides ?

La. They left me weary on a graffie terf. 280

Co. By falihood, or difcouttefie or why ?

La. To feek i'th vally fom cool friendly Spring.

F 4 Co»

270

275

a*)

Co. And left your fair fide all unguarded Lady ?

La. They were but twain, and purpos'd quick return.

Co. Perhaps fore-ftalling night prevented them. 285

La. How eafie my misfortune is to hit !

Co. Imports their lofs, befidc the prefent need ?

La. No lefs then if I fhould my brothers Ioolc.

Co. Were they of manly prime, or youthful bloom ?

La. As fraooth as Hebcs their unrazor'd lips. 290

Co. Two fuch I faw, what time the labour'd Oxe

In his Ioofe traces from the furrow came,

And the fwinK't hedger at his Supper fate j

I faw them under a green mantling vine

That crawls along the fide of yon fmall hill, 295

Plucking ripe clutters from tlfe tender (hoots,

Their port was more then human , as they flood ?

1 took it for a faery vifion

Of fom gay creatures of the element

That in the colours of the Rainbow live 300

And play i'th pKghted clouds. I was aw-ftrook,

And as I paft, I worfhipt ; if thofe you fe^k

tt were a journey like the path to Heav'n,

To help you find them. La. Gentle villager

What f eadieft way would bring me to that place l 305

Co. Due \vctl it rifes from this fhrubby peint.

La.

200

POEMS BOTH ENGLISH AND LATIN — 1645

('89 ;

Li. To find out that, good Shepherd, I fuppoie, In fuch a fcant allowance of Star-light, Would overtask the belt Land -Pilots art, Without the fure guefs of well-pra<5tiz'd feet. 310

Co, I know each lane, and every alley green Dingle, or buihy deil of this wilde Wood, And every bosky bourn from fide to fide My daily walks and ancient neighbourhood. And if your dray attendance beyetlodg'd, 315

Or fhroud within thefe li-nits, I (hall know Ere morrow wake, or the low roolted lark from her thach't pallat rowfe,if otherwife j I can conduct you Lady to a low

But loyal cottage, w.iere you may be fafe 320

Till further queft'. La. Shepherd I take thy word, And truft thy hoaeft offer 'd courtefie, Which oft is fooner found in lowly flieds With fmoaky rafters, then in tapftry Halls And Courts of Princes, where it firft was nasn'd, 325

And yet is moft pretended : In a place Lefs warranted then this, or lefj fecure I cannot be, that I mould fear to change it, Eie meblcft Providence, and fquare my triall

To my proportion' dftrength. Shepherd lead on. 330

The

(90)

The two Brothers.

Eli. Sr$. Unmuffle ye faintftars, and thou fair Moon That wontft to love the travailers benizon, Stoop thy pale vifage through an amber cloud, And disinherit Chios, that raigas here Id double night of darknes, and of fhades ; 335

Or if your influence be quite damnVd up With black ufurping mills, fom gentle tap«r Though a rufh Candle from the wicker hole Of fom clay habitation vifit us

r"

With thy long levell'd rule of ftreaming light, 340

And thou (halt be our (far of Arcady,

Or Tjrun Cynofure a Bro. Or if our eyes

Be bart'd that happines, might we but hear

T he folded flocks pen'd in their watled cotes, "

Or found of paftoral reed with oaten flops, 345

Or whiftlefrom the Lodge, or vUagecock

Count the night watches to his feathery Dames,

T'would be fomfolace yet, fom little cheating

In this clofe dungeon of innumerous bowes.

But O that haples virgin our loft filler 350

Where may (he wander now, whether betake her

From the chill dew, amongft rude burrs and thiftles ?

Perhaps

331 faintftars] No space in any copy examined.

A MASK (COMUS) — 1645

201

(91)

Perhaps fom cold bank is her boulfter now

Or'gainfttbe rugged bark of fom broad Elm

leans her unpillowd head fraught with fad fears, 355

What if in Wild amazement, and affright,

Or while we fpeak within the direfull graip

Of Savage hunger, or of Savage heat J

Eld. Bro. Peace brother, be not over-exquifitc To call the fafliion of uncertain evils j 360

For grant they be fo, while they reft Unknown, What need a man foreftall hit date of grief; And run to meet what he would mod avoid ? Or if they be but falfe alarms of Fear, How bitter is fuch felf-delufion ? 365

I do not think my fifter fo to feek. Or fo unprincipled in vermes book, And the fweet peace that goodnes boofoms ever, As that the fingle want of light and noife (Not being in danger, as I truft flie is notj 370

Could ftir the confhnt mood of her calm thoughts, And put them into mif-becoming plight. Vertue could fee to do what vertue would ', By her own radiant light, though Sun and Moon Were in the flat Sea funk. And Wifdoms felf 375

Oft feeks to fweet retired Solitude,

Where

(9>)

Where with her beft nurfe Contemplation She plumes her feathers,and lets grow her wings That in the various busfle of refoit Were all to rufrT.d, and fomtimes impair'd. He that has light within his own cleer breft May fit i'th center, and enjoy bright day, But he that hides a dark foul, and foul thoughts Benighted walks under the mid day Sun ; Himfelf is his own dungeon.

x.Bro. Tis molt true That mufing meditation molt affetts The Penfive fecrecy of defert cell. Far from the cheerfull haunt of men, and herds, And fits as fafe as in a Senat houfe. For who would rob a Hermit of his Weeds, His few Books, or his Beads, or Maple Difli, Or do his gray hairs any violence ? But beauty like the fair Hefperian Tree Laden with blooming gold, had need the guard Of dragon watch withuniuchanted eye, To five her bloflbms, and defend her fruit From the rafh hand of bold Incontinence. You may as well fpred out theunfun'd heaps Of Mifers treafurc by an out-laws den,

380

385

390

395

And

202

POEMS BOTH ENGLISH AND LATIN — 1645

(91)

And tell me it is fafe, as bid me hope 400

Danger will wink on Opportunity.

And let a (ingle helplefs maiden pais

Uninjur'd in this wilde furrounding waft.

Of night, or lonelines it recks me not,

I fear the dred events that dog them both, 405

Left fom ill greeting touch attempt the perfon

Of our unowned fifter.

Eld. Bro. I do not, brother, Inferr, as if I thought my lifters ftate Secure without all doubt, or controverfie : Yet where an equall poife of hope and fear 410

Does arbitrate th'event, my nature is That I encline to hope, rather then fear, And gladly banifli fquint fufpicion. My fifter is not fo defencelefs left

As you imagine, (he has a bidden ftrength 415

Which you remember not.

tl. Bro. What hidden ftrength, Unlefs the ftrength of Heav'n, if you mean that ?

Eld. Bro. I mean that too, but yet a hidden ftrength

Which if Heav'n gave it, may be term'd her own :

Tis chaftity, my brother, chaflity : 420

She that has that, is clad in coropleat fleel.

And

fP4) And like a quiver'd Nymph with Arrows keen May trace huge Forefts, and unharbour'd Heaths,

Infamous Hills, and fandy perilous wildes, Where through the facred rayes of Chaftity, No favage fierce, Bandite, or mountaneer Will <kre to foyl her Virgin purity, Yea there, where very defolation dwels By grots, and caverns fliag'd with horrid fliades, She may pafs on with unblench't majefty, Be it not don in pride, or in prefumption. Som fay no evil thing that walks by night In fog, or fire, by lake, or moorifh fen. Blew meager Hag, or ftubborn unlaid ghoftj That breaks his magick chains at curfeu time, No goblin, or fwart Faery of the mine, Hath hurtfull power o're true virginity. Do yevbeleeve me yet, or fliall I call Antiquity from the old Schools of Greece To teftifie the arms of Chaftity ? Hence had the huntrefs Vixn her dred bow Fair filver-fliafrei Queen forever chafte, Wherwith (Tie tan'dthe brinded lioneft And fpotted mountain pard, but let at nought The frivolous bolt of Cupid, gods a nd men

425

430

435

440

Fear'a

445

A MASK (COMUS) — 1645

203

Fear'd her ftern frown, and (he was queen cth' Woods,

What was that f laky-headed Gorgon flieild

That wife Minerva wore, unconquer d Virgin,

Wherwith (he freez'd her (oes to congeal'd (bone ?

But rigid looks of Chart aufterity, 450

And noble grace that daih't brute violence

With fudden adoration, and blank aw.

So dear to Heav'n is Saintly chaftity,

That when a foul is found fincerely Co,

A thoufand liveried Angels lacky her, 455

Driving far off each thing of fin and guilt,

And in cleer dream, and folemn vifion

Tell her of things that no grofs ear can hear,

Till oft convers with heav'nly habitants

Begin to call a beam on th'outward fhape. 460

The unpolluted temple of the mind ,

And turns it by degrees to the fouls effence.

Till all be made immortal : but when luft

By unchafte looks, loofe geftures, and foul talk.

But raoft by leud and lavifh act of fi n, 465

Lets in defilement to the inward parts,

The foul grows clotted by contagion,

Imbodies, and imbrutes, till (he quite looie

The divine propertv of her firft being.

Such

(96) :

Such are thofe thick and gloomy (hadowj damp 470

Oft feen in Charnell vaults, and Sepu!ch<°rs

Lingering, and fitting by a new made grave,

As loath to leave the body that it lov'd,

And link't it fclf by carnal fenfualty

To a degenerate and degraded fhte. 475

i. Bro. How charming is divine Philofophy ! Not har(h, and crabbed as dull fools fuppofe. But miific.il as is Jpollos lute. And a perpetual feaft of neclar'd fweets, Where no crude furfet raigns- Eld. Bro. Lift, lift, I hear 480 Som far off hallow break the filent Air.

x.Bro. Me thought fotoo \ what fliould it be ?

Eld. Bro. For certain Either fom one like us night-founder'd here, Or els fom neighbour Wood-man, or at wor ft, Som roaving Robber calling to his fellows. 485

a Bro. Heav'n keep my fifter, agen agen and neer, Beft draw, and ftand upon our guard.

Eld. Bro. He hallow, if he be friendly he comes well, if not, De fence is a good caufe, and H cav'n be for us.

The

The page numbers.] In some copies, but not all examined, both numbers appear broken or something prevented them from printing with a clear impression.

204

POEMS BOTH ENGLISH AND LATIN — 1645

(97)

The attendant Spirit habited like- a Shepherd. )

That hallow I mould know, what are you ? fpeak; 490

Com not too neer, you fall on iron flakes elfe.

Spir. What voice is that, my young Lord ? fpeak agen>

2. Bro. O brother, tis»my father Shepherd fure.

El- Bro. Tfyrfis .? Whofe artful ftrains have ofc delaii > The huddling brook to hear his madrigal, 495

And fweeten'd every muskrofe of the tiale, How cam'ft thou here good Swain ? hath any ram Slip't from the fold, or young Kid loll his dam, Or {haggling weather the pen't flock forfook ? How couldlt thou find this dark fequefter'd nook ? 500

Spir. O my lov'd matters heir, and his next joy, I came net here on fuch a trivial toy As a ft ray 'd Ewe, or to purfue the Health Of pilfering Woolf, not all the fleecy wealth , , That doth enrich thefe Downs, is worth a thought 505

To this my errand, and the care it brought. But O my Virgin Lady, where is flie ? How chance fhe is not in your company >

Eli. Bro. To tell thee fadly Shepherd, without b'ame> Or our neglect, we loft her as we came. 510

Spir. Ay me unhappy then my fears are trur

G

Ell

w 1

El. Bro. What feats good Thyrfts ? Prethee briefly (hew- - Spir. He tell ye, 'tis not vain, or fabulous, (Though fo efteenVd by (hallow ignorance) What the fage Poets taught by th'heav'nly Mufe, 515

Storied of old in high immortal vers Of dire Chimeras and inchanted»lles. And rifted Rocks whofe entrance leads to hell, For fuch there be, but unbelief is blind-

Within the navil of this hideous Wood, 520

Immur'd in cyprefs fhades a Sorcerer dwels

Of Btccbas, and of Circe born, great Cotom,

Deepskill'd in all his mothers witcheries,

And here to every thirfty wanderer.

By fly enticement gives his banefull cup, 525

With many murmurs mixt, whofe pleafing poifota

The vifage quite transforms of him that drinks,

And the inglorious likenes of abeaft

Fixes inftead, unmoulding reafons mintage

Charafter'd in the face ; this have I learn'c 530

Tending my flocks hard by i'th hilly crofts,

That brow thi& bottom glade, whence night by ni^ht

He and bis monftrous rout are heard to howl

like ftabl'd wolves,or tiger sat their prey,

Doing abhorred rites to Hecate- 535

In

A MASK (COMUS) — 1645

205

(99)

In their obfcured haunts of inmofl bowres.

Yet have they many baits, and guileful! {pells

T o inveigle and invite th'unwary fenfe

Of them that pafs unweeting by the way. !

This evening late by then the chewing flocks

Kad ta' n their fupper on the favoury Herb

Of Knot-grafs dew-befprent, and were in fold,

I fate me down to watch upon a bank

With Ivy canopied, and interwove

With flaunting Hony-fuckle, and began

Wrapt in a pleafing fit of melancholy

To meditate my rural minflrelfie.

Till fancy had her fill, but ere a clofe

The wonted roar was up arnidfl the Woods,

And fill'd the Air with ba'rbarous diflbnance,

At wSiich I ceas't, and liflen'J them awhile,

Till an unufuall flop of fudden filence

Gave refpic to the drowfie frighted fleeds

That draw the litter of clofe-curtain'd fleer),

At laft a foft and Column breathing found

Ho.'l like a fleam of rich dillifl'd Perfumes,

Aiid dole upon the Air, that even Silence

Was took e're the was ware, and wifli't ihc might.

Deny her nature, and be never more

G a

Still

Stilltobefodifphc't. I wasalleare, 5e0

And took in flrains that might create a foul

Under the ribs of Death, but O ere long

Too well I did perceive it was the voice 54o Of my moft honour'd Lady, your dear filter.

Amaz'd I flood, harrow'd with grief and fear, 565

And O poor haplefs Nightingale thought I,

How fweet thou fing'il, how neer the deadly fnare !

Then down the Lawns I ran with headlong haft 545 Through paths, and turnings oft'n trod by day.

Till guided by mine ear I found the place 57o

WhCre that damn'd wifard hid in fly difguife

(For fo by certain fignes 1 knew.) had met

Already, ere my beflfpeed could prevent, 550 The aidlefs innocent Lady his wifli't prey,

Who gently ask't if he had feen fuch two, 575

Suppofing him fom neighb our villager ;

Longer I durft not flay, but foon I guefs't

Ye were the two fhe meant, with that I fprung 555 Into fwift flight, till I had found you here,

But furder know I not. 2 . Bre. O night and fhades, 580

How are ye joyn'd with hell in triple knot

Againfl th'unarmed weaknefs of one Virgin

AV?ne; and helplefs ! Is this the confidence

You

The page numbers.] In some copies examined, these numbers are clear and normal. In others, the second 9 looks broken; in still others, the second 9 is out of line in various ways; and in a few copies the figure is almost lying on its side.

576 neighbour] Note spacing neighb our present in all copies examined.

206

POEMS BOTH ENGLISH AND LATIN — 1645

flOl)

You gave me Brother 5 Eld. Bro. Yes, and keep it ftill,

Lean onitfafely, notapeiiod 585

Shall be unfaid for me : againlt the threats

Of malice or of forcery, or that power

Which erring men call Chance, this I hold firm,

Vertue may be afTail'd, but never hurt,

Surpriz'd by unjuft force, but not cnthrall'd, 590

Yea even that which mifchief meant moll harm,

Shall in the happy trial prove molt glory.

But evil on it felf fhall back recoylf

And mix no more with goodnefs, when atlaft

G ather a like fcum, and fed' d to it felf 595

It (hail be in eternal reftlefs change

Self-fed, and felf-confum'd , if this fail,

The pillar'd firmament is rott'nnefs,

And earths bale built on ftubble. But com let's on.

Againft th'oppofing will and arm of Keav'n 600

May never this juft fword be lifted up,

But for that damn'd magician, let him be girt

With all thegreifly legions that troop

Under the footy flag of Acheron,

Harpy ies and Hydra's, or all the monftrous forms '. 605

Twixt Africa, and lude, He find him out,

And force him to reftore his purchafe back,

G j Or

(ici) Or drag him by the curls, to a foul death. Curs d as his life.

spir. Alas good ventrous youth, I We thy courage yet, and bold E mprife. But here thy fword can do thee little ftead, Farr other arms, and other weapons mnft Be thofethat quell the might of hellifh charms, He with his bare wand can unthred thy joynts. And crunble all thy finews.

Eld, Bro. Why prcthee Shepherd How durft thou then thy felf approach fo neer As to make this relation ?

Spir. Care aud utmoft fluffs How to fecure the Lady from furprifal. Brought to my mind a certain Shepherd Lad Of final! regard to fee to, yet well skilPd In every vertuous plant and healing herb That fpreds her verdant leaf to th'morning ray, He lov'd me well, and oft would beg me ling, Which when I did, he on the tender grafs Would fit, and heaiken even to extafie, And in requital! ope hi* leather 'n fcrip, And fhew me fimples of a thoufand names Telling their ftrange and vigorous faculties;

610

615

620

625

Amongft

584 1645 numbering, me] So all copies examined; Columbia note is wrong, reading me,.

A MASK (COMUS) — 1645

207

(-10$;

Amongft the rclt a fmall unfightly root,

But of di vine effeft, he culld me out ;

The leaf was darkifh, and had prickles on It,

But in another Countrey, as he laid,

Bore a bright golden flowre, but not in this foyl :

Unknown, and like efteem'd, and the dull fwayn

Treads on it daily with his clouted fhoon,

And yet more med'cinal is it then that Moly

That Hermes once to wife Vlyjfes gave ;

He call'd it Hxmony,vnA gave it me,

And bad me keep it as of fovranufe

'Gainft allinchantments, mildew Haft, or damp

Or •>:»% furies apparition $

I purs t it up, but little reck'ning made,

Till now that this extremity compell'd,

But now I find it true ; for by this means

I knew the foul inchanter though difguis'd,

Enter d the very lime-twigs of his fpells,

And yet came off : if you have this about you

(As I will give you when we go) you may

Boldly affault the necromancers hall j

Where if he be, with dauntlefs hardihood,

And brandifh't blade ru(h on him, break hisglafc,

And Hied the lufhious liquor on the ground,

G 4

(104) B ut feafe his wand, though he and his curft crew 63o Feirce figne of battail make, and menace high,

Or like the fons of Vulcan vomit fmoak, 655

Yet will they foon retire, if he but (brink.

Eli. Bro. Tbyrfis lead on apace, lie follow thee., And fom good angel bear a fheild before us.

635

640

The Scene changes to afiatelj Palace, fet out with all manner of delicioufnefs : [oft Mitjick^ Tables fprcd With all daintifS. Comus appears wijb bis rabbi'', and the Lady jet in an inc bunted Cb,iirt to Whom he offers his Glufjti which fie puts by, and goes about to rife.

But

Comus. Nay Lady fit; if I but wave this wand, your nervs are ail chain d up in Alablafter, 660

And you a ftatue ; or as Daphne was Root-bound, that fled Apollo,

645 La. Fool do not boaft,

Thoucanft not touch the freedom of my minde Withall thy charms, although this corporal rinde Thou hafte immanacrd, while H eaVn fees good. 665

Co. Why are you vext Lady ? why do you it own ?

65o Here dwel no frowns, nor anger, from thefe gates Sorrow flies farr : See here be all the pleafures That fancy can beget on youthfull thoughts,

When

208

POEMS BOTH ENGLISH AND LATIN — 1645

When the frefh blood grows lively, and returns

Brisk as the April buds in Primiofe-feafon.

And firfi behold this cordial Julep here

That flames., and dances in his cryftal bounds

With fpirits of balm, and fragrant Syrops mitt.

Not that Nepenthes which the wife of Tbone,

In Egypt gave to Jove-bom Helena,

Is of fuch power to ftir up joy as this,

To life fo friendly, or fo cool to thirft.

Why fhould you be fo cruel to your felf,

And to thofe dainty limms which nature kat

For gentle ufage, and foft delicacy ?

But you invert the cov'nants of her truft,

And harfiily deal like an ill borrower

With that which you receiv'd on otherterms, '

Scorning the unexempt condition

By which all mortal frailty muft fubfift,

Refrediment after toil, eafe after pain,

That have been tir'd all day without repaft.

And timely reft have wanted, but fair Virgin

This will reftore all foon.

La. 'Twill not falfe traitor, Twill not reftore the truth and honefty That thou haft banifh'c from thy tongue with lies.

670

675

680

685

690

W«

(106) Was this the cottage, and the fafe abode Thou told'ft rac of? What grim afpe&s are thefe, Thefe oughly-headed Monfters ? Mercy guard me J Hence with thy brew'd inchantments,foul deceiver, Haft thou betrai'd my credulous innocence With vifor'd fallhood, and bale forgery, And wouldftthou feek again to trap me here With lickerifh baits fit to enfnare a brute ? • Were it a draft for Juno when (he banquets, I would not tufte t'i -■■ r.eaibnous offer ; none But fuch as are good men can give good things, And that which is not good, is not delicious To a wel govern'd and wife appetite.

Co. O foolilhnes of men ! that lend their ears To thofe budge dodtors of the St ok\ Furr, And fetch their precepts fi om the Cyuie\ Tub, Praifing the lean and fallow Abftinence. Wherefore did Nature powre her bounties forth, With fuch a full and un withdrawing hand, Covering the earth with odours, fruits, and flocks, Thronging the Seas with fpawn innumerable. But all to pleafe, and fate the curious tafte ? And fet to work millions of fpinning Worms, That in their green {hops wsave the f nooth-hair'd filk

695

700

705

710

715

To

A MASK (COMUS) — 1645

209

(1*7)

To deck her Sens, and that no corner might

Be vacant of her plenty; in her own loyns

She hutch't th'all-worfhipt ore, and precious gems

To ftore her children with; if all the world 720

Should in a pet of temperance feed on Pulfe,

Drink the clear (beam, and nothing wear but Freize,

Th'all-giver would be unthank't, would be unprais'd,

Not Half his riches known, and yet defpis'd ,

And we fhould ferve him as a grudging mafter, 725

As a penurious niggard of his wealth,

And live like Natures baftards, not her Ions,

Who would be quite furcharg'd with her own weight.

And ftrangld with her wade fertility ;

Th'earth Cumberland the wingd air dark't with plumes, 730

The herds would over- multitude their Lords,

7 he Sea o'refraught would fwell,& th'uofoughc diamonds

Would Co emblaze the forhcad of the Deep,

And fo beftudd with Stars, that they below

Would grew inur'd to light, and com at Iaft 735

To gaze upon the Sun with fhamelefi brows.

Lift Lady be not coy, and be not cofen'd

With that fame vaunted name Virginity,

Beauty is natures coyn, muft not be hooufed,

But muft be currant, and the good thereof 740

ConHfts

Confifts in mutual and partak'nblifs, linfavoury in th'injoyment of it felt If you let (lip time, like a neglected rofe It withers on theftalk with languifh't head. Beauty is natures brag, and muft be ihown In courts, atfeafts, and high folemnities Where moft may wonder at the workmanfhip ; It is for homely features to keep home, They had their name thence ; courfe complexions And cheeks of forry grain will ferve to ply The fampler, and to teize the hufwifes wooll. What need a vcrmeil-iinctur'd lip for that Love-darting eyes, or trefles like the Morn ? There was another meaning in thefe gifts , Think what, and be adviz'd, you are but young yet.

Li. I had not thought to have unlockt my lips In thisunhallow'd air, but that this Jugler Would think to charm my judgement, as mine eyes Obtruding falfe rules pranckt in reafons garb. I hate when vice can bolt her arguments, And vertue has no tongue to cheGk her pride : Impoftor do not charge moft innocent nature, As if fhe would her children fhould be riotous With her abundance, fhe good caterers

745

750

755

760

Means

210

POEMS BOTH ENGLISH AND LATIN — 1645

(1Q?) Means her provifion onely to the good 765

That live according to her fober laws. And holy dictate of fpare Temperance : If every juft man that now pines with want Had but a moderate and befeeming fharc , Of that which lewdly-pampcr'd Luxury 770

Now heaps upon fom few with vaft excefs, Natures full bleffings would be welldifpenc't Inunfuperfluous eeven proportion, And (he no whit encomber'd with her ftorei And then the giver would be better thank'r, 775

Hispraifedue paid, forfwinifli gluttony Nc-'re looks to Heav'n amidft his gorgeous feaft. But with befotted bafe ingratitude Cramms, and blafphemes his feeder. Shall I go on ? Or have I faid anough ? To him that dares 780

Arm his profane tongue with contemptuous words Againft the Sun- clad power of Chaftity, Fain would I femthing (ay, yet to what end i Thou haft nor Eare, nor Soul to apprehend The fublime notion, and high myftery 785

That muft be utter 'd to unfold the fage And ferious doctrine of Virginity,

And thou art worthy that thou fliouldft not know

• More

(no)

Morc'hsppines then this thy prefent lot.

Enjoy your deer Wit, and gay Rhetorick 790

That hath fo well been taught her dazling fence,

Thou art not fit to hear thy felf convinc't ;

Yet fhould I try,- the uncontrouled worth

Of this pure caufe would kindle my rap'tfpirits

To fuch a flame of facred vehemence, 795

That dumb things would be mov'd to fympathize,

And the brute Earth would lend her nerves, and fluke.

Till all thy magiclc ftru&ures rear'd fo high.

Were fhatter'd into heaps o're thy falfe head.

Co. She fables not, I fetl that I do fear 800

Her words fct off by fom fuperior power ; And though not mortal , yet a cold fliuddringdew Dips me all o're, as when the wrath of Jove Speaks thunder, and the chain > of Erebus To fom of S'tuums crew. I muft dilfemble, 805

And try her yet more ftrongly. Com, no more^ T his is meer moral babble, and direct Arainfl the canon laws of our foundations I mud not luff" this, yet "tis but the lees And fetlingj of i. melancholy blood ; 8I0

fV.it this will cure all ftreight, one fip of this vVill bathe the u<o<->ping fpi: its in delight

?,Z) -end the biiis of dreams. Be wi(e,and tafec. — -

Tbs

813 Beyondl In about half the copies examined the B has not printed; but in all others examined, it is clear enough.

A MASK (COMUS) — 1645

211

(III)

The Brothers rttjh in Vi'itb Sftords drawnt wrefi hf& Clafs out of his handt andhcu\it again ft the ground; his rout make fignt of rtfiftance, but Are all driven in ; The attendant Soirit comes in.

Spir. What, have you let the falfe enchanter fcape ? O ye miftook, ye fhould have fnatcht his wand 815

And bound him faft j without his rod revers't, And backward mutters of difTevering power, We cannot free the Lady that fits here In ftony fetters fixt, and motionlefs ;

Yet flay, be not difturb'd, now I bethink me, 820

Som other means I have which may be us'd,

Which once of Melibxm old I learnt The footheft Shepherd that ere pip't on plains. There is a gentle Nymph not farr from hence. That with moifl curb fways the fmooth Severn llream, 825 Sabrina is her name, a Virgin pure, Whilom (he was the daughter of Locrine, That had the Scepter from his father Brute. She guiltlefs damfell flying the mad purfuit Of her enraged ftepdam GucnMen, 830

Commended her fair innocence to the flood

That ftay'd her flight with his crofs flowing courfc,

The

The water Nymphs that in the bottom plaid, Held up their pearled wrifts and took her in, Bearing her ftraight to aged Ncrcics Hall, Who piteous of her woes, rear'd her lank head, And gave her to hisdaughters to imbathe In nectar'd lavers ftrew'd with Afphodil, And through the porch and inlet of each fenfe Dropt in Ambrofial Oils till fhercviv'd, And underwent a quick immortal change Made Goddefs of the River i flill fhe retains Hermaid'n gentlenes, and ofcat Eeve Vifits the herds along the twilight meadows, - Helping all urchin blafts, and ill luck Agnes That the fhrewd medling Elfe delights to make, Which fhe with pretious viold liquors heals. For which the Shepherds at their fcfiivals Carrol her goodnes lowd in ruftick layes, And throw fweet garland wreaths into her ftream Of pancies, pinks, and gaudy Daffodils. And, as the old Swain faid, fhe can unlock The clafping charm, and thaw the numming ipelL, If fhe be right invok't in warbled Song, For maid'nhood fhe loves, and will be fwift To aid a Virgin, fuch as was her (elf

835

840

845

850

855

In

212

POEMS BOTH ENGLISH AND LATIN — 1645

(ill)

In hard beferting need, this will I try And addc the power of fom adjuring verf«»

so tic

Sabrint fair

Lificn where thou art fitting Under the glajfie, cost, tranflucent wave,

In twifted braids of Lillics knitting the loofe train of thy amber-dropping h&irt

Liften for dear honours fakjt

Coddefs of the fiver la\e,

Liften andfavit

Liitfin and appear to us

In name of great Ocexnw,

By the earth-fhaking Neptune's mace.

And Tethys grave majeftick pace,

By hoary Herein wrincled look,

And the Carpathian wifards hook.

By fcaly Tritons binding (hell.

And old footh-feying Glaucut fpellj

By leucothea's lovely hands,

And her fon that rules the ftrands, ' , . { .

By thetk tinfel flipper'd feet , -._ .

And the Songs of Sirens facet,

86o

865

870

875

gy

C114;

By dead Partbenope's dear tomb, And fair Ligeas golden comb, "Wherwith {he fits on diamond rocks Sleeking her foft alluring locks, By all the Nymphs that nightly dance Upon thy ftreams with wily glance, Rife, rife, and heave thy rofie head From thy coralpav'n bed, And bridle in thy headlong wave, *

Till thou eur fummons anfwer'd have.

Liften and favc.

Sabritta rifes, attended by water-Nymphes^ andjitigs.

By the rufhy -fringed han\, Inhere grows the Willow and the Ofief danhj

Myjliding Chariot flay es, ?hiekfetwhhAgat,andthe<aiurnflxcn »

Of TurkU blew* and Emrauld green That in the channeU ftrayes, Whilflfrom off the waters fleet Thus l.fet my printlcft feet O're the Cow flips Velvet bead, That bends not as J tread, Gentle fwain at thy rctjticft

J dm beret >

Spit •

880

885

890

895

900

A MASK (COMUS) — 1645

213

(115;

Sp'tr. Goddefs dear We implore thy powerful hand to undoe the charmed band Of tru: virgin here diftreft, Through the force, and through the wile Of unbleft inchanter vile.

Sab . Shepherd 'tis my office Left To help infnared chaftity ; Brightefr Lady look on me, Thus T fprinkle on thy bred Drops that from my fountain pure, I have kept of pretious cure, Thrice upon thy fingers tip, T hrice upon thy rubied lip, * Next this marble venornd feat Smcar'd with gummsof glutenous heat I touch with chafte palms moift and cold, Now the fpell hath loft his hold j And I mult hafte ere morning hour To wait in Ampbitrite's bowr.

Sabrina defects, and the Lady rifts out of her feat,

Sfir. Virgin, daughter of Locrine

Sprung of old Ancbifcs line,

H 1

910

May

May thy brimmed waves for this Their full tribute never mifs from a thoufand petty rills, go5 That tumble down the fnowy hills 3 Summer drouth, or finged air Never fcorch thy trefles fair, Nor wet Ottobers torrent flood Thy molten cryftal fill with mudd. May thy billows rowl aflioar The beryl, and the golden ore, May thy lofty head be crown'd With many a tower and tewafc round* And here and there thy banks upon With Groves of myrrhe, and'einnamon.

Com Lady while Heayen lends us grace, let us fly this curfed place, left the Sorcerer us intice Withfbm other new device. 920 j^ot a wafte, or needlefs fouid ,TI11 we com to holier ground, I fhall be your faithfull guide T hroagh this gloomy covert wide$ And not many furlongs thence J.s your Fathers residence.

915

925

930

935

940

945

Where

214

(ill)

Where this mghr are met in ftatc Many a friend to gratulate • His wifh't prefence, and befide All the Swains that there abide, With Jiggs, and rural dance refbrt, We fliall catch them at their fporr, And our fudden coming there Will double al| their mirth and chere j Com let us hafte, the Stars grow high, But night fits monarch yet in the mid sky.

POEMS BOTH ENGLISH AND LATIN — 1645

950

955

The Scene changes prefenting Ludlow To^n and the Prefidents Caftle , then c$m in Countrey- Dancers, after them the attendant Spirit, Kith the two Brothers and the Lady.

SONG.

Spir. Back Shepherds, bac\% anough your play. Till next Sun-jhine holiday. Here be without duc\ or nod. Other trippings to be trod Of lighter tees, and fuch Court guifc As Mercury didfirft devifc With the mincing Dryades On the Lawns, and on the Leaf,

Hj

960

965

This

(us;

This fecond Song prefents them to their father and mother.

Noble Lord, and Lady bright, 1 have brought ye new delight, Here behold fo goodly grown three fair branches of your own, Heavn hath timely tri'd their youth, Their faith, their patience, and their truth. Andfent them here through hard ajfays With a crown of deathlcfs Praife, To triumph in victorious dance O'refenfual Folly, and Intemperance.

The dances ended, the Spirit Epilogmztr, Spir. To the Ocean. now I fly, And thofe happy climes that ly Where day never fhuts his eye, Up in the broad fields of the sky : There I fuck the liquid ayr All amidft the Gardens fair Of Hejpcnts, and his daughters three That fing about the golden tree : Along the crifped fhades and bowres Revels the fpruce and jocond Spring,

970

975

980

The

985

A MASK (COMUS) — 1645

215

(U9) The Graces, and the rofie-boofom'd Howre$> T hither all their bounties bring, That there eternal Summer dwels, And Weft winds, with musky wing About the cedar'n alleys fling Nard.and cajfias balmy fmcls. IrU there with humid bow, Waters the odorous banks that blow Flowers of more mingled hew Then her purfTd karf can {hew* And drenches with Elyfian dew (Lilt mortals , if your ears be true) Beds of Hyacinth, and roles Where young Adonis oft repofes, Waxing well of his deep wound In fluuiber (oft, and on the ground Sadly fits th' Jjjyrian Queen j '

But farr above in fpangled fheen Celeftial Cupid her fam'd Son advanc't, Holds his dear Pfyche fweet intranc't After her wandring labours long, Till free confent the gods among Make her his eternal Bride, And from her fair unfpotted fide

QQO

995

1000

1005

fllOj

Two blifsful twins are to be born, Youth and Joy j fo fovc hath fworn.

But now my taslc is fmoothly don, I can fly, or I can run Quickly to the green earths end, Where the bow'd welkin flow doth bend, And from thence can foar as foon To the corners of the Moon.

Mortals that would follow me, ' Love vertue, {he alone is free. She can teach ye how to clime Higher then the Sphcary chime 3 Or if Vertue feeble were, Heav'n it felf would (loop to her,

IOIO

1015

The End.

1020

Two

Because this is the recto of the last leaf in a gathering that terminates the English poems, this page carries no signature, although normally it would have been [H4]. The omission is another bit of evidence that the English and Latin poems printed in 1645 were bound and sold separately, as the Latin poems begin on sheets that are not conjugate with the English sheets, as is the case in the 1673 volume. This omission of the signa- ture on this page would be regular procedure for the printer if the book ended with this leaf, as it undoubtedly did.

POEMATA— 1645

217

oannis

/filtoni

LONDINENSIS

POEMATA*

Quorum pleraque intra

Annum #tatis Vigcfimum Conicfipfit.

3\func primum Sdila,

L0NV1MI>

Typis R. R. Proliant ad Tnffgnia Principis,

in Coemeterio D. Pauli, apud Humphreditm

Aloft ly, i 645,

M

• -m. «a*. ma. 5ft v»I

et/X9 a>(,tj, uiln £"i> i'',"% JvS

<ft^Sjft<ffiiEc quae fequuntur de Autho- Wf?Sim re teftimonia, tametfi ipfe

-_- ^ intelligebat non tarn de fe f£ £sM R quamlupra fe eife dicta, eo ^M^M quod preclaroingenio viri5 nee non amici ita fere folcnt laudare, ut omnia fuis potius virtutibuSjOuam veritati congruentia nimis cupide amngant, no- luittamcn horum egregiamin fe volun- t .item non effenotam^ Cum alii prasfer- tim. lit id faceret magnopere fuaderenr* Dum enim nimiae laudis invidiam totis ab fe virions amolitur, fibique quod pjus jcquoeftnon attributum eflemavult, ju- dicium interim hominum cordatorum at- qoe illuftrium quin fummo fibi honor* ducat, negare aon potefb

A 2

rfodnmt

10

15

3 POEMATA.] The period is broken and raised above the line of type in all copies examined. 4 intra] The alignment of the type is bad in all copies examined, especially of the final a.

4.quam] The a here and in the same word in line 8 rises slightly above the line of the other type. 7 veritati] In some copies the a is smeared and in others it is so clean and clear that it seems impossible that the same piece of type could have been responsible for both appearances of this letter; but there are no other indications whatever on the page that any part of it has been reset.

218

POEMS BOTH ENGLISH AND LATIN — 1645

M

Joannes Baptifta Manfm , Marchio

Villenfis Neapolitans ad joannem tJHiltonittm Anglum.

U

T mens, forma, decor, fades, mos, fi pietas fie, Non Anglus,verum herde Angelusipfe fores.

Ad Joannem Miltonem Anglnm tri~

plici pvefeos Uurea corenandum Graca nimi-

rum^ Latina, atqttt Hetrttfca, Epi~

gramma Jo amis Salfitii Romani.

/^EdeMeles, cedatdepreffaMinciusurna ;

Sebetus Tafifum definat ufque loqui ; At Thamefis viftor cunctis ferat altior undas Nam per te Milto par tribus unus erit.

Ad Joannem Miltonum.

•"^RsedaMseonidem, jacket fibi Roma Maronem, VJ Anglia Miltonum ja&at utrique parem.

Sdvaggi.

Al

(5)

Al Sionor Gio. Miltoni Nobile Iriglefe.

ODE.

TH1 Rgimi aIC Etra o Clio ^-'Perche dificlle intrecciero corona Non pi ft del Biondo D io La Fronde eterna in Findoy e in Elicona9 Dienjiamertomaggior, maggiori i fregi9 A'celefle virtu celefti prcgi,

Nonpuo dd tempo edace Rimaxer preda, eterno alto valcre, Non pub I'oblio r apace Furar daUememorie eccelfo onoret Sit I* area di mia cetra ttn dardo forte Virtu m'adatti, eferiro la morte,

D el Ocean prtfondo

Cinta dagli ampigorghi Anglia rifiede

Separata dal mondoy

Verb chc ilfao valor I'umano eceede •

^ftefiafeeondafa produrre Eroi,

Cb' hartno a ragion del fovrttntan tra mi, ' '

^3

IO

i5

AS a

TESTIMONIA — 1645

219

Ala virtu tbandita

J) anno ne i petti lor fids riccttOy

£l»elUgti efol gradita,

ferche in lei fan trovar gioiay e diletto j

Ridi/io tu CjUvanni e mofira in tanto

Con tua vera virtu, vera il mio Canto,

Lungi dal Patrio lido

Spinfe Zettji I'indujlre ardente brama$

Cti udio d' Helena ilgrido

Con aurea tromba rimbombarlafama,

JSper poterla effigiare al paro

Dalle ptit belle Idee traffe ilpriu rare.

Cofi l" Ape Jngeg no fa

Trae con induftria ilfm liquor pregiate

Dalgiglio e dalla rofa>

B quanti-vaghifiori or nam ilprato ;

formano un dolcefuon diver fe Choide%

Tan varie voci mdodia Concorde*

Di bella gloria am ante

$4Hton daf Ciel natio per varie parti

20

25

30

35

Ze

(7)

Le peregrine piante

Volgefti a ricercar fcienx.fj, ed arti ; Del Gallo rtgnator vedefii i Regni9 E dell' Italia ancorgl'Eroipiu degni,

Tabro quafi divine

Sol virtu rintracciando iltuo feu/iera

Vide in ogni confino

Chi di nobil valor calca ilfentiero •

V ottimo dal miglior dopofcegliea

ferfabbricar d'ogni virtu I* idea* .

Qttanti nacquero in Flora

O in lei dlparlar Tofco apprefer Parte]

La cui memoria onora

11 mondo fatta eterna in dotte carte t

Volefti ricercarper tuo tefore,

£ parla^i con lor netl* opre lore*

Ne/t' altera Babc&e

Per te ilparlar eonfufe Giove in vane]

Che per varie favelie

Difeftejfj trofeo cMfu'lpian§ ?

40

45

50

55

Ch>

220

POEMS BOTH ENGLISH AND LATIN — 1645

Cti Ode oltr all Anglia iljuopiu degne Idioma Spagna, Frar.cia, Tofcana> e Grecia e Roma.

I pin profundi arcani

Clf occulta la natura e in ciclo e in terra Ch'a Ingrgnifovrumani Troppo avara tal'hargli chitsds, eferra, Chiaramerte conofci, egiungi aljine Delia moral virtude al or an confine.

N on bat tail Tempo I' ale,

Fermi (t imfnoto, e in un ferminfi gV ann'i s

Che di virtu immortals

Scorran di troppo ingiuriofi a i danni ;

Che s'opre degne di Poema o froria

Furongia, I'hai prefenti a$a memoria^

Dammi tua dolce Cetra Se vuoi ch'io dica del tuo dolce canto, Ch' inalzandoti all* Etra ■ Difarti huomo cclcfie ottieue il vanto9

II Tamigi ildira chegl' e conceffo Per tefao cigno pareggiar Permejfe,

6o

65

70

75

(9) Jo che in riva del Amo

lento fpiegar tuo merto altft e precltra So chefatico indarno, E ad ammirary non a lodarlo itnparo j Freno dunqnc la lingua, e afcolto ileore Che tiprende a today con lofiupore.

Del fig. Antonio Francini gentilhuome

Fiorcntino.

8o

.«. st, *b. «8& % *$>

*fodnm

lo

TESTIMONIA

ELEGIA PRIMA — 1645

221

(10)

f»J

$tgsgKgK$tfg qps

MRS

JOANNI MIL10NI

LONDINIENSI.

Juveni Patria, virtutibus eximio,

VIro qui multa peregrinatione, fiudio cuntta orhu ttffd- rarumlocaperjpexit, ut novm VlyjJ'es omnia ubique ab omnibus apprehendcret. Polyglotto, in cujut ore lingua jam depwdita ficre- vivifcunt}ut idiomata omnia fint in ejus laudibus in- facunda; Etjure eapercallctui admir 'ationes (? plaufus popu- lorum ab propria fapientia excitatos, intelligat.

Mi, cujus animi dotes corporifque, fenfa ad admirationem commovent, & per ipfam motum cuique auferunt ; cujus opera dd plaufus bortantur , fed vafittate vocem laudatoribut adi-

tnunt.

Cui in Memoria totut Orbit : In intelleftu. SaPientia. in vo- lant ate ardor gloria, in ore Eloquentia : Harmoni cos celeflium Spbxrarum fonitus Afironomia Duce audicuti ,^ Charaftcrcs mirabilium nature per quos Dei magnitudo defcribitur magijlrt Philofopbia legend ; Antiquitatum latebrtf, vctufiatis excidia, eruditionis ambages comjtc aflidua autorum Letfionc.

Exquirenti, reftaurantii per currents

At cur nitor in arduurn } llli in cujus virtutibus evulgandis ora Fama non {u^ician, tiec bominumfliiporinUudandufatUcft, Reverentix &> imms ergo boc ejus mentis debitum admirationistributuntojfen CzrslM Vatm Patricius Florentine.

Txnto homm fin-as. Unto, virtuth mm*.

Elegiaram

10

15

20

25

ELEGIARUM

Liber primus.

Elegia prima ad Carolnm Diodatuw.

Andem, chare, tu* mihi pervenere rubellar,

Pertulit & voces nuntia charra tuas, Pertulit occidua Devat Ceftrenfis ab ora Vergivium prono qua petit amne falum. Multum crede juvat terras aluifle remotas

Pectus araans noftri, tamque fidele caput,

\

Qubdque mihi^Iepidum tellus longinqtia fodalea

Debet, atunde- brevi reddere jufla velic. Me tenet urbs refli*4 quam Thamefis alluit uodl,

Meque nee invitum patria dulcis habet» Jam nee arundiferum mihi cura revife*e Camifltt,

Nee dudum vetiti melaris angit amor. Nada nee arva placent, umbrafque negantia molles,

Quam male Phcebtcolis convenit ille locus 1

Nee duri libet ufque minas perferre magiflri

Cxteraque ingeaio non fubeunda meo,

Si

10

15

17 audieuti,} All copies examined read thus. 1673 audicuti;

9 tenet] The first e is thrown up above other letters in all copies examined. 12 melaris] No space in any copy examined. 1673 reads me laris. 13 molles,] Most copies

examined read thus. But there are apparently three different states, with most copies reading as above. But IU copy 2 reads molles with no comma following; and IU 1645 and British Museum copy E1126 read molle without either the s or the comma.

222

POEMS BOTH ENGLISH AND LATIN — 1645

(12)

Si fit hoc exilium patrios adii/Te penates,

Et vacuum curis otia grata fequi, Non ego vel profugi nomen, fortemvc recufb, '

lakus &exiliiconditione fruor. O urinam vates nunquam graviora tuli/Tet

Hie Tomitano flebilis exul agro -t Non tunc Jonio quicquam ceflifTet Homero

Neve f oret vi&o Iaus ribi prima Maro. Tcmpora nam licet bicplacidis dare libera Mufis,

Ettotum rapiunt me mea vita libri. Excipit bine felTum finuofi pompa theatri,

Et vocat ad plaufus garrula fcena fuos. Seucatmauditurfenior, feu prodigus harres,

Seuprocus, aut pofita caffide miles adeft, Sive decennali foecundus lite patronus

Detonat inculto barbara verba foro, Sarpe vafer gnato fuccurritfervus amanri,

Et nafum rigidi fallit ubiquc Patris j Sa?pe novos illic virgo mirata calores

Quid fit amor nefcit, dum quoque nefcit,amat. Sive cruentatum furiofa Tragoedia fceptrum

QuafTat, & effufiscrinibus ora rotat, Et dolet, & fpeclojuvat & fpe&affe dolendo,

Interdum & lacrymis dulcis amaror inert :

20

25

30

35

Seu

4o

fi3J

Seu pucr infelix indclibata reliquit

Gaudia, & abri'pto Hindus amore cadir, Seu ferus e tenebris iterat Styga criminis ultor

Confcia funereo pe&ora torremovens, Seu mx-ret Pelopeia domus, feu nobilis Hi,

Autluitinceftos aula Creontis avos. Sfd neque fub te<5io femper nee in urbe latemus,

Irrita ncc nobis rempora veris eunt. Nos q'.icoue Iucus habet vicina conlitus ulmo

Atqae fuburbani nobilis umbra loci. Sxpius hie blandas fpirantia fydera flammas

Virgineos videas pmerii.fe choros. Ah quotfes dignx ftupui miracula forma;

Qux* poflct fenium vel reparaie Iovis ; Ahquoties vidi fuperantia lumina gemmas,

At que faces quotquot volvit uterque polus ; Coilaqae bis vivi Pelopis quarbrachia vincant,

Qua»que fluit puro ne&2ie tin&a via, Et decus eximium frontis, tremulofque capillos,

Aurea qux fallax -etia tendit Amor. Pelhcefquc genas, ad quas hyacinthina fordst

Purpura, & ipfe tui floris, Adoni, rubor- Cedite laudata? toties Heroides olim,

Et quxcunquevagum cepit arnica Tovem.

45

50

55

60

Cedite

46 luit] All copies of 1645 examined read Iuit the I looking very much like 1. See 1645, p. 15, El. //:i3, and p. 24 (IV): 109. 62, 63, and 64 are out of line with 61 in all copies examined.

ELEGIA PRIMA

ELEGIA SECUNDA — 1645

223

(H)

Cedite Acha?meniae turrita fronte puelbt,

Et quot Sufa colunt, Memnoniamque Ninon. Vos etiam Danaae fafces fubmittite Nymph*,

Et vos Iliacse, Romulegeque nurus. Nee PompeianasTarpeia Mufa columnas

Jaclet, & Aufoniis plena thcatra ftolis. Gloria Virginibus debetur prima Britannis,

Extera fat tibi fit foemina pofle iequi. Tuque urbs Dardaniis Londinutn ftru&a colonis

Turrigerum late confpicienda caput, Tu nimiumfeluc intra tua moenia claudis

Quicquid formofi pendulus orbis habet. Non tibi tot caelo fcintiilant aftra fercno

Endymioneae turba miniftradeae, Quot tibi confpicuae formaque auroque puellae

Per medias radiant turba videnda vias. Creditur hue geminis venifle inve&a columbis

Alma pharetrigero milite cincla Venus, Hr.ic Cnidon, & riguas Simoentis fiumine yalles,

Kuic Paphon, & rofeam pofthabitura Cypron, Aft ego, dum pucri finit indulgentia card,

Moenia qua-n fubirb linquere faufte paro ; Et vitare procul malefidae infimia Circes

Atria>divini Molyos ufus ops.

Stat

fi5)

65 Sta? quo que j unco fas Cami remeare paludes,

Atqueiterum rauca? murmur adire Schola?. jtocerea fidi parvumcape munus amici, Paucaque in alternos verba coada modos.

70 Elegia fecunda, Anno setatis 1 7.

In obit urn Yroeconh Academici Cantabrigienfis.

*TpE> qui confpicuus baculo fulgente folebas J- Palladium toties ore ciere gregem, Ultima praconum prarconem te quoque faeva

Mors rapit, officio nee favet ipfa fuo. Candidiora licet fuerinttibi temporaplumis 8o Sub quibus accipimus delituifTe Jovem,

O dignus tamen Ha?monio juvenefcere fucco,

Dignus in /Efonios vivere pofle dies, Dignus quern Stygiis medica revocaret ab undis _ Arte Coron ides, faepe rogante dea. 85 Tu fi jufliis eras acies accire togatas, Et celer a Phcebo nuntius ire tuo Talis in : Iiaca ftabat Cyllenius aula Alipes, anherea miflus-ab arcc Patris.

90

10

Talis

78 ae of Endymioneae is dropped down in all copies examined.

El. II. 13 Iliaca] The I is barely legible in some copies and the same indeterminate I or 1 as on page 13, line 46.

224

POEMS BOTH ENGLISH AND LATIN — 1645

(16) Talis & Eurybates ante ora furentis Achillei 15

Rectulit Atridse jufla fevera ducis. Magna fepulchrorum regina, fatelles Avcrni

Sxva nimis Mufis, Palladi faeva nimis, Quin illos rapias qui pondus inutile terrar,

Turba quidem tft telis ifla petenda tuis. 20

Veftibus hunc igiturpullis Academia luge,

Et madeant lachrymis nigra ferctra tuis. Fundat & ipfa modos querebunda Elegeia trifles,

Perfonec & totis naenia moefta fcholis.

Elcgiatertia , Annoaetatis 17. In obit nm Profit lis Wintonienfis.

XI osftus eram, & tacitus nullo comitantefedebam, *▼ A Harebantque animo triftia plura meo, Procinus en fubiit funeflar cladis imago

Fecit in Angliaco quam Libitina folo ; Dum procerum ingrelTi eft fplendentes marmore turres 5

Dira fepulchrali mors metuenda face ; Pulfavitque auro gravidos & jafoide mures.

Nee meruit fatrapum fternere falce greges. Tuncmemini clarique ducis, fratrifque vcrendi

Intempeftivis oifa cremata ropis. 10

Ec

(17)

Ec memini Keroum quos vidit ad sthera raptos,

Flevit & aminos iielgia cota duces. At te praxipue luxi uigniffime pr^ful,

Wi'ntoniarque olira gloria magna tuar 3 Dclicuifletu, ftrtrifli fie ore querebar,

Mors fera Tartareo diva fecunda Jovi, Nonne f xtis quod fylv<a tuas perfentiat iras,

Et quod in herbofos jus tibi detur agros, Qyodque 2fflatatuo marcefcant Iiliarabo,

Et crocus, & pulchra- Cypridi fara rofa. Nee finis ut Temper fluyio contermina quercus

Miretur Iapfus prsetereuntis aqu* ? Et tibi (uccumbit liqui^o quae plurima cselo

Evehuurpennis quamlibet augur avis, Et qua: mille nigris errant animalia (i/lvis*

Et quod alunt mutum Proteos antra pecus, IriVida, tanta tibi cum fit concefla poteftas*

Quid juvat humana tingere ca?de manus ? Nobileque in pectus certas acuifle fagittas>

Semide2mqueanimamfedefugaiTe fua ? Talia dum lacryraans alto fub peclore volvo/

Rofcidus occiduis Hefperus exit aquis*

Et Tarteffiaco fubmerferat aequore currurn

Phoebus ab eco littore menfus iter.

B

15

20

25

30

Nec

El. II. 23 Elegeia] The diaeresis is faint, but magnification shows it clearly in all copies examined. Columbia note is wrong. See also 1645, p. 20, line 27.

El. III. 5 ingreffa] The a is broken in all copies examined.

ELEGIA TERTIA

ELEGIA QUARTA — 1645

225

K«c moraf membra eavo pofui refovenda cubili,

Condiderant oculos noxque foporquc meos. Cum mihi vifus cram Iato fpatiarier agro,

Heu nequit ingenium vifa rcfcrrc meum. Illie punicea radiabant omnia luce,

Ue matutino cum juga fole rubent. Ac veluti cum pandit opes Thauraantia proles,

Veftitu nituicmulricolorefolum. Non dea tarn variis ornavic floribus hortos

Alcinoi, Zephyro Chloris amata Ievi. Flumina vernantes lambunt argentea campos,

Ditior Hefperio flavet arena Tago. Serpit odoriferas per opes levis aura Favoni,

Aurafub innutaeris humida n.ica rolls. Talis in extremis terras Gangetidis oris

Luciferi regis fingitur efle domus. Ipfe racemiteris dum denfas vitibus umbras

Etpellucentesmiror ubique locos, Eccemihi fubito praeful Wintoniusaftat,

Sydereum nitido fulfit in ore jubar s Veftis ad auratos defluxit Candida talos,

Infula divinum cinxerat alba caput, Dumque fenex tali incedit venerandus ami&J, I Intremuit iarto forca ten* fonOo

( >9) 35 $ gmina gemmaus plaudunt ca?IefHa penni;, Pura triumphali perfonat arthra tuba. Quifqire novum amplexu comitem cantuque faiuts^

Hcfque aliquis placido mifit ab ore fonos j Nate vcni, & patrii felix cape gau Jia regni, 4o . Semper ab hinc duro, nate, labore vaca. Dixit, 8c aligera? tctigerunt nablia turmar, At mihi cum tenebris aurea pulfa quies, fiebam turbatos Cephaleia pcllice fomnosa Talia condogant fomnia farpe mihi.

45

50

60

65

Elegia quarta. Annoxtatis 18. Ad Thomam Junmm prrfcepterem

juum afttd mercatorcs Anglicos Hamburg^ agones P aft or it muncrs fungentem.

Aqmina

f~\ Urre per immenfum fubito mca littera ponnirri, ^-^ I, pete Teutonicos Ixve per asquor agros, Segncs rumpe moras, & nil, precor, obftet eunti,

Et feftinantis nil rcmoreturitefo 55 Ipfe ego Sicanio frarnantem carcere ventos

/F.olon, & virides follickabo Deos 5 Citmlcamquefuis comitaSam Dorida Nymphis,

Ut tibi dem pladdam per fua regna Yiam,

•1 *

A

Catchword Aqmina] The first word on the next page is cor- rectly Agmina; but in all copies examined the catchword on p. 18 is erroneously as above.

226

POEMS BOTH ENGLISH AND LATIN — 1645

(10)

At tu, fi potcris,celcres tibi fume jugales,

Vefta quibus Colchis fugic ab ore viri. Aut queis Triptolemus Scythicas devenic in oras

Grams Eleufina miflus ab urbe puer. Atquc ubi Gcrmanas flaverevidebis arenas

Ditis ad Hamburg* mania fle&e gradom, Dicitur occifo quae ducere nomen ab Hama,

Cimbrica queni fertur clava dediffe neci* Vivitibi antiquae clarus pietatis honore

Prseful Chrifticolas pafcere dotfus oves ; Illequidem eft anims plufquam pars altera noflr.-e,

Dimidio vitas vivere cogor ego. Hei mihi quot pelagi, quot montes interjefti

Me faciunt alia parte carere mei 1 Charior ille mihi quam tu dodiffime Graium

Gliniadi>pronepos qui Telamonis erat. Quamque Stagirites generofo magnus alumno,

Quern peperit Libyco Chaonis alma Jovi. Qualis Amyntorides,qualis Philyreius Heros

Myrmidonum regi, talis & ille mihi- Primus ego Aonios illo prareunte t eceiTus

luftrabam, Srbifidi facra vireta jugi, Pieriofque haufi latices, Clioquefavente, Caftalio fpai fi kta ter ora mero.

10

15

20

25

30

(21)

flafflmeus at fignum ter viderar arietis JEthcm>

Jnduxirque auro lanea terga novo, Bifque novo terram fparfifH Chlori fenilem 35

Gramine, bifque tuas abltulit Aufter opes : Nccdum ejus licuit milulumina pafcere vultu,

Aut lingua: dulces aurebibiiTe fonos. Vade igitur, curfuque Eurum prajvertefortorum,

Quam fit opus monitis res docet, ipfa vides. 40

Invenxes dulci cum conjuge forte fedentem,

Mulcentem grernio pigrtora chara fuo, Forfitanaut veterum praelarga volumina patrum

Verfantem, aut veri biblia facra Dei. Caeleftive animas faturantem rore tenellas, 45

Grande falutiferae religionis opus. Utque tolct, multam, fit dicere cura falutem,

Dicere quam decuit jfi modo adelTet, herum. Hsec nuoque paulnm oculos in humum defixa modcftos,

Verba yerecundo fis memor ore loqui : 50

Uxc tibi, fi teneris vacat inter | oelia Mulls

Mittitab Angliaco littore fida manus. Accipe finceram, quamvis fitfera, falutem

Fiat & hoc ipfo gratior ilia tibi. Sera quidem, fed vera fait, quam cafta rccepit ) 55

Hammefr

Icaris a lento Penelopeia viro.

ifc

Note entire top half out of line with bottom half. 17 pietatis] The spacing pieta tis occurs in all 1645 copies examined. 27 Philyreius] See 1645, p. 16, line 23, and note. Columbia note here is also wrong. Catchword Flammeus] In all 1645 copies examined, the last two letters us are badly smeared.

55 The faint spacer mark occurs at the end of this line in all copies examined. Catchword Aft] In less than a third of the copies examined is this word legible, and whenever it is, the ligature ft is tilted.

ELEGIA QUARTA — 1645

227

Aft ego quid vojui manifeftum tollere aimeri,

Ipfe quod ex omni parte levare nequit. Arguitu. tardus meritb, noximque fatetur,

Etpudet omcium deferuiffe fuum. Tu modo da veniam fafio, veniamque roganty

Criminadiminui, quae patuere, folent. Nonferus in pavidos rictus diducit hiantes,

Vulnifico prqnos nee rapit ungue leo. S*pe farifliferi crudelia pe&ora Thracis

Supplicis ad mceftas delicuere preces. Extenfacque manus avcrtunt fulminis ictus^,

Plaeat & iratos hoftia parva Deos. Jamque diu fo ipfifle tibi fuit impetus illi,j

Neve morar ultra ducere partus Amor. Nam vaga Fama refert, heu nuntia vera majorum !

In tibi fink} mis bella tumere locis, Teque tuamque urbem truculento militecingi.,

Ef jam Saxonicos arma parafle duces. Te circum late campos pqpjlatur Envo,

Et fata came virum jam cruor arva rigae. Germanifque fuum conceffit Thracia Martem,

Illuc Odryfios Mars pater egit equos. Pcrpetuo'que comans jam dsflorefcit o!;vaa

Fugit & arrifonajn Diva pcrofa tubara,

Fugk

Fugit io terris, & jam non ultima virgo

Creditur ad iliperas jufta volafle domos. Te taraen interea belli circumfonat horror, 6o Vivis & ignoto folus indpfque folo s

Et, tibi quam patrii non exhibuere penates

Sede peregrina quarris egenus opem. Patria dura parens, & faxis fxvior alLis

Spumea qua; pulfat littoris unda tui, 65 Skcinc te decet innocuos exponere fx tus,

Siccine in externam ferrea cogis humum, Et finis ut terris quacrant alimenta rcmotis

Quos tibi profpiciens miierat ipfe Deus, Et qui l*ta ferunt de carlo nuntia, quiquc 70 Qi}x via pott cineres ducat ad aftra, docent ?

Digna quidem Stygii quae vivas claufa tenebris,

JEternaque animx digna perire fame ! Haud aliter va<es terrar Thesbitidis olim

Preffit inaffueto devia tefqua pede, 75 Defertafque Arabum falebras, dum regis Achabi

EfFugitatque tuas, Sidoni dira, manus. Talis & horrifono laceratus membra flagello,

Paulus ab /Emathia pellitur urbe Cilix.

Pifcofique ipfum Gergeflae civis Jefuia'

80 Finibus ingratus juflit abirc luis .

»4

85

90

95

100

At

57 Aft] The word appears to be Aft in some copies, notably IU Spencer and British Museum E1126; but under magnifica- tion, the first letter in the ligature that in these two copies seems to be f proves to be f with something between it and the t that retained enough ink to print the inner bar of what looks like f. The type for this word was set as Aft and in no copy examined has the type been reset, regardless of what interjected itself between the f and t. 69 The faint spacer mark appears in all 1645 copies examined.

103 Jefum] All copies examined show at least one dot over the e and the Morgan and Folger copies show a diaeresis clearly. See 1645, p. 16, (//):23, and p. 20, (lV):2j. Columbia text and notes omit this. 104 ingratus] The s has dropped down in all 1645 copies examined.

228

POEMS BOTH ENGLISH AND LATIN — 1645

(*4)

At tu fume aminos, nee fpescadat anxia curls

Nee tua concutiat decolor offa metus. Sis eteni'-^ qnamvis fulgentibus obi'itus armi^

Iritententque tibi millia tela necjm , At nullis vel inerm« Iatus vioUbitur armis,^

Deque tuo cufpis nuHa cruore bibet. Namque eris ipfe Dei radiante Tub argide tutus,

1 lie tibi cuftos, & pugil ille tibi ; lj!e Siona?ae qui tot fub moenibus arcis

AfTy rios fudit node filente viros ; Inq'ie fugam vertit quos in Samaritidas oras

Mificab antiquis prifca Damafcus agris, Terruit & denfas pavidocum regecohortes,

Aere dum vacuo buccinaclara fonat, Cornea pulvt reum dum verberat ungnla camputn,

Currus arenoiam dum quatit actus humum, Auditurqut hinnitus cqu-->rum ad beila ruentiim,

Et ft epitus fern, tnu- mura^ue alta virion. Et tu (q^od fupereft miferi ) fperare memento,

Etta-' magnanimo pe&orevince mala. Ncc du bites quandoque frui melioribusannis, Atcrue itcrum patrios pofle videre lar<?5„

105

no

115

120

125

Elcgia quinta, Anno xtatis 20, In adventiwi verk.

IN fe perpetuo Tempus revolubile gyro Jam revocat Zephyros vere tepeote novoj. Induiturque brevem Tellus reparata juventam,

Jamque foluta gelu duke virefcit humus. Fallor ? an & nobis redeunt in carraina vires,

Ingeniumque mihi munere veris adeft ? Munere veris adeft, iterumque vigefcit ab illo

{Quis putet) atque aliquod jam fibi pofcit opus. Caftalis ante oculos, bifidumque cacumen oberrat,

Et mihi Pyrenen fomnia no&e ferunt. Concitaque arcano fervent mihi pe&ora mow,'

Et furor> & fonitus me facer intus agit. JDelius ipfe venit, video Peneide lauro

Implicitos crines, Delius ipfe venit. Jam mihi mens liquidi raptatur in ardua eceli,

Ferque vagas nubes corpore liber eo. Perque umbras, perque antra feror penetralia vaturn,

Et mihi fana patent interiora Deum. Intuirurque animus toto quid agatur Olympo,

Nee fugiunt oculos Tartara caeca meos.

10

15

'Quid

20

108 Note spacing between last word in line and comma at end of line; also at end of line 112 below. 109 latus] The same I for 1 as in 1645, p. 13, (/):4$- II2 Note spacing between last word and semi-colon at the end.

Note that second line of title is out of line in all copies examined.

ELEGIA QUINTA — 1645

229

(26)

Quid tarn grandc foftat diftento fpiricus ore i

Quid parit hare rabies, quid facer ifte furor » Ver mihi, quod dedit ingenium,cantabitur illo j | profuerint ifto reddita dona modo. Jam Philomela tuos foliis adoperta novellis

Inftituis modulos, dum filet omne nemus. Urbe ego, tu fy lv a fimul incipiamus utrique, '

Et fimul adventum veris uterque canat. Vcris io rediere vices, celebremus honores

Veris, & hoc tubeat Mula quotannis opus. Jam fol Mt iopas fugiens Titnomaque arva,

Elegit ad Ar&bas aurea lora plagas. Eft breve no&is iter, brevis eft mora noftis opacas

Horridacum tenebris exulatilla fuis. Jamquc Lycaonius plauftrum cselefte Bootes

Non longafequitur feflus ut ante via, Nunc etiam folitas circutn Jovis atria toto

Excubias agitant fydera rara polo. Nam dolus , & cxdes, & vis cum node reeefik,

Neve GiganteumDiitimHerefcelttS. Forte alquis fcopulirecubans in vertice paftors

R<- fa". 'a cum primo fole rubefcit humus, Hac ,sit. hac certe caruifti node puella

Phccbe tua, teleies quae retinerct equos,

Ixtt

(27)

Lsta fuas repetit fylvas, pharetramque refumic

Cynthia, Luciferas ut videtalta rotas, Et zenue? ponens radios gaudere vidctur

OfEcium fieri tam breve fratris ope. 25 Defere, Phoebus ait, thalamos Aurora feniles,

Quid juyat effosto procubuiffe toro ? Te manet bolides viridi venator in herba,

Surge, tuos ignes alcus Hymettus habet, Flava verecundo dea crimen in ore fatetur, 30 Etmatutinosocyus urgetequos.

Exuit invifam Tellus rediviva feneftam,

Et cupit amplexus Phoebe fubire tuos,- Et cupit, & digna eft, quid enim formofius ilia,

Pandit ut omniferos luxuriofa Anns, 35 Atque Arabum fpirat mefles, & ab ore venufto

Mitiacum Paphiisfundit amoma rolls. Ecce coronatur facro frons ardua Iuco,

Cingit ut Idaeam pinea turris Opina ; ' Et vario madidos intexit flore capillos,

40 Floribus & vifa eft pofle placere fuis.

Vloribus eflfulos ut erat redimita capillos

Taenario placuit diva Sicana Deo. Alpice Phoeoe tibi facilcs hortantur amores, Mellitafque movent flamina Yerna prcces.

45

50

55

60

65

Cinnamea

24 The spacer or lead mark at the left is in all copies examined.

31 ^thiopas] The h failed to take ink in all copies examined;

but the impression of the letter is clear in all copies.

39 dolus,] The comma shows a mark or impression in all copies

examined. It is not 'absent' as suggested by part of Columbia

note.

230

POEMS BOTH ENGLISH AND LATIN — 1645

Cinnamea Zephyrus leve plaudit odorifer al3,

Blanditiafque tibi ferre videntur aves. Nee Gr.e dote tuoi temeram quadt amores

Terra, nee optatos pofcit egena toros, Almafalutiferum medicos tibi gramen in ufus

Prsebet, & hinc titulos adjuvat ipfa tuos. Quod fi te pretium, fi te fulgentia tangunt

Muaera, (muneribusfajpecoemptus Amor) Ula tibi oftenwt quafcunque fub acquore vafto,

Et mpsrinje&is montibus abdit opes. Ah quoties curn tu Iivofo feffus O lympo

Invefpertinasprjccipitaris aquas, Curte,inquit,curfulanguentem Phoebe diurno

Hefperiis recipit Cserula mater aquis ? Quid tibi cum Tcthy ? Quid cum Tarteflide lytnphi,

Dia quidimmundo perluis ora falo ? Frigora Phoebe mea melius captabis in umbra,

Hue ades, ardentes imbue rore comas. Moliior cgelida veniet tibifomnus in herbs,

Hue ades, & gremio lumina pone meo. Quaque jaces circum mulcebit lenefufurrans

Aura per humentes corpora fufa rofas. Nee me (crede mihi) terrent Semeleia fata, NecPhaetonteo fumidus axis equo j

Cum

(19)

Cum tu Phoebe tuo fapientius uteris ign,7, 70 Hue ades & gremio lumina pone meo.

Sic Tellus lafciva fuos fufpirat amores j 95

Matris in exemplum cxtera turba ruunt. Nunc ctenim toto currit vagus orbe Cupido> Languentefque fovet folis ab igne faces. 75 Infonuere novis lethalia cornua nervis,

Trifle micant ferro tela corufca novo. 100

Jamque vel invidiam tentat fuperaflfe Dianam,

Qua?que fedet facro Vefta pudica foco. Ipfa fenefcentem reparat Venus annua formam, 80 Atque iterum tepido creditur orta mari.

Marmoreas jurenes clamant Hymenjee per urbes, T05

Littus io Hymen, & cava faxa fonant. Gultior ille venit tunicaque decentior apta, ',

Puniceum redolet vcftis odora crocum. 85 Egrediturque frequens ad amceni gaudia veru?

Virgineas auro cinfta puella finus. 1 10

Votum eft cuique fuum, votum eft tamen omnibus umraij

lit fibi quem cupiat, det Cytherea viium. Nuucquoque feptena modulatur arundine pafor, 90 Et fua quar jungat cat mina Phyllis habet.

Navita nofturno placat fua fy Jera cantu, 115

DelphinaSque leves ad vada fumma vocac.

ELEGIA QUINTA

ELEGIA SEXTA — 1645

231

Jupiter ipfe alto cum con juge ludit Olympic*,

Convocat & famulos ad fua fefta Deos. Nunc e tiam Satyri cum feracrepufcula furguntj

Pervolitant celeri florca rura choro, Sylvanufquefua Cyparifli frondc revin&us,

Semicaperque Deus, femideufque caper. Qusquefub arboribus Dryades latuere vetuflis

I'ti juga, per folos expatiantur agros. Per fata luxuriat fruticetaque Mamalius Pan,

Vix Cybele mater, vix fibi tuta Ceres, Atque aliquam cupidus praedatur Oreada Fauniis,

Confulit in trepidos dum fibi Nympha pedes, Jamque !atet, latitanfque cupit male tec"U videri,

Et fugit, & fugicns pervelit ipfa capi. Diiquoque non dubitant cslo prasponere fylvas?

E t fua quifque fibi numina luces habet. Etfuaquifque diu fibi numina Iucus habeto.

Nee vos arborea dii precor ite domo. Te refcrant mifcris te Jupiter aurea terris

Sxcla, quid ad nimbes afpera tela redis ? Tu faltera lente rapidos age Phoebe jugales

Quapotes, & fenlim tempora veris eant. Brumaque produclas tarde ferathhpida nobles,

Xngruat & noftro fcrior umbra polo.

Ei-jgis

Elegia fexta.

Ad Carolnm Diodatum ruri comma- I2° rant cm,

'£hti cum idibm Decemb. fcripfiffet^ fa fat carmim excuftri pofiu/ajfet ft felito minus effent bcnay quod inter lauutias quibm crat ah amicis exceptus^ hmdjatif feltctm epe~ 125 ram Mufis dare ft pe-Jfe affirmabat^ hum

habuit re/finfum.

MItto tibi fanam non pleno ventre falutem. Qua tu diftento forte carcre potes. At tua quid noftram prole&at Mufa camcenam, I3o Nee finit optatai poflefequi tenebras ?

Carmine feire velis quara te redamemque colamque,

Crede mihi vix hoc carmine fcire queas. Nam neque nofter amor modulis includitur ar£tis„ fict venit ad claudos integer ipfe pedes. J35 ^uam bene folcnnes epulas, hilaremque Decembrin* Felbqueccelifugam qua: coluere Deum, Peliciafque refers, hyberni gaudia ruris,

Hauftaque per lepidos Gallica mufta fbco3. Quid quereris refiigam vino dapibufque.poefin ?

140 Carmen amat Bacchum, Carmina Bacchus amat,

Nee

10

9 Decembrim] The last three letters are battered and crowded.

232

POEMS BOTH ENGLISH AND LATIN — 1645

Nee puduit Phocbum viriies geftaiTecorymbos.,

Atque hederam lauro prjepetuifTe fua?. Sicpius Aoniis clamavit collibus Euos

MiftaThyoneo curba novenachoro. Nafo Corallxis mala carmina mi (it ab agris :

Non illic epulae non fata vitis erat. Quid nifi vina, rofafquc racemiferumque Lyarum

Cantavic brevibus Teia Muia modis a Pindaricofque inflat numeros Teumefius Euan.

Etredolet fumptum pagina qua?que merum. Dum gravis everfo currus crepat axe lupinus,

Etvolat Eleo pulvcre fufcus eques. Quadrimoque madens Lyricen Romanus Jaccho

Dulce canit Glycerin, flavicomamque Chloen, Jam quoqne lauta tibi generofo menfa paratu.

Mentis alir vires, ingeniumque fovet. Mafllca foecundam defpumant pocula venatrij,

Fundis & ex ipfo condita metra cado. Addimus his artes, fufumque per intima Phcebum

Corda, favent uni Bacchus, Apollo, Ceres. Scilicet haud mirum tam dulcia carmina per te

Numine compofito tres peperifTe Deos. Nunc quoque Threfla tibi carlato barbitos auro

Infonat arguta raolliter i&a mann ; j

15

20

25

30

35

Audituraue

.(33; !

Auditurque chelys fufpenfa tapetia dream,

Virgineos tremull qua? regat arte pede*. 4°

Ilia tuas faltem terieant fpe&acula Mufas,

Et revocent, quantum crapula pellit iners, Crede mihi dum pfallit ebur, comitataqus plectrum

Implct odoratos fefta chorea tholos, Percipies taciturn per peclora ferpere Phoebum., 45

Quale rcpentinus permeat offa calor, Perque puellares oculosdigitumque fonantem

Irruet in totos lapfa Thalia linus. N.a;nqueElegia kvis multorum curia deorum eft,

Et vocat ad numeros quemlibet ilia fuos ; 5°

Liber adefteIegis,Eratoque, Cerefque, Venufque*

Et cum purpurea matre tenellus Amor. Talibus inde licent convivia larga poetis,

Sxpiuj & veteri commaduiire mero. At qui bella refert, & adulto fub Jove caelum, 55

Heroafque pios, femideofque duces, Et nunc fancla canit fuperum confulta deorum;

Nunc latrata fero regna profunda cane, Ille quidem parce Samii pro more magiftri

Vivat, & innocuos praebeat herba cibos j 60

Stet propefagineo pellucida lympha catillo,

Sobriaque e puro pocula fonte bibat.

C

22 modis'] There is no period under the top of the interroga- tion mark, as is also the case on p. 59 at the end of line 18.

48 firms.] Clearly thus in all copies examined. Columbia note is wrong, perhaps due to broken type in the particular copy used. See p. 22 and note on catchword. 62 puro] Columbia note reads puro but none of the twenty-eight copies examined shows any sign of an accent mark over the 0.

ELEGIA SEXTA

ELEGIA SEPTIMA — 1645

233

f34J

Additur huic fcderifque vacans, & cafta juventus,

Et rigidi mores, & fine labemanus. Q;iaHs veite nitens facra, & luftralibus undis 65

S»ygis ad infenfos augur itureDeos, Hoc ritu vixifle fcrunt poft rapta fagacem

Lumina Tirefian, Ogygiumque Linon, Etlare devoto profugum Calchanta, fenemque

Orpheon edomitis fola per antra feris ; 70

Sicdapis exiguus,fic rivi potor Homcrus

Dulichium vexit per freta longa virum, Et per monftrificam Perfeix Phoebados aulam,

Et vada foemineis infidiofa fonis, Perque tuas rex ime domos, ubi fanguine nigro

Dicitur umbrarum detinuifle greges. Diis etenim facer eft vates, divumque facerdo*,

Spirat & occultum pectus, & ora Jovem. At tu fiquid again, fcitabere (fi modb faltem

Efle putas tanti nofcere fiquid agam) Paciferum clnimus cjelefti femine regem,

Fauftaque facratis facula pacta libris, Vagitumque Dei, & ftabulantem paupere te$o

Qui fuprema fuo cum patre regna colit.

Stelliparumque poJum, moduhntefque xthere turma?, 85

Et fubitb elifos ad fua fana Deos.

Dona

75

80

(it)

Dona quidem dedimus Chrifii natalibus UI2.

Illa fub auroram lux mihi prima tulit. Tc quoque prefla manenc patriis meditata cicutis,

Tu mihi, cui rccitem, judicis inftar ens. 90

Elegia feptima, Annoxtatis undevigefimo.

NOndum blandatnas leges Amathufia noram, Et Paphio vacuum pectus ab igne fuit. Sxpecupidineas, pucrilia tela, fagittas,

Atque tuum fprevi maxime, numen, Amor. Th puer imbelles dixi rransfige columbas, 5

Conveniunt tenero mollia bella duci. Aut de pafleribus tumidos age, pirve> triumphos^, '

Haec funt militia? digna trophsea tux. In genus humanum quid inania dirigis arma ?

Non valet in fortes ifla pharetra viros. 10

Non tulit hoc Cypriu1;, (nequeenim Deus ullus ad im

Promptior) & duplici jam feru's igne cajet. Vcr erat, & fuming radians per culmina villa;

Attulerat primam lux tibi Maie diem : At mihi adhuc refugam quarrebant lumina nocten? 15

Ncc matutinura fuitinuere jubar.

C »

Adit

66 Surgis] Badly battered type in all 1645 copies examined. 82 facratis] The medial ra are badly battered in all copies examined, fsecula] The ae is a battered specimen of the peculiar ligature ae that is sometimes used in the 1645 edition.

234

POEMS BOTH ENGLISH AND LATIN — 1645

Aftat Amor le&o, pi&is Amor impiger alis,

Prodiditaftantem mota pharetraDeum : Prodidit & fades, & dulcc minantis ocelli,

Et quicquid puero, dignum & Amore fuit. Talis in cererno juvenis Sigeius Olympo

Mifcet amatori pocula plena Jovi ; Aut qui formofas pellexit ad ofcula nymphas'

Thiodamanta?us Naiade raptus Hylas ,- Addidcratque iras, fed & has decuiflc putares,

Addideratque truces, nee fine felle minas. Et mifer exemplo fapuiflfes tutiiis, inquit,

Nunc mea quid poflit dextera teftis eris. Inter & expertos vires numerabere noftras,

Et faciam vero per tua damna fidem. Ipfe egofi nefcis ftrato Pythonc fuperbum

Edomui phcebum, cefTit & ille mihi; Et quoties meminit Peneidos, ipfe fatetur

Certius & gravius tela nocere mea. Me nequit addu&um curvare peritius arcum,

Qui poft terga folet vincereParthus eques. Cydoniufque mihi cedit venator, & ille

Infcius uxori qui necis author erat. Eft etiam nobii iiigens quoque viclus Orion,

Herculexque manus, Herculcufque comes. J

20

25

30

35

Jupiwr

40

(37)

•Jupiter ipfe licet fua fulmma torqueat in me,

Hxrebuntlateri fpiculanoflra jovis. Cetera qua? dubitas melius mea tela docebunt,

Ettua non leviter corda petenda mihi. Nee te ftulte tux poterunt defendere Mufar,

Nectibi Phcebaus porriget anguis opera. Dixit, Sraurato quatiens mucrone fagittara,

Evolat in tepidos Cypridos ille finus. At mihi rifuro tonuitferus ore minaci,

Et mihi de puero non metus ullus erat. JEt modb qua noftri fpatiantur in urbe Quirites

Et modb villarum proxima rura placent . Turba frequens,facie'que fimillimaturba dearum

Splendida per medias itque reditque vias. Auftaqueluce dies gemino fulgore corufcat,

Fallor ? an & radios hinc quoque Phcebus habet. H^cego non fugi fpe&acula grata feverus,

Impetus &qub mefert juvenilis> agor, alumina luminibus male providus obvia mill,

Neve oculos potui continuilfe meos. Unam forte aliis fupereminuiffe notabam>

Principium noftri lux erat ilia rnali.

Sic Venus optaret mortalibus ipfa videri,

Sic rcgina Deum confpicienda fuit.

C 3

45

50

55

6o

Hanc

The page numbering (36)] The 6 is broken and has retained ink in its loop unless completely broken in all copies examined.

42 Haerebuntlateri ] There is no space, or too little space between these words in all copies examined.

ELEGIA SEPTIMA — 1645

235

ttacc memor objecit nobis malus ille Cupido,

Solus & hos nobis texuit ante dolos. Nee procul ipfe vafer Iatuit, multa-que fagittar,

Et facis a tergo grande pependit onus. Nee mora, nunc ciliis haefic, nunc virginis ori,

Infilit hinc labiis, infidet inde genis : Et quafcunque agilis partes jaculator oberrat,

Hei mihi, mille locis pectus inerme ferit. Trotinus infoliti fubierunt corda furores,

Uror amans intus, flammaque totus eram. Jnterea mifcro quar jam mihi fola placebat,

Ablata eft oculis non reditura meis. Aft egoprogredior tacitequerebundus, &excors,

Et dubius voluifa»pe referre pedem. Findor, & hxc remanet, fequitur pars altera votum

Raptaque tam fubitb gaudia flere juvat. Sicdoletamifliim proles Junoniaccelum,

Inter Lemniacos pracipitata focos. Talis & abreptum folem refpexit, ad Orcum

Veclus ab attonitis Amphiaraus equis. Quidfaciam infelix, & Iudu viclus, amores

Nee licet inceptos ponere,neve fequi. , O utinam fpeftarc femel mihi detur amatos , Vultus, & coram triftia verba loqui j

70

(19)

65 Forfltan Be duro non eft adamante creara,

Forte ncc ad noftras furdeat ilia preces. Crede mihi nullus fie infcltciter arfit,

Ponar in exemplo primus & unus ego. Parce precor tencri cum ils Deus ales amoris,

Pugnent officio nee tua facia tuo. jam tuus O ceite eft mihi formidabilis areas,

Nate dea, jaculis nee minus igne potens; Et tita fumabunt noftiis altaria donis,

Solus & in fuperis tu mihi fummus eris. Deme meos tandem, verum nee deme furores, 75 Nefcio cur, mifer eft fuaviter omnis amans : Tumododafacilis,poftha,c mea fiquafuturaefl,

Cufpis amaturos figat ut una duos.

80

85

Fotfican

H#c ego mente olim la?va,ftudioque fupino Nequitiar pofui vana trophaea mear. Scilicet abreptum fie me malus impulit error,

Indocilifque a?tas praya magiftra fuit. Donee Socraticos umbrofa Academia rivo>

Prxbuit^ admiflum dedocuitque jugum. Protinus extincKs ex illo tempore flammis, Cin&a rigent multo pe^tora noftra gelu. Unde fuis frigus metuit puer ipfeSagittis,

Et Diomedcam vim timet ipfa Venus.

C 4

90

95

100

Zx

10

Catchword In] The word is practically illegible in all copies examined.

236

POEMS BOTH ENGLISH AND LATIN — 1645

(4° J

In proditionem Bombardicam.

CVm fimul in regem nupcr fatrapafquc Brirannos Aufus csinfandum pcrfide Fauxe nefas, Fallor ? an & mitis voluifti ex parte yideri,

Etpenfare mala cum pietate fcelus ; Scilicet hos alti miliums ad atria cseli,

Sulphureo curru flammivolifque rotis.

Qualiter ille feris caput inviolabile Parcis

Liquic Jordanios turbine raptus agros.

In eandem.

SXccine tentafli cxlo donate Jacobum Qua? feptemgemino Bellua monte lates ? Mi meliora tuum poterit dare munera numen,

Parce precor donis infidiofa tuis. Ille quidem fine te confortia fcrus adivit

Aftra, nee inferni pulveris ufus ope. Sic pctius foedos in caelum pellecucullos,

Et quot habet brutos Roma profana Deos. Namque hacaut alia nifi quemque ad juveris arte,

Cred,e rnihi cdi vix bene fcandet iter.

(V) In eandem.

PUrgatorem aniina: derifit Jacobus ignem, Et fine quo f uperum non adeunda domus.

Frendiut hoc triua monftrum Latiale corona

Movit & horrificum cornua dena minax. Et necinultus ait temnes mea facra Britanne, 5 Supplicium fpreta relligione dabis.

Etfiitelligeras unquampenetraveris arces,

Non nifi per Mammas trifle patebit iter. O quam funefto cecinifti proxima vero,

Verbaque ponderibus vix caritura fuis I Nam prope Tartareo fublime rot3tus ab igni

Ibatad afthereas umbra perufta plagas.

In eandem.

QUem modb Roma fuis devoverat impia diris, Et Styge damnarat Tsenarioque finu, Hunc vice mutata jam tollere geftit ad aftra, Et cupit ad fuperos evehere ufque Deos.

In inventorem B&mbardrt*

io T Apetionidem laudayit cseca vetuftas,

10

In

J

Qui tulit whercam folis ab axe facem ;

At

In eandem. 8 Deos,] All copies examined show only a small dot, which under extreme (iooX) magnification is an oval with very rough outline. In all copies examined, the mark, what- ever it was intended for in the original printing, drops a little below the line of the bottom of the letters. The same apparently indeterminate mark appears at least twice in the Latin Poems; viz., on page 48, {In quint. Nov.):6o trahentes, and page 65, (Ad Pat.):T>5 orbes,. Neither of these occurrences is any more helpful than the other; but in the English Poems, page 1, (Nat. Ode) :6 release, occurs a punctuation mark that seems to settle the matter. If the top of the badly battered comma at the end of line 6 of Nat.Ode is broken off, the remaining bottom half is strikingly similar to the mark in the four references above. At any rate, the notes to these passages in the Columbia edition are misleading, and, if the mark is a broken comma, then all four Columbia notes to these passages are wrong.

AD LEONORAM— 1645

237

f4>;

At mihi major erit, qui Iurida creditur arma, • Ettrifidum fulmen furripuifle Jovi.

AdLconoram Rom* canentem.

ANgelus unicuique fuus (fie crcditc gentes), Obtigit aethereis ales ab ordinibus. Quid mirum ? Leonora tibi fi gloria major,

Nam tua praefentem vox fonat ipfa Deum. Aut Deus, aut vacui certe mens tertia cceli

Per tua fecretb guttura ferpitagens } Serpitagens,facilifque docet mortalia corda

Senfim immortali afluefcere poffe fono. Quod fi cunfta quidem Deus eft, per cun&aque fufus,

In teuna loquitur, caetera mutus habet.

Ad eandem.

; j. Ltera Torquatum cepit Leonora Poetam, j[\ Cujus ab infano ceffit amore furens. Ah mifer ille tuo quantb felicius xvo

Perditus, & propter te Leonora foret ! Et te Pieria fenfiflet voce canentem

Aurea maternae fila movcre lyra?, Quamvis Dirca-o torfiflfet lumina Pcnthco

Sxvior, aut totus defipuiif? t iners,

10

(41)

Tu tamen errantes carca vertigine fenfiis

Voce cadem poteras compofuiflc tua j Et poteras a?gro fpirans Tub corde quietem Flexanimo cantu rcftituifle iibi,

Ad eandem.

y^Redula quid liquidam Sirena Neapoli jadUs, ^-' Claraque Parthenopes fana Achelbiados, Littorearnque tua defun&am Naiada ripa

Corpora Chalcidico ficra dediffe rogo ? Ilia quidem vivitque, & amcena Tibridis unda

Mutavit rauci murmura Paufilipi. XUic Romuiidum ftudiis ornata fecundis,

Atque homines cantu detinetatqueDeos. '

Slegiamm Finis.

10

AliiA ^t||M ««U1A

Tu

238

POEMS BOTH ENGLISH AND LATIN — 1645

(44)

Syl

varum

Lib

er.

Anno aetatis 16. Inpbitum

Procancellarii medict.

PArere fati difcitelegibu% ManufqueParcar jam datefuppliccs, Qui pendulum telluris orbem Japeti colitis nepotes. Vos fi reli&o mors vagaTamaro Semel vocaritflebihV hcu mora: Tentantur incaflumdolique ; Per eenebras Stygis ire certum eft. Si deftinatam pellere dextera Mortem valeret, non ferus Hercules Nefli vcnenatus cruore iEmathia jacuififet Oeta. Nee fraude turpi Palladis invida? Vidiffetoccifum Ilion Heftora, aut Quern larva Pelidis peremit Ecfe Locro, Jove Iacrymante.

10

i5

Si

(V)

Si trifle fatum verba Hecateia Fugare pofTmr, Telegoni parens Vixifletinfamis, potentique iEgiali foror ufa virga. Numenque trinum fallere fi queant Artes medentum, ignotaque gramina, Non gnarus hcrbarum Machaoa Eurypyli cecidiflet hafta. Lxfiflbt & nee te Philyreie Sagitta echidna? perlita fanguine. Nee tela te fulmenque avitum Ca?fe puer genitricis alvo. Tuque O alumno major Apolline, Gentis togatae cui regimen datum, Frondofa quern nunc Girrha Iuger, Et mediis Helicon in undis. Jam prsfuiflfes Palladio gregi La?tuJ, fuperftes^nec fine gloria, Nee puppe luftraflfes Charontis Horribiles barathri receflus. At fila rupit Perfcphone tua Iraca, cum te viderit artibus Succoquc pollenti tot atns Fav-cjbus crijwifTe moms.

20

25

30

35

40

Colends

12 Oeta.] Apparently the ligature (E was a scarce article. Rider's Dictionary of 1659, though using ligatures regularly, prints all capital (E's as Oe. Few editors have succeeded in catching this, the Columbia being the first for many years to print it correctly. Masson, Moody, Wright, Beeching, and Grierson all missed it. See also 1645, p. 59:3, Naturam non pati senium.

IN QUINTUM NOVEMBRIS — 1645

239

Colendeprefes, membra precor tua Molli quiefcant cefpitc, 8c ex tuo Crefcant rofa% calthaeque buflo, Purpurcoque hyacinthus ore. ;: Sit mite de te judicium Aaci, Subrideatque iEtna?a Prolerpina* ' Interque felices perennis El) fio fpatiere campo.

In quintum Novembris, Anno aetatis 17.

T Am pius extrema1 veniens Jacobus ab arcto

Teuicrigenas populos, late'que patentia regna Albionum tenuit, jamque inviolabile fcedus Sceptra Caledoniisconjunxerat Anglica Scotis : Pacificufque novo felix divefque fedebat. In folio, occultique doli fecurus & hoftis : Cum ferus ignifluo regnans Acheronte tyrannus, Eumenidum pater, aethereo vagus exul Olympo, Forte per immenfum terrarum erraverat orbem, Dinumerans fceleris focios, vernafque fidelcs., Participes rcgni port funera motiu fuiaros j Hie tempefht.es medio cict acre diras,

45

10

illie

(A7) lllicunanimes odium ftiuit inter amicos,

Armat & invi&asin mutua vifcera gentes;

Regnaque olivifera vertit florentia pace,

Et quofcunque videt purs virtutis amantes,

Hos cupit adjicere imperio, fraudumque magifter

Tentat inacceffum fceleri corriimpere peclus,

Infidiafque locat tacitas,caflefque latentes

Tendit, ut incautos rapiat, feu Cafpia Tigris

Infequitur trepidamdeferta per avia prjedam

Node fub illuni, 8c fomno nictantibu-. aftrist

Talibus infeftat populos Summanus & urbes

Cindtus cacrulex fumanti turbine flammar.

Jamque fluentifonis albentia rupibus am

Apparent, & terra Deo dilecta marino,

Cui nomei? dederat quondam Neptunia proles

Amphitryoniaden qui non dubitavit atrpcem /Tiquore tranato furiali pofcere bello, Ante expugnatx crudelia fxcula Troiaf.

At fimul hanc opibufque & fefla pace beatam Afpicit, & pingucs donis Cerealibus agros, Quodque magis doluit, venerantem numina veri Sancla Dei populum, tandem fufpiria rupit Tartareos ignes & luridum olemia fulphur. Quaha Trinacria trux ab Jove claufus in ittna

15

20

25

30

35

Mat

36 ^)tna] In most, but not all copies examined, the letters tna are dropped down.

240

POEMS BOTH ENGLISH AND LATIN — 1645

r-

:)

Effiat tabifieo monftrofus ab ore TiphoeiK. Iracfcunt oculi, ftridetque adamantinus ordo Dentis, ut armorum fragor, iftaque cufpidc cufpis. Arque pererrato folum hoc laerymabile mundo Invent dixit, gens hzc mihi fola rebcllis, Concemtnxque jugi, noftraque potentior arte. Ilia tamen, mea fi quicquam tentaminapoflunt, Non ferct hoc impune diu, non ibit inulta, Hi&enus ; & picei's liquido natat aere pennis j Qiuvolat,adverfi pracurfant agmine venti, Denfantur nubes, & crebra tonitrua fulgent. Jamque pruinofas veloxfuperaverat alpes, Et tenet Aufoniar fines, a parte finiftra NimbiferAppenninus erat, prifcique Sabini, Dcxtra veneficiis infamis Hetruria, nee non • Te furtiva Tibris 1 hetidi videt ofcula dantem ; Hinc Mavortigenxconfiftitin arce Q]iinni* Heddiderant dubiam jam fera crcpufcula lucern, Cum circumgrediturtotam tricoronifer urbem; Panificofque Deos portat.fcapulifquevirorum Evehitur,praseunt fumEnifTo poplite rcges, £t mendicantum feries longifGrna fratritm ; Cereaque in manibus geftant funalia czd , Cimmcriis nati In tenebri^ vitamque tsahentcs,

40

45

50

55

6o

Tcmpla dein multis fubeunt lucentia txdlt

( Vcfpcr erat facer ifte Petro,) rremitufquecanentiMa

Sspe tholos implet vacuos, & inane Iocorum.

Qualiter cxululat Bromius, Bromiique caterva,

Orgia cantantes in Echionio Aracyntho, 65

Dum tremit attonitus vitreis Afopus in undi$i

Et procul ipfe cava refponfat rupe Cithxron*

His igitur tandem folenni moreperaclis, Nox fenis amplexus Ercbi taciturna reliquit, Prscipitefque impellit equos ftimulante flagelio; 7°

Captum oculis Typhlonta, Melanchxtemque feroeem, Atque Achcronta?o prognatam patre Siopen

Torpidam> & hirfutis horrentem Phrica capillis.

Interea regum domitor, Phlegetontius harres

Ingreditur thalamos (neque enim fecretus adulter 75

Producit fleriles molli fine pellice nocles)

A.t vix compofitos fomnus claudebat ocellos,

Cum niger umbrarum dominus, re&orque filentum, ■

Prauatorque hominum falsa fub imagine teftus

Ailitit, affiimptis micuerunt tempora canis, 80

Barba finus promifia tegit, cineracea longo

Syrmate verrit humum veftis, pendetque cucullus

Vertice de rafo, 8c ne quicquam defit ad artes,

Cannabeo Itimbos conftrinxit func falaces,

© Tarda

37 Tiphoeus.] All copies examined have the period. Columbia text omits the period and has no note. 60 trahentes,(?)] This is the same punctuation mark as was used in 1645, p. 40, In endem£>, p. 49, {In Quin. Nov.):&$ folaces, and p. 65, {Ad Pat.) orbes,.

84 falaces,] Most copies examined clearly have a comma here. But IU McLeish, Clark film copy, and perhaps one or two others are indeterminate.

1

IN QUINTUM NOVEMBRIS — 1645

241

(5Q) Tarda feneflratis figens vdtigia calceis, 85

Talis, uti fama eir,\a!U Francifcus ercmo Tetra vagabatur folus per Iuitra feraium, Sylveftrique tulit genti pia verba falutis Impius, atque lupos domuir. Lybicofqucleones.

SubdoJus at tali Serpens veiatus ami&u 9°

Solvit in has fallax ora execrantia voces ;' Donnis nate ? Etiam.ie tuos fopor opprimit arms Immemor O fidei, pecorumque cblite tuorum, Dum cathedram venerande tuam, diademaque tripled Ridet Hyperboreo gem barbara nata fub axe, 95

Dumque pharetrati fpernunt tua jura Briranni j Surge, age, lurge piger, Latius quem Csfar adorat, Cui referata patet convexi janua cx\i, Turgentes animos, & faftus frange procaces, SacriU gique fciant, tua quid maledi&io poflit, 100

Et quid Apoftolica* poffit cuftodia clavis ; Et memor Hefperia? dis je&am ulcifcere clafTem, Me/faque Iberorum lato vexilla prof undo, Santlorumque cruci tot corpora fixa probrofar, Thcrmodoontta nuper regnante puella. j i°5

At tu ft" tenero mavis torpefcere leclo Crefcentefque tiegas hoiti contundere vires, ■

Tyrrhcnum implebit numerofo miiite Pontum,

Signacue

($1)

Signaque Aventino ponet fulgentia colic :

Relliquias veterum f ranger, flammifque cremabit, Sacraque calcabit pedibus tua colla profanis, Cujus gaudebant foleis dare bafia reges. Nee tamen hunc bellis & aperto Marte laceffes, Initus ille labor, tu callidus utere fraude, Qua?libet hxreticis difponere retia fas eft 3

Tamauead confilium extremis rex macnus aboris Patricios vocat, & procerum de ftirpe creatos, Grandacyofque patres trabea, canifque verendos; Hos tu membratim poteris confpergere in auras, Atque dare in cineres, nitrati pulveris igne /Edibus injeclo, qua convenere, fub imis. Protinus ipfe igitur quofcumque habet Anglia fidd^ Propoflti, fa&ique mone., quifquamne tuorum Audebit fummi non juffa faceileiePapr. Perculfofque metu fubito, cafuque ftupentes Invadat vel Gallus atrox, vel faevus Iberu j. Sxcula fie illic tandem Mariana redibunr, Tuque in bclligeros iterum dominaberis Anglos. Et nequid rimeas, divos divafque fecundas Accipe, quotque tub celebrantur numina fafh's. Dixit & adfeitos ponens malefidus amicus Fugir ad infandam, regnum illxtabile, Lethf ri. ]

no

115

120

125

130

Tars

j 12 foleis] What is the mark over the i? Columbia notes say it is diaeresis; but in no copy examined can it be determined. Under 100X magnification, it is sprawling, but still one piece. It might be either- the smashed and battered dot over the i or it might be a battered diaeresis. If it is a diaeresis, it is the only such mark over an i in the 1645 edition. See p. 16, El. 11.22,; p. 20, El. IV:2j; p. 25, El. F:i3; p. 28, El. K:c)i ; (6i) p. 43, Ad eandem:2; p. 45:17. The evidence points toward i without diaeresis. 126 Iberus.] The s is dropped down in all copies examined.

242

POEMS BOTH ENGLISH AND LATIN — 1645

Jam rofea Eoas pandensTithonia portas Veftit inauratas rcdcunti lumine terras j Mxftaque adhuc nigri deplorans funera nati 135

Irrigat ambrofiis montana cacumina guttis ; Cum iomnos pepulit ftellatx- janitor aula: Noclurnos vifus, & (omnia grata revolvens.

Eft locus xterna feptus caligine no&is Vafta ruinofi quondam fundumina tefti, 140

Nunc torvi fpelunca Phoni, Prodotxque bilinguis Effcra quos uno peperit Difcordia partu. Hie inter cxmenta jacent femifractaqae faxa, Ofla inhumata virum, & trajecla cadavera ferro j Hie Dolus intortis Temper fedet ater ocellis, 145

Jurgiaque, & ftimulis armata Calumnia fauces, Et Furor, arque via? moriendi millevidentur! Et Timor, exanguifque locum circumvolat Horror, Perpetuoquc leves per mutafilentia Manes Exululant, tellus & fanguine confeia ftagnat, 150

Ipft etiam pavidi latitant ptnetralibns antri Et Phonos, & Prodotes, nulloque fcquente per antrum Antrum horrent, fcopulofum, atrum feralibus urabris Diffugiunt fontes, & retro lumina vortunt, Hos pugile's Rom* per fatcula longa fideles J55

Evocat antiftes Babylonius, atque ka fatur.

finibw*

Finibus occiduis circumfufum incolk squor Cens exofa mihi, prudens natura negavic Indignam penicus noltro conjungere mundo; Illuc, fie jubeo, celeri eontendite greffii, Tartareoque leves dirHenturpulverein auras Et rex & pariter fatrapa?, fcelerara propago Et quotquot fidei caluere cupidine vera; Confilii focios adhibete, operifque miniftros. Finierat, rigidicupide paruere gemelli.

Interea Ibngo fle&ens curvamine caelos Defpicit artherea dominus qui fulgarat arce, Vanaque perverfac ridet conamina turba?, Atque fui caufam populi volet ipfe tueri.

Efle fcrunt fpatium, qua diftac ab Afide terra Fsrtilis Europe, & fpe&at Mareotidas undas ; Hie turris pofita eft Titanidosardua Famae j£rea,Iata,fonans, rutilisvicinior aftrts Quam fuperimpofitum vel Athos vel Pelion Off* Mille fores aditufque patent, totidemque feneftrx, Amplaque per tenues tranflucent atria muros; Excitat hie varios plebs agglomerata fufurros ; Qualiter inftrepitant circum mulftralia bombfc Agmina mufcarum, auttexto per ovilia junco,

Dum Canis xftivum cceli petit ardua oilmen

P I

160

165

170

i75

Tpfa

180

150 Exululant,] See Professor Patterson's wise note in Columbia loc. cit. It is still possible, however, that the corrector failed to notice that 1673 reads Exululat, or that 1645 reads Exululant, and made the change directed in the errata without noting the other form in print. 153 horrens,] The s is small and

dropped in all copies examined.

168 turbae,] This ligature, with its a part reaching far above the level of its e, due either to its design or to a bend in the top of the a and more probably to its design, occurs several times in the 1645 edition.

IN QUINTUM NOVEMBRIS — 1645

243

Jpfa quidem fumma fedct ultrix matris in ai ce, Auribus iunumeris cin&um C3put emitict olli, Qucis fonitum exiguum trahir, atque leviffima capta; Miumura, ab extremis patuliconfinibus orbis, Ncc tot Ai iftoride iervator inique juvencoe Ifidos, immiti volvebas lumina vultu, Lumina non unquam tacito nutantia fomno, Lumina fubjeftas late fpc&antia terras. Iftis ilia folet loca luce carentia fepe Perluftrare, etiam radianti impervia foli. Millenifque Ioquax auditaque vifaque linguis Cuilibet effundit temeraria, veraque mendax Nunc minuit,modb confictis fermonibus auget. Sedtamen a noftro meruifti carmine laudes I-'ama, bonum quo non aliud veracius ullum, Nobis digna cani, nee te memorarTe pigebic Carmine tarn longo, fervati fcilicet Angli Officiis vaga diva tuis,tibi reddimus 2qua. Te Drus xternos motu qui temperat ignes, Vulmine pramiflb alloquitur, terraque trementc ; Faraa files ? an te Iatet impia Papiftarum Conjurata cohors in meoue meofque Britannos, Et nova feeptrigeroexdes meditata jacobo : ;v.c plura, ilia ftatim fenfzc mandata Tonantis,

185

190

195

200

f*5J Et fatis ante fug^x ftridentes induit alas, 205

Induit & varii> exilia corpora plumis ; Dextta tubam geftat Temefeo ex sere fonoram. Nee mora jam pennis cedentes remigat auras, Atque parum eft curfuceleres pravertere nubes, Jam ventos, jam folis equos port terga reliquit : '. 210

Et primb Angbacas folito de more per urbes Ambiguas voces, incertaque murmura fpargiti Mox arguta dolos, & deteftabile vulgat Proditionis opus, nee non facta horrida divSlu, Authorcfquc addit fceleris, nee gar rula caecis 2I5

Infidiis loca ftru&a filet ; ftupuere relatis, Et pariter juvenes, pariter tremuere puelljrf EfFaetique fenes pariter, tantaeque ruinae t Senfus ad xtatem fubito penetraverat omnem Attamen interea populi miferefcit ab alto 220

Athereus pater, & crudelibus obftitit aufis Papicoliim ; capti pcenas raptantur ad acres? At'pia thura Deo, & grati folvuntur honores j Compita lseta focis genialibus omnia fumant* Turba choros juvenilis agit : Quintoque Novembris 225

Nulla Dies toto occurrit eelebratior anno.

D4

Anno

Et

214 Proditionis] Columbia note is misleading, as this whole page is one of the brightest in 1645. Professor Patterson was doubtless misled by an accident to his particular copy of 1645, as no copy examined by the present editor exhibits smearing or bad printing of any part of this page.

244

POEMS BOTH ENGLISH AND LATIN — 1645

Anno aetatis 17, In obitum Praefulis fciieniis*

A

Dhuc madentes rore fqualebant gense.

Et ficca nondum luniina Adhuc liquentis imbre turgebant falis.

Quern nuper effiidi pius, Dum mifta charo jufta perfolvi roga

Wintonienfls prarfulis. Cum centilinguis Fama (proh Temper null

Cladifque veranuntia) Spargit per urbes divitis Britannia?,

Populofque Neptuno fatos, Ceflifle morti, & ferreis fororibas

Te generis humani decus, <Qui rexfacrorum ilia fuifti in infiila

Qua; nomen Anguilla? tenet. Tunc inquietum pe&us ira piotinus

Ebulliebat fervida, Tumulis potentem fxpe devovens deam :

Nee vota Mafo in I bids Coneepit altodiriora pe<5tor«, Graiufque vatcs parcii).s

10

15

20

(17)

TurpemLycatribis execratuseft dolurn,

Spouiamqne Neobokn fuam. At eccc diras ipfe dum fundo graves,

Et imorecor neci necem, AudirTe tales videor attonitus fonos

Leni, fub aura1, flamine : Cxcos furores pone, pone vitream

Bilemque & irritas minas. Quid temer& violas non nocenda numina,

Subitoque ad iras percita. Non eft, ut arbitraris elufus mifer,

Mors atra Noftis filia, Erebdve patre creta, five Erinnye,

Vaftove nata fub Chao : Alt ilia caelo milTa ftellato, Dei

Meffes ubique colligit j Animafque mole carnea reconditas

Inlucem & auras evocat : Ut cum fugaces excitant Horar diem

Themidos Jovifque filix ; Et fempiterni ducit ad vultus patris 3

At jnfta raptac impios Sub regna furvi luctuofa Tartari,

Sedcfque fubterraneas

. 7

25

30

35

40

1 urt>f its

Han*

1 ADhuc] The u throws up above other letters in all copies examined.

22 Sponfamqne] The mistaking of n for u occurs sometimes; but in this instance, the apparent n is actually an inverted u as may be seen under magnification of the letter. All copies examined show enough difference between n and u to determine that here the u was inverted. Columbia text silently emends with no mention in the notes.

IN OBITUM

NATURAM — 1645

245

f*8)

Hanc ut vocantem la?tus audivi, citb <

Fcedum reliquicarcerem, Volatilefque fauftus inter milites

Ad altra iublimis feror : Vates ut olim raptus ad ccelum fencs

Auriga curius ignei, Kon me Bobtis terruere lucidi

Sarraca tarda frigore, aut Formi doloil Scorpionis brachia,

Konenfis Orion tuus. Praetervolavi fulgidi folis globum,

Longeque fub pedibus deam Vidi triformem, dumcoercebat fuos

Framis draco nes aureis. Erraticorum fyderum per ordines^

Perla&easvehorplagas, Velocitatem faepe miratus novam,

Donee nitentes ad fores yentumeft Olympi, & regiam Cryftallinam, &

Stratum fmaragdis Atrium. Sed hie tacebo, nam quis effari queat

Oriundus humano patrc Amcenitates illiuslocl mihi

Sateflin sternum frm,

45

50

55

6o

65

Hxiuram

(59)

Naturam non pati fenmm.

Eu quam perpetuis erroribus acta fatifcit Avia mens hominum,tenebrifque immerfa profundi* Oedipodioniam volvit fub pectore no5tem ! Qux vefana fiiis metiri facta deorum Audet, & incifas leges adamante perenni Affimilare fuis, nulloque folubile faeclo Confilum fati perituris alligat horis.

Ergone marcefcet fulcantibus obfira rugis Nature facies, & rcrum publica mater Omniparum contracta uterum irerilefcet ab jevo ? Et fe faffa fenem male certis paffibus ibit Sidereum tremebunda caput ? num tetra vetuftas Annorumque xterna fames, fqualorque fitufque Sidera vexabunt ? an & infatiabile Tempus Efuiiec Caelum, rapietquein vifcera patrem ? Heu,potuitne faas imprudens Jupiter arces Hoc contra munifle nefas, & Temporis iilo Exemifle malo, gyrofque dedifTe perennes » Ergo erit ut quandoque fono dilapfa tremendo Convexi tabulata ;uant,atque obvius iclu Stridatuterque polus, fuperaque ut Olympius aula

Decidat, horribilifque retecta Gorgone Pallas.

Qualis

10

i5

20

62 nitentes] First n is dropped down in all copies examined.

3 Oedipodioniam] See p. 44:12 for note on capital Oe.

18 perennes'] Exactly the same interrogation mark, lacking

the dot, as on p. 32 El. VI.22.

246

POEMS BOTH ENGLISH AND LATIN — 1645

(€0)

Quatis in jEgxam proles Junonia Lemnon Deturbata facto cecidit de limine carli. Tu quoque Phoebe tui cafus imitabere nati Prxeipiti curru, fubitaque ferere ruina Tt onus, & extincla fumabit lampade Nereuj, Et dabit attonito feralia fibila ponto. Tunc etiam aerei divulfis fedibus Haemi Diflulcabit apex, imoque allifa barathro Terrebunt Stygium dejeda Ceraunia Ditem In fuperos quibus ufus erat, fraternaque bella. At Pater omnipotens fundatis fortius afttis Confulilitrerum fumm3e,cei toque peregiC Pondere fatorum lances, atque ordine fummo Singula perpetuum juflit fervare tenorem , Volvitur hinclapfu mundi rota prima diurno; Raptat, & ambitos focia vertigine cxlos. Tardior haud folito Saturnus, & acer ut olitrs Fulmineum rutilat criftata caffide Mayors. Floridus sternum Phoebus juvenile corufcat, Nee fovet effoetas loca per declivia terras DevexotemoneDeus ; fed femper amic* luce potens eadem currit per figna rotarum, Surgit odoratis pariter formofus ab Indis JEthereum pecusalbcntiquicogit Olympo

25

30

35

40

45

Mane

Mane vocans, & ferus agens in pafcua c*li,

Temporis &gemino difpertic regna colore.

Fulger, obitque vices alterno Delia cornu,

Cxruleumque ignem paribus complectitur ulnis. 50

Nee variant elementa fidem, folitoque fragore

Lurida perculfas jaculantur fulmina rupes.

Nee per inane furit levipri murmure Corus,

Stringit & armiferos jequali horrorc Gelonos

Trux Aquilo, fpiratque hyemem.nimbofque volutat. 55

Utque folet, Siculi diverberat ima Pelori

Kex marjs, & rauca circumftrepit aequora conchS

Oceani Tubicen,nec vaita mole minorem

.#.garona ferunt dorfo Balearica cete.

Sed ncque Terra tibi faecli vigor ille vetufti 60

Prifctis abeft, fervatque fuum NarciiTus odotem f

ft puer ille fuum tenet & puer ille decorem

Phcebe tuufque & Cypri tuus, nee ditior olim

Terra datum fceleri celavit montibus aurum

Confcia, vel fub aquis gemmas. Sic denique in arvutn 65

Ibitcun&arum feries juftiflima rerum,

Donee flarrma orbem populabitur ultima, late

Circumplexa polos, & vafti culmina cxli »

Ingentique rogo flagrabit machina mundi.

DE IDEA PLATONICA

AD PATREM— 1645

247

(62)

De Idea Flatonica quemadniodwti AriHuteles intellexit.

Dlcitc facrorum praefides nemorum dear, Tuque O noveni perbeata numinis Memeria mater, quyque in immenfo procul Antro recumbis otiofa ^Eternitas, Momimentafervans, <k ratas leges Jovis, Cxlique faftos atque ephemeridas Deum, Quis ille primus cujus ex imagine Natura follers finxit humanum genus, iEternus, incorruptus, squxvus polo, Unufque &univerfus, exemplar Dei ? Haud ille Palladis gemellus innub x Interna proles infidet mend Jovis ; Sed quamlibet natura fit communior, Tameh feorfus extat ad morem unius, Et, roira, certo ftringitur fpatio loci ; Seu fempiternus ille fyderum comes Caeli pcrerrat ordines decemplicis, Citimumve terris incolit Luna; globum : Sive inter animas corpus adituras feden£ Obliviofas torpct ad Lethes aquas : .

10

i5

Sive in rcmota1 forte terrarum plagl Incedit ingens hominis archetypus gigas, Et diis tremendus erigit celfum caput Atlante major portitore fyderum. Non cui profundum carcitas lumen dedit Dircaeus augur vidit hunc alto finu j Non hunc filenti no&e Pleiones nepos Vatum fagaci prarpes oftendit choro ; Non hunc facerdos novit Aflyrius, licec Longos vetufti commemorct atavos Nini> Prifcumque Belon/inclytumque Ofiridem. Non ille trino gloriofus nomine Ter magnus Hermes (ut fit arcani fckns) Talem reliquit Ifidis cultoribus. At tu perenne ruris Academi decus ( Hxc monftra fi tu primus induxti (cholis) Jam jam pbetasurbis exulcs tuae Kevocabis, ipfe fabulator maxrmus, Aut inftitutor ipfe migrabis faras.

Sh'e

20

N

Ad Patrew.

Unc mea Pierios cupiam perpeclora fontes Xniguas torquere vias, totumquc per ora

25

30

35

Volveri

Title, quemadmodum ] The final m is smashed in all copies examined. The second line is in smaller type. 7 imagine]

The e is out of line, above other letters. 11 innubae] The ae is spaced away from the b. 20 aquas :] The colon is spaced away from aquas but notice end spacing for lines II, 12, 15, 18, and 20.

De idea Plat. 27 Pleiones] Columbia note is misleading, as some copies show trace of left dot of diaeresis.

248

POEMS BOTH ENGLISH AND LATIN — 1645

Volvere Iasatum gemino de vertice rivum g Uc teoues oblita fonos audacibus alis Surgat in offlcium venerandi Mufa parentis. Hoc atcunque tibi gratum pater optime carmen Exiguum meditatur opus, »ec novimus ipfi Aptius a nobis quae poflint munera donis Refpondere tuis, quamvis nee maxima poflint Refpondere tuis, nedum ut par gratia donis Efle queat, vacuis qua? redditur arida verbis. Sed tamen ha?c noftros oftendit pagina cenfus, Et quod habemus opum charti numeravimus ifta J Qua: mihi funt nulla?, nifi quas dedit aurea Clio Quas mihi femoto fomni peperere fub antro* Et nemoris Iauretafacri Parnaflides umbrae;

Nectu vatis opus divinum defpice carmen. Quo nihil xthereos ortus, & lemina carli. Nil magis humanam eommendat origine mentem> Sandra Promethes retinens yeftigia flammae. Carmen amant fuperi, tremebundaque Tartara carmen Ima ciere valet, divofque ligare profundos, Ettriplici duros Manes adamant? coercet. Carmine fepofiti retegunt arcana futuri Phcebades, & tremula? pallentesora Sibylla? j Carmina facrificus folknnes pangit ad aras

10

15

20

25

Aurea

f*5)

Aurea feu fternit motantem cornua taurum j

Seu cum fata fagix fumantibus abdita fibris

Confulit, & tepidis Parcam fcrutatur in extij.

Nos etiam patriura tunc cum repetemus Olymptf m, 30

/EternrqUe mora? flabunt immobilis a?vi,

Ibimus auratis per caeli templa coronis,,

Dulciafuaviloquo fociantes carmina pleclro,

Aftra quibus, geminique poli convexa fonabuht;

Spiritus & rapidos qui circinat igneus orbes. 35

Nunc quoque fydereis intercinit ipfc choreis

Immortale melos, & inenarrabile carmen j

Torrida dum rutilus compefcit fibila ferpens,

Demiflbque ferox ghdio manfuefcit Orion 3

Stellarum nee fentit onus Maurufius Atlas. 40

Carmina regales epulas ornare l'olebant,

Cum nondum luxus, valteque immenfa vorago

Nota gula?, & modico fpumabatcoena Lyaeo.

Turn de more fedens fefta ad eonvivia vates

yEf.ulea intonfos redimitus ab arbore crines^ 45

Heroumque a&us, imitandaque geftacanebat,

Et chaos, & pofiti late fundamina mundi,

Reptantefque Deos, &alentcs numinaglandeSp.

Et nondum BLtnxo qurlitum fulmen ab antra,

Denique quid vocis modulamen inane juvabit, 50

£ Verborur*

5 offlcium] The ffl constitute a ligature of three letters. Co- lumbia silently emends text, and carries no note. Corrected in 1674, p. 65, to offlcium using triple ligature ffl. 6 utcunque] The first letter u is broken and smeared in all copies examined. 13 ifta] In most copies examined the circumflex is clear enough; but in the particular copy Professor Patterson used, as in some others, there is too little to go on, hence the needlessly confusing note in Columbia to this word. In all copies examined ifta is followed by a spacer mark.

35 orbes?] Another blob of ink, indeterminate, and may be either period or comma.

AD PATREM— 1645

249

(66)

Vcrbor um fenfufque vacans, numerique loquacis ? SiJveftres decet ifte choros, non Orphca cantus, Qui tenuit fliivios & quercubus addiditaures Carmine, non cithara, fimulachraque fun&a cancndo Compulit in lacry mas ; habct has a carmine laudes.

Nee tu perge precor facras contemnere Mufas, Nee vanas inopefque puta, quarum ipfe peritus Munere, mille fonos numeros componis ad aptos, Millibus & vocem modulis variare canoram Po&us, Arionii merit 6 fis nominis hxres. Nunc tibi quid mirum, fi me genuiiTe poetarrt Contigerit, charo fi tarn prope fanguine junfli Cognatas artes, ftudiumque affme fequamur : Ipfe volens Phoebus fe difpertire duobus. Altera dona mihi, dedit altera dona parenti, PividuumqiieDeum genitorquepuerque tenemus,

Tu tamen ut fimules teneras odilfe camcenas, Non odifle reor, neque enim, pater, ire jubebas Qua via lata patet, qua pronior area Iucri, Certaque condendi fulget fpes aurea nummi ; Ncc rapis ad leges, male cuftoditaque gentis Jura, nee inftflfis damnas clamoribus aures. Sed magisexcultam cupiens ditefcere menteffJf Me proeul uibano ftrepim, feceffibus altis

Ab«

(*7) Abduftum Aoniar jucunda per otia rpas-

Phoebaeo lateri comitem finis ire bcatum.

Orficiumchari tacco commune parentis,

Me pofcunt majora, tuo pater optime fiimptu

55 Cum mihi Romulea? par uit fac;ndia lingua?, Et tatii veneres, & qua: Joyis ora deccbant Grandia magiuloquis elata vocabula Graiis, Addere fuafiiti quos jaclac Gallia flores, Et quam degeneri novus Italus ore loquchm

60 Fundit, Barbaricos tefhtus voce tumulus, Quarque Palatftinus loquitur myfleria vate , Denique quicquid habct cxlum, fubjcdlaquc coslo Terra parens, terrarque & coelo interfluus aer, Quicquid & unda tegir, pontique agitabile marmofy Per te nofle licet, per te, fi nolte libebit. Dimotaque venitfpe&anda fcientia nube, Nudaque confpicuos inclinat ad ofcula vukus, Ni fugilTe velim, ni fit libafle raoleftum.

I nunc, confer opes quifquis malefanus avitas Auftriaci gazas, Peruanaque regna prxopeas. Qua? potuit majora pater tribuiiTe, vel ipfe Jupiter, excepto.dooaiTet ut omnia, coelo* Non potiora dedit, quamvis & tuta fuiffenf,

65

70

Publka qui juveni commifit lumina nato

75

8o

85

90

95

Atq«

58 Munere,] Columbia text is correct; but the note on this word creates a ghost reading. Both 1645 and 1673 read Munere, Professor Patterson probably having been trapped by the resem- blance between some of the t's and r's used in both editions. All copies examined read Munere, here. 7iff.] Note different

alignment of lines beginning with 71.

85 vate .] All copies examined are as above, seemingly lack- ing the s except IU Maggs (Christ's College); Boston Public 3. 4178. 14; Harvard 14485.11; and Morgan 961 restored with pen and ink. These four copies show enough of the s to make it cer- tain that it was set in the 1645 printing, and all copies examined have space for it. Catchword Atque] In some copies, this word is clear enough; but in others it is so badly smeared that it can- not be read. See especially, IU Spencer.

250

POEMS BOTH ENGLISH AND LATIN — 1645

Atque HypcrionioJ currus,& frarna diei, Et circum undantem radiata lace tiarara. Ergo ego jam dofts pars quamlibet ima catervae Varices hcdcras inter, laurofque fedebo, Jamque nee obfeurus populo milccbor inerti, Vitabuntque oculos veftigia noftra profano*. Efte procul vigiles curar, procul efte querela:, Invidiacque acies tranfverfo tortilis hirquo, Sarva nee anguiferos extende Calumnia ridus; In me trifle nihil faediffima turba poteftis, Nee veftri fiim juris ego j fecuraque tutus Pe&ora, vipereo gradiar fublirais ab i&u»

At tibi, chare pater, poftquam noa aequa merenti Pofle referre datur, nee dona rependerefa&is, Sit memorafle fatis, repetitaque munera grato Pcrccnfere animo, fidatque reponere menti.

Et vos, O noftri, juvenilia carmina, lufus, " Si modo perpetuos fperare audebitis annos, Et domini fuperefle rogo, lucemque tueri, Nee fpiffo rapient oblivia nigra fub Orco> forfitan haslaudes, decantatumque parentis ^omen, ad exemplum, kto fervabitis jeyo.

—

IOC

105

no

"5

120

ffulm

(<9)

Tfalm 114.

I2£jt«\ 071 nmJlS) oV £y*«A ftth' hucaC*

A» t&ti jv&vov ttiv taw ycv@- ifii l*Jk* £r A Qtot Main ^Myn. xpefow fituritevir* lite *) irr&mhn pvyaf' Vfiattn b*\*fo% Kyfuin iiKufAfn potty, e^'af* isvp&ijS* ?&f I'op«/kV»p mtn tLpy)£p§tJ$* 7myfo* Ex. £' *>$$*• <nuufiyj>my (tTmpina, tkortovn*

Bet/97!£$(t cA* apa. -mam ctvaflxipTWw epmsut

o7* 7ra£$t ox/ptyjt pfo? Cm wmex etpvu.

Tirfi cvy Atpat QiltLffm vnKap pJyetJl* fyf»nattSt

Y&S Uf/dvif at77 <t?)Vg<)H8i& myw i Tin}' opficfc O3tap0fjwiw awwpswa xxovUefa Stf xpih ffQpiyoomf «i/»ya?>spS If dhan ', TLiu<me&i ti «a' ey* vpf*s *Vow*/p7jpwr' «fiW«»

Xuio y£i* TfVim %th i&tyt\' Ik-juvwt* T<U(t, fleer Tgiiw vm.-m c'iQmi I'tsuyJJk*

£ j Pbilofofbzt

10

15

20

22 The third word is made up of battered and over-inked letters in all copies examined.

PHILOSOPUS

AD SALSILLUM— 1645

251

ft*)

fhihf$phus ad regent quendam qui

' ewn tgmtum & in font em inter reesfr? te cap-

tttm infciw damnAverat , nr in ^fftiiu

if»f€uo/«p^ bdc fubhp miftt. '

fi £v& ei otifftit fU TtV ivvo[Mti iJi w avJjuSf £ktiVov ohai <fydumrnt> opetmw J'aJx igtf^rojr

f ■ "I 1 • J

l{&]. ZvTUi Jl'tXf 6774ln« %}lB> fWM* WDMJe oJ^i*

t

Ad SalfiUnm poetam Komannm agrotantem.

SCAZONTIS.

OMufa grefllim quae voiens trahis claudum, Vulcanioque tarda gaudes inceffu, Nee fentis illud in loco minus gratum, C^uam cum decentes flava Deiope furas Alternat aureum ante Junonis ledum. Adefdum & hxc sis verba pauca SalGIlo Refer, camoena noftra cui tantum eft cord*, Quamque ille magnis prxtulit immeritb divis. Haec ergo alumnus ille Londini Milto, Diebus hifce qai fuum linquens nidum Polique tracTum, (peflGmus ubi ventorum,

In&meffiis impotenfque pulmonis

Pernix

10

Pernix anhela tub Jove exercet ffabra^ Venit feraces Itali foli ad glebas, Vifum fuperba cognitas urbes fama Virofque dodteque indolem juventutis, Tibi optat idem hie faufta multa Salfille, Habitumque feflb corpori penitus faoum; Cui nunc profunda bills infcllat renes, Praecordiifque flxa damnofum fpirat. Nee id pepercit imp ia quod tu Romano Tamcultus ore Lesbium condis melos. O dulce divum munus, Qfalus Hebes Germana ! T uque Phoebe morborum terror Pythonecjefo, five tu magis P*an Libenrer audis, hie tuns facerdos eft. Querceta Fauni, Yofque tore vinofb Colles benigni, mitis Euandri fedes, Siqvid falubre vallibus frondet veftris, Levamen atgro ferte certatim vati. Sic ille charts redditus rurfum Mulls Vicina duki prata mulcebit cantu. Ipfe inter atros emirabitur Iucos Numa, ubi beatum degie otiam arternum, Suam reclivis Temper Ageriam fpeSans. Tumidufque & ipfe Tibris hinc delininiS Spei favtbit annuar colonorum :

i5

20

25

30

35

K«i

252

POEMS BOTH ENGLISH AND LATIN — 1645

(7>)

Nee in fepukhris ibit obfeffum reges

Nimiumfiniftro laxus irruensloro : Sed fraena melius temperabic undarurq, Adufque curvi falfa regna Portumni.

Manfus.

Joannes Baptisld Man fits MatcUx) V'tllcnjis vlr ingenii laudes turn literaxum ftudio, nee von & be/liea virtute apud [tabs cUrus in primis eft. Adqttem Torquati 1 c.ffi dUlogus extdt de Ami- cit'ta fcriptm ; erat enim Taffi amicijfimpts ; ab quo etiam inter Campanix principes celebrutur, inillopoemate cm titulus Gerufalcmme con- quiftata, lib. so.

Fra cavalier magnanimi3 e cortefl Rifplende il Manfo .

Is authorem Neapoii commorantem fumma benevo- lentik profcemtu eft9 multaqm ei detain huma- mtatuofpeia. Ad hum itaqne. bojpes Ule attc- qttam ab ea, urbe difcederet, ut ne ingratum fe ofienderety hoc carmen mijit*

H-fccquoque Manfe tux meditaneur carmina laudi Pierides, tibi Manfe chor onotiflime Phcebi, Quandoquidern ille ah'um haud xquo eft dignatus honore Poft Galli cineres, & Mccsnatis Hetrufci. Tti quoque fi noftnetantum valet aura Camoena% v iclriccs hedcras inter, laurofque fedebis.

Te

40

(73) Te pridem magr.o fclixconcordia Taffb i Junxit, & xterais inferiprtt nomina chartis. Mcx tibi dulciloquum non infeia Mufa Marinum .'■* Tradidit, iile tuum did fe gaudet alumnum, io

Dum canit Afiyrios diviim prolixus amores ;

Mollis & Aufonias ftupefecit carmine nymphas,

Ille itidem moriens tibi foli debita vates

OfTa tibi foli, fupremaque vota reliquit.

Nee manes pietas tua chara fefellit amici, 15

Vidimus arridentem operofo ex arre poetam.

Nee fatis hoc vifum eft in utrumque, & nee pia ceflant_

Officia in tumulo, cupis integros rapere Oreo,

Qua p©tes, atque avidas Parcarum eludere leges ;

Amborum genus, &Yariafub forte peradlara 20

Defcribis vitam, morefque, & dona Minerva? j

iEmulus illius Mycalen qui rtatus ad altam

Rettulit /Eolii vitam faeundus Homeri.

Ergo ego te Clius & magni nomine Phoebi

Manfe pater, jubeo longum falvere per a»vum 25

Miflus Hyperboreo juvenis peregrinus ab axe.

Nee tu longinquam bonus afpernabere Mufams

Quae nuper gelida vix enutritafub Arfto

Imprudens Italas aufa eft volitare per urbes.

Nos ctiam in noftro modulantcs flumin? cygnos o 3°

Credimui*

Mansus. 4 of introduction dialogus] The upright of the d is bent in all copies examined. 3 honore 1 So below in all copies examined. 'J

7 There is an ink mark at the end of this line in all copies examined. 9 There is an ink mark at the end of this line in all copies examined. 19 potes, ] The o is broken in all copies examined. 28 gelida] The note in Columbia is misleading. All copies examined clearly use a circumflex, in some copies badly mutilated, but still discernible as a circumflex. Catch- word Credimuis] The word Credimus properly spelled on the following page, is misspelled as a catchword in all copies examined.

MANSUS — 1645

253

(74) fcredimus obfcuras aoCtis fenfifTe psr umbrae

Qgi Thamefiilate puiis argenteus urnis Qceani glaucos perfundic gurgite ci ines. Quin & in has quondam pervenic Tityrus eras. Scd neque nos genus incultum, nee inutile Phoebo^ Qua plaga fepteno mundi fulcata Trione Brumalem patitur longa fub node Boocen. Nos etiam colimus Phcebum, nos munera Phccbo Ilaventes (picas, & lutea mala caniflris, Halantemque crocum (perhibet nift vana vetuftas) Mifimus, & le&as Druidum de gente choreas. ( Gens Druides antiqua facris operata deorum Heroum Iaudes imitandaque gefta canebant) Hinc quotiesfefto cingunt altaria canta Delo in herbosa Graise dc more puellae Carminibus laetis memorant Corincida LoXQ, Fatidicamque Upin, cum flavicoma Hecacrge Kuda Caledonio variatas peftorafuco. Fortunate fenex, ergo quacunque per orbem Torquati decus, & nomen celcbrabitur ingens, Claraquc perpetui fuccrefcet fema Marini, Tuquoque in ora frequens venies plaufumque virorum, Etparili carpes iter immortale volatu.

Dicetur turn fponte tuos habitaffe penates

Cyntbms,

(75 J

Cynthius, & famulas venifTe ad limina Mufas s

At non fponte domum tamen idem, & regis adivic Kara Pneretiadaecaelo fugitivus Apollo * Jlle hcet magnum Alciden fufecperat hofpes {

35 Tantum ubi clamofos placuit vitare bubulcot, Nobile manfueti ceflic Chironis in antrum, Irriguos inter faltus frondofaque tecla Pccciumproperivum : ibifarpefubilice nigrl AJ cUharx ftrepitum blanda prece vi&usamici

40 Exiki duros lenibat voce labores.

Turn neqwe u'pafuo, barathro nee fixa fub irao, Saxa ftetere loco, nutat Trachinia rupe*, Nee fentit folitas, immania pondera, ftlvas, Emotarque fuis properant de collibus orni,

45 Mulcenturque novo maculofi carmine lynces. Diis dile&e fenex, te Jupiter aequusoportet Nafcentem, & miti luftrarit lumine Phoebus, Atlantifque nepos j neque enim nifi charus ab orw Diis fuperis potent magno favifle poetr.

50 Hinc longa;va tibi lento fub flore fcne&us Vcrnat, & -fcfonios lucratur vivida fulbs, Nondum deciduos fervanstibi frontis honored, Ingeniumque vigens, & adultum mentis acumen O mihi fi mcafors talera concedatamicuia

55

60

65

70

75

Phopbarot

46 Corineida] The diaeresis is clear in several copies examined, and at least one dot shows in every copy examined. This misled Professor Patterson into calling the accent mark a grave one.

254

POEMS BOTH ENGLISH AND LATIN — 1645

Phosbacosdecoraflfe viros qui tarn bene norir, Siquandoindigenas revocabo incarmina reges, Arturumqueetiamfub tern's bella moventem ; Aut dicam invi&a: fociali foedere menfar, MagnanimosHeroas, & (O modo fpiritus ad fit) Frangam Saxonicas Britonum fub Marte phalanges. Tandem ubi non tacitar permenfus tempora vitx, Annorumque fatur cineri lira jura relinquam, Ille mihi leclo madidis aftaret ocellis, Aftanti fat erit ii dicam fim tibi curx; llle meos artus liventi morte folutos Curaret parva componi molliter urna. Forfitan & noftros ducat de marmore vultus, Ne&ens aut Paphia myrti aut Parnaffide lauri Fronde comas, at ego fecura pacequiefcam. Turn quoque, 11 qua fides, fi prjemia certa bonorum, Ipfe ego cselicolum femotus in xthera divum, Quo labor & mens pura vehunt, atque ignea virtus Secreti haec aliqua mundi de parte videbo (Quantum fata finunt) & tota mente ferenum Ridenspurpureo fufHindar lumine niltus Ft fimul aethereo plaudam mihi laetus Olympo.

80

85

90

95

100

Epitaphium

(77J

mBhhhh mmm mmmM

EPITAPHIUM

DAMONIS.

Arg u m entum.

THyrfis ck Damon ejufdem vicinia* Paftores., eadem ftudia fequuti a pueritia amici erant, ut qui pluri- mum. Thyrfis animi cam& pro- fe&us peregiedc obitu Damonis nuncium accepit. Domum poftea reverfus, St rem ita efTe comperto, fe, fuarrsque folitudi- nem hoc carmine deplorat. Damonis autem fub perfonahic intelligitur Carolus Deodatus ex urbe Hetrurise Luca paterno genere oriundus, cetera Anglus } ingenio, doctrina., clariffimifque ceteris virtutibus., dum viveietj juvenis egregius.

Epitaphium

10

83 ad fit) ] Columbia text prints adsit) and has no note. 100 plaudam] The d has a bent upright in all copies examined.

Title EPITAPHIUM/] The U is an inverted n as in the type font being used, as in most roman fonts, there is no serif on the inner side of the top of the left hand vertical stroke of the U whereas there is always a serif on the inner side of the bottom of the right hand descending line of the n. DAMONIS.] The period is above the line of the type in all copies examined. ARGUMENTUM.] Both U's are inverted n's as in EPITAPHIUM above.

EPITAPHIUM DAMONIS— 1645

255

(7*)

■ wWO »WO Jim*

S^» f&& <W5 <*M **» flfi *«•» *•*"■•»

2& <&£«*& gs^ 21 <S tf£

J^*V« ^/T*W vfVV w

; EPITAPHIUM

DAMONIS.

Hpnerides nympha? (nam vos & Daphnin & Hy- Ec plorata diu meminiftis fata Bionis) (Ian Dicitc Sicelicum Thamefina per oppida carmen: Quas mifer efFudit voces , guar murmura T hyrfis, Ec quibus affiduis exercuit antra querelis, Fluminaque, fontefque vagos, ncmorumque receflus, Dum fibi prsereptum queritur Damona, neque alMni Luctibusexemit noclem loca Tola pererrans. £t jam bis viridi furgebat culmus arifta, Et totidem flavas numerabanc horrea meffes, Ex quo fumma dies tulerac Damona fub umbras, Ncc dum aderat Thyrfis ; paftorem fcilicet ilium Dulcis amor Mufae Thufca retinebat in urbe. Aft ubi mens expleta domum, pecorifque relicli Cura vocac, fimul altueta feditque fub ulmo.

Turn vero amifium turn denique fentic amicutri,

Ccepic

10

i5

(79)

Ccepit & immenfumfic exonerare dolorem.

Ite domum impafti, domino jam non vacat, agui. Hei mihi ! qua? terris, quae dicam numina coelo, Poftquam te immiti rapueruntfunere Damon ; Siccine noslinquis, tua fie fine nomine virtus Ibit, &r obfeuris numero fociabitur umbris f At non ille, animas virga qui dividit aurea,' Ilia velit, dignumque tui te ducat in agmen, Ignavumque procul pecus arceat omne filentunt,

Ite domum impafti, domino jam non vacat, agni, Quicquid erit, certe nifi me lupus ante videbit, Indeplorato non comminuere fepu'.cro, Conftabirque tuus tibi honos, longumque yigebtf Inter paftores : lllitibivotafecundo > Solvere poft Daphnin, port Daphnin dicere landes <5audebunt, dum rura Pales, dum Faunus amabit : Si quia id eft, prifcamque fidem coluifle, piumque^' Palladiafque artes, fociumque habuilFe canorum.

Ite domum impafti, domino jam non vacat, agni. Hxc tibi certa manent, tibi eruut hare prxmia Damon* Atmihiquid tandem fiet modo ? quis mihi fidus Hacrebit lateri comes, ut tu fa?pe folcbas Frigoribus duris, & per loca foeta prawns,1 Auc rapido fub fole,fiti morientibus herbis ?

20

25

30

35

40

Sive

i Hy

Hy-"| (Ian J So in all copies examined. 6 Fluminaque,] The first

u is broken and smeared in some copies; but clear in others.

The page number] The 7, the 9, and the second parenthesis are all broken in all copies examined.

256

POEMS BOTH ENGLISH AND LATIN — 1645

(to)

Sive opus In magnos fuit eminus ire leoncs Aut avidos terrere lupos prafepibus altis ; Quis fando fopire diem, cantuque folebit ?

Ite domum impafti, domino jam non vacat, agni. Pe&ora cui credam ? quis me lenire docebit 45

Mordaces curas, qui* longam fallere no&em Dulcibusalloquiis, grato cumfibilat igni Mollc pyram, & nucibus ftrepitat focus, at malus auftcr Mifcet cuntta foris, & defuper intonat ulmo.

Ite domum impafti, domino jam non vacat, agni. 50

Aut aeftate, dies medio dum vertitur axe, Cum Pan aefculea fomnum capit abditus umbra, Et repetunt fub aquis ilbi nota fedilia nympha:. Paftorefque latent, ftertit fub fepe colonus, Quis mihi blanditiafque tuas, quis turn mihi rifus, 55

Cecropiofque fales referet, cultofque lepores ?

Ite domum impafti, domino jam non vacat, agni At jam folus agros, jam pafcua folus oberro, Sicubi ramofx denfantur vallibus umbr.-c, Hie ferum expe&o, fupra caput imber & Eurus 60

Trifte fonant, fradteque agitata crepufcula filv£.

Ite domuro. impafti,domino jam non vacat, agni.

Heu quam culta mihi prius arva procacibus herbis

Involvuntur. & ipfa iitu feges alta fatifcit I

Innubi

f«I>

Innuba negle&o marcefcit & uva racemo, 65

Nee myrteta juvant ; ovium quoque ta»det, at ill* M cerent j, inque fuum convertunt ora magiftrum.

Ite domura impafti, domino jam non vacat, agni. Tityrusad corylos vocat, Alphefibceus ad ornos, Ad falices Aegon, ad flumina pulcher Amyntas, 70

Hie gelidi fontes, hie illita gramina mufco, Hie Zephyri,hic placidas interftrepit arbutus undas ; Ifta canunt furdo, frutices ego naclus abibam.

Ite domum impafti, domino jam non vacat, agni. Mopfus ad hxc, nam me redeuntem forte notarat 75

CEt callebat avium linguas, & fydera Mopfus) Thyrfi quid hoc ? dixit, qua: te coquit improba bill's ? Aut teperdit amor, aut te male fafcinat aftrum, Satutni grave farpe fuitpaftoribus aftrum, Intimaque obliquo figit praecordia plumbo. 80

Ite domum impafti, domino jam non vacat, agni. Mirantur nymphar, & quid te Thyrfi futurum eft ? Quid tibi vis J ajunt, non hare folet efle juventas Nubila frons, oculique truces, vultufque feveri, Ilia choros, lufufque leves, & femper amorem 85

Jure petit, bis ille mifer qui ferus amavit.

Ite domum impafti, domino jam non vacat, agni.

Venit Hyas,Dryope'que, & filia Baucidis Aegle

F Do £U

70 Aegon,] Note the initial Ae not M although the ligature is more common throughout. 83 vis'] The same dot-less inter- rogation mark encountered before, and so in all copies examined. 88 Aegle] Note the initial Ae again.

EPITAPHIUM DAMONIS— 1645

257

Doifta modos, citharaeque fciens, fed perdita faflii, Venit Idumanii Chloris vicina fluenti ; Nilmeblanditf-e, nil nie folantia verb,a, Nil me, fi quid adeft, mover, aut fpes ulla futuri.

Ite domum imparti, domino jam non vacat, agni. Hei mihi quam flmiles ludunt per prata juvenci, Omnes unanimi fecum flbi lege fod ales, Nee magis hunc alio quifquam fecernit amicum De grege, fie denfi veniunt ad pabula thoes, Inque vicem hirfuti paribus junguntur onagri; Lex eadem pelagi, deferto in litrore Proteus AgminaPhocarum numerat, vilifque volucrum Paffer habet femper quicum fit, & omnia circum Farra libens volitet, fero fua te&a revifens, Quem fi fors lerho objecit, feu milvus adunco Fatatulit roftrp, feu ftravitarundine foiTor, Protinusille aliumfocio petit inde volatu. Nos durum genus, &diris exercita fatis Gens homines aliena animis, & pectore dilcors, Vix flbi quifque parem de millibus invenit unum, Aut fi fors dederit tandem non afpera votis, Ilium inopina dies qua non fperaveris horl Surripit, xternum lincuens in faecula damnum,

Ite domum impafti, domino jam non vacar, agni.

90

95

100

105

no

Ken

Heu quis me ignota? traxit vagus error in oras

Ire per ae'reas rupes, Alpemque nivoiam !

Fxqiiid erat tanti Romam vidifle fepultam ? 115

Quamvis ilia foret, qualem dum viferet olim,

Tityrus ipfe fuas &: oves & rura reliquit j

Ut te tarn dulci poiTem caruiiTe fodale;

PoiTem tot maria alta, tot interponere monies,

Tot fy Ivas, tot faxa tibi, fiuviofque fonantes. 120

Ah certe extremum licuiffet tangere dexuam,

lit bene compofitos placide morientis ocello?,

Et dixiiTe vale, noftri memor ibis ad alba.

Jte domum iinpafti, domino jam non vacar, agni.

Quamquam etiam veftri nunquam meminilTe pigebit *; 125

Paftores Thufci, Mufis operata juventus,

tiic Cruris, atque Lepos ; & Thufcus tu quoque Damon,

Antiqua genus unde petis Lucumonis ab urbe.

O ego quantus eram, gelidi cum flratus ad Ami

Murmura, populeumque nemus, qua mollior herb3, 130

Carpere nunc violas, mine fummas caipere myrtos,

Et potui Lycida? ccfrantem audire Menalcam.

Ipfe eriam tentare aulas fum, nee puto multu;itf

Difplicui, nam flint & apui me munera vellra

Fifcellar.calathique & cerea vincla cicurs, 135

Quin &: noltra fuas docuerunt pom ina faces

¥ z Ei

95 fod ales,] Space occurs in all copies examined. Columbia silently emends.

130 qua] In all copies examined, the accent is clearly grave and Columbia note is misleading.

258

POEMS BOTH ENGLISH AND LATIN — 1645

(&0

Et Datis, & Francinus, erant & vocibus ambo

it ftudiis noti, Lydorum fanguinis ambo.

Itc domum impafti, domino jam non vacat, agni.

Haec mini turn laeto di&abat rofcida luna, 1 40

Dum folus teneros claudebam cratibus hados.

Ah quotiesdixi,cum te cinis ater habebat,

Nunc canit, aut lepori nunctendit rctia Damon,

Vimina nunc texit, varibs fibi quod fit in uius j

Et qua turn facili fperabam mente futura 145

Arripuivotblevis, & praefentia finxi,

Heus bone numquid agis ? nifi te quid forte retai dat;

Imus ? & argud paulum recubamus in umbra,

Aut ad aquas Colni, aut ubi jugera Caffibelauni ?

Tu mihi percurres medicos, tua gramina, fuccos, 150

Helleboriimquejiumilefque aocos, foliumque hyacinthi,

Quafque habet ifta palus herbas, artefque medentu m,

Ah percant herbae, pereant artefque medentum

Gramina, poftquam ipfi nil profecere magiftro.

Ipfe etiam, nam nefcio quid mihi grande fonabat 155

Fiftula, ab undecima jam lux eft altera no&e,

Et turn forte novis admoram Iabra cicutis,

Diflilueretamen rupta compage, nee ultra

Fcrre graves potuere fonos, dubito quoque ne fira

Turgidulu?, tamen & referam, vos cedite filv*. 160

Iw

Itc domum impafti, domino jam non vacat, agni, Ipfe ego Dardanias Rutupina per aquora puppes Dicam, & Pandrafidos regnum vejus Inogeniar, Brennumque Arviragumque duces> prifcumque Belinuo^

Et tandem Ar moricos Britonum fub lege colonoj j 1 65

Turn gravidam Arturo fatali fraude Jogernen

Mendaces vultus, aflumptaque Gorlbis arma,

Mcrlini dolus. O mihi turn fi vita fuperfit,

Tu procul annofa pendebis fiftula pinu

Multum oblita mini, aut patriis mutata camoenis 1 70

Brittonicum (hides, quid enim ? omnia non licet uni

Non fperafle uni licet omnia, mi fatis ampla

Merces, & mihi grande decus (fim ignotus in acvum

Turn licer, externo penitufque inglorius orbi^

Si me flava comas legat Ufa, & potor Alauni, 1 75

Vorticibufque frequens Abra, & nemus omne Treant*,

Et Thamefis meus ante omnes, & fufca metallis

Tamara, & extremis me difcant Orcades undis.

Ite domum impafti, domino jam non vacat, agni, Hax tibi fervabarn lenta fub cortice lauri, 180

Ha?c, & plura fimul, turn qua: mihi pocula Manfus, Manfus Chalcidica? non ultima gloria rip* Bina dedit, mir-um artis opus, mirandus & ipfe, Et circum germoo crfaverat argumento :

F 5

*X>

164 Belinum,J The comma is clear enough in all copies examined, especially under magnification, and exceptionally clear in a few, making Columbia note wasted and its alleged information misleading.

EPITAPHIUM DAMONIS— 1645

259

{%6)

In medio rubri maris unda, & odoriferum ver 185

Lirtora Ionga Arabum, & fudantcs balfama filvx, Has inter Phoenix divina avis; unica terris Ccruleum fulgens diverficoloribus alis Auroram vitreis furgentem refpieit undis. Parte alia polus omnipatens, & magnus Olympus, 190

Qjis putet?hic quoque Amor.,pi5t3eque in nube pharetix, Anna corufca faces , & fpicula tintta pyropo ; Nee tenues animas^ pectiifque ignobile vulgi Hinc ferit, at circurn flammantia lumina torqqens Semper in cre&um fpargit fua tela per orbes 195

Impiger, & pronos nunquam collimat ad i£hrs, Hinc mentesardcre facra:, formaeque deorum. ju quoque in his, nee me fallit fpes lubrica Damon,

Tu quoque in his certe es, nam quo tua dulcis abiret

San&aque iimplicitas, nam quo tua Candida virtus > 200

Nee te Lethxo fas quaefivifle fub orco>

Nee tibi convenient lacrymae, nee flebimiis ultra,

Ite procul lacrymae, purum colit xchera Damon,

-^Etherapurus habet, pluvium pede reppulit arcum }

Heroumque animas inter, divdfque perennes/ 205

JEthereos haurit Iatices & gaudia potat

Ore Sacro. Quin tu coeli port jura recepta

Dexter ades, placidufque five qnicunquc vocar is,

Seu

(*7)

Seu tu nofter eris Damon, five xquior audis Diodotus, quo te divino nomine cun&i GoelicoJar norint, fylvifque vocabere Damon. Quod tibi pu, pureus pudor, & fine labe juveutni Grata f uit, quod nulla tori libata voluptas, En etiam tibi virginei fervantut honores j. |pfe caput nitidun* cinctus rutilante corona, J.ctaque frondentis geitans umbracula palm* Sternum perages immorules hymenxos; Cantus ubi, choreifque furit lyra mifta beads, Fella Sionzo bacchantur & Orgia f hy tfo.

.FINIS.

210

215

The page numbering] In the IU Gannon copy, the top of parentheses and numbers has not printed, as something was between the type and the paper, probably, from the slight im- pression across the top of the page, another piece of paper which took part of the impression.

There is no signature on this page, although [F4] would be regular, but as this is the final page, the paper was cut with this leaf.

A MASK

(1637)

THE BRIDGEWATER MANUSCRIPT LAWES MANUSCRIPT OF THE FIVE SONGS

261

262 A MASK (1637) AND MANUSCRIPTS

A MASK— 1637

T

FTT^HE MASK, WHICH TODAY WE CALL COMUS, probably following Dalton (1738), was first printed in 1637 through the desire of its producer, Henry Lawes, whose dedicatory epistle to John Egerton appears before the text. This edition, issued without the author's name, is now rare, not many copies having survived, probably not more than twenty-five being ex- tant, and perhaps as few as fifteen. Indeed, it is today, though no rarer than the first edition of Lycidas, the most expensive and sought after of all editions of Milton's poetry. It was published for Humphrey Robinson, without the name of the printer. Probably no copy exists today that has not been rebound, and the original binding state of issue is unknown. The thin, almost square pamphlet was made up of 35 pages of text, so numbered, with two preliminary leaves [A] and A2, of cap paper, folded twice to form quarto gatherings, with the text beginning on page 1, sig- nature B, and continuing through page 35, [F2r] with its verso blank. Page 5 carries the wrong signature, A3, for B3, in all copies examined. The paper was mixed stock, as shown by the watermarks, there being at least two different watermarks that occur in various copies. In the Illi- nois Copy, the two preliminary leaves, or conjugate quarter sheet, carry the double decorated col- umns watermark like Churchill numbers 525-529, with initials R V with perhaps another letter under them. The B gathering carries a watermark like the tall, decorated, double-handled vase (pot) used so much in French papers (Briquet (1907) number 12,803 and Churchill numbers 467, 469, 470, 471). The C gathering carries a watermark so crudely formed as to be compared with that in the B gathering only by its general shape, having spread so much that no detail is visible. The D gathering carries a watermark delicately made and clearly outlined, about like Churchill number 468, and Briquet (1907) number 12,803. The E gathering carries a watermark about like that in the D gathering. The quarter sheet F — [F2] carries no watermark, which fact makes it unlikely that it was ever part of the sheet [A] — A2 or vice versa. Mr. William Jackson of the Houghton Library, Harvard University, has kindly supplied the information that the Har- vard copy contains only two discernible watermarks, one similar to Heawood number 70 — a double column figure — and the other similar to Heawood number 78 — the pot. The paper is of poor qual- ity in all copies examined. The chain marks run parallel to the lines of type. The printer may have been John Raworth, whose widow, Ruth, printed Milton's 1645 Poems. The decoration on page 1, numbered 241 in H. J. Waltemade's list (unpublished Illinois thesis, 1938), is found in many of John Raworth's printings, and in a few printed by Ruth. The type is almost certainly the same as that used by Raworth, as several w's indicate, and the peculiar k with its right hand upper bar ending below the regular top line of the lower case letters. There is the same tendency to provide too little space between words as was observed in 1645, and there is also a slight tendency to allow unnecessary space between a word and a punctuation mark following it. Altogether, it is possible that John Raworth printed it. Unless otherwise stated, all statements in the notes apply to all copies examined.

LIST OF 1637 COPIES EXAMINED AND COLLATED

Original. Illinois Copy.

Photostats and Films. Bodleian: Malone 302 (1); Malone 195(3). British Museum: 12-g.32.34; C.34.d.46, a unique state of page 23; 161. d. 72. Cambridge, Trinity College: Cap.Q.143. Harvard: 14485.29.8.50. Huntington: 62589. Morgan: 15600. New York Public: 1637. Yale: Elizabethan Club. British Museum C-34.d.46 and New York Public 1637 are photostats, the others being film copies. All copies except Huntington have been examined at first hand.

A MASK PRESENTED AT LUDLOW CASTLE — 1637 263

A MA o JSl x|r

PRESENTED

At Ludlo^ Caftle,

On ^A/Lkhaelmajje night % before the

Right Hon©rable,

Iohn Sarle of Bridgwater* Vicount Brackt^ Lord <Tr<efident of 'Wales , And one of His Maiesties moft honorable Privie GounfelL 7

Bheu quidvolm ml fir q mi hi I fioribus fajlrttm Perditus ■ «

1 ) ~~m

LONDON,

Printed far Hvmphrey Robinson*

at the figneof the Three Ptdgeomm f'wls Church-] Ard* 1 6 57*

?.

In all copies examined: 2 The word is poorly aligned. 3 The A of At is battered and type marks appear above and below the t Ludlow The L and o sit above the line and the w is battered and dropped. Caftle, The a sits up and type marks appear under the word. 4 The colon has been set upside down. 6 HONORABLE, The final E is broken at the top. 9 MAIESTIES The first I is a lower case letter without the dot. 13 LONDON, The first O appears to be from another font. 14 A spacer or other mark appears before Printed and the r is dropped. The o is battered in for HVMPHREY The initial large H has a break in the middle of its left hand ascender. The S in ROBINSON, is italic and the word runs down hill to the right. The water stains above, below, and between the rules, as on page 35, are conjecturally but most reasonably explained by Mr. H. E. Cunningham as resulting from rules set too high pressing into the extremely damp paper on the press and squeezing the water out on either side which then dried in wavy ridges leaving stains in all copies examined. In some, but not all copies examined, in line 1, the inner serif of the right hand slope of the A in MASKE is broken and smeared, and the left hand outer serif at the foot of the K is broken. In a few copies, spacer marks appear at the bottom left side below all type. In the Illinois copy, the crease running through the b of before in line 5, was there when the sheet was printed; but the crease running through the top rule below was not. Both these creases and the one through the first letter at the top of the page in this copy probably were made while the paper was very wet, just before and just after printing.

264

A MASK (1637) AND MANUSCRIPTS

■.:■ -■.:- ; . ■ ■■■.

.-JL

Mi

l MM

tit

[mi

SSI

J

TO THE RIGHTj

HO ^0% ABLE, IOHN LordVicomt BRACLY,

Son and heire apparent to the Earle ofrBridgeypater, &c.

My Lo rd,

His Toem , which receivd its fir ft occa/ion of birth from jour

*fgfe!fe> and others of your noble famtlie, and much honour from your own Terfon in the performance, now returns againe to make a finall dedication ofitfelfe to you. Although not openly ackriowledgdbj the Author y jet it is a^ legitimate^ offering , fo lonely , and fo much d'efired, that the often copying of it hath tird my pen to ghe mj fey er all

A z friends

10

The Epiftle Dedicatoric. friends fatUfaclion , and brought me to a necefiitie of producing it to the~> publich view- and now to offer it up in all rightfull demotion to thofe faire hopes , and rare Endowments of jour much-promijin^ Youth , which ghe a full a/furance, to all that know jon , of a future excellence. Lhejweet Lord to be the houour of your ^Qame > and recehe this as jour owne , from the hands of him, who hath by many favours beene long obligd to jour mott honour dl? arents % and as in thisreproe- fentationjour attendant Thyrfis^ now in all reall exprefion

Your faithfull , and moft humble Servant* »

H. La vves.

10

Heading. Type marks appear at the bottom of beginning and ending of the first line. 2 The kern of the N is bent. 3 The R in BRACLY, is broken in all copies examined, and the bottoms of the letters have failed to print in Morgan copy only. 4 The second p in apparent is battered. 5 The lower kern of the / in of is bent. The lower part of the g in Bridgewater, is battered. The w in the same word should be noted carefully. Text. 4 The lower kern of the/ in the word familie is broken off, probably to clear the capital letter immediately below it; but it is certainly a different / from that in line 2. 7 The / in felfe has been trimmed top and bottom to fit in between the g descending above it, and the I rising below it. 8 Note the w in acknowledg'd In the Illinois copy, the crease in the paper running through lines 2, 3, 4, and 5 of the text was there when the sheet was printed.

4 Note the v in devotion. 5 Note the w in Endowments. 6 Note v in give. The first / of the ligature // in affurance, is broken top and bottom. 13 Thyrfis, The bottom of the T is broken. 15 Type mark under Your The first f in faithfull, is battered, smeared at the top, and sits above the line. Type marks appear above and below almost entire line. 16 There are type marks under both words and above the comma at the end. 17 There is a type mark under the L and the E is battered. In the Illinois copy, the crease running down diagonally to the right from the left margin through lines 12, 13, and 14 was there when the sheet was printed.

A MASK PRESENTED AT LUDLOW CASTLE — 1637 265

<o

A MASKE

P E R F O R M E D1 B E F O R E

the Fradident of VV ales at Ludlow, i 6 j 4,

The firfl: Scene discovers a wild wood.

The Attendant Spirit defends or entm .'

BEfore the ftarrie threfhold of laves Court My manfion is , where thofe immortal I fhapes Of bright aereall Spirits live infphear'd In Regions mild of calme and fcrene aire, Above the fmoake and ftirre of this dim Fpot 5

Which men call Earthy and with low-thoughted care Confm'd, and pefter'd in this pin- fold here , Strive to keepe up a- fraile, and feaveriih being Vnmindfull of thfc crO wnc that Ver tue gives After this mortall change to her true Servants 10

Amongft the enthron'd gods on Sainted featSi Yet fome there be that by due fteps afpirc - » /

rif v B To

Title and Introductory Material. 2 The F of BEFORE has its upper left hand serif broken off.

3 Praefident The r barely printed. Note the split W in WALES but it is not W though it is a special form of this capital. Note also the extra amount of space between the W and the A.

4 Note the battered I in 1634. 7 The line of stage directions is not centered.

Text. 2 The a of manfion printing poorly is the first of many occurrences of this letter that appear to be from the wrong font. 4 The n of and is the first of many faint printings of this letter. Also in ferene. 5 fmoake The first k used throughout and standard in this font. Note that its body appears to be too short. In dim occurs the first of many i's that appear overbold. 6 Which The second h is dropped down, with The right hand top of the w is bent. 7 The top of the f in pin-fold is broken off, the first of many occurrences, here, The comma is broken. 10 The faint t in After indicates that the base was made too short for the other type, and is characteristic throughout; but some occurrences of the same letter are clear enough, and more than one mold seemingly was used.

266 A MASK (1637) AND MANUSCRIPTS

(O

To lay their juft hands on that golden key That ope's the palace of JJtcraity : To &ch my errand is, and but for fuch 15

{wmffclnot foilethefe pure ambrofial weeds Wkk $£ lanck vapours, of this Sin- worne mould. \ 1&H$ my tttsfe» Neptme befides the fway ' Of every fait Flood, and each ebbing Strcamc Tooke in ^roy let-tavixt high, and neather Ifve 20 Imperial ^.eoj^l the Spa^girtliesi 1 That like to rich, and various gemms inlay The unadorned i>olbme of the Deepe , r ' ' Which he to grace his tributarie gods By courfe commits to feverall government 2s

And gives themJeavevtOjW^are their Sajjhire crowns, And weild their little tridents, but this He < Thegrqate^andthebeftiof aUthe^maine * . He quarters to his blu-haird cfeities , s

And all this tracl: that fronts the falling Sun 30

A,notye I^eereof mickletrjaft , and- power Mas in his charge, with temper*^ awe to guide An old, and haughtie Hationiproud in Armes; Where his faiieoSfpittng'nwrs'tri.n-Princely lore. * \ Are comasing-to jattend' their ■■Earfiers. Mate , , \ ... 3$. And^new-enrruftedi Scepter :H but their way Lies througbthe perpkkttfpaf hsof this dreare wood^ The nbddin**ior4,ODo£whbfo fliadie- buows^ , Threats the fotbrne« and WPndfingPa^nger* . And here: tlieiiij^nder>age might' ftftr-perill 0 \ 4° But that b)? «f^ cfe eommand from -Soyeraigne iwt* , • I was difpatcht i»r thek defence^ and guard* And liftenwhy^ for-Lwilltell yee now* JYhat never yet Wjafchcard i« TaJtero* Soag- ■■

?£rom

13 The n in hands is not seated properly, hence is faint. 17 With The W characteristically drops down. 32 The top of the H in Has is damaged. 38 The h in horror is faint in Illinois copy. 41 quick The i failed to print.

A MASK PRESENTED AT LUDLOW CASTLE— 1637 267

From old, or moderne Bard in hall> or fotttfre. r 45

Bacchus that firft from out the purple Grape Cruih tthe fweet poyfon of mif-ufed Wine After the Tufcan Mariners transform'd Coafting, the Tyrrhene fhore, as the winds lifted , On Circes Hand fell (who knowes not Circe 50

The daughter of the Sun i whofe charmed Cup Whoever taftcd loft his upright ihape, And downward fell into a grovling Swine ) This-Nyrdph that gaz'd upon his cluftring locks With I vie berries wreath'd , and his blith youth '55 Had by him, ere he parted thence, a Son Much like his Father, but his Mother more, . Whom therefore (lie brought up and Comm nam'd , Who ripe, and frolick of his full grownc age "}

Roaving the Celt/ck, and Iberian fields 60

At laft betakes him to this ominous wood , An<3 ui.thjck flicker of black fhades imbowr'd ^xcejls Jii^Mother at her mfghtie Art Qffiit|g to every wearie Travailer £tis orient liquor in a Chryftall glafte 65

^o quench the drouth otFheebus, which as they taft (For raoft doe taft. through fond intemperate thirft) Sooneas the Potion works, their humane count 'nance Th'expreiTe refembknce of the gods is chang'd Into fome brutitli forme of Wolfe, or Beare 70

Or Ounce, or Tiger, Hogj> or bearded Goat, • . All other parts remaining as-tbey were , \ , ' And they , fo perfect in their miferie 4 [

Not once perceivetheir foule -disfigurement, But boaft themfelvcs more comely then before ^5

And all their friends 5 and native home forget 6 \

£2 d To

The Page Number. In New York Public Library 1637 copy only the 3 is tilted. 49 The o is faint and the following comma broken of fhore,. 53 The n of grovling is smeared at the top. 56 The t is badly worn in parted. 59 The top of the f is broken, the u is too black, and the first 1 is battered in full. The n in growne is broken at the top. The g in age is broken. 63 The first i in mightie is broken at the top, but the dot is present. 66 There is a mark between i and c above the left shoulder of the c in which. 67 The n in intemperate is broken.

268 A MASK (1637) AND MANUSCRIPTS

U)

To roule witfi i pleaftre in a fenfuajl Hie, Therefore when any favoured of high love Chances tapafle through this adventrous glade, ■ Swift as the Sparkle of a glancing Starre so

I fl.oote from heav'n' to giue him fafe convoy, As now I doe : but firft I muft put off Thefe my skie robes-fpimoutof/n* wooffe, And take the weedsandlikeneffeofaSwaine, * Thattotheferviceofthi^houfcbelongSj 85

Who with his foft Pipe, and fmooth-clittied Song^ Well knows to ftill the wild winds when they roare, And hufli the waving woods, nor of leffe faith, And in this office of his Mountaine watch, Likelieff, and neereft to the prefent aide 90

Of this occafion. But I heare the tread ■ - Ofhatefullfteps^Imufrbeviewkffcnow, .

Comes enters with a Charming red in onc^ h*nd , hit Qla([^> iti thz^> other > with htm a rtut of tMonfiets. headed like fundry forts of wilde Beafis, but othertvife like CM en and Women, their afpareJt git firing, they ctme iu waking a riotous and vnrn* ly noife, with Torches in their hands.

Comus, The ftarre that bids the Shepheard fold, j Now the top ofheav n doth hold, And the gilded Carre of Day 95

His glowing Axle do:h allay,. In the ftcepe t^sftlakik ftreame, . And the llope Sun his. upward beame Shoots ngsinft the duskie Pole y Pacing toward theochergole ioo

Of

79 The C in Chances is badly worn. 81 The ligature fh in fhoote is faint and probably broken in all copies examined. 83 The o in robes is broken at the left of its top. 85 There is a spacer mark between this and house in all copies examined. 91 The top of the f in Of is broken off. Line 5 of Stage Directions. The n is inverted, not a u in the word iu and so in all copies examined. The ascender of the d in and is bent. 94 There is no space between the words ofheav'n in any copy examined. 95 The marked disparity between the two r's in Carre is noticeable in all copies examined. 96 The t in doth barely printed. 97 The second e in fteepe is faint and the descender of the p is bent. 99 The second a in against barely printed. The h in the is faint. 100 The P in Pacing has been over-inked or smashed on its left side. The t in other is very faint. Catchword Of, the 0 is broken at the bottom.

A MASK PRESENTED AT LUDLOW CASTLE — 1637 269

m

Of his Chamber intfeeEafcls'^ '

Meane while welcome Joy,andFca(Vf

Midnight fk>ut,and.revdrie,

Tipfie dance, and Jollitic. •.■•:; ili; /

Braid youirLdeks vrath rofie. Twine, ■ 105

Dropping odours, dropping Wine.

Rigor now is goncxo bed,

And Advice with fcrupulous head ,

Strict Age, and fowre Severitie

With their graueSawes in (lumber lie* ';no

We that are oFpnrsr. fire,

Immitate the ftarrie quire,.

Who in their nightly watchful! Sphearcs ,

Lead in fwift round" the Months aft d Yeares.

The Sounds, and Seas with alltheir fiffirie drove,' 1 15

Now to the Moonein wavering Morricemove,.

And on the tawny finds and Ihelves,

Trip the pert Fairies andthe dapper Elves ;

By dimpled Brooke, and Fourttaine brim,

The Wood-nymphs deckt with daillestrimr I20

Their merry wakes, and paftimeskeepe,

What hath night to doe with fleepe «f

Night hath better fweets to provey i

Vtms now wakes, and wakens Love*

Gome let us our rights begin ' 125

'Tis onely day-light that makes Sin

Which thefe dun /hades will ne're report.

Haile GoddefTe of Nofturiull fport

JDark-vaild Cotpte, t'whom the fecrer flame

f)f mid night Torches burnesj my fterious Dame i30

That ne re at cali'd, but when the Dragon woome

Of S ygian darknelfe fpets her thickeft gloome

i A3 And

The Page Number in Illinois copy is over-inked so that the impressions of both parentheses and the number have spread. 103 The first i in midnight lacks a dot, the first occurrence of one of these dotless i's, made to be used under the upper kern of letters like f. 104 The c in dance barely printed. 1 1 1 The first r in purer barely printed. The top of the f in fire is broken off. 114 The word and is poorly set and the n is battered in all copies examined. 115 There is a spacer mark above the end of the word drove, that may be a type mark. 120 There is no space between the words daifiestrim, in any copy examined. 127-132 In all copies examined, something happened to the left hand side of the initial capitals of each of these lines. 130 The hyphen barely shows in mid-night and the r in Torches barely printed. 132 The t in Stygian is scarcely visible. The signature A3 erroneously appears for B3 in all copies examined.

270 A MASK (1637) AND MANUSCRIPTS

And makes one blot of SlUafewigi iic?i ;srD arllO Stay thy clowdi^l£^l>flhaife^T? >bw ! 1 v :> ribM Wherein thou rid'ft wich&tfr^rdaibl^^ Vs thy vow'd Priefts, till utraoftiefldb- is / n.a/ iiqi ■ Of all thy dues b<c staff? p&id riotie^eftiuibov b ;/l ,Ere the blabbing EaftcWeAapc- ^ ^jobb a r]c CI TheniceMornconth7^/4^ide|Ja:o:;; ei \.;i - ; I From her cabin'd(jQop:hoijefffeepey. wh A i40v And to the tel-tale Sunidifcry ■: Our conceal^ 'Solamim§dU!: - rv $3.3U£i& Come, knit hands, and beat^the gfOMiid^ i In a light fantaftick round." • <; :> m ■ 3ft

Breafcflffjbisakfrii^^^ afeT .

0 f foi-Qe^fefffbfooBd^ iMbra about thisqgrtmnd,

Run to your Inroads, Within thtffe Brakes^ and;3Vees v Our numtjerxrifyiaqtfg^t'f !tSo»e'VirJitrfiifO"> ;n r (ForfoIcandiiftihgA^ Mqmib v I

Benighte4iathde*vsbods» fttowtDtn^chkaafe? 3gJ,T And to my wjfce trsiins^ flisefhe'rq ioilg" " ? - " tbriT Be weJJ ftock't -with a$3aire.a Heard as grasrti d - -r W About my Mother C/iw Throl hufte' djfid -n%IH, My da-zling Spclkimo the- fpimgie *!»■;'" vtor i»^%H Ofpowertocheatethecyipwi^bfleareilMolij rags* 1 And give it falfe prefentments, left^he place * And my qudntirabiiis' breedcaAomfhmenty i ii riwrtW AndputtheDamMtdfiifpiDfoosai^it, b<0 all IT Which m^nbtbc,ftrtW's«gairift my courfe $ fea 1;

1 under ftiropm^tents of 'friendly ends, " '-'160 ' •/ And ^d plact .wofrds of gloz ing courtefk '■*■' Baited wi^rf&bsdiotuftplaufibk " : ■ rb & q \- ' 0 r ft ' SJ'A ■ • Wind

135 In Illinois copy only there is a smear of ink between the i and the e in befriend, other copies being clear. The Stage Direction. The first e in Meafure is broken in all copies examined, and only considerable magnification of an original can make certain that it is e and not c as it appears. 149 The first parenthesis is smeared on its left hand or outer side. 154 The t in into has little chance to print between the bold n and o following. 162 The spacing of notunplaufible is crowded.

A MASK PRESENTED AT LUDLOW CASTLE— 1637 271

lit?

Wind m&ilnt9dtht>*&k bezmdimati^

And hugi^iig^imtes^^hcn^^chereye

Hath met the? virtue of this Magkkduft, l65

I (hall a$?eajfe<fQme harmlefle Viikigcr

Whom rhr^fctepesup.'abotit his Country geare

But hei-q mi csraric^' I! fcbiy &ep afide •

And hearken ,if I jnay , her buifnefTe here.

The Ladie enters.

This way the n$jfe.was, if mine eare be true *7Q

My beft guide.nosvme thought it was the founds

Of Riot, and ill manag'd Merriment,

Such as the jocond Flute, orgamefome Pipe

Stirs up among the loofe unlecer'd Hinds

When for their teeming Flocks, and granges full . 175

In wanton dance they praife the bounteous Pa»,

And thanke the gods amide. I mould be loath

To meet the rudeneflfe , and fwill'd infolence \ ,

O f fuch late Waffailer s .; yet A where elfe

Shal 1 1 informe my unacquainted feet 180

In the blind mazes of this tangled- wood?

My Brothers when theyfaw me wearied our

With this long wa$$ refolding here to lodge

Vnder the fpreading- favour of thele Pines ;

Stept as they fed to the next Thicket fide 185

To bring me Berrifs, or fuch cooling fruir

As the kmdJbofpitablc woods provide;

They left me then, when the gray-hooded Ev'n

Like a fad Votarift in Palmers weedsN

Rofe from the hindmoft wheels or Phxhtts waine. 190

But where thev are, and wKy they came not back

Is now the labour of my thoughts, t&likelieft ,

They

167 This line is lacking in 1673, hence 1637 number is one larger from here on. 173 In Illinois copy only, something lay on the middle of the F in Flute and prevented it from printing at that point only. 186 In Illinois copy only, the second e in Berries, barely printed. 191 In some copies, including Illinois, the h in why almost fails to print, but is clear in other copies examined.

it iHO;

200

272 A MASK (1637) AND MANUSCRIPTS

(1*3 ^ I

They had ingag'd %bmth/nadtlngyM^s-k^^t : • ■ b And envious ^i^ricfife^e^tbe^Teoukl^etati^l^'! Had ftolne them fromnje^ejfe.otheeviih Night 195 Why iliouldit thou,. but for fome feik)nk)&s!endr In thy darke lanterne.rhus clofe up. th^ &ars^ -u J - That nature hung iff Heav'n, andair^ijbidbteips With everlafting oile to give due light 3 i y \ To the mifled , and lonely Travailer. This is the place, as well as I may guette W7hence even now'the tumuk 6£loud ftfeh- ys&r ' Was rife, and perfe&in royiiftetaingeare'^ ';; x' Yet nought but fingle darknelTe doe I find, b What might this be i a thoufand fantaiies< : 205

Begin to throng into my raemorie wit sp.orni qu Of calling fbapes, and beckning thadows dire^ ' "

And ayrje tongues,. that fyllabte mens .names : On Sands, and S hoars ,and defert WiiderneiTes. Thefc thoughts mayiiartle well, but notaftound The vertuous mind, thiat ever walks attended By a ftrong fiding champion Confcience. ' ■ 4

0 welcome pure-ey'd Faith, white-handed Hope Thou flittering Angel girt with golden wings, And thou unblemiuYt forme of Chaftitie

1 fee yee vifibly, and now<beleeve That he, the Supreme good, t'whora all things ill Are but as flavifh officers of vengeance - . . . Would lend a gliftring Guardian if need were To keepc my life, and honour unaflaird. Was I decciv'd , or did a fabie cloud Tnrne. forth her filver lining on the night i

I did not erre, there does a fables cloud

Turne forth her^filvei; lining on the night ^ .

" And

194 The second r is very faint in returne, 196 The r in for is out of line. 197 The second n in lanterne is broken, as is the top of the f in clofe in all copies examined. 201 The p is broken in place, straight across the loop. 202 The 0 in of is battered at the top right. 212 The B in By is battered. 213 The O is broken at the top.

210

215

220

A MASK PRESENTED AT LUDLOW CASTLE— 1637 273

And cafts a gleame over this tufted Grove* 225

I cannot hallow to my Brothers , but Such noife as I can make to be heard fardeft He venter, for my new enhVhd fpirits Prompt mc$ and they perhaps arc notfarre off.

Song.

Sweet echo , fweetefl Nymph that liv'ft tmfcene 230 Within thy ayriejbell

By flow Nitquditt'smargent greene, \^£nd in the violct-imbroidu r d vale

Where the love-Urne Nightingale Nightly M thee her fad Song mmrneth weE. 235

Gmli thou not tell me of a gentle Pain

Thar likeft thy NarcifFus <*/-*? - .

O if thou have Hid them rnfomefkwrie Cave,

Tell me but where, 240

Sweet Queen of Par lie, Daughter of the Sphere, So maitt thou be translated to the skies , And give refounding grace t$ allHeav'ns Harmonies*

Com. Can any mortall mixture of Earths mould Breath fuch Divine inchanting raviihmentf 245

Sure fomething holy lodges in that brcfty And with thefe raptures moves the vocal aire To teftifie his hidden refidence; How fwcetly did they float Upon the wings Of Silence, through the emptie- vaulted night 250 At every fall fmoothing the Raven downe Of darknefie till fhe fauTd : I have oft heard

C My

The Page Number. The 9 is badly battered in some and shows much wear in all copies examined. 225 The inner horizontal serif of the G in Grove, is almost gone. 228 The i in enliv'nd lacks its dot in some but not all copies examined. 230 liv'ft The apostrophe is broken and smeared in all copies examined. In Illinois copy, there is a rust spot at the end of this line that has eaten a hole nearly through the paper. 232 The lower part of the g in greene, is broken, as are all the g's in this italic passage. 239 The t in them is so badly worn that it seems improperly spaced. 240 The e in me is broken and looks like a c as in the stage direction on page 6, and not even magnification helps much here. However, careful study of the shape of the two letters will indicate that the letter here is a broken e, not a c as it looks. See line 230 echo, and line 243 grace for other occurrences of both letters to permit direct comparison. 244 The right hand serif at the top of the E in Earths is broken or worn off.

274 A MASK (1637) AND MANUSCRIPTS

(10)

My mother Cirtt with the Sirens three

Amidft the fiowrie^kirtrd Naiades

Culling their Potent hearbs 3 atid balefull drugs 255

Who as they fung , would take the pnfon*d foule

And lap kmElyfiitm, Scyila wept.

And chid her barking waves into attention 5

And fell Charybdis murmur'd foft applaufe :

Yet they in pleading flumber ImTd the fenfe 260

Afid in iweet madneffe rob'd it of it feJfe,

But fuch a facred, and home-felt delight,

Such iober certainty of waking bMe

I never heard till now. He fpeake to her 264

And fhe fhall be my Qoeene. Haile forreine wonder

Whom certame thefe rough ihades did never breed

VnlefTe the Goddeffe that in rurall ibrine

DweH'ft here with Pan > or Sifoan> by bleft Song

Forbidding every bleake unkindly Fog .

To touch the profpcroiis. growth of this tall wood,, 270

La. Nay gentle Shepherd ill is loft that praife That is addreft to unattending Eares , Not any boaft of skill, but extreame fhift How to regaine my fever'd companie Compell'd me to awake the courteous Echo 275

To give meanfwer from her mollie. Couch.

Co. What chancegood Ladie hath bereft you thus ? La. Dim darkneffe, and this leavie Labyrinth. Co. CovXd that divide you from neere-ufhering La. They leftmewearyonagraflieterfe. (guides? Co. By falfhood, or difcourtefie, or why ? 281

La. To ieeke fth vally fome coole friendly Spring, Co. And left your fiire fide all unguarded Ladie i Lat They were but twain, $ purpos'd quick return.

CK

258 There is no dot over the i in chid in any copy examined. 263 The ng of waking and the b of bliffe are set below the line. 265 The u in Queene. is faint because the kern of the Q pre- vents the smaller letter from seating properly. 265-266 The two end letters of the two lines have been crowded by their spacers and position until they have risen a little, and put their impress into the paper, hence look blurred in all copies examined. 284 There are type marks under La.

A MASK PRESENTED AT LUDLOW CASTLE— 1637 275

(II)'

Co. Perhaps fore- flailing night prevented 'them? 285 . La. How cafie my misfortune is to hit ! I

Co. Imports their lofTe,befide the prsefent need? ,

La. No leffe then if I inould my brothers lofe.

Co. Were they of manly primCjOr youthful bloom?

La. As fmooth as Hebe's their unrazord lips. ■ 290

Co. Two fuch I faw, what time the labour'd Oxc In his loote traces from the furrow came , And thefvyink't hedger at his Supper fatse; I faw them under a greene mantling vine That crawls along the fide of yon irnall hill 5 295

Plucking ripe clufters from the tender moots, Their port was more then humaine; as they ftood, I tooke it for a faerie virion Of fome gay creatures of the element That in the colours of the Rainbow live 300

And play i'th plighted clouds , I was aw-ftrookej And as I pafV, I worfliipt; if thofe you feeke It were a^journy like the path to heav'n To helpe you find them. La. Gentle villager What readieft way would bring me to that place i 305

Co. Due weft it rifes from this fhrubbie point.

La. To find out that good fhepheard I fappoic In fuch a fcatit allowance of ftarre light Would overtaskthe beft land-pilots art Without the fure guefle of well-pracWd feet. 310

Co. I kno wctchlan'e, anci every alley greene . Dingier^ or bufhie deli of this wild wood:, And evefy*Bosfcic Uourne from fide to tide My dav lie walks and ancient neighbourhood^ ■ ? v •• * And if y our; ftray attendance be yet lodg d 315

Or fhroud within i&efe limits^ I ffiall know

Cj Ere

285 There is a type mark at the end of the line. 291 In Oxe the x sits up and the e appears to be from a larger font. 295 The right hand upright of the m in fmall is broken. 299 The bottom of the O in Of is broken. 314 The y in daylie is very faint.

276 A MASK (1637) AND MANUSCRIPTS

Ere morrow wake] or the low-roofted farke

From her thach't palate rowfe, ifotherwile

I can conduct you Ladie ro a low

But loyal 1 cottage , where you may be fafe 320

Till further queit'. La. Shepheard I take thy wordr

And truft thy honeft offer 'd courtefie^

Which oft is fooner found in lowly fheds

With fmoakie rafters, then in tapftrie halls,

And courts of Princes, where it firft wasnam'd^s

And yet is mod pi amended : in a place

Leffe warranted then this, or Mefecure

I cannot be, that I fhould fcare to change it,

Eye me bleft Providence, and fquare my trial! 329

To my proportion'd ftrength. Shepheard lead on.— ••

X ^ The two Brothers.

Eldjbro. Vnmuffle yee faintftars,and thou fair moot* That wontft to love the travailers benizon Stoope thy pale vifage through an amber cloud And disinherit C7/&4w,,thatraignsiiere In double night of darknefle, and of fhades y 335 Or if your influence be quite damm'd up Writh black ufurping mifts, fome gentle taper 1 hough a rufli candle from the wicker hole. Of fome clay habitation vifit us With thy long levell'd rule of ftreaming light 3^ And thou malt be our ffone of \*4rcadie , /.-) Or Tyridtt Cynofure. . 2 Brt. Ox if our eyes* . Be barr'd that happjneffe, might we but heare The folded flocks pen'd in their watled cotes ,„ Or /bund of paftoral reed with oaten flops, 5

Or whi&lc £ora the Lodge, or village cock- Count

317 There is a type mark above the comma following wake, in all copies examined. The r in roofted drops down. 321 There is a faint but unmistakable apostrophe and space for it between the final t of queft'. and the period following. The tops of the S and h of Shepheard have been crowded by the kern of the y immediately above them. 324 The r in tapftrie is either too short or prevented from printing by the bulk of the preceding ligature and the i that follows. 326 The r and t are very faint in prsetended for the same reason or reasons. 331 The period after Eld. has dropped down. 341-347 As at the bottom of page 5, the left hand outer edges of the initial capitals in these lines show battering or some other cause for their rough printing. 342 The O in the second Or is broken at the top. 343 The loop of the a in that is filled. 344 The top of the f in folded is broken off. The s in flocks is faint in most copies examined.

A MASK PRESENTED AT LUDLOW CASTLE— 1637 277

Count the night watches to his featherie Dames ,T

T' would beidmc folaceyet, fome little cheating

In this clofe dungeon or innuraerous bowes.

But 6 that haplcfle virgin our loft fifter 350

Where may fhe wander now , whether betake her

From the chill dew, among ft* rude burs and thiftles.?

Perhaps fome cold ban c is her boulfter now

Or 'gainft the rugged barke of fome broad Elme

Leans her unpillow'd head fraught with fad fears; 355

What if in wild amazement, and affright

Or while we fpcake within the direfull grafpc '

Of Savage hunger, or of Savage heat *

Bid: bro. Peace brother, be not over exquifite To caft the faihioaof uncertainc evils , 360

For grant they be fo ,, while they reft unknowne What need a man foreftalf his date of griefe And run to meet what he would moft avoid i Or if they t>e but falfe alarms of Feare How bitter is itich felfe-delufion ? . 365

1 doe no: thinke my fifter fo to C^tke Or fo unprinciprd in venues book And the fwcet peace that goodneffe bofoms ever" As that the fingle want of light , and noife (Not being in danger , as 1 truft fhe is not) 3? 0

Could ftir the conitant mood of her calme thoughts^ And put them into mii-brcomming plight. Yertue could fee to doe what vertue would By her owne radiant light, though Sun and Mooa Were in the flat Sea funck , and Wifdoms felfe> 375

Oft feeks to fwcet retired Solitude Where with her beft nurfe Contemplation She pluraesKcr feathers, and lets grow her wings

C 1 Thar

347 There is a type mark above the comma at the end of the line. 348 Note the difference between the two t's in little. 353 The k in banke barely printed in Illinois copy. 359 Both E and d in Eld: are broken and hence over-inked. 366 The final e in feeke seems to be from a larger font. 372 The f in mif-becomming is either badly worn or from a different font. 374 The second o in Moon is broken. 377 In Illinois copy, second t in Contemplation barely printed.

278 A MASK (1637) AND MANUSCRIPTS

(14)

That in the varioosbuftle of refort

Were all to ruifl'd , and fometimes impair'd i 380

He that has light within hisowne cleere breft

May fit i'th center , andenjoy bright day,

But he that hides^darke foule , and foule thoughts

Benighted walks under the mid-day Sun,

: Himfelfe is his owne dungeon.

2. Bro. 'Tis ffloft true 385 •

That muiing meditation moftaffc&s The Penfive fecrecie of defert ceil Farre from the cheerefull haunt of men ,and hearife, And fits as fafe as in a Senat houfe For who would rob an Hermit of his* weeds 390 His few books, or histeides , or maple difli, Or doe his gray hairs any violence * Butbeautie like the faire Hefperiantree Laden with blooming gold , had need' the guard Of dragon watch with unirichantedey€ 395

To f^ve her blofibms , and defend her fruit From the ram handofboldlncontinence. You may as well fpread out'the unfun'd heaps Of mifers treafure by an outlaws den And tell rae it is fafe,as bid me hope * 40a

.^Danger will winke on opporturiitic And let a fingJe heifdeffe maydewp|fle Vnin j ur'd in this wild furrounding waft. Of night, or lonelyneffe it recks me not I fearc the dred events that d% themboth, 405 left fomeill greeting touch attempt the perfbn Of our unowned fiftcr.

E Id. Bro ,. I doe: not brother . Inferre , as if Erhought my fitters /late

Secure

388 The top of the f in from is broken off. The third e in cheerefull barely printed. 392 The O in Or is broken at the bottom. 397 The serif at the top of the I in Incontinence is battered. 402 The top of the 1 in let is bent.

A MASK PRESENTED AT LUDLOW CASTLE— 1637 279

on

Secure without all doubt , or controverfte :

Yet where an equall poife of hope, and feare 410

Does arbitrate th'event , my nature is

That I encline to hope , rather then feare

And gladly banifh fquint fufpicion.

My filter is notfodefenceletfe left

As you imagine , fhc has a hidden ftrength 415

Which you remember not.

2. Brc, What hidden ftrength VnlefTe the ftrength of heav'n , if meane that {

Eld. Bro. I meane that too, but yet a hidden ftrength W hich if heav'n gave it, may be term'd her owne ; *Tis chaftitie, my brother, chaftitie : 420

She that has that, is clad in compleat fteele , And like a quivcr'd nymph with arroweskeene May trace huge forrefts , and *inharbour'd heaths • Infamous hills. , and (andie perillous wilds "Where through the facred rays of chaftitie 425

No favage fierce , bandite , or mountancctc \ Will dare to foyle her virgin puritie Yea there, where very defolation dwells By grots , and caverns fliag'd with horrid fhades > She may pafle on with unblehch't majeftie 430

Be it not done in pride, or in preemption. Some fay no eyill thing that walks by night In fog, or fire, by lake , or moorifb fen Blew meager hag, orftubborneunlaydghoft That breaks his maglcke chaines at curfeu time 435 No goblin, or fwart Faerie of the mine Has hurtfull power ore true virginity. Boeyee beteeve me yet , or uV.Il I call Antiquity from the old ichools of Greece

To

413 The second f in fufpicion. is either badly worn or from a different font. 417 if meane that? All copies read thus. 426 There are two type marks at the end of the line. All copies examined read mountaneete. 435 The first u in curfeu barely printed. 438 The a in fhall barely printed.

280 A MASK (1637) AND MANUSCRIPTS

( x6 )

To teftific the armes of Chaft me f 440

Hence had the huntreffe Dia» her dred bow JFairc filver-fhaficd Qneene for ever chaft Wherewith we tam'd the brinded lionefle .-And fpotted mountaine pard , but fet at nought The frivolous bolt oiCufid, gods and men 445

Fear'd herfternefrowne,& fli6 was queen oth' woods. ' 'What was that fnakie headed Gergon fheild That wife Minerva wore , unconquer d virgin Wherewith (he freez'd her foes to-congeal'd ftone * But rigid looks of Chaft aufteritie 45°

And noble grace that daih't brute violence With fudden adoration , and blancke aw* So deare to heav'n is faintly chaftitie That when a (bule is found fmcerely fa , A thoufand liveried angels Jackie her 455'

Driving ferre off each thing offinne, andgulfr, Andincleeredreame, and folemne vificii Tell her of things that no grofle eare can heare, Till oft converfe with heav'nly habitants Begin to caft a beame on th* outward (hape 460

The unpolluted temple of the mind And turnes it by -degrees to the fouls eflence Till all bee made immortal!; but- when luft By unchaft loofcs,loofe gefturcs, and foulc talke But raoft by leud , and lavifh a& of fin v 465

Lets in defilement to the inward parts , The foule growes clotted by contagion , Jmbodie ^ and imbrutes , till (he quite loofc Thedivinepropertie of her firft being. Such arc thofe thick , and gloomie fhadows damp 470 Oft fecne in Charnell vaults, and Sepulchers

Hovering

442 The t in filver-fhafted barely printed in some copies, but is clear in others. 443 The r in brinded barely printed. 447 The g in Gorgon has the broken lower loop characteristic of this letter in the italic font being used. 468 The s of Imbodies, barely printed. The hinflie barely printed. In the catchword, Hovering, something has interfered with the printing of the bottoms of ng,.

A MASK PRESENTED AT LUDLOW CASTLE— 1637 281

(*7) Hovering, and fitting by a new made grave" As loath to leave the body that it lov'd, And link't it felfe by carnall fenfualitie To a degenerate and degraded ftate. 475

2 Bro. Maw charming is divine Philofophie I Not harfli^ andcrabbedas<fuli fools fuppofe, Bat muficalt a§ is ApMs lut©^ ; ; " And a perpetuall feafl: of neclar'd fwcett Where no crtide furfetraigns. El: bro. Lift,U(l I hearC 480 Some iarre oflf hallow breake the filent aire.

2 Bro, Me thought fe too, what fliould it be ?

Eldr bro. For certaine Either Tome one like us night founder'd here, Or elfe fome neighbour wood man, or at worft Some roaving robber calling to his fellows. 485

2 Bro. Heav'nkeepemylfteriagenagenandqeerc, Bed draw , and itand upon our guard;

Eld: bro. He hallow, If he be friendly he comes well, if not ;

Defence is a good caufe, and Heav'n be for us.

The itieMmtyirH habited like ajhefheard.

That hallow I fliould know, what are you, fpeake, \ 490 Come nottoonecre,you fall on iron ftakeselfe. Spir. What voiccis tha^my ypng Lords' fpeakagen.^ 2 Bro, O brothcr&ismy father Shepheard fure. Eld- bro* T^ry^fMiofeartMtftrains have oft de- The huddling brook ti^heare his madrrgale, (iayd 495 And fweetetfd every muskrofe of the dale, How cara'ft.rJ?ou here goad S waiae, hath any ram Slip't from the, fold,7 or yong kid loft his dam, Or ftraggling; weather the pen tflock forfook y2

t> How

472 made grave] Type marks show above the last letter of the first word and continue above the entire second word. After line 489 The line of Stage Directions is not centered. 494 The lower half of the colon after Eld: barely printed.

282 A MASK (1637) AND MANUSCRIPTS

OS)

How conldft thou fina* this darke fequeiWd nook ft 50c

spir. O my loyM mafters heire,and his next joy I came not here on fach a triviall toy- As a ftrayd Ewe, or to putfue the Health Of pilfering woffe, net all the fleecie wealth That doth enrich tiiefe doutfts is worth a tboiaght 505 To this my errand, and the tareir hrougiati But 6 my virgin Ladle whore is>fl&e , ' How chance fhe is ootin your sompanie ?

Eld:bro>lL® teil theefadly. fhepheaird^withoirt blame Or our negte$, wee loft/he* as wee came* ..- 510

Sfir. . Aye me unhappie then my fears are true.

Bid: bye* What fear's good fhytfis ? prethee briefly " Sfir* He teil you, 'tis not vaine, or fabulous (lhewff (Though ib efteem'dby iShallow ignorance) What the fage Poets taught i>y th' beav'nly Mufe 515 Storied of old ia Ibigh immortal!: verfe Of dire Chimeras and inchanted Bes And rifted rocks- whosfe entrance leads to hdly, For fuck there b^faufcti^eJiefeJs Mind.

Within the nayilj # this ^deous wood 520

ImrriUrd in cyfreftc ffiacfesa ! Sorcerer dwells Of Baechnt9 aad of Cmat borne, ^^ Comas ^ , Deepe sWd io all h&iootlieis, witehejaes , And hefce to evicrj tiiirftiewjafiderer By $ie ejQt^eraen* glvet:hisbmtMla^1 ^ 525

Witrhman^ mutrnurs iwiat, w^hoie pleantig p©ifo» ■ TheVifage quitsEtraasfouras of hirartfaat drinks^ And the inglorious: Kfeeneflfe of a be-aft: > Fixes inftead 3 imttioulding reafbnsrnumage Chara&er'd indie face; this have! tearh't 530

Tending my flocks hard- by i'th hilly <a#fts

That

The Page Number. The top loop of the 8 is filled. 507 The h in fhe is badly worn. 510 The O in Or is broken at the top. 517 The e in lies is very faint. 522 The B in Bacchus is broken.

A MASK PRESENTED AT LUDLOW CASTLE— 1637 283

That brow this bottome glade ,' whence night by night

He and his monftrous rout are heard to howle

Like ftabl'd wolves, or tigers at their prey

Doing abhorred rites to Hecate 535

In their obfeured haunts of inmoft bowres.

Yet have they many baits, and guiicfull fpelk

T'inveigle , and invite th'unwarie fenfe

Of themthatpafleunweetingby the way.

This evening late bjr then the chewing flocks 540

Mad ta'ne their fupper on the favourie herbe

Of Knot-grafs dew-befprent, and were in ibid

I fate rne downe to watch upon a bank

With ivie canopied, and interwove

With flaunting hony.fuckle, and began 545

Wrapt in a pleafirig fit of melancholy

To meditate my rural rainftreifie

Till fancie had her fill , but ere a cloie

The wonted roare was up amidft the woods,

And filld the aire with barbarous diflbnance 550

At which I ceas't^and liften'dthcm a while

Till an unufuali ftop of ludden filence

Gave refpit to the dtowfie Frighted fteed*

That draw the litter o£ clofe-curtain'd fleepe.

At laft a fofr, and foiemne breathing found 555

Rofe like a ftearae of rich diftiU'd Perfumes

And ftole upon the aire, that even Silence

Wastookee're fhe was ware , and wifh't fhe might

Deny her nature , and be never more

Still to be fo difplac't. I was all eare , 56o

And took in ftrains that might create a foule

Vnder the ribs of Death , but 6 ere long

To? well I did perceive it was the voice-

D 2 Of

The Page Number. The 9 is badly worn. 558 The S in Silence is battered. 560 In British Museum copy C.34.d.46. only, the S in Still is italic. The top of the t in the same word is broken ort in all copies examined. 563 The second 0 in Too is broken. The f in the catchword Of is broken at the top.

284 A MASK (1637) AND MANUSCRIPTS

(20 v

Cf my-moft honour'd Lady your deare fitter.

Am 2 d 1 flood, harrow'd with griefe and feare, 565

And 6 poore haplcfle nightingale thought I

How iv, e'et thou fing'ft , liow.neerc.the deadly fnare I

Then dovvr.e the lawns I ran with headlong haft

Through paths, and turnings often trod by day

Till guided by mine eare I found the place 570

Where that damd wifardhidin flicxii/guifer

( For fo by certain figns I knew) had met

Alreadie, ere my beft fpeed could prevent

Tie aidlefie innocent Ladie his wifh't prey?

Who gently ask't if he had feene fuch two 575

Suppofing him fome neighbour villager .5-

Longerldurftnotftay,butfoonelguefs't ri# \

Yee were the two (he mean't, with that I fprung

Into fwifr flight till I had found you here>,

Butfartherknowlnot. . %-Srf, O night and mades 580

How are yee joy n'd with hell in triple knot

Againft th'unarmed weaknefTeof one virgin

Alone, and helplefle I is this the confidence

You gave mebrother <? Eld: hro. Yes3and keep it ftill^

Leane on it fafely ,. not a period 585

Shall be unfaid for me ; againft the threats

Of malice or of forcerie , or that power

Which erring men call Chance, this I hold firme ,. .

Vertue may be afTail'd , but never hurt ,

Surpriz'dby unjuft force ,butnotenthraird, 590

Yea even that which mifehiefe meant moft harme,,,

Shall in the happietriall prove moft glorie.

But-evil 1 on it felfe fhallbacke recoyle

And trixe no more with goodncflre,whenatlaft.

Gathcr'd like fcujiij and fetl'd to it felfe 595

Is

565 The a in Amaz'd is very faint, and there is only the faintest mark possible, visible only under magnification, although there is space for the apostrophe between the z and the d of this word. The g in griefe is battered. 587 The c in forcerie, is broken. 592 There is too little space between the words happietrialprove in all copies examined. 593 The first 1 in evill barely printed.

A MASK PRESENTED AT LUDLOW CASTLE— 1637 285

It fhallbeein eternall reftleffe change

Selfe fed s and felfe confum'd,if this faile

The pillar'd firmament is rottenneffe,

And earths bafe built on ftubble. But come let's on.

Againftth' opposing will and arme of heav'n . 600

May never this juft fword be lifted up,

But for that damn'd magician,Iet him be girt

"With all the greifly legions that troope

Vnd-er the footie flag ofc^ichtron , :

Harpy ks and Hydra 's, or all the monftrous bugs 605

'Twrxt Africa ,and Inde, lie find him out

And force him to reftore his purchafe backe )

Or drag him by the curies ,and cleave his fcalpe

Downetothehipps.

Spir. Alas good ventrous you^h, I love thy courage yet, and hold Empi ife, 610

But here thy fword can doe thee little fteacf, Farre other arms, arid other weapons muft Be thofe that qrell the might of hellifh charms, He with his bare wand can urthred thy joynts And crumble a-U thy (inewes.

Eld. Bro, Why prethee fiVphcard 615

How durft thouthen thy felfe 'approach (aneere As to make this -relation t

Spir. Care and utrnoft fliifrs How to f cure the Ladie from furprifall Brought to my mind a certaine lbepheard fad Of fmall regard to fee to, yet well skill'd 620

Ir every vertuous plant , and healing herbe That fpreds her verdant Jeafe to f h' morning ray , He lov'd me well , and oft would beg me fing, Which when I did, he on ihe tender gnaffe

D 5 Woul4

596 There is a type mark over the e and the r barely printed in eternall in all copies examined. There is a type mark over the e in change at the end of the line. 599 on.] All copies read thus, and the Columbia note is wrong; but may have arisen in connection with the first on which carries and can carry no punctuation. 609 The t in youth, barely printed. 614 The n in unthred barely printed in Illinois copy, but is clear in others. 616 There is no space between the two words thouthen in any copy examined. The top of the i in fo is broken off. There is a diaeresis over the first e in neere in all copies examined. 618 The first e in fecure failed to print. 621 The n in In barely printed.

286 A MASK (1637) AND MANUSCRIPTS

(22)

"Would fit, and hearken even to cxtafie.,' 625

And in requital! ope his leather'n icrip, And (hew me fimples of a thoufand names Telling their ftrange, and vigorous faculties, JVmongft the reft a fmall unfightly root , • But of divine effect, he eull*d me out '$ 630

The leafe was darkifh 9 and had prickles on it ? But in another Countrie ,as he faid , Bore a bright golden flowie » but not in this foyle •: Vnknowne ,and like efteem'd, andthe dull fwayne Treads on it dayly with his Clouted fhoone, ■ 635

And yet more med'cinall is it then that kJMoIj That Hermes once to wi&FlyJfes gave. He caird it Hdmeny , and gave it me And bad me keepe it as of fbveraineufe 'Gainft all inchantments , mildew blaft, or damp 640 O r gaft'y furies apparition j I purf t it up , but little reck'ning made Till now thatthis extremity compell'd, But now I find it true , for by this means I knew the foule inchanter though difguif'd, 645

Enter'd the very limetwigs of his fpells, , 'And yet came off,if you have this about you < As I will give you when wee goe) you may Boldly aflault the necromancers hall , "Where if he be , with dauntleife hardihood 650

And brandinYt blade rufh on him , breake his glafle , And died the luftiious liquor on the ground But feafe his wand , though he and his curft crew Feirc'e figneofbattailemake3and menace high, Or like the fons of Vnlcw vomit fmoake , 655

Yet will they foone retire., if he but Ihrinke

632 The 0 in another is battered. The catchword Eld: should read Eld. as does the first word on next page.

A MASK PRESENTED AT LUDLOW CASTLE— 1637

287

I Id. Br*. Thyrfxt lead on apae e Ik folio* thee, And lomc good angelt beare a {h:\ld bctoic us.

7 he Scene Conga to a jtatelj palace fct out with aBman- »tr of dettcionfnejfe , Joft muficke , tables fpred nit ball dainties. Comvs appeares with hv rabble , and the Ludie fet in an inchantedchaire to whom he offers bifglajfe, wbhh Jhe puts by , and goes about to r fe.

Comus. Nay Ladie fit ; if I bur wave this wand , Your nervs arc all chain'd up in alablafter, 66o

And you a ft.atue j or as Daphne was Koot bound that fled Apollo.

La. Too e doe not boi I \ Thou cn.1 not touch the rrecdomeofmy mind Withall thy charms, although this corporall rind Thou haft lmmanacl'd , while hcav'n lees good. 665

Co. Why are you vext Ladie, why doe you ftownef, Here dwell no frowns, n ranger, from thefc gates Sorrow flies farre : fee here beall the pleafurs Thar fancie cm beget on youthfull thoughts W hen the trclh blood grows live 1 v, and returns 670

BrisV- ;.s rhe April buds it* primrofe feafbn. And fir It behold this cordial julep here That Mines, and dancesm his cryftall bounds With fp rits of bal ne , and fragrant fvro s mixt. Not that Nepenthes which, the wife ofThone 675

In Mgypt gave to love borne Helen* Is of fuch pow^r to ftirre up joy as this, To lite fo frimdIy,or focoole to thirft. Why fhouldyou be fo crucll to your felfe,

And

Eld. Bro. Thyrfs lead on apace He follow t And fome good angell beare a fheild before us.

The Scene changes t$ a Jlately palace fet out with all wanner of delicioufnejfe , foft muficke, tables fpred with all dainties. Comus appear es with his rabble , and the Ladiefet in an inchanted chair e to whom he offers hkglaffe> which Jhe puts by ,and goes about to rife,

Comus. Nay Ladie fit ; if I but wave this wand ,', Your nervs are all chain'd up in alablafter, 560

And you a ftau;e joras Daphne was Root bound that fled Apollo.

La. Fooledoenotboaft, Thou canft not touch the freedomeof my mind Withall thy charms,although thjs corporall rind Thou haft immanacl'd , while heav'n fees good. 665

Co. Why are you vext Ladie, why doe you frowned Here dwell no frowns^ nor anger, from thefegates Sorrow flies farre : fee here beall the pleafurs That fancie can beget on youthfull thoughts W hen the f rcfti blood grows lively, and returns 670

Brisk as the April buds in primrofe feafon. And firft behold this cordial julep here Tha? flames, and dances in his cryftall bounds With fpirits of balme , and fragrant fyrops mixt» Not that Nepenthes which the wife of Thon? • 675

In Mgyptgurt to love-borne Helena Is of fuch power to ftirre up jfiy as this , To life fo friendly, or focoole to thirft. Why fhouldyou be fo cruell to your felfe.

And

BRITISH MUSEUM COPY C.34.d.46.

ILLINOIS COPY

The widest line of type is reduced in width from about 3J4 inches to 2^ inches in both prints.

The Stage Directions. There are two different states of the first two lines. In all but one copy examined, these two lines read The Scene Changes to a ftately palace Jet out with all/ manner of etc. In one copy examined, British Museum C. 34^.46., these two lines read The SceneConges to a ftately palace fet out with all man-/ ner of etc. The two lines have been entirely reset, except possibly for the last two words in the second line. In line 3 of the stage directions, appeares the first p is battered and the kern of the second is bent in all copies examined. 664 Withall This lack of space is according to 1645; but 1673 prints as two words. 668 beall There is a lack of adequate space in all copies examined. 672 There is no dot over the i in cordial in any copy examined. 676 In JEgypt the JE is roman. 1645 and 1673 print 'Egypt' without the ligature. The hyphen is clear in love-borne in Illinois copy, but very faint in other copies.

288 A MASK (1637) AND MANUSCRIPTS

Andtothofedaintie limms which nature lent 680 For gentle ufage , and foft delicacie ■? But you invert the cov'nants of her truft , •And harfhly deale like an ill borrower With that which you receiv'd on other termes, * Scorning the uocxempt condition , . 685

. By which all mortall frailty muft fubfift, Refrefhment after toile, cafe after paine, That have been tir'd all day without repafl: , And timely reft have wanted , but faire virgin This will rcftore all foone.

£a. Twill not falfe traitor, 6go

Twill notrefiorethe truth and honeftie That thou haft banifh't from thy tongue with lies, Was this the cottage, and tlie fafe abode Thou told'ft me of i what grim afpe&s are thefe, 694 Thefe ougly-heade^ monfters i Mercie guard me .' Hence with thy brewd inchantments fouk deceiver, Haft thoubetray'd my credulous innocence With vifor'd faIfliood,and.bafe forgerie, And wouldft thou feek againe to trap me here With lickeriih baits fit to enfnarc a brute *? 700

Were it a draft for I we when (he banquets I would not raft thy trcafonous offer ; none But fuch as are good men can give good things,1 And that which is not good , is not delicious ' To a wel-govern'd and wife appetite. 705

Co. O foolimncfteof men 1 . that lend their eares To thofe budge doctors ofthz Stokk furre, And fetch thej r prsecepts from the Cynick tub, Praifing the leane, and fallow Abftinence. Wherefore did Nature powre her bounties forth 110

With

699 The second e in here is battered. 706 O is broken at the bottom. At the bottom of the page, the catchword And from page 23 shows through in some, but not all copies.

A MASK PRESENTED AT LUDLOW CASTLE— 1637 289

( n)

Withfucha fullaa-3 urtMtmi rawing hand,

Covering he earth with odours, fruits, and flocks

Thronging trie feas with fpawnein 4imaabfc

But all to pleafe, an>: fate the curious raft i

And fe^to work millions of fpinning worms, 715

That in their green (hops weave the imooth-hair'd filk

To deck her Sons, and that no corner might

Be vacant of her plcnrie, in her owne luyns

She hurch't th'all worfhipt ore,and precious gems

To ftore her children with* if all the world 720

Should in a pet of temperance feed on Pulfe,

Drink the clear ftreame, and nothing weare but Freize,,

Th'all-giver would be unthank't, would be unprais'd,

Not halfe his riches known , and yet de/pis'd,

And wc ftnuld ferve him as a grudging mafter? 725

As a penurious niggard of his wealth ,

And live like Natures baftards, not her ions,

Who wou!d be quite furcharg'd with her own weight,

And ftrangl'd with her waft fertiiitie ; ( plumes,

Th'earth qumber'd , and the wingd aire dark't with

The hearts would over. multitude their Lords , 731

The fea ore- fraught would f well , and th'unfbught dia-

Would fo emblaze .: he forehead of the Deep, (monds

And fo beftu dde with ftars that they below

Would grow inur'd to light , and come at laft . 735

To gaze upon the Sun with fliamelefs brows.

Lift Ladic be not coy, and be not cofen'd

With that fame vaunted name Virginitie,

Beautie is natures cohe, muft not fee hoorded,

But muft be currant, aid the good thereof 740

Confifts in mutuall and partaken blide,

Vnfavourie in th'injoyment of it felfe

E HL

711 The d in and is battered. 712 The t in the is very faint in Illinois copy, but clear in most other copies. 713 The second n in innumerable is small and barely printed. 715 The f in fet is broken in Illinois copy only. 724 The top of the f in halfe is broken off. 731 over-inultitude] Thus in all copies examined. 736 The descender of the p in upon has lost out in conflict with the ascender of the b below, and has barely printed. In some copies, notably British Museum C. 34^.46., spacer marks extend from the left over half way across the width of the printed line; other copies are clear of these marks. Both letters of the catchword If are battered and broken.

290 A MASK (1637) AND MANUSCRIPTS

( 26 )

If you let fliptfme , like* neglected rbfe

It withers dn the ftalke with languifh't hcacf*

Beautie is natures brag , and muft be fhowne 745

In courts , at feafts , and high folernnities

Where moft may wonder at the workmanmip *

It is for homely Features to keepe home>

They had their name thence 5 courfe complexions

And cheeks ok forrie graine will ferve to ply 750

The fampler^and to teize the hufwifes wooll.

What need a vermeil-tincVd lip for that '

JLove- darting eyes, or fcreSes like the Morne

There Was another meaning in thefe gifts *

Thinke what , and be ad viz'd, you are but y ong yetos

La. I had not thought to have unlockt my lips In this unhallow'd aire, but that this ]ugler Would thinke to charme ray judgement, as mine eyes. Obtruding falfe rules pranckt in reafons garbe* I hate when vice can: bolt her arguments 760

And vertue has no tongue to check Jter pride : Impoftbr doe not charge mo& innocent nature As if me would her children ihouM be riotous With hers abundance, me goo^catereflfe Means her provifion only tothc gdod* ; \ 765

That live according to herfober laws And holy di&atfc of fpare Temperance,1 14 every juflr man-that- now pines with want , Had but a moderate, and befeeming mare ?/ Of that which lcwdy-pamper?d Luxurie' 779

Now heaps upon forae few with vaft excerfe,. Natures fuU bleiTmgs would be welldifpenc't In unfuperfluous even proportion , ' AfldmenowlmeBcomber'dwithherftore.

■ .;

S ' And

The Page Number. The top of the 6 is broken off in Illinois copy, but is present in other copies examined. The entire vertical row of initial capital letters, except for indented line 756, has printed too heavily, the type pressing into the paper and the ink spreading a little. 750 The top of the f in of is lacking. 763 The A of As is battered. 768 The top of the f in If is broken.

A MASK PRESENTED AT LUDLOW CASTLE— 1637 291

<*7)

And theft the giver would be better thatik't, 775

His praife due paid, for fwinifh gluttony Ne're looks to heav'n amidft his gorgeous feaft, But wiih beiotted bale ingratitude Cramms , and blafphemcs his feeder. Shall I goe on t Or have I laid enough? to him that dares 780

Arme his profane tongue with reproachfull words Againft the Sun-clad power of Chaftitie Faine would I fomething fa/, yet to what end* Thou haft nor Eare , nor Soulc to apprehend 1 he fublime notion, and high myfterie 785

Th?t muft be utter'd t© unfold the fage And ferious doctrine of Vhrginitie , And thou art worthy that thou fhouldft not know . More hapinefle then this thy praefent loy Enjoy yourdeere Wit, and gay Rhetorick 790

That hath fo well beene taught toerdazling fence* Thou art not fit to heare thy ielfe convinces Yet mould I trie, the uncoatrouled worth Of this pure caufe would kindle my rap't fpirits To fucha flame of facred vehemence , 795

That dumb things would be mov'd to fympathize, And the brute Earth wou id lend herrierves,and fhake, Till all thy magick ftruclures rear* d fohigh Were fhatterM into heaps ore thy falfehead.

Co. She fables not, I fcele that I doe feare 800

Her worcjsiet off by fbme fuperior power 5 And t> ough not mortal!, yet a cold fhuddring dew Dips me all o're, as when the wrath of lavt Speaks thunder, and theehaines ofEnSut To fome of Satums crew. I muft di 'embfe, 805

And try her yet more &on<4y. Come 5 rid more, ' i Ej This

775 In some copies, the blocking has slipped in the chase and the last four letter s of thank't, and the last letter of gluttony in the line below have slipped slightly away from the other betters. 778 The t in with barely printed. The top of the f in beiotted is broken. 806 The g in ltrongly

778

conflicted* with the E oi the signature, and barely printed.

292 A MASK (1637) AND MANUSCRIPTS

This is meerc morall babble , and direcV _, Agaiqft tlie canon laws of our foundation , I muft not fuffer this, yet 'tis but the lees And fetlings of a melancholy blood > 8io

But this will cure all freight, one ftp of this . Will bathe the drpoping fplrits in delight. Beyond the bii(Te of dreams, Be wife, .and taft.-^

The brothers rujh in with (words drawne , wreB hit gUJfetout of his hand, and breake it againft the, . Y ground^ his rout makefigne of refinance , tut Are. all driven in \\ the attendant Spirit comes in.

Spir.. What, haveypu let-thefajfe enchanter fcape i O y ee miftooke, yee mould haw fnateht his wand 515 And bound him iafl; without his rod revers'ty ™

And backward gutters of diffevering~ power .

I W7ee cannot, freer he Ladie that, fits, here.. . , In ftonle fetters fixt^ and motionleffe 5.-: ;a f Yet ftay>bp not difturb'd, nowJ bethinke me, 820 Some other meanes, I have which may be us'd, , Which once of zJMehb&us old I learnt The foptheft mepheard that ere pipe't on plains, .

There is a gentle nymph not farre from hence 824 That with moiftcuEbfwaysthe finootji Severn ftreara, Satrina is her name , a virgin pure $ u Whilomc fhee was the daughter of Lomne$ . < That tiadtfiefcepter from his father Brute.

. She guiltleffe.damfell flying the mad purfuit Of her enraged fte*pdam Guendokn, v. ; < . 830

Commended her faire, innocence to the. flood .« \ \6i 0 Thatfiay;dh(et%htwitb.hfepioffeTflowing.courfri>'

The

807 There is a faint but unmistakable apostrophe after direct' in all copies examined. 816 The top of the f in fait; is broken, and the f is battered. 817 The c in backward barely printed. 822 The reading here is certainly Melibxus though Columbia prints the a? as 'ae' and has no note, except for Bridge-water Ms.

A MASK PRESENTED AT LUDLOW CASTLE— 1637 293

(29)

The water Nymphs that in the bottome playd Held up their pearled wriftsand tooke her in , Bearing her fhaite to aged Neretts hall 835

Who piteous of her woes reatd her lanke head, And gave her to his daughters to imbathe In ne&ar'd lavers ftrewd withafphodil , And through the porch, and inlet of each fenfe Dropt in ambrofial oyles till me reviv'd , 840

And underwent a quicke , immortall change Madegoddcfle of the river 5 (till ihe retaines Her maiden gentleneffe, and oft at eve Vifits the heards along.the twilight meadows, Helping all urchin blafts , and ill lucke fignes 845

That the fhrewd mcdling elfe delights to make, Which me with precious viold liquors heales. For which the mepheards at their feftivalls Carroll her goodnefle lowd in rufticke layes , And throw fweet garland wreaths into herftreamesso Ofpancies, pinks, and gaudie darTadills. And, as the old Swaine faid, ihe can unlocke The clafping charme, and thaw the numming fpell> If fhe be right invok't in warbled Song $ For maidenhood (he loves, and will be fwifc 85s

To aid a virgin fuch as was her felfe In hard befetting need , this will I trie And adde the power of fome adjuring verie.

Smgt

S fibrin* f aire

Ltflen where thou art /if ting • 860

Y&kt theglafsie, cook, tranjlucent wave,

In tmfied braids if iillies knitting

The Page Number. The 9 is battered. 836 reatd] Thus in all copies examined. 857 The loop of the a in hard is filled. 858 There is too little space between the words offome in all copies examined. 861 The ascender of the d in Vnder is bent. The type mark about three- quarters of an inch to the left of the signature is present in all copies examined. The catchword The is imprinted so severely that the letters look battered, but are not, and type marks appear under the entire word.

294 A MASK (1637) AND MANUSCRIPTS

The loofe trsfoe of thy amber-droppng hurt > Liftenfor it Are honours fake 6 oddejfe of the fdver lake 865

Lifien and fave. Liften and appeare to us In name of great Oceams^ By th earth flaking Nepttris mace And Tethys grave rnaj ei'ricke pace , 870

By hoarie Ntreus wrincled looke , And the Carfathianwifaxds hooke , "Eyfczlc Tritons winding flielL Andoldfooth faymgC^w^/fpell^ By Leucotheas lovely hands, 875

And her fon that rules the ftrands, By Thetis tinfel-flipper'd feet} ~> And the Tongs of Siren* facet 9 By dead Farthempc's deare tomb, And faire L*ged-s golden comb, 880

Wherewith ihe fits on diamond rocks Sleeking her loft alluring locks , By a'l the Nymphs that nightly dance Vponthy ft 1 earns with wilie glance, Rife, rife and heave thy rofie head 885

From thy coral-paven bed, And bridle in thy headlong wav£ Till thou our futnmon* anlwerd have.

Liften and fave,

Sabrimrifes attended by water Nimphes andjtxgs*

By the rttjhie fringed banke? . . 890

Where growes the willow and the efier dancke LMjJlidwg chariot ftaycS)

Thick

863 The dot over the i in traine looks like an accent mark in the Illinois copy; but it is a normal dot in most other copies examined. The h in thy is filled. There is a type mark over the comma at the end of the line. 880 The i in Ligea's barely printed, except at the bottom. 883 The second 1 in all barely printed. 884 The serif at the top of the r in ftreams is gone or failed to print. There is no dot over the first i in wilie. The catchword Thick is spelled Thicke on the following page.

A MASK PRESENTED AT LUDLOW CASTLE— 1637 295

( |i 5

Thicfa fet with agat , and the azttrm fluent Of turkku blew , and Mmronld greene

That in the channe/l fir ayes, 895

Whilftfrom ejfthe waters fleet Thus I fet my frintUjJe feet ore the cow/lips velvet head. That bends not as I tread, Gentle ftvainc at thy requefi 900

/ am here,

Spr* Goddeffe deare Wee implore thy powerfull hand To uadoe the cha, med band Of true virgin here diftreft, 905

Through the force , and through the wil? Of unBleft inchanter vile.

Sab. Shepheard tismy office beft To helpe infnared chaftitie $ Brightefl: Ladie lookc on me >. 910

Thus I fprinckle on th v breft Dropsthat from my fountainepure I have kept of preciouscure,. Thrice upon thy fingers tip, Thrice upon thy rubied" lip^ 915

Next this marble venom'd (cate Smear'd wkh gummes of glutenous heats I touch with chaft paimesmoift and cola, Now the fpellhath loft his hold* And I muft haft ere morning hourc 920

To waitein i^mfhitrite's bowre*

$dri#4

1 , ]

904 The slight r and e in charmed scarcely have a chance to print, coining as they do between so much sturdier letters. 906 In the Illinois copy, the le of wile can barely be distinguished from the indeterminate ink marks they make; but in other copies the letters are clear. 914 The top of the f in fingers has been broken off. 917 The second e in heate is badly battered or has had too much pressure put on it.

296

A MASK (1637) AND MANUSCRIPTS

Sabrim depends a»dihe JL&dk rifam of herfeate.

Spir. Virgin , daughter oiLocrim Sprung of old Anchifi)tib& May thy brimmed waves for this Their full tribute rever milTe From a thoufand peuienlls , That tumble downe the fnowie hills : St.moier drouth , or finged aire Never fcorch thy treffes f aire , Nor wet O&obers torrent flood Thy molten cryftail fill with mudde > . May thy billowes row le a fhoare The beryll, and the golden ore, May thy loftie head be crown'd With many a tower, and terrafle rouild , And here and there thy banks upon With grovesofmyrrhe,and cinnamon

925

930

Come Ladie white heaven lends us gface » Let us fly this curfed place, - Left the forcerer us intice - f* With fome other new deyicc Not a waft, or need efle found ' " Till we cometo holy er ground , I mall be your faithful! guide' ~ Through this gloom*- covert wide P" And not many furlongs thence Is your Fathers refidence , Where this night are met in ftate Many a frcind to gratulate

940

945

His

The Page Number. The 2 is much worn, and in the Illinois copy shows little lower serif. 928 The u in Summer barely printed. 932 The right hand element of the w in rowle is lacking or has failed to print, a fhoare] Thus, in all copies examined. 935 The n in round, is filled in the Illinois copy, but clear in other copies examined. 942 The 1 in needleffe failed to print in the Illinois copy, but is clear, though lightly printed, in other copies. 945 The e in gloomie barely printed. 949 The loop of the article a is clear, but the letter has filled above the loop.

A MASK PRESENTED AT LUDLOW CASTLE— 1637 297

<33)

His wiuYt prefcncc 5atidbefide 950

All the Swains that there abide ,

With liggs, and rurall dance refort,

Wee (hall catch them attheir fport*

And our fuddaine comming there

Will double all their mirth, and chere," 955

Come let us haft the ftarrs are high

But night fits monarch yet in the mid skic.

The Scene changes prefeming Ludlow MM And the Presidents Cafklejhen come in Comtrie dancers ^af- ter them the attendant Spirit with the two Brothers andtheLadie,

Song, Spir. Back jhepheards , back enough jour flay C9 Till next Sun-Jhine holiday , Here be without duck or nod, 96o

Other trippings to be trod Of lighter toes, andfuch Court gut fe As Mercury did JlrJi devife With the miming Dryades On the lawns , and on the leasl 965

This fecond Song praefents them

to their father and mother." |

Noble Lord, and Lady bright,

I have brought yee new delight , '

He* e behold (b goodly growne.

Three faire branches of your owne ,

Heav'n hath timely tri'd their youth , Q70

Their faith, their patience, andthtir truth,

F And

955 There is a type mark above the comma at the end of the line. 956 The h in haft is unlike . the regular h of this font. After line 965, the second line of the Stage Directions is followed by type and spacer marks. 968 The r in Here is faint and perhaps broken. The signature letter F has type marks below it, as has the entire bottom line of the text.

298

A MASK (1637) AND MANUSCRIPTS

/ /

<'34)

Andfent thim here through hardajfap With a crowne of dtathlejfe Praife,

To triumph in* wcJarieus dance OrefenfftaK fMly, and Intemperance.

975

980

985

The dancis ended, the Sprit EfiUgizts,

Spin To the Oceas now t flie , And thofe happie climes that lie Where day never fhuts his eye, Vp in the brpad fields, of the skfe? There I luck the; Kquid ayre AH amidol the* gardens faire Of Hefteruf, and his daughters three • That ling about the golden tree, Along the crifped fhades itand bowres ReveTts the fpruce' and }ocbndc Spring, The Graces > and the rpfie-bofom'd Howres- Thither all their bounties brings That there ^ternaJl ^um4^ dwells And weft wind%with muskie wing \ About the cedar'n alleys fling. Nard, and CafU*s. b^kpie, {metts. Iris there with Humla bow c Waters^ the odorous banks ^hat blow . Flowers of niorc mingled;hew Then her purfTd fcarfe can fficw, And ckenches with Mlyfim dew (Lift raortaIlsy,ify6&p westetiw^ ; y*i&\ Beds of Hyacinth, and roles ) Where young Jdfi#&®ft repo&sj Waxing well of his dfcep€ wouir* feflOrrfcfofiL and ©ft the groirf *Wt"te I' C

\ ■'

990

995

IOOO

972 The e in them is broken and barely printed. The last letter of affays in Morgan copy only looks more like e than s but this entire page in that copy has been abused, and it is very difficult to make sure of the last letter of this word. Other copies print s clearly enough. 1001 There are type marks under the last line and under the catchword. The catchword Sadly is smeared and shows type marks and water stains.

A MASK PRESENTED AT LUDLOW CASTLE— 1637 299

(35)

Sadly fits ttiJfyriaa Queene ;

But farrc above in fpangled fheene

Celcftiall Cupdhtt fam'd Sonadvanc't,

Holds his dearc Pfyche fweet intranet iqo5

After her wandring labours long,

Till free confent the gods among

Make her his asternal! Bride,

And from her faire unfpotted fide '

Two blifsfull twins are to be borne I ioio

Youth , and Ioy j fo love hath fwome?

But now orjrtaske is frnoothly done, ,1 can fly , or I can run Quickly to the greene earths end," Where the bow a welkin flow doth bend, 1015

And from thence can foare as foone To the corners of the Moone.

Mortalls that would follow me. Love vertue, flie alone is free, She can- teach yce how to clime 1020

Higher then the Sphame chime 5 Or if vertue feeble were Heav'n it felfc would ftoope to her-

Yhtfrincty&Uftrfinsifi this Maske 5 wire The Lord Br ac 1 y, VThe Lady Alice

Mr, Thomas Eo br tonJX Pp**™^

The Snd.

1010, ion, 1018, 1021, 1023 Note the type marks at the right hand ends of these lines. The Rule. The water stain from the pressure of the rule, set a little too high, put on the wet paper squeezing the water out to the amount recorded by the stains was dealt with in the note to the title page. The type marks almost surrounding the words below the rule, and further water stains above The End. and the type marks below this type indicate the great pressure put on this page.

300 A MASK (1637) AND MANUSCRIPTS

THE BRIDGEWATER MANUSCRIPT

PRESERVED AT BRIDGEWATER HOUSE, formerly Cleveland House, in London is a manuscript copy of the mask known as Comus, the property of The Earl of Ellesmere, who has granted permission for its reproduc- tion nere. This is the first time the manuscript has ever been reproduced ; indeed, it has never before been accurately transcribed and printed, the notes Professor Patterson assembled in the Columbia Milton, vol.1 1474 ff., being the most reliable treatment of its text yet printed. The manuscript was described by Warton, 1791 ; by Todd in his transcribed edition of 1798, largely dependent on Warton; by Lady Alix Egerton, who transcribed it, none too accurately, and printed the tran- scription in 1910 with a few collotype reproductions of certain pages; by Masson in the revised (1881) first volume of the Life, page 611, note 1, and again in the Poetical Works. It is best treated by D. H. Stevens {Modern Philology 24(1927) 315-320), who carefully described it and provided some information about its history. The manuscript is written in a secretary hand on quarter sheets of cap paper. Stevens assumed that it had not been written by Lawes; and it seems likely that it is a copy prepared at the instigation of the poet Milton, himself, by one of his father's professional scriveners. Certainly the lettering of the title page is beautifully professional, and the body of the text is fairly well done. The writ- ten ascription of the authorship on the title page to Milton is said to be written by the younger Egerton, who took part in the original performance. Wartime con- ditions have made any recent re-examination of the manuscript impossible.

The entire manuscript with a transcription is presented here without much comment, and in its original size. It should be carefully noted that many of the names introducing the speeches in the original are in red ink, and are therefore almost illegible at times, although clear enough at others. On each page of the original manuscript, to the left of the lines of handwriting, there is a ruled line, also in red ink. On some pages, this ruled line can be seen, even in reproduction ; but on others, as on the title page, the ruled red line is too faint to show in reproduction.

BRIDGEWATER MANUSCRIPT

301

WW

:1

f:l

->

V

"V,M* A»f),(»

./•/■* £5r/i&jvi

\^'

\

A Maske Represented before the right

blc

ho : the Earle of Bridgewater Lord president of Wales and the

ble

right ho : the Countesse of 5 Bridgewater./

. At Ludlow Castle the 29 of September 1634

re e*->

The chief e persons in the rep'sentacion were:/ The Lord Brackley

IO LheThady AUCel Egerton./

Mr 1 homas J 6 '

Author Jo: Milton./

P:i./i2./

302

A MASK (1637) AND MANUSCRIPTS

This page, the verso of the manuscript's title page, is blank in the original with only the black ink marks showing through the paper.

BRIDGEWATER MANUSCRIPT

303

10

15

20

/

I J ,' ~. a y CI

/

I

t/5v ypnjlA (jr^f* *w*fk+n

&%,yv«^ Jt'*»*+ *^*U& Upyt>

vOf

H

* \*

I

/

<

10

A Maske./ TAe _/irsJ sceane discovers a wild wood, then a guardian spiritt or demon descendes or enters, [may be comma]/

ffrom the heavens nowe J flye (975)

and those happy Climes that lye

Where daye never shutts his eye

up in the broad field of the skye./

there I suck the liquid ayre [there may be T

all amidst the gardens fayre blotted ; illegible] (980)

of Hesperus and his daughters three

that singe about the goulden tree./ [11. 983-86 not

there eternall summer dwells present] (987)

and west wyndes with muskye winge

about the Cederne allyes flinge

Nard and Casias balmie smells

Iris there with humid bowe

waters the odorous bankes that blowe

1 5 fflowers of more mingled hew then her purfld scarfe can shew yellow, watchett, greene & blew and drenches oft wth Manna dew Beds of Hyacinth and Roses

20 where many a Cherub soft reposes./

(99o)

[I do not understanc

marks in starfe

[Present only here

(995)

(998)

Before the starrie threshold of Joves Courte my Mansion is, where those immortall shapes

(1)

of bright

304

A MASK (1637) AND MANUSCRIPTS

25

30

35

40

45

K 1-^yj ***-"^^ Y^)vv^•b, J\&J**/$h4F+'L

v«v»

<<V>#

( 0

^w ^ *« ^«w-rr - <«**\ ^*> i^i^p- 4rjtua t-f^A. *&»

A,

*#i

VW£>/>Vi*

•* «o<M^F^t^f V**^ th&tiib g>M*rfh *ii«^.)r».'v4l£

fyi^WiMru^'

>^>TMAi*»>-

t avW< ^r^*^ ****>* It ,vv**v»+ ^j**r~(fyfh&4*x>#>ubl

of bright a[]reall spiritts live inspheard [what is second

in regions mylde of Calme and Cerene ayre vowel in

25 above the smoake and stirr of this dim spott aereal] (5) w** men call earth, and w°h low-thoughted Care Confinde and pestered in this pinfold heere strive to keepe vp a fraile fk fevourish beeings vnmindfull of the Crowne that vertue gives

30 after this mortall change to her true servants (10)

amongst the enthroned gods, in sainted seats [in may be on] yet some there be that with due steppes aspire to laye their just hands on that goulden keye that opes the pallace of /Eternitie: j

35 To such my errand is, and but for such (15)

J would [possibly woould] not soile theese pure ambrosiall weedes

wth the ranke vapours of this sin-worne nioulde but to my taske; Neptune besides the swaye of everie sake flood, and each ebbings streame

40 tooke in by lott, twixt high and neather Jove (20)

imperiall rule of all the Sea girt Jsles [perhaps Sea-girt) that like to rich and various gems in laye [perhaps inJaye] the vunadorned bosom of the deepe wch he to grace his tributarie Gods

45 by mm Course com mitts to severall goverment (25)

and gives them leave to weare their saphire Crownes and i&uld weild their little tridents; but this Jsle

the

BRIDGEWATER MANUSCRIPT

305

50

55

60

65

70

i/J £^_ 4L.Sk r Juliet rxL tvvtv4* * p/w*J*- ft* JbATA^i j^fc "**

fat. ««fc"" ^"^ ff;

/^ t*,^* <A ^*^ •£*"-

l&v^ h.

•^rww(

^/p /^M» v^**49/ *-*T><»»+t

or\\,& /(Aw- \Aild5cxr v-iu.*p~ ^X|fv«.

or^»v^>u

A^ -fr*

o*«V

/' '

jJ&rnviS" i«>.v» t^t -Kat^C ear ho

cat ■Ccro<v~<:

/

/

the greatest and the best of all the Maine he quarters to his blew haired dieties,

50 and all this tract that fronts the fallinge sunn a noble Peere of mickle trust and power has in his Chardge, wth tempred awe to guyde an ould and haughty nacion, proude in armes where his faire ofspringe nurst in princely lore

55 are cominge to attend tbeir fathers state and newe entrusted scepter, but their waye lies through the perplext paths of this dreare wood, ofs- cf. the noddinge horror of whose shadie browes l. 39]

threats the forlorne and wandringe passinger

60 and heere their tender age might suffer perill (40)

(30)

[looks like

off- (35) changed to

65

70

but that by quick commaund from soveraigne Jove [could J was dispatcht, for their defence and guard be

and listen why, for J will tell you now comannd]

what never yet was heard in tale or songe from old or moderne bard in hall or bowre

Bacchus that first from out the purple grapes crusht the sweete poyson of mis-vsed wyne after the Tuscane manners transformed coastinge the Tyrrhene shore, as the winds listed on Circes Jsland fell (whoe knows not Circe the daughter of the Sunn, whoos charmed Cup whoe ever tasted lost his vpright shape

and ■

(45)

[could be mariners]

(50)

306

A MASK (1637) AND MANUSCRIPTS

75

8o

85

go

95

Vto

' -4.1

ft '

Ui,<^ £4 h\& poll** yivjo-v Aw-K/vV h«»\£u4 *$Pi«*lim2>*

/it O^'Hf ^*v4;f ,y&m<£\

ff^ <t*

1

/ '

/'

and downeward fell into a grov[or wjelinge Swyne.) [period

This nimphe that gazed v[or w]pon his clustringe locks un- 75 wth Jvye berries wreath'd, and his blith youth certain]

had by him, ere he parted thence a sonne (56)

much like his father, but his mother more,

w*h [blot]erefore she brought vp and Comus [larger lettersf nam'd,

whoe ripe and frolick of his full growne age [full mark un- 80 roavinge the Celtick and Jberian fields known] (60)

at last betakes him to this ominous wood,

and in thick shelter of black shades inbowr'd

excells his mother at her mightie arte,

offringe to everie weary traveller

85 his orient liquor in a Christall glasse

to q"uench the drouth of Phebus, w°h as they taste (for most doe tast through fond intemperate thirst) soone as the potion workes their humane Countenance th'expresse resemblance of the Gods, is chang'd

90 into some brutish forme of Wolfe, or Beare, or ounce, or Tiger, Hogg, or bearded goate, | all other parts remayninge as they were and they soo[or e] perfect is their miserie not once perceive their fowle disfigurement

95 but boast themselves more comly then before; and all their freinds, and native home forgett to rowle wth pleasure in a se"nsuall stie

(65)

(7o) cf. Hesperus

1.7]

(75)

BRIDGEWATER MANUSCRIPT

307

ioo

105

no

115

u Ate

d ^V««i* Yw'^ Qb«&i* l-t nWO V»™\

ah*m^^ Aft **** S*vJ^v iWtUrJka ££ „>sfci;^

/ jC/ s*r f'^ / } Q / S — ^

Therefore when any favour'd of high Jove chaunces to pass through this advent'rous glade,

100 swift as the sparcle of a glan[or u]ncinge starre (80)

J shoote from heaven, to give him salfe convoy as nowe J doe: but first J must put off these my skye webs, spun out of Jris wooffe, and take the weeds and liknesse of a Swayne

105 that to the service of this house belongs (85)

whoe wth his softe pipe, and smooth dittied so'nge well knows to still the wild winds when they roare, and hush the wavinge woods, nor of less faith and in this office of his mountaine watch

no likeliest and neerest to the present ayde, (90)

of this occasion, but J heare the tread

"5

of hatefull stepps, J must be viewles nowe./

Exit

Comus enters w"1 a charminge rod in one hand & a glass of liquor in the other w"1 him a route of ~*-— -. monsters like men & women but headed like wilde beasts their apperell gli'st'ringe,[?] they come in makinge a riotous and vnruely noise w"1 torches in their hands./

Co: The starr that bids the shepheard fold (93)

now the top of Heaven doeth hold,

and the gilded Carr of daye (95)

his glowinge axle doeth allaye

in the steepe Atlantique streame

and

308

A MASK (1637) AND MANUSCRIPTS

120

125

130

135

140

As li'i awAm» Ma. $i& ^«<J^

v**.*

H*

kf fr **^

wlr^ c^ \e*

*VS,

iox> •

Aio/w?i '4v~tff ****>*» w A*36£*>n^i5- moHu« iW/^6;

i?^ /t*>404

	and the slope sun his v[or w]pward beame			Wee that are of purer fire
	shoots against the Northerne Pole			imitate the starrie quire
120	pacinge toward the other goale of his Chamber in the East	(100)		whoe in their nightly watchfull sphears leade in swift round the months & years,
	meane-while welcome, Joye & feast,		•35	the sounds and seas with all their finnie drove	(115)
	midnight shoute, and revelry			nowe to the moone in waveringe morrice move,
	tipsie dau[or n]nce and Jollitie,			and on the tawny sands and shelves
125	braide your locks[or e] wth rosie twine droppinge odours, droppinge wine	(105)		trip the pert fairies, and the dapper Ealves by dimpled brooke, and fountaine brim
	Rigor now is gone to bed. [perhaps ,]		140	the wood nimphs decte with daisies trim	(120)
	and advice wth scrupulous head,			their merry wakes & pastimes keepe
	strict age, and sovre severitie			what hath night to doe with sleepe
130	wth their grave sawes in slumber lye	(no)		night

BRIDGEWATER MANUSCRIPT

309

145

150

155

160

165

t«wu*

no&'

/

Aoa

4f fcW ^l^ J<, &^;

i/JM «*^ ****-£*y ^ $<'& Af,

L/ C 0 (1- ' 1?

'tt~& ****** A*uw/W* « '* Hr^ 'V-i«.«Hoa«. ^L^jj/O-

Mvr

4 I

t ffL* «Qlfc f**&«f^ ****** ^°^ 4® T***»*

own-

Night has better sweets to prove

Venus now wakes, and wakens love, 145 Come let vs our rights begyn . (125)

tis only 'day light that make [or s] suf

w°h these dun shades will neere report

haile goddess of nocturnall sport

Darke-vayld Cotitto, whome the secret flame [extra space L50 of mid night torches burne misterious dame before whome]

that neere art call'd but when the dragon woombe (131)

of stigian Darknes, spetts her thickest gloome, [caps in

and makes one blot of all the aire, words 2 & 3?]

staye thy cloudie Ebon chaire 155 wherein thou rid'st with Hecatt' and befriend ('35)

us thy vow'd preists till vtmost end

of all thy dues be done, & none left out

ere the blabbinge Easterne scoute

the nice morne on the Jndian sfeepe 160 from her Cabin'd loopehole peepe, (140)

and to the tell tale sun descrie

our Conceal'd scflempnitie,

come knitt hands & beate the ground

in a light fantastick round./

The measure in a wild, rude, & wanton Antick./ 165 Co: Breake of, breake of, J feele the different pace (145)

of some chast footinge, neere about this ground

run

310

A MASK (1637) AND MANUSCRIPTS

170

i75

180

185

190

)

TMK

,J

r c >n C ^ c 1 v /O 1 «>

Xiw,<S awv .juft««lt» wIa&C Ltljfe ^fWxJ*

,*uJC hrtvP^AJy ^/V*y)Jp* MjJfiyWAC k4Hfrf& '

/V*>

run to your shrouds w^in these brakes & trees/ /Aey a// scattre [or er]

our number may affright; some virgin sure

(for so J can distinguish by myne arte) 170 benighted •ewe in these woods, now to my Charms (150)

and to my wilie traynes, J shall ere longe

be well stockt with as fayre a heard as graz'd

aboute my mother Circe, thus J hurle

my dazlinge spells into the spungie aire 175 of powre to cheate the eye with bleare illusion ('55)

and give it false presentments, least the place,

and my quainte habitts breede astonishment

and put the damsell to suspitious flight,

w*h must not be; for thats against my course,

180 J vnder fayre pretence of freindly ends (160)

and well plac't words of gloweinge Curtesie bayted with reasons not vnplausible winde me into the easie harted man, and hug him into snares, when once her eye

185 hath met the vertue of this magick dust (165)

J shall appear some harmles villager

whome thrifte keeps vp about his Countrie geare [not in but heere she comes, J fayrly step aside 1673]

and hearken if J may her businesse heere The lady enters

190 La This waye the noise was, if my eare be true

my best guyde nowe, methought it was the sound (170)

of

BRIDGEWATER MANUSCRIPT

311

195

200

205

210

215

4'P* !&/»4iM»4i i)/P* «&**? ^t

n Oik i4va,u.«

it r~» -fef ■/" 0|> d/u^v- * /'p. 23? > Ju^Qfy ***- 4vQ1**Um**'

V)T

...

^ /

/

195

200

of riott and ill-manag'd merriment

such as the iocond flute or gamesome pipe

stirrs vp amonge the mk loose vnlettered hindes

when for their teeminge flocks and granges full

in wanton dau[or n]nce they praise the bounteus Pan (175)

and thanke the Gods amisse, J should be loath

to meete the rudenes, and swill'd insolence

of such late wassailers; yet o where els

shall J BMflwwwii informe my vnacquainted feete

in the blinde mazes of this tangled wood, (180)

my brothers when they sawe me wearied out

with this longe waye, resolvinge heere to lodge

vnder the spreadinge favour of these pines,

205

210

215

stept as they s'ed, to the next thickett side

to bringe me berries, or such coolinge fruite (185)

as the kynde hospitable woods provide

but where they are, and why they come not back (190)

is now the labour of my thoughts, tis likeliest

they had ingaged their wandringe stepps too farr

and envious darknesse ere they could returne

had stolne them from me./ (T94)

J cannot hollowe to my brothers, but (225)

such noise as J can make to be heard fardest

J'le venture, for my new enliv'n'd spiritts,

prompt me, and they perhaps are not farr hence, (228)

312

A MASK (1637) AND MANUSCRIPTS

220

225

230

frl&y* hrfto^btt- +\* to oS&r& /»*&<>

uw~auo *wut-e>rf 'V*^

^\voH4^ Qjor-HUr «|t^£h^ Jkoxrtl** |« AUtf^v*-**

ho'vM.i&Mtn

235

eh K/W*

Songe I

Sweete Echo, sweetest nymphe that liv'st vnseene (229) within thy ayrie shell by slowe Meanders margent greene 220 and in the violett imbroderd vale

where the love-lorne nightingale nightly to thee her sad song mourneth well,

Canst thou not tell me of a gentle payre (235)

that likest thy Narcissus are 225 O if thou have

hid them in some flowrie Cave u tell me but where.

S weete Queene of parlie, daughter to the spheare (240)

soe mayst thou be translated to the skyes 230 And hould a Counterpointe to all heav'ns harmonies

Comus looks in & speakes

Co Can any mortall mixture of Earths mould (243)

breath such divine enchauntinge ravishment sure somethinge holye lodges in that brest (245)

and with these raptures moves the vocall ayre 235 to testifie his hidden residence

how sweetely did they floate vpon the wings of silence, through the empty vaulted night, at every fall smoothinge the raven downe (250)

of

BRIDGEWATER MANUSCRIPT

313

240

245

250

255

260

1 jk£^ iJt^(Jik Q(L*4£Uk

\vti& ,*»&*>** -txpj, iwvtr o*5^*i^^0-rfti|<k«<A /<&Of- ^CvtOi /Xv| Af*^ Jfc&fat**-, «*>r»«A *»#j#- X^u£ rfo$ *&V $Avfacre-yDA#>&i *{+V **ku+i<M*

tv7f-XV

IPVO

/

4^**4*\U«m &*&>

/tiffin 4~>rv^ K*v m^CT/^^JJ

'?V

£/

240

245

250

of darkness till she smil'd, J hav[or u]e oft heard

my mother Circe with the Sirens three

amidst the flowrie-kyrtled Niades

cullinge their potent herbs and balefull druggs

whoe when they sung, would take the prisond soule (255)

and lap it in Elisium, Scilla wept

and chid her barkinge waves into attention

and fell Caribdis murmurd soft applause

yet they in pleasinge slumber lulld the sence

and in sweete madnes rob'd it of it selfe, (260)

but such a sacred and homefelt delight

such sober certentie of wakinge bliss

J never heard till now, Jle speake to her

255

260

and she shalbe my Qweene; Haile forreigne wonder whome certaine these rough shades did never breede (265) vnless the goddess that in rurall shrine dwel'st heere with Pan or Silvan, by blest song forbiddinge every bleake vnkindly fogg to touch the prosperinge growth of this tall wood La: Nay gentle Shepheard, ill is lost that praise (270) that is addrest to vnattendinge eares not any boast of skill, but extreame shifte how to regayne my severd Companye Compeld me to awake the Curteus Echo to give me answer from her mossy Couch (275)

Co. • what

314

A MASK (1637) AND MANUSCRIPTS

265

270

275

280

285

290

t ,

<VV )/{«■»/ A0«Aww%

au^o^ fy&' f*fi+, +*\w* %f ftf6d-M6eil& *

ry»

<. I?' "/?»$

t, . ?i /l r /, J. ... ,7- a UuA^J

LTA+b ft '/Jrfcnr A ^Ov ^ ^H 1 &«-

Co: What Chau[or n]nce good lady hath bereft you thus?

265 La: dym darknesse and this leavye laborinth

Co: Could that devide you from neere vsheringe guydes?

La: they left me weary on a grassie terfe

Co: by falsehood, or discurtesie, or why? (280)

La: to seeke in the valley some coole freindly springe

270 Co: and lefte your fayer side, all vnguarded ladye?

La: they were but twaine & purpose [or s'd] quick returne,

Co: perhaps forestallinge night prevented them

La: how easie my misfortune is to hit! (285)

Co: imports their losse, beside the present neede?

275 La: noe lesse then if J should my brothers loose

Co: were they of manly prime, or youthfull bloome?

La: as smooth as Hebes their vnrazor'd lipps.

Co: Two such J sawe, what tyme the labour'd oxe (290) in his loose traces from the furrowe came

280 and the swink't — hedger at his supper sate, J sawe em vnder a greene mantlinge vyne that crawles alonge the side of yon smale hill pluckinge ripe clusters from the tender shoots, (295)

their porte was more then humane as they stood,

285 J tooke it for a faerie vision

of some gaye creatures of the Element

that in the cooleness of the raynebow live

and playe i'the plighted clouds; J was awe-strooke (300)

and as J past J worship't: if those you seeke

290 it were a Jorney like the path to heav'n

to

BRIDGEWATER MANUSCRIPT

315

295

300

305

310

3i5

3l©J* W*v>^ /V**/U« Mtiwi

i«w *»a^* A~f^K-

fZ fitor-ks&fr *AJ-«™\1 ./?.£<mW(

A>*Cr <W>^&<^ orM^^y *y*»* fay WwA*i* /

>£($***

helpe you finde them; La: gentle villager

what readiest waye would bringe me to that place?

Co: due west it rises from this shrubbie pointe, (305)

La: to finde out that good shepheard J suppose

295 in such a scant allowance of starr light would overtaske the best land pilots arte wthout the sure guesse of well practiz'd feete; Co: J knowe each lane, and every Alley greene, (310)

dingle, or bushie dell, of this wide wood,

300 and everie boskie bourne from side to side my daylie walks and antient neighbourhood and if your straye attendance, be yet lodg'd or shroud wthin these lymitts, J shall know (315)

ere morrowe wake, or the lowe rooster larke

305 from her thatcht palat rowse, if otherwise

J can conduct you ladie, to a lowe,

but loyall cottage, where you may be safe

till furder quest; La: Shepheard J take thy word (320)

and trust thy honest offer'd Curtesie 310 wch ofte is sooner found in lowly sheds

with smoakie rafters, then in tap'strie halls

and Courts of princes, where it first was nam'd

and yet is most pretended, in a place Iciii u* (325)

lesse warrented then this, or lesse secure 315 J cannott be, that J should feare to change it

Eye my blest providence, and square my tryall

to my proportion'd streingth; shepheard leade on.

The

316

A MASK (1637) AND MANUSCRIPTS

320

325

330

335

340

¥iir tr titers

<

4 d l** fc*,yt§~ <{^ft ..♦6/ "f ft &*- w tt vtt w<** h fern #

1

vi

*rfo

6

** /*>*£* -OxM^u s^ojwp^

; -©or /> «l£<<«tf safari

/flMA* 5

f

** &0* /•**■$ *MMJ***- «|> Vtimu|vM^ Lewi

£**>* Ud$frA$ X&r**, **"<>«*} f-nnfJ* SvaocJ JtVQftUl

'^^Lly^

FfoMA^/

^/y

r

c/

>

F'

£/: 6ro.

r/ze too brothers Vnmuffle yee fainte starrs, and thou faier nioone

320

325

330

that wonst to love the travailers benizon (330

stoope thy pale visadge through an amber cloude

and disinherit Chaos, that raignes heere

in double night of darkness, and of shades

or if your influence be quite damm'd vp (335)

wth black vsurpinge mists, some gentle taper

though a rushe candle, from the wicker hole

of some claye habitacion visite vs

wth thy long levell'd rule of streaming light

and thou shalt be our starr of Arcady (34°)

or Tirian Cynosure: 2 bro. Or if our eyes

be barr'd that happines might wee but heare

the folded flocks pen'd in their watled cotes

or sound of pastoral! reede with oaten stopps

or whistle from the lodge, or village Cock (345)

count the night watches to his featherie dames

335 t'would be some solace yet, some little cheeringe in this lone dungeon of inumerous bows, but O that haples virgin our lost sister where may she wander nowe? whether betake her (350) from the chill dewe, amongst rude burrs & thistles

340 perhaps some could banke is her boulster nowe or gainst the rugged barke of some broade Elme leanes her vnpillow'd head fraught wth sad teares or els in wild amazement and affright, (355)

sbe

BRIDGEWATER MANUSCRIPT

317

345

350

355

360

365

,0

\ — /

I

fair ini^iU^hyr^ii £mavJ* dff/m**

4vV juuft- frufr

V

%

soe fares as did forsaken Proserpine

345 when the bigg rowling flakes of pitchie clouds (357)

and darkness wound her in : El. bro. peace brother peace J doe not thinke my sister soe to seeke (365)

or soe vnprincipl'd in vertues booke, and the sweete peace that goodness bosoms ever

350 as that the single want of light and noise (not beinge in danger, as J hope she is not) could stirr the constant mood of her calme thoughts (370) and put them into misbecomminge plight vertue could see to doe what vertue would

355 by her owne radiant light, though sun & moone were in the flatt sea sunke, and wisdoms selfe of seeks to sweete retired solitude (375^

where, wth her best nurse contemplacion

she plumes her feathers, and letts grow her wings

360 that in the various bustle of resorte,

were all to ruffl'd and sometimes impayr'd

he that has light within his owne cleere brest (380)

may sit i'th Center, and enioye bright daye

but he that hides a darke sowle, & foule thoughts

365 walks in black vapours, though the noone tyde brand blaze in the summer solstice. 2 bro: tis most true that musinge meditacion most affects (385)

the pensive secrecie of desert Cell farr from the cheerefull haunte of men or heards,

and

318

A MASK (1637) AND MANUSCRIPTS

370

375

380

385

390

^ /f/) /- / / n

1 00. ^)U)0 ovJEXS ,y-0fS 4* U%\x<\% d lud XOitWf,

fits Jhj&p>M> Ao^lrr ^wtrp^^«^u4ui*A ^a^

V

f

^/ ^iW *#■/)«.( t^' "Hiauj f yWOM 4'tf <>**& 4c -fc*^

iff" fyi?nSS**^*'> v^ <**& wwL

370 and sitts as safe as in a senate house

for whoe would robb an hermitt of his weeds,

his few bookes, or his beads, or maple dishe (390)

or doe his graye haiers any violence?

but bew[or v or u]tie like the fayre hesperian tree 375 laden with bloominge gould, had neede the guard

of dragon watch with vninchaunted eye

to save her blossoms, and defend her fruite, (395)

from the rashe hand of bold Jncontinence,

you may as well spreade out the vnsum'd heapes 380 of misers treasures by an outlawes den,

and tell me it is safe, as bid me hope

dainger will winke at opportunitie (400)

and she a single helpeles mayden passe vniniur'd in this wide surroundinge wast

385 of night or lonelinesse, it recks me not

J feare the dread events that dog them both lest some ill greetinge- touch attempt the person of our vn owned sister. El bro. J doe not brother inferr as if J thought my sisters state

390 secure, wthout all doubt or question, no;

J could be willinge though now i'th darke to trie a tough encounter, with the shaggiest ruffian that lurks by hedge or lane, ofthis dead circuit to have her by my side, though J were suer

She

(4«5)

(408)

BRIDGEWATER MANUSCRIPT

319

395

400

I

#»'T|Tr»««

[\mm4-

'*^*CL^K'V r "a. bj- (^ <^Sh

405

410

415

*Ti> fro***- T"" ^V^Vy ***♦•**»* *

'Ju*A? W^^ 4 stuff i"

395 she might be free from perill where she is,

but where an equall poise of hope, & feare (409)

does arbitrate th'event, my nature is (410)

that J encline to hope, rather then feare, and gladly banish squint suspition,

400 my sister is not soe defencelesse left

as you immagine brother, she has a hidden strength wch you remember not, 2 bro. what hidden strength? vnless the strength of heav'n, if you meane that? (416) el:bro J meane that too: but yet a hidden strength

405 wch if heaven gave it, may be tearm'd herowne,

tis Chastitie, my brother Chastitie

she that has that is clad in compleate Steele',

and like a quiver'd nimphe with arrowes keene,

(420)

may trace huge forrests, and vnharbour'd heaths 410 infamous hills, and sandie perrilous wildes,

where through the sacred rayes of Chastitie

noe salvage, feirce, bandite, or mountaneere (4-5)

will dare to soile her vjrgin puritie,

yea even where, very desolacion dwells 4'5 by grots, & Caverns akup shag'd wth horrid shades (428)

and yawninge denns, where glaringe monsters house

she may pass on wth vnblensh't maiestie[doubtful ,] (429)

be it not done in pride orA presumption (430)

naye more noe evill thinge that walks by night

in

320

A MASK (1637) AND MANUSCRIPTS

420

425

430

435

440

445

MlV i tiJ An f,,

fill ' C

f,/f,b MitAU^V limy ,+M H»"fv^ ',.M(. f-4 ^v

^- * > ' ' i/ ' I ]f 1 ^

' jvfov*' /ifW* fii|f** v<iwt±nf , |*,y ^*^ rh*$

ftpsj&& !v»»vj** Clut^tU, U^^yp*

420 in fogg or fire, by lake or moorish ffen,

blew meager hag, or stubborne vnlayed ghost

that breaks his magick chaines at Curfew tyme

noe goblinge, or swarte fayrie of the mine (435)

has hurtefull power ore true virginitie,

425 doe you beleeve me yet, or shall J call

antiquitie from the ould schooles of Greece

to testifie the armes of Chastitie,

hence had the huntress Dian her dread bow (440)

faire silver shafter Queene, for ever chast

430 wherewith she tam'd the brinded Lyonesse

and spotted mountaine Pard, but sett at nought

the frivolous bolt of Cupid, Gods and men (444)

feard her sterne frowne, & shewas Queene o'th'woods

what was that snakie headed Gorgon sheild, [comma

435 the wise Minerva wore, vnconquer'd virgin doubtful]

wherewith she freezed her foes to congeald stone?

but rigid lookes of chast awsteritie

and noble grace that dasht brute violence (45°)

with sudden adoracion, and blanke awe 440 soe deere to heav'n is sainctly Chastitie

that when a sowle is found cinceerely soe

a thousand liveried Angells, lackey her

drivinge farr of, each thing of sfn, & guilte (455)

and in cleer dreame and solemne vision 445 tell if her of things that noe grosse eare can heare

till

BRIDGEWATER MANUSCRIPT

321

450

455

460

465

470

|.A ),^,04 4-^uv^^rj, IhtAyyf&'fi-

/

450

455

till oft converse with hevenly habitants

begins to cast a beame on th'outward shape

the vnpolluted temple of the mynde (460)

and turnes it by degrees to the soules essence

till all be made immortall, but when lust

by vnchast lookes, loose gestures, and foule talke

and most by lewde lascivious act of sin

letts in defilement to the inward partes, (465)

the soule growes clotted by contagion,

imbodies, and imbruts till she quite loose

the divine propertie of her first beeinge,

such are those thick, & gloomie shadowes dampe

oft seene in Charnell vaults, and sepulchers, (470)

hoveringe and sittinge by a newfmade grave

460 as loath to leave the bodye that it loved and linc'kt it selfe by carnall sensualitie to a degenerate, and degraded state./

2 bro: How charminge is divine philosophic (475)

not harshe and crabbed as dull fooles suppose

465 but musicall as is Appolloes lute 0

and perpetuall feast of Nectard sweets where noe crude surfeit raignes, EUbro: list, list, J heare some farr of hollowe breake the silent ayre (480)

2 bro: me thought soe too what should it be, El:b: for certaine

470 either some one like vs night founderd heere or els some neyghbour woodman, or at worst,

some

322

A MASK (1637) AND MANUSCRIPTS

Wf

475

<0-moM.

480

'^tJintfii

2/:'

485

490

k

0<YO&

some roavinge robber callinge to his fellowes;

2 &ro heav'n keepe my sister: agen, agen, & neere (485)

best drawe, & stand vpon our guard, El:bro. Jle hallowe

475 if he be freindly he comes well, if not

defence is a good Cause, and heav'n be for vs

he hallows and is answered, the guardian dxmon comes in habited like a shepheard./ El.bro. That hallowe J should knowe, what are you speake, come not too neere, you fall on Jron stakes els (490)

Dx: what voice is that? my young Lord? speake agen.

480 2 bro: O brother tis my fathers shepheard sure

el:b: Thirst? whose art full straynes have oft delayed the hudlinge brooke to heere his madrigall

and sweetned every muskrose of the dale, (495)

how camst heere good shepheard, hath any ram

485 slipt from the fould, or young kyd lost his dam or straglinge weather the pent flock forsooke how couldst thou finde this darke sequesterd nooke? De: O my Lov'd masters heire, and his next Joye (500) J came not heere on such a trivall toye

490 as a strayed Ewe, or to pursue the stealth of pilferinge wolfe, not all the fleecie wealth that doeth enrich these downes is worth a thought to this my errand and the Care it brought./ (505)

but O my virgin lady where is she

howe

BRIDGEWATER MANUSCRIPT

323

495

•^

500

505

5io

5i5

' AjC AW

? « {*ec t&*

•/

fcOd |*«W, C,J <j£nflS i\Q**> tfm+$fy f&** '

«\&*

V

/Uuttv

fLfi

ClSl I

495 howe chaunce she is not in your Companie?

El:bro: To tell thee sadly shepheard, wthout blame

or our neglect wee lost her as wee came,

De: Ay me vnhappie then my fearesare true./ (5'o)

El:bro: what feares, good Thirsis prithee briefly showe

500 De: Jle tell you, tis not vayne, or fabulous, (though soe esteem'd by shallowe ignorance) what the sage poets, taught by th' heav'nly muse storied of old in high immortall verse (515)

of dire Chimeras, and enchaunted Jsles

505 and rifted rocks, whose entrance leads to hell for such there be, but vnbeliefe is blinde, within the navill of this hidious wood

5io

515

immured in Cipress shades a sorserer dwells (520)

of Bacchus and of Circe borne, greate Comus deepe skild in all his mothers witcheries and heere to everie thirstie wanderer by slye enticement gives his banefull Cup with many murmurs mixt, whose pleasinge poyson (525) the visage quite transforfnes of him that drinkes and the inglorious likeness of a beast fixes insteed, vnmouldinge reasons mintage charactred in the face, This have J learnt tendinge my flocks, hard by i'th hillie Amir Crofts (530)

that

324

A MASK (1637) AND MANUSCRIPTS

520

525

530

535

540

545

£./<- ^vt-r^ 4]Wf 4*#*4tA mXlikyw

■ft:

V(VW<'^'

<IH

feu— ^J'frr?/& F/i

fax £j£& ■&■» <fa»- ooiyjl^r6j(£>iM'i*A \(ft>« *Xu« LsUilU 4* try b*wtfa- Lv<tj()*&]li&r

£*& Id ^7>y- *^ ^lw*/ ™^ *»** |w»** .

that browe this bottome glade, whence night by night 520 he and his monstrous route are heard to howle like stabled wolves, or tigers at their prey doeinge abhorred rites to Heccate

in their obscured haunts of inmost bowers, (535)

yet have they many baites and guylefull spells 525 to invegle, and invite the vnwarie seVice

of them that passe vnweetinge by the waye, this eveninge late, by then the chewinge flocks had tane their supper on the savorie herbe (540 )

of knot grasse dew-besprent and were in fold, 530 J sate me downe to watch vpon a banke with Jvie Cannopied and interwove with flauntinge hony sucle, and began wrapt in a pleasinge fitt of melencholy (545)

to meditate my rurall minstrelsie 535 till fansie had her fill, but ere a close

the wonted roare was vp amidst the woods and filld the aire with barbarous dissonance at w*h J ceast, and listned them a while till an vnvsuall stop of suddaine silence 540 gave respite to the drowsie frighted steeds

that drawe the litter of close-curtain'd sleepe at last a sweete, and solemne breathinge sound rose like the softe steame of distill'd perfumes and stole vpon the aire, that even silence 545 was tooke ere she was ware, & wisht she might deny her nature and be never more

still

(55o)

(555)

BRIDGEWATER MANUSCRIPT

325

550

555

560

565

570

i\r#

4u& tube «** If f&rtoMM. IrA yw*»W *vdnle «<\6*S$ ^J&H -Priori tU o\y JkA^j £ui 0 &»*Lm '

£ir

-till yuy^-** 6^ it^M* &&V* 7)+*^

*vf

«M«tr Y>

.<r.

X*X*<

It /«' I'K PM(H L / 4 /

still to be soe displac't, J was all eare

and tooke in th streines that might create a sowle (560)

vnder the ribbs of death, but 0 ere long

550 two well J might perceive, it was the voice of my most honor'd lady, your deere sister amai'd J stood, harrbw'd with greife, & feare, and 0 poore hapless nightingale thought J (565)

how sweete thou singst, how neere the deadly snare,

555 then downe the lawnes J ran wth headlonge hast through paths and turnings, often trod by daye, till guyded by myne eare, J found the place where that damn'd wizard hid in slye disguise (570)

(for soe by certaine signes J knowe) had met

560 alreadie eare my best speede could prevent

the aideless innocent ladie his wisht prey

whoe gently askt if he had seene such two,

supposinge him some neighbour-villager, (575)

longer J durst not stay, but soone J guest

565 yee were the two she meant, wth that J sprung into swift flight, till J had found you heere but furder know J not; 2:bro O night & shades how are you ioyn'd with hell in triple knott (580)

against the vnarmed weaknes of one virgin

570 alone, and helpeless, Js this the confidence?

you gave me brother? el:bro: yes & keepe it still leane on it salfly, not a period

shalbe vnsaid for me, against the threats (585)

of

326

A MASK (1637) AND MANUSCRIPTS

■■■ . .'.'

■■■■■■■iiB

575

580

585

590

595

♦A, ^rtnaj* I440M j£tf *U'«w *■ ^ ( t4, ** L

i.'UA*) If4**

ft fyf "ff *(*"*}* <****, X*& <4u** rf Ue« *~ /^£y)Vrfl / VM/» Sp* -* !^ /*» J *ft*X t toil ,

&V04Ji

7.

l r\ I 0 iS m /) /? Cp[. ~j' ft J * , . • /

t»&0lf£~ ^ $JL, &&.L& it- ,U

1\k4 (t4#v+

»«f!< MU

/•""f*

t^'

of malice, or of Sorcerie, or that powre 575 w6*1 erringe men call chaunce this J hould firmc virtue may be assail'd but never hurte surpris'd by vniust force, but not enthrall'd, yea even that wch mischiefe meant most harme shall in the happie triall prove most glorie, 580 but evill on it selfe shall back recoyle

and mixe noe more with goodnesse, when at last gather'd like scum, and setl'd to it selfe it shalbe in eternall restless change selfe fed, and selfe consum'd, if this fayle 585 the pillard firmament is rottennesse

and earth's base built on stubble, but come lets on: against the opposinge will, and arme of heav'n

(59o)

(595)

never may A this iust sword be lifted vp, (600)

but for that damn'd magitian, let him be girt

590 with all the grisley legions that troope vnder the sootie flagg of Acheron, Harpies, & Hydraes, or all the monstrous buggs twixt Africa, and Jnde, J'le finde him out (605)

and force him to restore his purchase back

595 or drag him by the Curies, and cleave his scalpe

downe to the hipps, Dem: Alas good ventrous youth J love the Courage yet, and bold emprise, but heere thy sword can doe thee little stead (6ro)

farr other armes, and other weopons must

be

BRIDGEWATER MANUSCRIPT

327

600

605

610

615

620

625

h

<wc JxJ^u jtifo ^ . -g-y -tw ^7

i,.,,, <«tf fay- ^rr 7r"X'1 ", A : r rf A

Wr UmlH

\

fi

<Tl f*^7V

600 be those that quell the might of hellish Charmes, he with his bare wand can vnthred thy ioynts and crumble all thy sinewes, El:bro: why prithee

shepheard how durst thou then approach soe neere, (615)

as to make this relacion ; Dem: Care, & vtmost shifts

605 how to secure the lady from surprisall

brought to my mynd a certaine shepheard lad

of smale regard to see to, yet well skill'd

in every verteus plant, and healinge herbe (620)

that spreades her verdant leafe to th'morninge ray,

610 he lov'd me well, and oft would begg me singe,

wcb when J did, he on the tender grasse [J written over he] would sit, and hearken even to extasie

and in requitall open his letherne scrip, and shew me simples of a thousand names

615 tellinge their strange, and vigorous faculties, amongst the rest a smale vnsightly roote but of divine effect, he c'ull'd me out the leafe was darkish, and had prickles on it, he call'd it Hemony, and gave it me,

620 and bad me keepe it as of soveraigne vse

gainst all anchauntments, mildew blast, or dampe,

or gastlie furies apparition,

J purst it vp, but little reckoninge made

till now that this extremitie compell'd,

625 but now J finde it true, for by this meanes

J knew

(625)

(630) (637)

(640)

328

A MASK (1637} AND MANUSCRIPTS

630

635

640

645

)

^•/fw<*N irt ;<t/vv ^^4 »>««$< '/» u<£ i>'^/

(0* • *¥**/> xjr

Z'ir^ *{f

< ■ t}

v

A*

■ *<* <*pe $rj> ^u.^ *d ^;mCu />**«^U L^./lZ OfJ. yOi y // n } p .4SC

viA* t/»Ju*, i^ ff** vi£**b. A. fJ> JL */> f &ty-

J knew the foule Enchaunter, though disguis'd

entered the very lymetwiggs of his spells (645)

and yet came off, if you have this about you

(as J will give you when wee goe) you may

630 boldly assaulte the Negromancers hall,

where if he be, with dauntlesse hardy-hood

and brandisht blade, rushe on him, breake his glasse (650)

and shed the lussious ljquor on the ground,

but cease his wand, though he and his curst crew

635 fierce signe of battaile make, and menace high or like the sonns of Vulcan vomitt smoake yet will they soone retire, if he but shrinke. (655)

El:bro Thirsis leade on apace, J followe thee and some good Angell beare a shield before vs.

The Sceane cfiatiges to a stately pallace set out w'k all manner manner of delitiousness, tables spred with all dainties Comus appears w"1 his rabble, and the lady set in an inchaunted chayre, to whome he offers his glasse wch she puts by, and goes about to rise./

640 Co: Nay ladye sit, if J but wave this wand (058)

your nerves J are all chain'd vp in alablaster and you a statue, or as Daphne was (660)

roote bound, that fled Apollo. La: foole doe not boast thou canst not touch the freedome of my mynde

645 with all thy charmes, although this corporall rind thou hast immanacl'd, while heav'n sees good, Co: Whye are you vext ladie, why doe you frowne (665)

heere

BRIDGEWATER MANUSCRIPT

329

650

655

660

665

670

/yv»

.C

AM

£4 &* /«* /u* ^ Hsr* 7r '

£>*• ^it/til £"«>* **&Ujfyj[»J+Jt*&+r'

^»±fbfa-^ '£"•• %G~& ****** iU Qjf M£***f*r**r* IT?*'**"* &^f

■£•

/

1W*

heere dwell noe frownes, nor anger, from these gates

sorrowe flies farr, see heere be all the pleasures 650 that fansie can begett on youthfull thoughts

when the fresh blood grows lively, and returnes

briske as the Aprill budds in primrose season. (670)

and first behould this cordiall Julep, heere

that flames, and dances in his christall bounds, 655 with spiritts of baulme, and fragrant sirrops mixt;

Not that Nepenthes wch the wife of Thone

in Egipt gave to Jove-borne Hellena (675)

is of such power to stirre vp Joye as this

to life, soe freindly, or soe coole too thirst, (677)

660 poore ladie thou hast neede of some refreshinge

that hast been tired aldaye without repast, (687)

a timely rest hast wanted, heere fayre Virgin

this will restore all soone; La: t'will not false traytor

twill not restore the trueth and honestie (690)

665 that thou hast banisht from thy thrmght'- tongue wth lies, was this the Cottage, and the safe aboade thou touldst me of? what grim aspects are these? these ougley headed Monsters? Mercie guard me, hence with they brewd enchauntments, fowle deceaver (695)

670 were it a draffe for Juno, when she banquetts (700)

J would not taste thy treasonous offer, none but such as are good men;[?] can give good things, and that \vch is not good, is not delitious to a well govern'd and wise appetite;

Co:

330

A MASK (1637) AND MANUSCRIPTS

675

680

685

690

695

700

u

CJA) / # ^ it' «/ 5 * /

M**/

/r/lfil A'A/Y1

U &*♦# J?«Hr p^, A*^ ffav^l **«iru. »m<*v 4^ r/

» - r« rv*» »• 1 wr,r/^ v«%v*» *»***^( !(*<** '"P*'** W ^

KtT;

*<*

'^

675

680

685

(705)

(710)

Co: O foolishnes of men, that lend their eares

to those budge Doctors of the Stoick &mk. furr

and fetch their precepts from the Cinick tub

praisinge the leane, and shallow abstinence;

wherefore did nature power her bounties furth

with such a full, and vnwithdraweinge hand,

coveringe the earth with odours, fruits and flocks

throngeinge the seas with spawne innumerable

but all to please, and sate the Curious tast,

and set to worke millions of spinninge wormes

that in their greene shopps, weave the smoote[?]-haired silke

to deck her sonnes, and that noe corner might (716)

be vacant of her plentie, in her owne loynes

she hutch 't th'all worshipt oare, and pretious gems

to store her childeren with if all the world

690 should in a pet of temperance, feede on pulse (720)

drinke the cleere streame, and nothinge weare but freeze th'allgiver would be vnthank't, would be vnprais'd not halfe his riches knowne, and yet despis'd and wee should serve him as a grudgeinge Master,

695 as a penurious niggard of his. wealth (725)

and live like natures bastards, not her sonns, who would be quite surcharg'd wth her owne waite and strangl'd with her vast fertillitie, th'earth cumberd, and the wing'd ayre dark'd wth plumes

700 the heards would overmultitude their Lords (730)

the sea orefraught would swell, and th'vnsaught diamonds

would

BRIDGEWATER MANUSCRIPT

331

705

710

7i5

720

725

i

*

**»

-f cX »m XltiL. wt-A /xy*+, IsUtArirtt djlit

/kA ,w<hfW iW>*«*- t»*MJU* /o cktrik+irftnifa-

/OT,«w.k»» **■&».- /£{*•/, ;,„/,„./ /

64 ft* Xr. »#„-* £ ^ /&, /V„. ^ .

*^

°/* [*?&*+ -tfii*^* + v/<**«+& .

4/ r /,JCVv"*' tpih.*"

K0 )0 \M>ry.4> MmjM

7

H« />!

/tti**4

t&i

would soe emblaze with Starrs, that they belowe

would growe enur'd to light, and come at last

to gase vpon the sunn with shameles browes. (735)

705 /a: J had not thought to have vnlockt my lipps (755)

in this vnhallowed ayre, but that this Jugler would thinke to charme my Judgement, as my eyes obtrudinge false rules prank't in reasons garbe. [.probably a J hate when vice can boult her arguments blot]

710 and vertue has noe tongue to check her pride. (760)

Jmposter doe not thinlrr charge most innocent nature as if she would her children should be riotous with her abundance, she good Chateresse means her provision onely to the good,

715 that live accordinge to her sober lawes, (765)

and holy dictate of spare temperance.

Jf every Just man that now pynes with want

had but a moderate and beseeminge share

of that wch leudly-pamper'd luxurie 720 now heap's vpon some fewe, with vast excesse (770)

natures full blessinge, would be well dispenst

in vnsuperflous even proportion,

and she noe whit encomberd with her store:

and then the giver would be better thank't 725 his praise due payed, for swinish gluttonie (775)

neere looks to heav'n, amidst his gorgeous feasts

but wth beesotted base ingratitude

crams, and blaspheames his feeder, Co: Come, noe more

this (778-805)

332

A MASK (1637) AND MANUSCRIPTS

730

735

740

745

750

1+fif1 /»*+** /*w& £&tll+ £§yxy»4-

€gsf&4rMlwi <w$ffl*»»fa f»&&£»* «J$ &<$!&.

rg

(806)

730

735

(810)

this is meere morrall babble, and direct

against the Canon lawes of our foundacion

J must not suffer this; yet tis but the lees

and setlinge of a mellancholy bloud,

But this will cure all streite, one sip of this

will bath the droopinge spiritts in delight

beyond the blisse of dreames. bewise, and tast; The brothers rushe in with swords drawne, wrest his glasse of liquor out of his hand, and breake it against the ground his rowte make signe of resistance, but are all driven in, the Demon is to come in with the brothers./

De: What have yee left the false Jnchaunter scape? (813)

O yee mistooke, yee should have snatcht his wand,

and bound him fast, without his rod reverst (815)

and backward mutters of disseveringe power

740 wee cannot free the lady that sitts heere in stonie fetters fixt, and motionlesse. yet staye, be not disturb'd, nowe J bethinke me some other meanes J haue that may be vsed (820)

woh once of Millobeus(or Millebeus) old J learnt

745 the soothest shepheard that ere pipt on playnes There is a gentle Nimphe not farr from hence that wth moist Curbe, swayes the smoote seavernc streame, Sabrina is her name, a virgin pure, (825)

whilome she was the daughter of Locrine

750 whoe had the scepter from his father [e & r mixed] Brute, she guiltless dam'sell, flyinge the mad pursuite

of her

BRIDGEWATER MANUSCRIPT

333

755

760

765

770

775

ttd* wdfj* %* fa&l*' A ^ ** ^ r ' * * M'£

r M*rkA8 &&$ /&*<* ~<k c*tf&«wt • 7

AkKL rv \<&p*<y9 +«l~/( *i***+ vwiivwl/^. ^xWy>

» »

v*-

755

760

of her enraged stepdame Gwendolen

commended her faire innocense to the floud, (830)

that stayed her flight with his Crosse floweinge course,

the water nimphs that in the bottom played

held vp their peac[or rjkled wrists, and tooke her in

bearinge her straite to aged Nereus hall

whoe piteous of her woes, reard her lanke head (835)

and gave her to his daughters to imbath

in nectar'd lavers, strewd with Asphodill

and through the portch and inlet of each sence

dropt in abrosiall oyles, till she revived

and vnderwent a quick immortal change (840)

made goddess of the River, still she retaines

765 her maiden gentleness, and ofte at Eve

visitts the heards alonge the twilight meadowes helpinge all vrchin blasts, and ill luck signes that the shrewd medlinge Elfe delights to make, (845)

for w°h the shepheards at their festivalls (847)

770 Carroll her goodnes loud in rustick layes

and throwe sweete garland wreaths into her streame of pancies, pinkes, and guady daffadils (850)

[may be . after daffadils but not certain] and, as the ould swayne said, she can vnlock the claspinge Charme, and thawe the numminge spell

775 if she be right invok'd in warbled songe:

for maydenhood she loves, and wilbe swifte

to ayde

334

A MASK (1637) AND MANUSCRIPTS

780

785

790

795

800

{cruris / . 0/ (J

v /

t

n

-*-fh*/u&vl&fi} JS

/

/W-ifvvH*'

f\ _ I i . i ■ • t IJO . >i? 1 l/. it .

to ayde a Virgin such as was her selfe (855)

(in hard besettinge neede) this will J trie and add the power of some adiuringe verse./ Songe./ 780 Sabrina faire ^ (858)

listen where thou art sittinge vnder the glassie, coole, transelucent wave (860)

in twisted braides of lillies knitting the loose traine of thy Amber-droppinge haire; 785 listen for deere honors sake

Goddess of the silver lake

Listen & save./ (865)

The verse to singe or not. listen and appeare to vs (866)

in name of greate Oceanus, 790 by th'earth-shakinge Neptunes mace, and Tethis grave maiestick pace, El bro: by hoarie Nereus wrincled looke, and the Carpathian wizards hooke, 2 bro: by scalie Tritons windinge shell, 795 and ould sooth-sayinge Glaucus spell, El br: by Lewcothoas lovely hands, and her sonne that rules the strands, 2 bro: by ^^Thetis tinsel-slipperd feete, and the songs of sirens sweete, 800 El br: by dead Parthenopes deare tombe,

(870)

(875)

and

BRIDGEWATER MANUSCRIPT

335

805

810

815

820

(#,. /& ft* Qf£^*(l*{ *f .f+q £?*£,' *"*«* . J/J, vxfc, A«<& &»•<»+ *£}**{*' $*•**

s

/ 1 /) y

C$«M .fill <V*WfH** -Jv/tttrji+A &/>»*&& , ->-

^ V^U«v^*pr»™<!tf £ffl \».M«*of A*4*lt^l* O^L^v $6*0- \\\y J\ytf»MMr& <\Mw*Mu>#' ^A-Xky/^4 f

vo&a£\*»» £kjct <>^W /&♦**

c2

and fayer Ligeas golden Combe,

wherewith she sitts on diamond rocks, (880)

sleekinge her soft alluringe locks,

De: By all the Nimphes of nightly dau[or njnce,

805 vpon thy streames with wilie glau[or n]nce,

rise, rise, and heave thy rosie head,

from thy Corall paven bed, (885)

and bridle in thy headlonge wave,

till thou our summons answered have,

810 Listen & save.

1/

Sabrina rises attended by the water nimphes

and singes./

By the rushie fringed banke (889)

where growes the willow, and the Osier danke (890)

my slydinge Charriott stayes, Thick sett with Agate, and the Azur'd sheene 815 Of Turkiss blew, and Emerald greene that in the Channell strayes, Whilst from of the waters fleete (895)

thus J rest my printles feete ore the Couslips head 820 that bends not as J tread

gentle swayne at thy request

J am heere (900)

De:

336

A MASK (1637) AND MANUSCRIPTS

825

830

835

840

845

£

/)^ Y 'I ^ / 0 9 n ' " f) -i

■ y\ / I, I .^_ / *

4-f W&vr&jtA \JAc^^ffaf\*<ri ijoyv&v—

wv/wAer**'

if;

ft^ &»*&/& fy*-,

Mil £D*t w\fl «rf-

o

	De: Goddess deere	(901)		next this marble venom'd seate	(9<5)
	Wee ymplore thy powerfull hand			smeard with gumms of gluttonous heate
825	to vndoe the Charmed band			J touch with chast palmes, moist,	& could
	of true virgin heere distrest		840	now the spell hath lost his hold
	through the force and through the wile	(905)		and J must hast, ere morninge howre
	of vnblest inchau[or n]nters vile.			to waite in Amphitrites bower	(920)
	Sab: Shepheard tis my office best				Sabrina descends and
830	to helpe ensnared Chastitie,			De: Virgin daughter of Locrine	the lady rises out
	brightest lady looke on me,			sprung of ould Anchises lyne,	of he seate. [he is
	thus J sprincle on this brest	(910)	845	may thy brimmed waves for this	not certain]
	drops that from my fountayne pure			their full tribute never misse
	J have kept of pretious Cure,			from a thousand pettie rills	(925)
835	thrice vpon thy fingers tip, thrice vpon thy rubied lip,			that tumble downe the snowie hill	S yj summer

BRIDGEWATER MANUSCRIPT

337

850

855

860

865

870

• »

MV0»V .

?***»

* &*

St

t Jn Iff, £, v+*<.+r^»4 ■»'<><>"

j; 7

r>

\

	Summer, drouth, or singed aire	[ist ,	is doubtful]		least the Sorcerer vs intice
850	never scortch thy tresses fayer nor wett Octobers torrent floud thy molten Cristall fill with mud may thy billowes rowle a shoare the beryll and the goulden Oare			(93o)	865	wth some other newe device, not a wast or needles sound till wee come to holier ground De: J shalbe your faithfull guide through this gloomie Covert wide,	(94o)
855	may thy loftie head be Crownd with many a towre, and terrace round and heere and there thy bankes vpon with groves of mirhe and Cynamon.			(935)	870	and not many furlongs thence is your fathers residence, where this night are met in state many a freiAd to gratualte	(945)
	sister	songe enas./		his wisht presence, and beside
	El bro: Come lady «bM> while heav'n	lends vs	grace			all the swaynes that neere abide	(950)
860	let vs fly this cursed place					with

338

A MASK (1637) AND MANUSCRIPTS

875

880

885

fa\4~r

/

OriwArt «%ivivr^ Onc/c lt~&

i>/*l /***{$- JAWf c^^vrf , \ \>4-\u ffti \*u4 Jfc*

^-\^^ /rfAu^ t+r^vM|>5/ -kc^ ti * /$*ii>^ Wa*^/** \h>rrc¥.&-

A«& 4ff>/hQ«5p>&Ak ^idU^fiQ^ ^^/^AfaHsM'^

'/

V Mo&

fatr -tr*

*r>nl

H

iU(^

i W' <\ ^0" Av> If I *<< u< /v ^ vv fan J«*> V /?

ftSn?^

with Jiggs, and rurall dau[or n]nce resorte

wee shall catch them at this sporte, 875 and our suddaine Cominge there

will double all their mirth, and cheere,

el br: come let vs hast the starrs are high (955)

but night sitts Monarch, yet in the mid skye The sceane changes then is presented Ludlow towne and the Presidents Castle, then come in Countrie dau[or n]nces, and the like &c, towards the end of these sports the demon with the 2 brothers and the ladye come in. the spiritt singes./

Back shepheards, back, enough your playe (957)

880 till next sunshine holy daye

heere be without duck, or nod

other trippings to be trod (960)

of lighter toes, and such court guise

as Mercurie did first devise 885 with the mincinge Driades

on the lawnes, and on the leas

2 songe presents them to their father & mother./

Noble Lord and Lady bright (965)

J have brought yee new delight heere behould soe goodly growne

three

BRIDGEWATER MANUSCRIPT

339

890

895

900

905

•rw 4xxUf^ff vnv- <j| ******* iud) 4*W- hr^kf

0-VM5

f

7,

X7 //

U*V*"d~

-J

,'3c*

n

* 4 <3 ,^«A.^/yl« i>»X>* 4°r

w

) / 0

«<*«*'

4

(•4- fi i(AA.C%i,>b o tf- (J ^ pu» ^iuu

«jv*v< llyJXv ih B £>*\rA*4 tart**** <<tcA ,&k#*6 ifO toyo& ,\\>filFt* t/o>u jcMr *>4u&.

futrt fv A(^4Fc0 ^^ifo** **Mk »****■ ^/iV*>$*v ii ^4?k ,)u«h«J v4«*^ **> fc^v —

/

»95

890 three fayer branches of your owne Heav'n hath timely tri'd their youth

their faith their patience, and their truth (970)

and sent them heere through hard assaies wth a Crowne of death lesse praise to triumphe in victorious Dau[or njnce ore sensuall folly and Jntemperance (974)

They dau\or n]nce, the dau[or n\nces all ended the

Dsemon singes or sayes./

Now my taske is smoothly done (101 1)

J can flye or I can run

quickly to the earths greene end 900 where the bow'd welkin slow doeth bend,

and from thence can soare as soone

to the Corners of the Moone

Mortalls that would follow me

love vertue, she alone is free 905 she can teach you how to clyme

higher then the sphearie chime

or if vertue feeble were

Heaven it selfe would stoope to her FYnis

(1015)

(1020)

340 A MASK (1637) AND MANUSCRIPTS

THE BRITISH MUSEUM MANUSCRIPT OF THE FIVE SONGS OF A MASK

w;

"HATEVER MUSIC MAY HAVE BEEN EMPLOYED in the original production of A Mask (Comus) at Ludlow Castle on 29 Sep- tember 1634, only the five songs are still in existence. These exist in two different manuscript copies, the one, said to be Lawes' own copy, was so far as is known, and still may be, the property of the 'Misses Church of Beaconsfield' according to Foss. The other copy is British Museum Additional Manuscript 11,518. The first has been unavailable for reproduction because of war conditions. The second is reproduced and transcribed by permission of the British Museum, as the songs contain a version of the words that may be as old as the first printed edition. Foss states that he collated the two manuscripts, and that the words of the two differ less than the music. Aside from deletions, these words offer about the same version of the text as 1637, 1645, and the Trinity College Manuscript. The two music manuscripts are most valuable for their music, not for their words.

BRITISH MUSEUM MANUSCRIPT OF FIVE SONGS (A MASK)

tfm+cSj&jar Jfe£ -for- a. &L

mt

t=*

*% I

i

>*¥&>£' a//&',-&£« /& AnTyt.

***+* ce<jrif (josf-cx*, 2*l<n~* //te

&

<-i*

%

C »f, \ M \ lis

: A zrz=

~<

s

i

pi=

^ k ? a

r

mm

^m

¥=+

" *u.

vif^/fafi fa f^ um tn /& 6rcl& ifii!e£s ef /£ d$Ly &***■ J?f«

x~j~ j m

m

3

I

0 ^ j mm. ,M f'f!f(- ^

■=F

a Mr^f

32

I

i

r>

i i a

\ t -3

3X

1 ,1 f r j§ ■■ I -1 f'£

-i 1 ) i i i —

mm j " r • ■ r ' j i ' ^-^H

i

3s=k

P

/*€**. jUt /**<-+ fi£j \ \ \ =

=L

<% ' —

;'ll, UuUl I'll S l I i ! 'I'll'l'-

i

>f § 'ji? i N i • n-ri E

From the Heav'ns now I fly, and those happy Climes that lie where day never shuts his Eye up in the broad Fields of the Sky 5 There I suck the liquid Air all amidst the Garden fair of Hesperus & his daughters three that sing about the golden Tree; Iris there with humid Bow

(975)

(98o)

(982) (990

10 waters the Od'rous Banks that blow

Flowers of more mingled Hew

than her purfled Scarfe can shew

Beds of Hyacinths & Roses

where many'a Cherub soft reposes 2 sweet Echo sweetest Nymph that liv'st unseen

within thy Airy shell

by slow Meanders margent green

& in thy violet embroiderd Vale

341

(994) (997) (998) (229)

342

A MASK (1637) AND MANUSCRIPTS

-^* ~ if , , <i " / ~ tji - /•' I- .... ■

33

^* c*- ■'

-/- /. "

7" i*1

»

*

O td-/ a*-<.

M

Pi

:£

^^

^

s£§

^-J-A 1 . ■ / J C, . \ \ ft U 1 1 * A_

— * ""7 \ JF C 1 1 — ' ^* '

m

~/

/

~«*^

g^»- of Fify &**?£&»- <^ //Ccc/fi£e^ , £ <SH*.ysA ££?u *c^ '/Awg/i-

j^

1 f ' '1

I M IF

23:

^

#

3a

li-

j i j.." i iiL 1 1 1 ! i ! f,!'l'^

S

S I ■ vt

a.«>" ii7$-t*\. Z*r/lc>^ ffvet*. »■*' jftfftdy undcr*i ,

' ^>

) N Tf i j (>fif>i

M

^m

4

^£+-

^^

_ v

/^j^ 0?n*^ <rf'/u% £7mSw0<?*pi/<4tLq &*.i*~i ^uf-otx. Jcrr~Ve.+ *-HiriiJxm J***

m yp| i

til t-rr-mi

5 Where the Love lorn Nightingale

nightly to thee her sad song mourneth well Canst thou not tell me of a gentle Pair that likest thy Narcissus are 0 if thou have lo hid them in some flowry Cave tell me but where sweet Queen of Pity Daughter of the Sphere

(235)

(240)

So may'st thou be Transplanted to the Skyes

& hold a Counter point to all Heav'ns Harmonies

Sabrina Sabrina fair

Listen where thou art sitting

under the glassy cool translucent wave

in twisted braids of Lillys knitting

the loose Train of thy Amber dropping I lair,

Listen for dear Honours sake

(«5<0 (860)

BRITISH MUSEUM MANUSCRIPT OF FIVE SONGS (A MASK)

343

-J 1 * < 1 — I— 1 tr* '

.4

i — b : -^

F=F

8?S «

S

13

I*-

i

T=r

I

-T-

m

0 ■ ■»

j 1 1 1 1 | I j ^=Hr--iyt-^

tft*~t. i'-c iAj%~?A <n*.f- &ii.c4 £?• ?tc*J trf-At.f '/-**.///*. £*i»/ ti

3X

*3=x=i

3

yyc^>

IX:

•fn**

m\

r=K

-__.« 1___

^^^

V f9^*"'

fr-J-i-Ji

v-n/htty jfa. *r 77ra n.cjUi

/^ „ — t I / - . . ,HT7 ™/w "****■ mruf* 7A&V

^^^fe^^^^SI

^

>r. ^ ;g_ g ^e 5 iUS3ir-W^^

Goddess of the silver Lake Listen Listen Listen and save.

4 Back shepherds, Back enough your play till the next sunshine Holiday

Here be without Duck or Nod other trippings to be trod

5 of lighter Toes & such Court Guise as Mercury did first devise

with the mincing Dryades

(865) (957)

(960)

10

15

o're the Lawns & o're the Leas 2. part Noble Lord & Lady bright I have brought you new delight Here behold so goodly grown these fair Branches of your own Heav'n hath timely try'd their Youth their Faith their Patience & their Truth and sent them here thro' hard Assays

(965)

(97o)

344

A MASK (1637) AND MANUSCRIPTS

%

&.■>!.£&- .

\±lJXv\vz

m

'cm*. tr*€*%. qu.tc4.

(4

•i

F^$£

=3P

'P UU-Ott* ;/&>> MrM? &c& '• euQ/f^t. fifr.nC£ can/o*r*4

v.^'..

*rfw— ■ ^ — ^ nw» «■— ^mh ^y ■ twJm •— ■ • ■ ■ li i ■ ' ■' 1 1 1 i i ■ in ■. ii «■! *— —— — <y fc- ni-j .»i ■ y%™ *wy ■ ■»■■!■■ m »~ 1 — —

; ,7>x*~ # ^£. cerwr *f frZ: ptrg-H ■ $h»«-/*/, /*ul£ l*\ru& 'Zfi&rw ! (?/«: £^*c m : ! /0 \ s ^ < -4—4- —

<2

j=gfe__t-_ip

tt

with a Crown of Deathless Praise		to the corners of the Moon
to triumph in victorious Dance		Mortals that would follow me
o're sensual Folly and Intemperance.	(974)	love Virtue she alone is free
5 Now my Task is smoothly done	(ion)	she can teach you how to climb
I can fly or I can run		10 higher than the sphaery chime	(1020)
quickly to the Earths green end		Or if Virtue feeble were
where the bow'd Welkin slow doth bend		Heav'n its Self would stoop to Her.	Henry Lawes.
5 and from thence can soar as soon	(1015)

1 LYCIDAS

(1638)

345

346

LYCIDAS— 1638

LYCIDAS— 1638

|^|[NHE POEM Lycidas first appeared in a volume entitled JUSTA/ EDVARDO KING/ naufrago,/ . . . printed at Cambridge by Thomas Buck and Roger Daniel in 1638. The Jl book is about as rare today as A Mask, 1637. The volume opens with thirty-six pages of Latin and Greek poems, then, with new pagination but continuous signatures, and after the English title page, Obfequies to/ the memorie/ of/ Mr Edward King,/ . . . , come twenty-five pages of English poems. The final poem is Lycidas, which begins on page 20 and ends on page 25, and is signed J.M. The book was printed on cap paper in quarto gatherings. In the Illinois copy, sig- natures F2-[F3] carry a watermark much like Churchill number 525, the twin columns with grapes above and initials between the columns; G2-[G3] signatures carry a similar but perhaps not iden- tical watermark; and H-[H4] signatures carry a different version of the same design. The English poems occupy the twenty-five pages of the gatherings F through H in fours, and the half sheet I- [la]. Two copies which seem to have been corrected by Milton are still extant. The copy repro- duced is the Illinois copy, supplemented by British Museum copy 1077^.51.

LIST OF COPIES EXAMINED AND COLLATED

Original. Illinois copy. Photostat and Film copies. Bodleian: 302(2). British Museum: C.21.C.42; 1077^.51 (unique copy with line 15 on page 20 unindented) ; 239.K.36. Cambridge University Library; Trinity College Library: VI.11.101; VI. 10.46. Harvard: 14485.32. Hunt- ington: 1638. New York Public: 1638. Texas: Wrenn. Wellesley. Yale: Elizabethan Club.

^0 :-*%-?30§&

»•£.*"* *<■"*

j ^f£e™'*™?h,ere the htgbU&ts appeared t ;> &^P'keiglimmerin0 eyelid, of the mora, &Mdr<it,*Afold,andl>o^olethe*be4rd V;'gl™*t timethe^.flj'&rndskerfHttrjborn, [WB*tt>ni"g °*r finks with the fab de»s of night, V^^llthecvnjlArrgfoight r

^J^Xrite^yHf^h^mdhUburniJht vh S^MiffM't' the rurali dtttiXere not mttt^ JFimffk <to W oaten flute .4j <-~--^

I

This fragmentary proof is the top of page 21 , lines 23 to 35, of the poem. It is found today in the Cambridge University Library, pasted on the inner side of the back cover of De Literis & Lingua Getarum . . . Editore Bon. Vulcanio Burgensi, printed by Plantin in 1597. There are five corrections of letters, two insertions of the hyphen, one correction of punctuation, and one attempt at realignment, all but the last correction having been made in the printed copy.

LYCIDAS — 1638

347

20

Reafcn not limits them th t weep, 'But bids them lunch into the deep ; Tells us they not exceed, that drain In teurs the might j Ocean ; Nor all that in thefe tears Are found As in a general! deluge drown d.

20

Rrafon not limits them that weep, 'But bids them lanch into the deep ; Tells us they not exceed, that drain In tears the mighty Ocean ; Nor all that in thefe tears are found As in a gener all deluge drown d.

T. Norton.

T. Norton.

Lycidas.

YEt once more, O je laurels, and one* mere, Te myrtles brown, with $vy never- fere, 1 come to pluckjour berries harfh and crude* And with fore d fingers rude Shatter your leaves before the mellowing yeare. Bitter conftraint, andfadoccafion deare Compells me to difiurb your feafon due : For Lycidas is dead, dead ere his prime, (Tottng Lycidas!) and hath not left his.peere. Who would not fing for Lyctdas? he knew Himfelftofing, and build the lofty rhymel Hemufnotflote upon his watry Here Zfnwept, and weltrr to the parching wind Without the meed offome melodious tear. *Begin then, & tiler s of the fac red well That from beneath the feat of Jove doth fpring* Begin , andfomewhat loudly (weep the firing: Hence with denial vain, and coy excufe. So may feme gentle Aiu^e With Ucky words favour my defitndurn^ And as hepaffes, tnr;r A.;d bid fur peace be to fry fable firouo'^.

BRITISH MUSEUM copy 1077.cl.51. Page 20.

10

15

20

Lycidas.

YEt once more, O ye laurels, and once more, Te myrtles brown, with svy never- fere, 1 come to pluckjour berries harfb and crude, And with for c*d fingers rude Shatter your leaves before the mellowing ygarc. Bitter confiraint, andfadoccafion deare Compells me to difiurb your feafon due s For Lycidas is dead, dead ere his prime, (Toung Lycidas I) and hath not left his peer ea Who would not fingfor Lycidas? he knew Himfelftofing, and build the lofty rhymel He muff not fiote upon his watry bier e Z^nwept, and welter to the parching wind Without the meed offome melodious tear. \ 'Begin then, Sifters ofthefaered well That from beneath the feat offove doth fpring; Begin, andfomewhat loudly fweep the firing: Hence with deniallvain, and coy excufe. So may fome gentle Mufe With lucky words favour my deft in* d urn, And as hepaffes, turn And bid fair peace be to my fable Jhroud.

ALL OTHER COPIES EXAMINED Page 20.

10

15

20

The catchword For has been cut off in both photographs to permit printing together here.

4 fore'd The upright of the d is bent in all copies examined. 10 In Cambridge University copy and British Museum copy C.21.C.42. in margin is written 'well' to come between he and knew The writing in both cases is probably Milton's own. 11 The right hand serifs of the right hand upright of the initial H are missing, and the upper one is missing in all the same initial letters in lines 12, 18, 57, 63, 69, 91, 104, 112, 113, 183, 187. There is an ink mark above the period at the end of the line in all copies examined. 14 The strange ink mark that looks like an exclama- tion mark, but probably is not, at the end of the line is present in all copies examined except British Museum copy 1077. d. 51. 15 This line is indented in all copies examined except British Museum copy 1077^.51. in which copy the line is set flush to the right hand margin of the other lines.

348 LYCIDAS — 1638

21

For we were nurfi upon the felf- fame hill, Fed the fame flocks by fountain, fljade, and rill% Together both, ere the high lawns appeared 25

"Under the glimmer ingeye'lids^of the mom, We drove a- field, and both together heard What time the gray-fly winds herfultrj horn, Battening our flocks with the fre/b dews of night, Oft till the evn-ftarre bright 30

Toward heav'ns defcent had flop' d his burnifht wheel \ Mean while the rtirall ditties were not mute Temper d to th3 oaten flute : Rough Satires danc'di and Fauns with cloven heel From the glad found would not be abfent long, 35 And old Dametas lov'd to heare ourfong.

But oh the heavy change, now thou art gone, Now thou art gone, and never mufi return ! Theefbepherds, thee the woods, and defer t caves With wild thyme and the gadding vine oregrown, 40 tAnd all their echoes mourn, The willows and the haftLcopfes green Shall now no more befeen Fanning their joyous leaves to thyfoft layes. As killing as the cankff to the rofe, 45

Or taint-worm to the weanling herds that graze, O rfrojl to flowers that their gay wardrobe wear , When fir fl the white-thorn blowes; Sucht Lycidasy thy loffe tofbepherds eare. Where were ye Nimphs, when the remorfeleffe detf 50 Closed ore the head of your lord Lycidas* For neither were ye playing on the flee f, Where the old Bards the famous Druids lie, Nor on the /baggie top of Mona high, Nor yet where Devafpreads her wifardflream- 55 Ah me, I fondly dream!

Had ye been there for what could that have done!

What could the Mufe her felf that Orpheus bore,

?h&

The first thirteen lines of this page exist on a scrap of paper as printer's proof. See page 346 26 The ink mark between eye-lids and of is in all copies, though much fainter m British Museum copy 1077.cl.51., but is not in the scrap of proof- 51 Again in Milton s hand probably but not certainly, in the margin is written Lov d for lord in Cambridge University copy and British Museum copy C. 2 i.e. 42.

LYCIDAS — 1638 349

22

The Mufe herfelf,for her inchantingfome ?

Whom univer fall nature did lament ; 6o

When by the rout that made the hideous tore

Bitgoary vif age down thefireamwasfent,

Down thefwift Bebrusto the Lesbian fhore.

Alat \ what boots it with mceffant care

To tend the homely frighted /hepherds trade, 65

Andjlridly meditate the thankjeffe Mufel

Were it not better done as others do,

Tofport with Amaryllis in the Grade,

Bid in the tangles ofNeeras hair i

Fame u thefpurre that the clear fpirit dothraife, 70

( That laft infirmitie of noble mind)

To [corn delights, and live laborious day <es;

But the fair guerdon where yve hope to find,

And thinkjo burfl out intofudden blaze,

Comes the blind F uric with thy abhorred (hears, 75

And flits the thin-fpun life; Tut not thepraife,

Pbcbusrepltd, and touch* d my trembling eares.

Fame u no plant that grow t son mortallfoil,

Nor in the glaring foil

Set off to th world,norin broad rumour lies} 80

But lives > andfpreads aloft by thofepnre eyes

tyfndperfea witneffe of all-judging Jove:

As he pronounces lafily on each deed,

Offo much fame in heavn expetl thy meed

Oh fountain Arethufe, and thou honour* dfloud, 85

Smooth. fltding Mincius, crown dwith vocall reeds-

That {tram I heard was of a higher mood.

*But now my oat proceeds,

Andlifiens to the herald of the fea

That came in Neptunesplea. 90

^We -waves and as^d the felon winds,

^Jhardmfaphathdoom^dthisgentlefwainl

AndiHefltondeveryguft of rugged wingi,

That blowesfrom off each beaded Tromontorie:

They

64 Alasl The exclamation mark is roman here only in all copies examined. 67 do, In the handwriting that is probably Milton's, the margin of Cambridge University copy and British Museum copy C.21.C.42. contains the word 'use' to be substituted for do, 80 broadrumour No space in any copy examined.

350 LYCIDAS— 1638

They knew not ofhisftorie; 95

And [age Hippot tides their anfwer brings,

7 hat not a blaft mas from his dungeon ftray'd;

The aire vou calm, and on the level brine

Sleek Panope with Ml her fifters play' d:

It was that fat all and perfidious bark^ i °o

'Built in th' eclipfe, and rigg'd with curfet dark^

7 hat funk fo low that f acred head of thine.

Next Chamus (revtrendftre) went footing flow y

His mantle hairie,andhis bonnet fedge,

Inwrought with figures dim, andon the edge 105

Like to that fanguine flower infcrib 'dwith wo-

Ahl who hath reft(quoth he) my deleft pledge ?

Laft came, and laft did go,

The Tilot of the Cjalilcan lake.

Two maffie keyes he bore ofmetalls twain, 1 1 0

( The golden opes, the iron fhuts amain )

Hefhookhis mitred locks, and ft em befpake,

How well could 1 have fpard for thee,youngfwaitet

Enough offuch as for their bellies fake

Creep and intrude and climbe into the fold? 115

Of o! her care they little reckoning make,

Then how to fcr amble at the /hearers feaft,

ssfndjhove away the worthy bidden gueft.

Blind mouthes! that fcarcethemfelves know how to hold

e^f/heephookj or have learn 'd ought elfe the leaft 1 20

That to the faithful I herdmans art belongs1.

What recks it them} what needthty ? they arefped;

tsfnd when they lift their lean andflajhiefongs

Grate on their fcrannel pipes of wretched ft raw,

The hung ry /keep lookjtp, and are not fed, 1 2 5

Butfwoln with wind, and the rankjmift they draw,

Hot inwardly, and foul contagion fpread:

Be fides what thegrimme wo If with privy paw

'Daily devour es apace, and little fold.

But that t wo- handed engine at the doore, 130

/ Stands

112 mitred The t is either from a smaller font or much battered in all copies examined.

LYCIDAS — 1638

351

*4

Stands ready tofmtte once, and/mites no more.

Return, Alpheus, the dread voice is pafl That Jhrunk, thy ftr earns; return, Sicilian Mu(et And call the vales, and bid them hither caft Their bells, andfiowrets of a thoufand hues, 1 35 Te valleys low, where the mild whifpers ufe Ofjhades and wanton winds andgufhing brooks, On who/efrejb lap the fwartftarre fparely looks, Throw hither all your quaint enammeWdeyes, That on the green turf fuckjhe honied fhowres, 140 And purple all the ground with v email flowers. Bring the rathe primer ofe that for faken dies, " The tufted crow-toe, and pale ge (famine, The white pink^ andthepanfte freafy withjeat, The glowing violet, 145

The musk^rofe,and the well- at tird wood bine, With cowflips wan that hang the penfive head, And every flower that fad embroidery wears : Bid Ameranthus all his beauty Jhed, And daffadillies fill their cups with tears, 150

Toflrew the laureat herfe where Lycid lies. For fa to interpofe a little eafe, Let our frail thoughts dally with falfefurmife; Ay me I whil'fi thee the fhores and founding feas Wafhfarre away, where ere thy bones are hurtd, 155 Whether beyond theftormy Hebrides, Where thou ptrhaps under the humming ti'e Vtfifjl the bottom of the monftrous world; Or whether thou to our mot ft vorves demd, Sleep' ft by the fable ofBellerus old, 1 60

Wht re the great vifion of the gun ded mount Lookj toward Namancos and Bayonas hold; Look homeward Angtl now, and melt with ruth, Andy Oye dolphins, waft the haplejfe youth.

Weep no more, wofull fhepherds, weep no more- 165 For Lycidas your for row is not dead,

SunJ^

157 humming In Cambridge University copy and in British Museum copy C. 2 i.e. 42. in the same handwriting as before, 'whelming' is written in the margin and humming starred.

352 LYCIDAS — 1638

*5

Sunkjhough he be beneath the Watty port:

So (ink* the day-ftarre in the Ocean bed*

And yet anon repairs hit drooling heady

And trickj his beamsy and with newfpangled ore 1 70

Flames in the forehead of the morning fkie:

So Lycidas funkjow, but mounted high

Through the dear might of him that walked the W4vef;

Where other groves ', and other Fireams along.

With NeFlar pure his oazie locks he laves y 175

And hearts the twcxfrejfivc nuptiailfeng;

There entertain him all the Saints above

Infolemn t roups and fweetfocieties,

Thatjing,andjinging in their glory movet

iLAnd wipe the tears for ever from his eyes* 1 80

Nowy Lycidafy the fbephcrds weep no morei

Henceforth thou art the Genius ofthefhore

In thy large recompenfe, and [halt be good

To all that wander in that perillousfloud.

Thutfang the uncouth Jwain to th' oaks and rills, 185 While the ft ill morn went out wit hfandals gray, He touch d the tender flops of various quMlsy With eager thought warbling bis Dor'ukjaj: And now thefunne had fir etch3 d out all the hills, Andnow was dropt into the weftern baj'y 1 90

At lap hero fey and twitch" d his mantle blew, Tomorrow to frejh woods and paflures new.

J.M.

After line 176, Cambridge University copy and British Museum copy C. 2 i.e. 42. have in the margin 'in the blest kingdoms / of Joy, and Love' written in the same hand-

writing as the earlier marginalia. The word 'meek' may have followed 'kingdoms' as it does in 1645 and 1673, as the margins are badly worn away. 185 Thus The s is either from a smaller font or badly worn in all copies examined. 187 quills The ui are apparently joined like a ligature in all copies examined.

,

EPITAPHIUM DAMONIS

[ca. 1640]

353

354 EPITAPHIUM DAMONIS — [ca 1640]

EPITAPHIUM DAMONIS [ca. 1640]

IN THE 18 AUGUST 1932 ISSUE of the London Times Literary Supplement, Professor Leicester Bradner announced his discovery in the British Museum of a separate and hitherto unknown printing of Milton's Epitaphium Damonis that had been acquired 7 JY 57 and mis- catalogued under 'Damon.' The pamphlet is one of four printed leaves, without pagination but with signatures, without title page, and gathered in fours. At the end of the poem is the word Londini but no author's name. It is obvious upon the most casual examination that it is a totally different printing from the hitherto supposed first printing in the 1645 Poems. Professor Bradner dated it as of either 1639 or 1640, either of which dates is reasonable enough, as the poem seems to have been written after Milton returned to England in the fall or early winter of 1639. The Latin text was printed with an English translation by Walter W. Skeat at Cambridge in 1933, and the same translator printed a different translation of the poem at Oxford in 1935. Professors Mabbott and French added an account of the discovery in the final volume of the Columbia Milton in 1938. Their collation of the [ca. 1640] text therein is unreliable, although their account of this printing contains many erudite and valuable points.

It is impossible to do more than speculate upon the printer in an effort to trace down the date of printing. The type itself is about the only aid the pamphlet offers, although there is a deco- rated H at the beginning of the poem. About all that can be said of the printer is that nothing appears in the text to indicate that it could not have been printed by John Raworth. He used type very much like this, especially the serifless top of the left hand side of the M at the end of the first line of the first page (Ar), the peculiarly double cuspated top of the A in DAMONIS, the curved lower member of the R in ARGUMENTUM, and the projection beyond the right hand vertical of the diagonal of the N in the same word. In line 1 of the Argument, & the amper- sand is exactly like that used by Raworth in the folio History of the Council of Trent, 1640, sig- nature Gggg2v line 10 et ss. In addition, as in one or two of Raworth's other books, the a with circumflex as used in the text herein seems to have been the largest size type he owned of this accented letter, and he used the same size, though it was too small, in the text of the ARGU- MENTUM. But there is too little to go on to be sure of the printer, and, the type design being what it is, there were many printers in the Fleet neighborhood using the same design.

EPITAPHIUM DAMONIS — [ca 1640]

355

<*» <4f> «*» *&» **•» *&* *$"» r4» *A» *>&» ♦#■• *i»«f.» C-Jr» f,f^ «^» <^» ^.vw-^^i v,v/»iv.Tj»v'im 5v^"UT *s.v.«r i-Wra* <ms<%'s,s^PmY^* mv.-x*

*^£&&&S§!

EPITAPHIVM

DAMOISULS

ARGVMENT

THyrGs, & Damon ciufdem vicinix pafto- res, eadem itudia fequuti a pueritia amici erant,ut qui plurimum Thyrfis animi cau- sa profe&us paregre de obitu Damonis nuncium accepic Domum poftea revcrfus, & rem ita cflc compcrto, fc,fuamqucfblitudinemhoc carmine deplorac Damonis aurem fub pcrfona hie intclli- gitur Carolus Deodatus ex urbe Hctruriac Luca patexnogenere onundus,cxtera Anglus • ingenio, doclrina,clarifsimifquecaucris vircucibus> dum vivcrec,iuvenis egregius.

A DAMON

10

2 pueritia] The a is from a smaller font, and is the same as used in the text, where it fits the font therein employed. 7 perfona] The a is also smaller here, and again fits the font of the text Catchword DAMON 1 The D is from a smaller font.

356

EPITAPHIUM DAMONIS — [ca 1640]

DAMON.

Tmerides nymphar(nam vos & Daphnin& Pty- Et plorata diu meminiftis fata Bionis) (lan

Dicitc Sicelicum Thamcfina per oppida carmen Qiias mifcr effudit voces,qua? murmura Thyrfis, Et quibus aflidv.is exercuit antra querelis '

Fluminaque fonccfque vagos, nemorumque receflfus Dum fibi pra»repcum qucritur Damona,neque altam Lu&ibus excmit no&em loca fola percrrans, *

Et jam bis viridi furgebat culmusarifta, Et totidem flavas numerabant horrea mefles, 10

Ex quo fumraa dies tulerat Oamona fub umbras Ncc dum aderat Thyrfis,paftorem fcilicet ilium Dulcis amor Mufa? Thufca retinebat in urbc. Aft ubi mens expleta domum, pecorifque relidH Curavocatjfimul aflueta fcditquefubulmq, Turn veroamiflfum tumdenique fentit amicum, Ca?pit& immenfum fie exonerare dolorera.

Ite domum impafti5domino iam non vacar,agni\ Hei mihi quse terris,qua? dicam numina coelo i Poftquam te immiti rapuerunt funere Damon J Siccine nos linquis, tua lie fine nomine virtus Ibit,& obfeuris numero fociabiturumbris ? At non ille, animas virg;i qui dividit aurca Iftavelit,dignumquetui te ducat in agmen Ignavumqueprocul pecus arceatomnefilentum.

Ice domum impafti,dominoiarn nonvacat, agni. Quicquid eritjCertenifi me lupus ante videbit^ Indeplorato non comminuere fepuicro,

Conftabitquc

15

25

EPITAPHIUM DAMONIS — [ca 1640] 357

Da m o No

Conftabitque tuus tibi hono5,long6mque vlgcbic Inter paftores,illi tibi vota fecunao 30

Solvere poft Daphnin, poft Daphnin dicere laudes Gaudebunt,dum rura Pales,dum Faunus amabit : Si quid ideft,prifcamque fidem coluiiTc,piumque Palladiafqueartes, fociumquc habuifle canorum

Ite domum impafti,domino jam non vacat,agni. 35

Ha»c tibi cc rna manenr,tibi erunt hare prarmia Damon, At mihi quid tandem fiet modo i quis mihi fidus Ha?rcbit lateri comes ut tu fa>pc fokbas Frigoribus duris, & per loca faeta pruinis, Autrapidofubfole,fiti moricntibus herbis 40

Sive opus in magnos fuit eminus ire leones Autavidosterrere lupos, prefepibus altis $ Quisfandofopirediem,cantuquefolebit£

Ite domum impafti,domino iam non vacar,agni. Pe&ora cui credam 1 quis me lenire doccbit 45

Mordaces curas?quis longam fallerc noctcm Dulcibus alloquiis,grato cum fibilat igni Molle pyrum,& nucibus ftrepitat focus, at malus aufter Mifcet cun&a foris, & defuper intonat ulmo

Ite domum impafti,domino iam non vacat,agni. 50

Autaeftate,dies medio dum vertitur axe, Cum Pan sefculca fomnum capit abditus umbra Et repetunt Tub aquis fibi nota fedilia nymphar, Paftorefque latent, ftertit fub fepe colonus, Quis mihi blanditiafque tuas,quis turn mihi rifus 55

Cecropiofque fales referet,cultofque lepores i

Ite domum impafti,domino iam non vacat,agni. At iam folus agros,iam pafcua folus oberro Sicubi ramofae denfantur vallibus umbra? Hie ferum expe&o, fupra caput imber & Eurus 60

Trifte fonant, fracteque agitata crepufcula fil va?.

z A 2 Ite

42 preiepibus] The first use of e with cedilla for ae occurring again in equora (162) Hec (180) formeque (197), ethera (203), equior (209), Celicolae (211), Le&que (216), hymeneos (217)! Sion?o (219). The Columbia appendix to this poem states that Laetaque as in 1645 and 1673 is wrong and due to the spelling of the word in this separate edition.

358

EPITAPHIUM DAMONIS — [ca 1640]

Damon* Itc domum impafti, domino iam non vacar,agni. Hcu quam cultamihi priusaiva procacibus hcrbis lnvolvuntur5& ipfa fitu fcges aka fatifcit ! Innuba negle&o marcefcit & uva raeemo, 65

Ncc my rteta juvantjOvium quoque ta?det,at iliac Mxrcnt, inquc fuum convertunt ora magiftrum

Ice domum impafti^domino jam non vacar,agni. Tityru's ad corylos vocat, Alphetiboeus ad ornos, Ad ialiccs Acgon,ad flumina pulchcr Amyntas, 70

Hie gelidifontes, hie illica gramina mufco, Hie Zephyrijhic placidas intcrftrepit arbutus undas ^ Kta canunt furdo/rutices ego nac~tus abibam.

Ire domum impafti,domino jam non vacat, agni. Mopfus ad ha?c,nam me redeuntcm forte notarac 75

(Et callebat avium lingua$,& fydera Mopfus) Thyrfi quid hoc i dixit,qua?tecoquitimprobabilis? Aut te pcrdit araor,aut te male fafcinat aftrum Saturni grave fa?pe fuit paftoribus aftrum, Intimaquc obliquo figit pra?cordia plumbo 80

Ire domum impafti,dominojam nonvacat,agm. Mirantur nympha?, & quid te Thyrfi futurum eft t Qjid tibi vis?ajunt,non hare lolcteflTejaventae Nubila frons,oculique truces,vultufque feveri Iilachoros,lufufqueleves,& fempcramorem 85

lure petit,bis ille mifer qui ferus amavit.

Ice domum impafti,domino jam non vacat,agni. VcnitHyas,Dryopcque,ct filiaBaucidis Aegle Docla modos,citharaequc fciens, fed perdita faftu, Venit Idumanii Ghlorisvicina fluenti, 9°

Nil me blanditia?,nil me folantia verba Nil me,(i quid adcft,movet,aut fpes ulla futuri.

Ite domum impafti, domino jam non vacat, agni. Hei mihi quam fimilcs ludunt per prata juvenci

Omncs

EPITAPHIUM DAMONIS — [ca 1640] 359

Damon.

Omnes unanimi fccum fibi lege fodales, 95

Ncc magis hunc alio quifquam fecernit amicum

Dc grcge,fic denfi veniunt ad pabula thoes,

Inque vicem hirfuti paribus junguntur onagri,

Lex eadem pclagi>dcfcrto in littore Proteus

Agmina Phocarum numerat,vilifque volucrum ioo

Pailer habet femper quicum iir,& omnia tircum

Farra libens volitct fcro fua tecla revifens,

Qucm fi fors letho objecit,(eu milvusadunco

Fata tulit roftro,feu ftravit arundinc fbffor,

Protinus ilk alium focio petit indc volatu* 105

Nos durum gcnus5& diris exercita fatis

Gcns,homines,aliena animis,& pe&ore difcors

Vix fibi quifque parem de millibus invenit unum,

Aut (1 fors dederit tandem nonafpera votis,

Ilium inopina dies quanonfperaverishora no

Surripir, aetcrnum linquens in fa»cula damnum.

Itc domum impafti, domino jam non vacat,agni. Heu quis me ighocas traxit vagus error in oras Ire pcracreas rupes,Alpemquenivofam J Ecquid erat tanti Romam vidiflfe fepultam i u5

Quamvis ilia forer, qualem dum viferet olim, Tityrus ipfe fuas & oves & rura reliquitj Vt te tarn dulci pofTem caruifle fodale Poflcm tot maria alta,tot interponere montes, Tot fylvas,tot faxa tibi,fluviofque fonantes. i20

Ah ccrtc extrcmum licuiflet tangere dextram, Et bene com poficos placide morientis ocellos, Et dixiflTe vale,noftri memor ibis ad aftra.

Ite domum impafti,domino jam non vacar,agni. Quanquam etiam veftri nunquam meminifle pigebic 125 Paftores Thufci,Mufis operata juventus, Hie Gharis,atque Lepos j & Thufcustu quoque Damon.

A 3 An-

360 EPITAPHIUM DAMONIS — [ca 1640]

Dam on*

Antiqua genus undc pctis Lucumonis ab urbe. O ego quantus cram gclidicum ftratusad Arni Murmura,populeumque nemus,qua mollior herba, 130 Carpere nunc violas 5nunc fummas carpere myrtos Ec potui Lycida? certantem audirc Menalcam, Ipfc etiamtcnrareaurusfum,nccputomuhum Difplicui, nam funt & apud me munera veftra Fifcclla?,calathiquc &ccrea vincla cicuca?, J35

Q^in & nofria fuas docucrunt nomina fagos Ec Datis,& Francinus^erant & vocibusambo Ec ftudiis noci,Lydorum fanguinisambo.

Ice domum impafti,dominoiam non vacat,agni. Hrcmihi turn laeto di&abatrofcidaluna, mo

Dam folus tencros claudebam cracibus hardos. Ah quoties dixi,cum tc cinis atcr habebat, Nunc canit.aut lepori nunc tendit retia Damon, Vimina nunc texit, varios fibi quod fit in ufus ; Ec q iae turn facili fperabam mente futuia J45

Arripuivotolevis,& praefentia finxi, Heus bone numquid agis ? nifi tc quid forte retardat Imus? & argutapaulum recubamus in umbra, Autad aquas Colni,aut ubi jugera Caflibelauni < Tu mihi percurres medicor/ua gramina,fuccos, 150

Helleborumque5humilefque crocos, foliumqjhyacinthi, Qaafque habet ifta palus herbas , artefque medentum, C Ah pereant herba>,pereant artefque medentum Gramina,poftquam ipfi nil profecere magiftro.) IpCe etiam,nam nefcio quid mihi grande fonabac 155

Fiftula, ab undecima iam lux eft altera no&e, Ettum force novis admoram labra cicutis, Diffiluere tamen rupta compage,nec ultra Ferre graves potuere fonos,dubito quoquenefim Turgidulusjtaraen & referam ,vos cedite filva? 160

Ite

EPITAPHIUM DAMONIS — [ca 1640] 361

Damon.'

Itc domum impafti, domino iam non vacat,agni Ipfe ego Dardanias Rutupihaper e quorapuppes Dicam,&Pandrafidos regnum vetus Inogenia? Brennuraque Arviragumque duces,prifcumque Belinum Et tandem Armoricos Britonum fub lege colonosj 165

Turn gravidam Arturo fatali fraude Iogernen Mendaces vultus^flfuraptaque Gorlois arma Merlini dolus.O mihi turn fi vita fupcrfir, Tu procul annofa pendebis fiftula pinu Mukum oblita mihi,aut patriis mutata cama?nis 170

Brittonicum ftrides,quid enim ? omnia non licet uni Non fperaffe uni licet omnia, mi fatis ampla Merces,& mihi grande decus (fim ignotus in a?vum Turn licet, externo penitufqueingloriusorbij Si me flava comas legat Vfa,& potor Alauni, 175

Vorticibusque frequens Abra,& nemus omne Treanta?,

Et Thamefis meus ante omnes5& fufca metallis Tamara,& extremis medifcant Orcades undis

Ite domum impafti,domino iam non vacat,agni. Hcc tibi fervabam lenta fub cortice lauri 180

Ha?c,& plura fimul,tum quae mihi poculaManfus

Manfus Chalcidicaj non ultima gloria ripa?

Bina deditmirum artis opus,mirandus &ipfe,

Etcircum gemino caelaverat argumento :

In medio rubri maris unda,& odoriferum ver 185

Littoralonga Arabum,&fudantes balfama filva?

Has inter Phoenix divina avis,unica terris

Cseruleum fulgens diverficoloribus alis

Auroram vitrei sfurgentem refpicit undis.

Parte alia Polus omnipatens>& magnus Olympus, 190

QuisputetfhicquoqueAmorpic^aequeinnubepharetra!

Arma corufca faces,& fpicula tin<5ta pyropo

Nee tenues animas,peclufque ignobile vulgi

Hinc

362

EPITAPHIUM DAMONIS — [ca 1640]

D

AM ON,

Hinc ferit,at circum flimmantialumindtorquens

Semper in ereclum fpargit fua tela per bi bes

Impigcr,& pronosnunquamcollimatad i&us,

Hinc mentes atdere facra:,formcqucdeorum.

Tu quoque in his,nec me fallit (pes lubrica Damon,

Tuquoque in his certe es,nam quo tua dulcis abirct

SanctaqucfimplicitaSjnamquotua Candida virtus?

Nee te Letharo fas quajfiviffe fub orco,

Nee tibiconveniunt lachryma?,ncc flcbimus ultra,

Ire procul lachiyma?,purum colit ethera Damon,

Aethera purus habet,pluvium pede reppulit arcum

Heroumque animas inter,divofque perennes

Acthereoshaurit latices & gaudiapotat

Ore Sacro.Quin tu coeli poft jura recepta

Dexter ades,placidufq ue favc quicunque vocaris,

Seu tu nofter eris Damon,five equior audis

Diodotus,quo te divino nomine cun<5h

Celicolae norint,fylvifque vocabere Damon.

Qjodtibi purpureus pudor,& fine labe juventus

G rata fuit,quod nulla tori libata voluptas,

En etiam tibi virginei fcrvantur honores,

Ipfe caput nitidum cindus rutilante corona,

Lctaquc frondentis geftans umbtacula palmae

Aetemum perages immortaleshymenfos

Cantusubijchorcifquefuritlyramifta beads

Fefta Sioneo bacchantur & Orgia Thyrfo.

7 JY 57

Londmi

195

200

205

210

215

FINIS.

POEMS

PRINTED BY OTHERS

363

364 POEMS PRINTED BY OTHERS

POEMS PRINTED BY OTHERS

MILTON HIMSELF PUBLISHED EVERY IMPORTANT POEM he ever wrote and saw fit to preserve, except the Cromwell sonnet, recently so much admired by Mr. Belloc. But some of his poems were first printed and others were reprinted during his lifetime, by persons other than himself, although only one such piece, the Vane sonnet, was never printed by Milton. In 1645, he acknowledged the lines On Shakespeare, which had been first published anonymously in the Shakespeare Second Folio, printed at London in 1632. The same lines, with a few variations, had also appeared in the volume of Shakespeare's Poems, printed at London in 1640, before Milton himself published the lines. The poem was printed once more after 1645 and before Milton's second edition of his minor poems in 1673, when in 1 663- 1 664 the Third Folio of Shakespeare's plays appeared. He must have furnished copy for at least the first of these printings by persons other than himself, and there is some evidence that the lines On Shakespeare found in Shakespeare's Poems, 1640, had been emended by him, as there are some passages that read more nearly like Milton's 1645 text than they read like that of the Second Folio, 1632.

A short time after the 1645 Poems had been published, perhaps within a month after their appearance, Milton wrote a sonnet addressed to Henry Lawes, dated, in the Trinity College Manuscript, Feb. 9, 1645, which would be 1646 N.S. This sonnet was. first published on 3v of the preliminary leaves in Choice Psalms Put into Musick for Three Voices, by William and Henry Lawes, London, 1648, and commemorating the death of the former. Milton acknowledged this poem by printing it himself in his Poems of 1673. In much the same fashion, but with a different sequence, in the apparently anonymous Life and Death of Sir Henry Vane [The Younger], by [George Sikes], issued in 1662 with no place of publication on the title page, there occurs on pages 93 and 94 a sonnet of which it is stated that it was composed by its anonymous author July 3, 1652. It is, of course, the Vane sonnet, found in the Tr. Coll. Ms., and printed by Phillips in 1694, but never printed by Milton for obvious reasons. He might have included it in the 1673 Poems; but Vane's memory was not then in good repute. Then in 1640, there appeared an edi- tion of A Banquet of Jests, sometimes attributed to Archie Armstrong, James I's fool or jester. There is a copy that may be unique of this book reading Sixth Edition on its title page, in the Cambridge University Library, which contains a version of some of Milton's lines on Hobson the carrier. Milton printed two sets of lines on Hobson in 1645. Garbled versions of both appeared also in another Banquet of Jests, printed at London in 1657, and again in Wit Restored, printed at London, 1658. We cannot be certain that Milton furnished copy for any of these printings; but they certainly indicate that his lines on Hobson, written perhaps early in 1631, had circulated considerably and found much favor in manuscript.

Included under this heading also are the three sonnets on Fairfax, Cromwell, and Skinner, respectively, which are found in the Tr. Coll. Ms., but which Milton himself never printed, and which were not printed so far as is known during his lifetime. They were first printed so far as we know by Phillips as preliminary material to the Letters of State published at London in 1694, an edition of an English translation of Milton's Latin letters written for the Parliament, the Council, the two Cromwells, and perhaps the Committee of Safety between 1649 and 1660. No earlier printings of these three sonnets are known to exist.

ON SHAKESPEARE 365

ON SHAKESPEARE

Although Milton printed the poem On Shakespeare in 1645, and again in 1673, the first was not the earliest printing of the poem, nor were Milton's two printings the only ones of the century. Within his lifetime, the poem was printed three different times in connection with Shakespeare publications, and once more after his death, all four times before 1700. Indeed, the appearance of the poem in the Second Folio of 1632 is the earliest surviving printing we possess of any of Milton's poetry, and it was probably the first of his English poems to be printed. It appears in the preliminary leaves of the Second Folio, anonymously, among the laudatory verses prefixed to that edition. Professor Robert Metcalf Smith in 1928 (Lehigh University Publications, II (1928) no. 3) dealt with the Second Folio and its Milton poem at such length and with such adequacy that only his conclusions need be employed here. The page on which Milton's poem occurs in the Second Folio was printed in three different states, which Professor Smith called 'Effigies A, B, and C, each of these pages and each printing of the Milton poem on them differing slightly from the other two. Professor Smith also called attention to other printings of Milton's poems in later Shakespeare volumes, and herein are reproduced the version found in Shakespeare's Poems of 1640, and also the version found in the Third Folio, 1663-4. The poem also appeared in the Fourth Folio, 1685, but as this was eleven years after Milton's death, that version is not repro- duced herein. The versions of 1632, and variants, of 1640, and of 1663-4 are collated in the textual notes under the reproduction of the poem in the Third Folio, 1664. Milton himself apparently had nothing to do with the appearance of the text of the poem in any of the folios, though he may have been in some way connected with the printing of the Poems version of 1640, and may even have supplied new copy for it, as this version differs much more from the folio versions than they differ among themselves. No collation between the versions found in the Shakespeare publications and Milton's own printings is provided because so far as is known there is no connection between them.

LIST OF COPIES OF SECOND FOLIO, 1632, COLLATED

Originals. IU: copy 1(3 other copies lack this leaf) Effigies C.

Photostat and film copies. Columbia University Library: Effigies B. Folger Shakespeare Library: copies 1, 2, 4, 5, 7, 8, 11, 14, 16, 20, 21, 23, 24, 27, 29, 30, 31, 32, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 46, 53, 57, 59, 60. 33 copies Effigies C. Copies 6, 9, 10, 36. 4 copies Effigies A. Copy 15, Effigies B. Total, 38 copies. Huntington Library: 69383. Effigies C. Michigan University Library : Effigies C. New York Public Library : Copies Allot Ann King Lenox ; por- trait printed over word 'London'; Allot imprint Newsham-Astor ; Allot title reset; second varia- tion ; Printed for William Aspley ; Printed for Richard Hawkins ; Printed for John Smethwick ; Allot Thomson; all Effigies C, 9 copies. Newberry Library: Case YS 02. Effigies C. Texas: Starck copy, Effigies C ; Wrenn copy, Effigies C. Wellesley College Library : Effigies C.

Total, 55 copies. Effigies A, 4 copies. Effigies B, 2 copies. Effigies C, 49 copies.

366

POEMS PRINTED BY OTHERS

An Epitaph on the admirable Dramaticke

PoetW. Sh akespeare.

SHAKESPEARE SECOND FOLIO, 1632

Page [Asr]

An Epitaph on the admirable Dramaticke

Poet, W .Sbakefbeare,

Hat neede my Shakefpeareyor his homufi £<*»«, The labour of an Jge, in piled flones Or that his hallow d Ifyliques fhouli be hid Z)>ider aflarre-ypointed fyramid ? Deare Sonne oj Memory, great Heire of Fame, What needji thoufuch dullT»itneJfe of thy Name? Thou in our wonder andafion'ifbment Haft built thyfelfe a lafling Monument : For Tt>hil'Byto th'Jhame of flow-endeVouringArtl Thy eafie numbers flow yand that each part, Hath from the leaves of thy unvalued Booke, Tiofe Delphicke Lines with deepe Imprefsion tookfi '. Then thouour fancy of her felfe bereaving, Dojl make us Marble with too much conceivingl AndfoSepulcber din fuch pompe dojl lie, T hat Icings for fuch a TomSe would wifh to die,

10

15

'Hat neede my Shakefpeare for hit honor' 'd bones, \ The labour of an Agejn piled flonet " Or that his hallow' J tfeli.[uesfhould be hid Vnder aflarre-ypointing Tyramid f Deart Sonne of Memory great Hart o/Fame, What need/} thoufuch JuOttitneffc of thy Name t Thou in our wonder and afloniflment Haft built thyfelfe a lafling Monument : For whil'fl to tb'fhame offlow-endeaVouring Art Thy eafie numbers flow and that each part, Hath from the leaves of thy unvalued Booke, Thofe Delphicke Lines with deepe imprefion tookt Then thou out fancy ofherjelfe bereaving, Dofl make us Marble "with too much conceiving, Jndfo Sepulcher'dinfuchpomfe dofl lie Tk.;t Kings for fuch a Tvnbt would wifh to die.

10

15

An Epitaph on the admirable Dramaticke

Poet, V V.S HAKESPEARE.

ffiHat neede my Shakefpeare/br his honour d bones, ' The labour of an jfgejn piled flones Or that Ins halldw'd 7\eli<jtws Jlmld be bid fader aflarre-ypointing Tyramid ? Deare Sonne of Memory ^great Heire of Time, 5

What needfl thoufuch dufllfitnejfe of thy 2tyme ? Thou in our "wonder and aftoniflment Hafl built thyfelfe a lasting Monument : For whil'U to tb'fhame offlow-endeVouringArt Thy eafie numbers flow,aiul that each part, Hath from the leaves of thy unvalued Booke, Tliofe Delphicke Lines ftitb deepe Imprefsion tooke Then thou our fancy ofherfelfe bereaving, Dofl make us Marble with too much conceivings /Indfo Sepulcher'd tn/u:h pompe dofl lie That things f or fuchaTombe "wouldn't fl) to die,.

10

15

The order of the notes follows Professor Smith's three states, Effigies A, Effigies B. and Effigies C. 2nd line of Title Poet] J Poet, W.] ] VV. Shakespeare.] Shakespeare.} Shakespeare. 4 Under] Vnder) ) ftarre-y pointed] Jtarre-y pointing] ] 5 Fame,] Fame,] ] 9 whil'st,} whil' ft] } flow-endevouring] flow-endeavouring] flow-endevouring Art, } Art] ] 12 Imprefsion] imprefsion] Imprefsion tooke: ] tooke] ]

SHAKESPEARE, POEMS, LONDON, 1640

Page [Ksr & v]

KAn Epitaph on t be Admirable Drtmaticke Ptety William' Sheakcfpearc.

W/hat neede my Sha^e^eart for his hououred b joejf

The labour of an age, in piled Ames, Or that h» hallow 'd Rehke slhould b< hid, Vnder a ftarre-ypointing Pyramid t Dcare Sonnc.of Memory, great he ire of Fame, What needs clou fuch weake wimefle of ih) name. Thou in our wonder and aQoocuSmcnt, Haft built thy felre a live-long Monument: For whilft to th'fhame of flowcndeVQUnng Atr^ Thy eafie. numbers flow > one that cat h heart ,

Hack Mk\ the leaves of thy nnvalu'd Bockc.

Thofe Df Iphickc lines with deepe Ioaprtfljon tcoke.

Then thou our fancy of ow felfe bereaving X>oft make us marble with too much conceiting^ And To Scpulcher'd in fuch pompe doth lk£ That Kings for fuch a Tombc would wiuWdk.

i. Ml

ON SHAKESPEARE — 1663-1664 367

SHAKESPEARE THIRD FOLIO, 1663-64

Page [bsr]

An Epitaph

On the admirable Dramatick Toet,

WILLIAM SHAKESTEAKE.

ffillHat need my Shakefpeare for his honour d

felSK bones ^

The labour of an Age , in piled ftones ,

Or that his hallow'd Reliques fhould be hid

Under a Starre-ypointing Tyramid?

Dear Son of Memory, great Heir ofEame, s

What need'fl thoufuch dull witnefle of thy Name ?

Thou in our wonder and aftonishment

Haft built thy felf a lafting CMonument :

For whii'ft to th'shame of flow-endeavouring Art

Thy eafie numbers flow, and that each part , 10

Hath from the leaves of thy unvalued Book,

Thofe Delphick Lines with deep Impreffion took

Then thou our fancy of her felf bereaving,

Doft make us ^JM^arble with too much con- ceiving,

And fo Sepulcher* dm fuch pomp doft lie , 15

That Kings for fuch zTomb would wish to die.

Collation of Second Folio, 1632, Poems, 1640, and Third Folio, 1664, printings of On Shakespeare. The variants of the Second Folio copies among themselves will be found on page 366. The text of the poem in 1632 is printed in italic type with an occasional use of roman ; in 1640 and 1664, the type is reversed, almost all of it being roman with occasional use of italic in 1664, and in the text, oidy the name Shakespeare is in italic in 1640. 1 neede] ] need 2 Age,] age,] Age, /tones] ftones,] | 3 Reliques] Relikes] Reliques hid\h\(\,] hid 4 V-Under] Vndcr] Under ftarre-pointed(-ing)] ftarre-ypointing] Starre-ypointing 5 Deare] ] Dear Sonne] ] Son 6 needft] needs] need'ft dull] weake] dull Name?] name.] Name? 7 aftonijhment] aftonefhment,] aftonifhment 8 lafling] live-long] lafting 9 whii'ft] whilft] whii'ft flow-end e (-a) vowing] flow-endevouring] flow-endeavouring Art(,)]] Art 10 part,] heart,] part, 11 Booke, ] ] Hook, 12 Lines] lines] Lines tooke(:) ] tooke.] took 13 her] our] her 14 Marble] marble] Marble 15 doft] cloth] doft

1664 seems to have followed .the text of Effigies B of 1632. 1640 has some readings connected with 1645, and seems to be the only text printed with Shakespeare that gives any evidence of having been prepared or corrected by Milton himself. But this is conjecture only. The type page in the original is about 9'/iu inches high.

368 POEMS PRINTED BY OTHERS

H

CHOICE PSALMS, WILLIAM AND HENRY LAWES, LONDON, 1648

Page av

To my Friend Mr. Henry Lawes.

Arry, whofe tunefiill and well meafur'd fong Firft taught our Englifh Mufic how to fpan Words with juft note and accent, not to fcan With Midas eares,committing fhort and long,

Thy worth and skill exempts thee from the throng, 5

With praife enough for Envie to look wan : To after age thou (halt be writ the man That with fmooth Aire couldft humour beft our tongue.

Thou honour'ft Verfe, and Verfe muft lend her wing

To honour thee, the Prieft of Vhabus Quire, 10

* The ftory That tunft their happieft Lines in hymne or * ftory .

fe hyrih1m in Dmt ^all give Fame *cave t0 ^et tnee higher Mufi«. Then his Cafella, whom he woo'd to fing,

Met in the milder fhades of Purgatory.

JP. Milton,

Upon the death of William Lawes, there appeared a volume more or less commemorating him under the title Choice Psalms put into Mustek for three voices. The book was printed by James Young for Humphrey Moseley, London, 1648. It contains elegies, set in musick by several friends, upon the death of William Lawes. On the two leaves immediately preceding the music are four poems addressed to Henry Lawes, or to both the brothers. The third of these preliminary poems is Milton's, and is signed J.Milton. The marginal note is the only annotation we have by Milton himself. 12 higher] The g is broken in all copies examined. The copies examined include 5 originals at Illinois; two film copies from Harvard; and one each from Huntington and Yale, making a total of 9 copies.

THE LIFE AND DEATH OF SIR HEKRT VA^E, N.P., 1662

Page 93. Page 94. .

V A /V£, fonnjr in fears, int In fug: connftl old, Hhe her to felllt \t» e or te unfold 3

Then whom a tetter Senatonr ner'e held 'I he i/r.'.'i "( hallow flat eS, hard tote ffell'd,

The he/me of Home, when Gowns not ArmirejtH'i 'J Lea to aivifi haw rear «u; hejl, upheld,

The fierce bpzuoteud the Mucin Mi. Move vi her two main Nerves, Iron and Geld

It/ size) - In aU her r.<jnifAgt : be fides to know

; •' Roth l-.ir'iiual yower and civil, what etch meaner, 10

#•£/.•'*•• H hat fevers each, thou bttfl team's, which few hale itm»

The liHtidt of either Sword to thee we owe ; 7 bercferc on thy firm hand Religion leaves In peace, and reckons tine her elittji Son.

[}A size)

This sonnet was first printed anonymously in [George Sikes] The Life and, Death of Sir Henry Vane, n.p., 1662. On page 93 is the statement, The Character of this deceased Statesman, ... I shall exhibite to you in a paper of Verses, composed by a learned Gentleman, and sent him, July 3. 1652. Then follow the lines to Vane, carrying over on page 94. IU copy 1 of [Sikes] was used for the reproduction. There are no variants in the hve original and nine film copies examined of 1662, but, 5 Whether] The t is faint or broken in all copies examined, peace] .The c barely prints in all copies examined.

LINES ON HOBSON THE CARRIER 369

LINES ON HOBSON THE CARRIER

MILTON WR( known Camb by printing t

LOTE TWO SETS OF VERSES on the death of the well Cambridge character, Hobson the carrier, which he acknowledged by printing them in the 1645 and again in the 1673 Poems. The verses are of little account, and, as Henry John Todd pointed out in his edition of Mil- ton's Poetical Works of 1801 (et seq. vol. 6:89 fn.) they were used and printed elsewhere. Both sets of verses were printed in garbled versions in Wit Restor'd, London, 1658, pages 84-86, and the verse Milton printed second is contained in Banquet of Jests, London, 1640, pages 1 29-131. The title page of the 1640 edi- tion reads 'Sixth Edition' but the bibliographical details of this volume, the only known copy of it being in the Cambridge University Library, or its relations to earlier editions, have never been worked out. It is interesting to note the treat- ment of these pirated printings in the Columbia edition. In 1936 (Modern Lan- guage Review 31:395-402) Professor W. R. Parker announced the 'discovery' of the printings of 1640 and 1658, making no mention of Todd, and no mention of

1657. In the last Columbia volume, the text of 1640 is printed, pages 349-50, and Professor Parker's article summarized in the notes on pages 584-85, and textual variants from 1658 supplied. The Columbia 1640 text contains one grave error, and a few other minor errors of omission. But so inconsequential are these two sets of verses that little attention should be devoted to their texts in such publica- tions no matter how startling it may be to find verses by Milton in jestbooks. The 1640, 1657, 1658 printings are not, as Professor Parker calls them, 'perfectly valid textual "sources" ' for these poems, as they cannot be connected with Milton. They are probably pirated and certainly shortened contemporary printings. The same verses printed in 1640 appeared also in what seems to be a reprint of the Banquet of Jests, London, 1657, pages 82-83, the only copy known seeming to be that in the Folger Library. Both sets of verses appear in Wit Restor'd, London,

1658, pages 84-86. Reproductions of each of these three anonymous printings are provided herein, without more than passing comment, as they are of most dubious value as texts, for they probably have no connection whatever with Milton. The 1640 version of Hobson II lacks lines 15-20 and 25-26 inclusive; and the 1658 ver- sion of the same verses lacks lines 13-26 and 29-34 inclusive. The free change of words and the equally free exclusion of lines should be noted. Old manuscript versions of these Hobson poems are also known to exist ; but they cannot in any way be connected with Milton. See Columbia Works, 18:591; and G. Blackmore Evans, 'Two New Manuscript Versions of Milton's Hobson Poems,' Modern Language Notes, 57 (1942) 192-194.

370

POEMS PRINTED BY OTHERS

FROM BAHQUET OF JESTS, LONDON, 1640

Pages 129, 130, 131

V-m 0W Hobfon the Carrteref Cambridge.

HHere Hobfon $er, who did moft tru^ly prove That he could ncie' dy^whilf he dtdmoi a bj ng bisd'jlinie, never to fit*

he might {till jtg on% and keep trot.

Mat^htnTtirMaU^nt&t #Jeet VtuiUbureJolmonwAS ai$aj* Time number smoUmget without aUeri 'Gainft truth^twMimlio^nmeAtedo'ut

time: <**dlih fome*tighk movdwitb „

ij'M^wrigatit' . ; ',.

Hu principles heptgft >asdjbc endeq iffctii Ztfjfagivefafftolifi^elfah0de$i *M m much hrcmb^g 'put bimm^

^breath -:'■ WrwereitcmkiMi&oHtaffi^l to* long vacMnm^wdiaMr*t€tts^ f*frwh*ifeefe-difatfcx tmltrjmfo

right f '

pedfkforktAviimjfatib'uhis Csrismm

Ugh, '

His tesftre told him t&Jt bis ttmewjs dndlack afloat made bis lift burden^ Wrbt&his doings lofted as thejmefe, Hf^ad bee** anmmrtAB CAtritr. Obiliemto the Woo»che fpe*tb<s date, fn M.trfe rectpr^A^AvdbAdhtsfaiie

m l,

LindttAtbemmtuaAfUmng oftb&kmti Vet (j^+tfthfifykii^ri^ti difeafe.

HisUtttrs An deliver d a&^ ami got*.

OnebfremAines tbiffufe*£tiptio». *

10

15

20

25

FROM BANQUET OF JESTS, LONDON, 1657

Pages 82 & 83

Vpm ttd Hobfon the Carrier •/

CarobnJgc.

tKT'TErt Hobfon /;</, vrb* *d mfl

JL A truely prtrve

Tb*t be cent J never die, n b'dfi h dU m: W $•■'*>*£ hu Asftimj, never to r*tt li'mfji he might fitil jog tn. and keep bm fn*i A lade tf ffhetrts met alt, never te dec*?, *Untilt hu revdmi** not at ft*} Time nnmbtrt wmmm, tet n*the*i ail cr*me 'Gainfi trutb^ */.▼.« motion nmmbriiottt h s

time i Amdliks feme engine imv*d with whetlt

andmighe, Hutrindplet tet*{ ceat'd he ended jlrsif fa. ' * K'fl,

£#/?, thae grvet *U mt U*e fare htm **

death % And tec mm h breathing pmt htm em f

break : Xer were tt eewifadiFli** t» a(f.rm% To* l*n* Yacatian htftnea** la* Tem». Eafe WM hu t hit ft di caje% aadjl fmdft

eighty He d/d far keetvimfe, that km Carts vert

liebt. Hit leajmre teJd him that hit time wm eeme. And tat /• of tea i made hit hft bmrmnftme fir hsd mtdnmft tafred at tmy were, He bad been an immortal! carrit r. Obedient eo the Moon keffent bit date. In cemrfe recrtfreeol * mid bad beef ate Ltnch te tke mutual fiemttteftktfeAt Tet (ftraneetetkinkj bitimfMwAt bit difeafe. Hit Liter t Are deliver' 'd alt, and jtem 1 Omtf nmainet tku fmferfcriftiom.

10

15

20

25

1 HHere] The first letter is repeated. 2 couldnever] No

space. 5 Not spheares mortall as Columbia prints. [15-20] inclusive of 1673 and 1645 are lacking. [25-26] are

lacking. See next page for collation with 1657 and 1658.

See next page for collation with 1640 and 1658.

ON HOBSON — 1658

371

FROM WIT RESTORED, LONDON, 1658

Pages 84, 85, 86

Another*

HEre lies old Hobfoni Death hath his deiire, And berc ( alafle ) hath left him in the mire; Or elfe the waies being foul, twenty to one, He's here ltuck in a (lough, and overthrown. Twai fuch a fhifter, that if truth were known. Death was half gladthat he had got him down. For he hath any time this ten years full, Dog*dd him *cwixt C*mhtdg€ and the Lend**.

Bull. And furely death could never have prevail'd, Had not his weekly courfe of carriage fail 'd* But lately finding him fo long at home, And thinking now his journey's end waf

come ; And that he had tane up bis lateft Inne , Death in the likenefle of a Chamberlin,

q 3 Skew*

She w'd him bis room, where he muft lodge

that night, PuU'd off h*s boots, and took away the light. If any ask lot him, it fhall be fed, Hobfon has fupt, and newly gon to bed.

10

15

H

Another on the fame.

Ere lieth one, who did mofttruely prove,

That tie could never die, whilfi he could

move. So hung his deftiny, never to rot , Whilft he could out jogg on , and ke<$ his

trot. Made of Sphear met tall, never to decay, Untill his refolution made of ftay. Time numbers motion , yet without a crime , •Gainft old truth, motion numbered out his

time. And

And like fome Engine mov'd, with wtaeeles

and weight, His principles once ceas'd, he ended ftrcight. Reft , that gives all men life, gave him his

death, And too much breathing put him out of

breath'. For had his doings lafted as they were He had been an immortall Carrier.

10

This is the only known printing by others of these lines.

Collation of 1658,' 1657, 1640. 1658 prints in roman and 1657 and 1640 in italic type. 1 Here] ] HHere lieth one,] Hobson lyes,] ] prove,] prove] ] 2 die,] dye,] ] could move.] did move:] ] 3 deftiny,] ] deftinie, 4 could] might] ] jogg] jog] ] trot.] trot;] trot. 5 Sphdar] fpheares] ] 6 Untill] ] Vntill made at] was at] ] 7 crime,] crime] ] 8 'Gainft old truth,] 'Gainft truth,] ] time.] time:] ] 9 Engine] engine] ] mov'd,] mov'd] moov'd whe"eles] wheele] ] lo.ceaf'd,] ] feasd, ftreight.] ftraight.] ftraight 11 all men] all us] ] death,] ] death 12 breath.] breath:] ] 13 were,] were] ] 14 Carrier.] carrier.] ]

372

POEMS PRINTED BY OTHERS

SONNETS FROM LETTERS OF STATE, 1694

Present in the Trinity College Manuscript, but never printed by Milton, although the Vane sonnet had been printed by George Sikes in 1662, these four sonnets were printed, three for the first time, in the Letters of State, edited and published by Edward Phillips, in 1694. The texts of the MS. must be taken as basic for all four, and there is no point in collating MS. with 1694, or the Vane text with 1662. The 1694 texts are reproduced, from IU copy 8, and no variants were observed among the twelve original and six film copies examined.

Page xlvi.

To my Lord Fairfax.

FAirfax, whofe Name in Arms through Europe rings , And fills all Mouths with Envy or with

Praife, And all her Jealous Monarchs with Amaie. And Rumours loud which daunt remoteft

Kings, Thy firm unfliaken Valour ever brings 5

Victory home, while new Rebellions raife Their Hydra- heads, and the falfe North dif-

plays Her broken League to Imp her Serpent

Wings: O yet ! a Nobler task awaits thy Hand, For what can War, but A&s of War dill 10

breed, Till injur'd Truth from Violence be freed j And publick Faith be refcu'd from the

Brand Of publick Fraud i in vain doth Valour

bleed, While Avarice and Rapine (hires the Land,

Page xlv.

T O

Oliver Cromwell

CRomtrdtcux Chief of Men,thatihiou£h a Croud, Not of War only, but djftradHons rudej Guided by Faith\and Matchlefs Fortitude : To Peace and Truth, thy Glorious way

haft Plough'd, And Fought God's Battels,. and his Work

purfu'd, While Varment Streams with Blood of

Scots imbru'd 5 And Vmbarfield refound thy Praifes loud, And Worcefkefs Laureat Wreath j yet much

remains To Conquer ftillj Peace hath her Victories No lefs than thofe of War; new Foes arife Threatning to bind our Souls in fecular

Chains, Help us to fave Free Confcience from the

piW

Of Hireling Wolves, whofe Gofpel is their Maw.

b 2

10

These sonnets appear in the Trinity College MS. pp. 419, and 453-455, but were never printed by Milton. They appear in the Letters of State of 1694. The text of the M S. must be taken as the basic text of these sonnets, and there is no point in collating those texts with 1694. The 1694 texts are here reproduced from IU copy 8 solely because that was the first printing of the poems. There are no variants observed among the twelve original and six film copies of 1694 examined.

SONNETS FROM LETTERS OF STATE — 1694

373

Page xlvii

ToMt.CTRIJC SFCINNER Upon his Blindnefs,

CTRIAC this Three years day, thefe Eyes though clear To outward view of blemifti or of Spot, Bereft of Sight, their Seeing have forgot : Nor to their idle Orbs doth day appear, Or Sun, or Moon, or Star, throughout the

Year; Or Man, or Woman ; yet I argue not Againft Heaven's Hand, or Will, nor bate

one jot Of Heart or Hope ; but ftill bear up, and

fleer Right onward. What fupports me, dofi?

thou ask ? The Confcience, Friend, to have loft them

over ply'd In Liberties Defence, my noble task ; Of which all Europe rings from fide to fide. This thought might lead me through this

World's vain mask Content, though blind, had I no other

Guide.

10

15

Page xlviii

To Sir HENRT VANE.

VANE, Young in years, but in Sage Councels old, Then whom a better Senator ne're held The Helm of Rome, when Gowns, not

Arms, repell'd The fierce Epirote, and the African bold, Whether to fettle Peace, or to unfold The Drift of hollow States, hard to be

Spell'd ; Then to advife how War may beft be up- held, Mann'd by her Two main Nerves, Iron and

Gold,

In all her Equipage : Belides, to know Both Spiritual and Civil, what each means, What ferveseach, thou haft learn'd, which

few havedone. The bounds of either Sword to thee we

owe i Therefore on thy Right hand Religion

leans,

And reckons thee in chief her Eldeft Son»

10

This sonnet appears in the Trinity College MS., but was never printed by Milton. It appears in the Letters of State of 1694. The text of the MS. must be taken as the basic text of this son- net, and there is no point in collating that text with 1694. The 1694 text is here reproduced (from IU copy 8) because that was the first printing of the poem. There are no variants ob- served among the twelve original and six film copies of 1694 examined.

Printed anonymously in 1662, and found in a single draft in the Trinity College MS., though not in Milton's hand. Twelve origi- nal and six film copies of Letter of State, written by Mr. John Mil- ton, London, 1694, were used for collating the following text repro- duced from IU copy 8 of that edition, probably prepared by Edward Phillips. Milton himself never printed the poem. The collation is between 1694 and 1662. The MS. version appears herein on page 455. 1694 is printed in roman type and 1662 in- italic which is disregarded in collation. 1 Young] young Sage] fage Councels] counfel 2 Senator] Senatour ne're] ner'e 3 Helm] helme Gowns,] Gowns Arms,] Arms 4 Epirote,] Epeirot bold,] bold. 5 Peace,] peace 6 Drift] drift States,] ftates, Spell'd;] fpell'd, 7 War] war beft be upheld,] beft, upheld, 8 Mann'd] Move Two] two Gold,] Gold 9 Befides, ] befides 10 Spiritual] fpiritual and Civil,] power and civil, means,] meanes, 11 ferves] fevers learn'd,] learn't, 13 Right] firm leans,] leanes 14 1662 opens the line with In peace, then continues with the entire 1694 line.

VERSES FROM THE PROSE WORKS

375

376

VERSES FROM THE PROSE WORKS

FROM OF REFORMATION TOUCHING CHURCH DISCPLIHE, 1641

Page 30. Dante, Inferno XIX:ii5 f.

*Ah Conftantine, of how much illxoascaufe Not thy Converfiony but thoferich demaines That the ftrft wealthy Pope received of 'thee.

Page 30. Petrarch, Sonnet 108

And to be floor t^at lajt hisguidhim brings Into a goodly valley > where be fees A migmymaffe of things flrangely confus'd, Things that inearth vecrcloft^ or were abused.

Page 31. Ariosto, Orlando Furioso XXXI Y:73 f.

Founded in chafl and humble Foz'ertie^j, 'Gainfl them that rais'dthee doft thou lift thy horny Impudent wbotrefvhere haft thou placed thy hope ? In thy Adulterers, or thy ill got wealth } Amber Coaftantine comes not in haft.

Page 31. Ariosto, Orlando Furioso XXXIV:8o f.

Thenpaft heeto aflotvry tMountaine greeneT Which oncefmeltfweet, nowflinksas odioujly^ This was that gift (if you the truth will have) That Cotfftaritine to good SyXvzfaogave.

FROM THE REASOH OF CHURCH GOVERNMENT, 1641/42

Page 15.

When I dye, lee the earth be roul'd in fUmey.

— said by Tiberius

FROM AH APOLOGY ETC., 1642

Page 26. Horace, Satires 1:1:24

-'-/aughi/ig to teach the truth What hinder st as feme teachers give to Boys Junkets and knacks^ that they may learne apace*

Page 26. Horace, Satires 1:10:14

—Jrfting drcides great things Stronglier, and better oft then earnefi can.

Page 27. Sophocles, Electra:b2\

Tit you that fay it, KotJ^you do the deeds, Andy our ttnvodly deeds finde me the recrds.

VERSES FROM THE PROSE WORKS

377

FROM AREOPAGITICA, 1644

FROM TETRACHORDOH, 1645

Title page. Euripides, Supplices:$T,8

This is true Liberty when free born men Having to advife the public may freak free, Which be who can, and wiU, deferv's high praife, Who neither cm nor will, may hold his peaces What canbejufier in a State then thii ?

Page 39. Horace, Epistles 1:16:40

W'vvn doe me count a good nt*n $shom but he W"> kerpts th" lawes andflatntes of the Senate, Who ju.ig-j i» great ftths and controverfief, Who fit witneffr and opinion rvinnes the caufe ; Hut his oVpKe houfe, and the w^ole neighbourhood Sees hisfoule in fide through his white a skin.

FROM TENURE OF KIHGS & MAGISTRATES

Page 18. First Edition, 1649. Seneca, Hercules Furens:g22

There can be flaine

No facripce to god more acceptable Then an u/ijafi and wicked King —

Page 20. Second Edition, 1650

There can bejlame

Nofacrrfice to God more acceptable Then an unjujl and wicked King —

378 VERSES FROM THE PROSE WORKS

FROM PRO POPULO DEFEHSIO

guts expedivh Salmafio fuam Hundredam, Picamque dccuit nojlra verba conari ? CMagifter artis venter ; & Jacobsi Centum,exulamis vifcera marfupii regis, gubd fi dolofi Jpes refulfcrit nummiy 5

Ipfc Antichrifti quimodoprimatum Papae ' Minatus uno eftdiflipare'fumatu, Cantabit ultrd Cardinalitium melos.

Page 154. First (4to) Edition, 1651

Qui* expedhfit Salmafio fuam Hundredam, Picamque docuit noHra verba conari ? <SM agitter artis venter, & Jacobaei Centum, exulantis vifcera marfupii regis. Quod ft dolofi Jpes refulferit nummi, Ipfe Antichrifti qui modo primatum Papae Minatus uno eft difsipare fufflatu, Cantabit ultro Cardinalitium melos.

Page 202. Second Edition (folio), 1651

£«* exfedivit Salmafio fuam Hundredam, Picamque docuh noHra verbs conari * Magifier artk venter, & ] acobarl Centum, exulantis vifcera marfupii regis.- Qjiodfi ihfofi ftes refulfrrit nummi, 5

Ipr \ntichrifti qui modo pr imatiim Papa Miritusunotftdiffipare fufflaru, Camabh ultro Cardinalitium melos.

Page 127. Third Edition, 1658

VERSES FROM THE PROSE WORKS 379

FROM DEFEHSIO SECUTiDA, 1654

Gaudete Scombri^ & quicquid eft pifcmm falo,

JZuifrigida hyeme incolitif-algentes fret a, Veftrum mifertus ille Salmafiuf eques Bonn$ amicire nuditatem cogitc.t ; Chfi,rt£q\UrgHf apparat papyrinos 5

~Vobt6 chchIIos pr<eferentes Claudii Infignia nomenque & dectts Salmafiiy Geftetis ut per omne cetarium forum E quit is clientes,fcriniis mungentium Cubit o virorum^ capful is gratiffimos. io

Pages 38-39. London, 1654

Gaudete Scombri, & quicquid eft pifcium falo,

&«/* frigida by erne incolitis algentisfreta ,

Vejlriim mifertus illc Salmafius eques

Bonus amicire nuditattm cogitat -

Cbartaque largus apparatpapyrinos 5

VobiscucuUos prwfermtes Claudii

Jnjignianomenque & dec us Salmajii ,

Gejietis ut per omne cetarium forum

Equitis clientes ,fcriniis mungentium

Cubito virvrum , (3" capfulis gratijiimos. 10

Page 28. The Hague, 16542

Gaudete Scombri,®" quicquid efl pifcium falo,

Qui frigida hyeme incolitis algentis freta,

Vejirum mifertus ille Salmafius eques

Bonus amiciri nuditattm cogitat :

Cbartaque largus apparatpapyrinos 5

Vobis cucullospraftrmtes Claudii

Jnftgnia nomtnqut & decus Salmafu ,

Gefietis ut per omne cetarium forum

JLquitis clientesfcriniis mungentium

Cubito virorum,& capfulis gratif.imos. 10

Page 28. The Hague, 16543

380 VERSES FROM THE PROSE WORKS

FROM THE HISTORY OF BRITAIN 1670

Page ii. Translated from Geoffrey of Monmouth

Goddefs of shades, and Huntrefs, who at will Wall(ft on, the romling Sphear,and through the deep, On thy third Reigne the Earth look^ now, and tell What Land) what Seat of reft thou bidft me feek^% What certain Seat, where I may worfhip thee 5

For aye i with Temples vow d3 and Virgin quires.

Brutus far to the Weft, in th' Ocean wide

Beyond the Realm of Gaul, a Land there lie s9

Sea-girt it lies, where Giants dwelt of old,

Now void} it fitts thy people $ thether bend io

Thy courfe, there Jhalt thou find a lafting flat,

There to thy Sons another Troy fhalt rife,

And Kings be horn of thee ; whofe dredded might

shall aw the World, and Conquer Nations bold.

Page 186. Translated from Matthew of Westminster

Low in a mead of Kine under a Thorn,

Of head bereft li'th poor Kenelm King-born.

THE TRINITY COLLEGE MANUSCRIPT

381

THE TRINITY COLLEGE MANUSCRIPT 383

THE TRINITY COLLEGE MANUSCRIPT

M

ILTON PUBLISHED TWO COLLECTED EDITIONS of most of his minor poems during his lifetime. In addition to these two printings, much of the English . poetry exists also in manuscript. There is a manuscript copy of the first book of Para- disc Lost, now in the Morgan Library in New York, the only manuscript still extant of any por- tion of the longer poems. For many of the shorter English poems, there are the copies preserved in a manuscript still extant in the library of Trinity College, Cambridge. The earliest account of this manuscript is to be found in the 1738 edition of the prose works, edited with a biography and other additions, by Thomas Birch. In 1740, Francis Peck published his New Memoirs, in which he stated that he had the MS. before him. He made a number of corrections of Birch's readings. Then in 1749, Thomas Newton, in the biography prefixed to his massive two volume edition of Paradise Lost, summarized what was then known about the MS. Sotheby reproduced much of the poetry in 1861. William Aldis Wright edited a full size reproduction of it, with printed transcription, in 1899, and the Cambridge University Press printed it. His introduction and notes provide about all we know of the history of the MS. Wright reasoned that it probably came to the Trinity College Library in or about 1691, with the other books and manuscripts given to the Library by Sir Henry Puckering, although, Wright acknowledges, there is no mention of the Milton MS. in Bernard's catalog issued in 1697 of the Puckering material. Wright states that there is no knowledge of how the Milton MS. came into Puckering's possession. However, it is possible that Puckering bought Milton's books direct from Milton, as several of the earlier biogra- phers state or hint that, before he died, Milton sold much of his library and other literary effects. Perhaps Puckering bought them. However that may be, the MS. is known to have been in the Trinity College Library since 1738, and since Newton, every important editor of the poetry has made use of it in one way or another, from Newton, Warton, Todd, Mitford, Masson, Verity, Beeching, Wright, to Professor Patterson (Columbia).

Wright's account of the MS. is sufficiently accurate even yet, the MS. being last seen and ex- amined by the present editor between 1925 and 1930, unless there have been some serious changes in it since 1930. It is, and probably for years has been, a slim volume, bound at least as early as Newton's time, containing about fifty pages, three being blank, and the remaining forty-seven containing manuscript copies of various of the shorter English poems only, with pages one through eight and ten through forty-one in Milton's own handwriting, and the remaining poems in various other hands. (See J. H. Hanford, 'Chronology of Milton's Private Studies' PMLA 36(1921) 251-314.) Wright's discussion of the MS. is too well known to repeat here. In gen- eral, little can be added to what he said of the arrangement and contents of the leaves. All the poetry contained in the MS. is here reproduced by the gracious permission of the Cambridge Uni- versity Press.

Frequently in the MS., Milton struck out material; then later, wishing to restore it, he under- scored it to indicate restoration. It is characteristic of him, and of his age, that he punctuates very sparingly and rarely begins lines with capital letters. His spelling is not uniform throughout, as must be expected of that day and age.

In general, Wright's transcriptions have stood the test of years, and are reproduced with almost no changes. His errors of omission or commission were very few, but occasionally inexplicable, as in the case of the name 'Thomason.'

The actual size of the original sheets, as they now exist, is approximately 7^ by 123^ inches, the reduction in height being about one-third for the full sheets.

384 TRINITY COLLEGE MANUSCRIPT

Part of a maske .

Looke nymphs & sheVheras looke heere ends our ques since at last^dMeyes are blest

Arcades Part of an Entertainment at

Looke Nymphs & shepherds look What sudden blaze of majestie is that w* wee from hence descrie

too divine to be mistooke 5 this this is shee

to whome our vowes & wishes bend heere our sollemne search hath end

Fame that her high worth to raise seem'd erst so lavish, & profuse i o now seemes guiltie of abuse wee may justly now accuse

and detraction from her praise of detraction from her praise

lesse then halfe *she hath express't "wee find express't

conceale Envie bid her hide the rest

Marke what radiant state she spreds 1 5 in circle round her shining throne

shooting her beams like silver threds this this is she alone sitting

seated like a goddesse bright in the center of her light

20 might she the wise Latona be

or the towred Cybele mother of a hundred gods

Ceres Juno dares not give her odds

who would ™~ have thought this clime had held 25 a deity so unparalel'd.

appeares As they offer to come forward The Genius of ye wood rises & turning towards them speakes

Gen Stay gentle Swayns, for though in this disguise

I see bright honour sparkle through yor eyes

Of famous Arcady you are & sprung

of that renouned flood so often sung in Divine Alphe"us who by secret sluse

stole under seas to meet his Arethuse

And yee the breathing roses of y"5 wood .

faire silver-buskin'd Nymphs as great & od

I know this quest of yo15 & free intent 35 was all in honour '& devotion merit

To the great mistresse of yon " shrine J

whome w* low reverence I . as mine

and wth all helpfull service will comply

to furder nights glad sole tie

•t" and lead you where you may lore neere behold

searching what shallow those ve tues iv*11 dull Fame hath left untold

wch I full oft amidst the alone

have sat to wonder at

For know by lot from Jo wer

45 & charge of this faire w er v

23 Ceres should be in italics. Milton struck it out and indicated that Juno be restored by drawing a line under it. 44 In Todd's

am time [1801] this line could still be read, 'from Jove I have the power'.

TRINITY COLLEGE MANUSCRIPT

ARCADES

385

./K

Jf r

'if <vrt

;*6%k

Sg&l T •

«*W JVC

<&A^f>#- /,

*S*

I * «t '

^ 5

5 'v **""* *

"$&W*%'f£i^itU/

i*r.Ayt*{ Ik/

"*,«»fc^

W&7

386 TRINITY COLLEGE MANUSCRIPT

live a thousand ycares

to nurse the saplings tall, & curie the grove' in ringlets quaint, & wanton windings wove and all my plants I save from nightlie ill of noysome winds, or blasting vapours chill bowes 5 & from the leaves brush off the evill dew

& heale the harmes of thwarting thunder blew

or

&• what the crosse dire-looking Planet smites

or hurtfull worme wth cankered venome bites

when evening gray doth rise I fetch my round

i (i over the mount and all this hallowed ground

and early ere the odourous breath of morne awakes the leaves slumbring leaves, or tassel'd horn shakes the high thicket hast I all about

visit c?" number all my rancks, & every sprout

1 5 wth puissant words, & murmurs made to blesse

but else in deepe of - night when drousinesse mortall eyes sense hath lockt up hath chain'd mortalitie then listen I to the cselestiall sirens harmonie

that sit upon the nine enfoulded spheares »o and sing to those that hold the vital sheares

& turning the adamantine spindle round on wch the fate. of gods & men is wound such sweet compulsion doth in musick lie to lull the daughters of Necessity 25 & keepe unsteddie Nature to her Law

& the low world in measur'd motion draw after the heavenly tune w* none can heare heare of humaine mould wth grosse unpurged eare and yet such musick worthiest were to blaze 30 the peerelesse height of her immortall praise

whose lustre leads us, & for her most fit if my inferior hand or voice could hit

inimitable sounds yet as wee goe what ere the skill of lesser gods can show *5 I will assay her worth to celebrate

and so attend you towards her glittering state where yee may all that are of noble stemme approach & kisse her sacred vestures hemme

Song

Ore the smooth enameld greene 4" where no print of step hath been

follow me as I sing and touch the wav under the shadie fe of

of branching elme sta re proofe 4 5 follow me

I will bring yee wher she sits clad in splendor as befitts /

her deitie [ though

such ueene 1 yet we

5" All Ar t seene^-

TRINITY COLLEGE MANUSCRIPT

ARCADES

387

— V ' "7

M«£«mI

t£> A^ fr£*tj fyj*iW

C

£ #« r^V;^ /lK^ Urn*** . ^StTaT^ ***** Wtjfir**,

7u te *A f* ^'% e**H &*&

• * °^ » /n M<| Arte*?/ fa*f*f//jyrlln<.

-fH"? **£ *> / Pi'**-

* *— <fo *'*« *►*

-•j

-CCJif

>^ri

■

388 TRINITY COLLEGE MANUSCRIPT

This concluding song of Arcades appears alone at the top of page 3 of the manuscript.

2 Song

nymphs & shepherds dance no more

by sandie Ladons lillied bancks On old Lycieus or Cyllene hoare

trip no more in twilight rancks though Erymanth yor losse deplore

a better soyle shall give you thanks From the stonie Maenalus bring yor flocks & live with us.

er

heere yee shall have greater grace

to serve the Ladie of this place

Such a rurall Queene A All Arcadia hath not seene

Last line of song, As struck out by changing s to 11 to read All not A as Wright printed.

This sonnet appears at the end of the First Draft of the Letter on page 6 of the manuscript.

[Sonnet VII]

How soone hath Time the suttle theefe of Youth stolne on his wing my three & twentith yeere my hasting days fly on wth full careere but my late spring no bud or blossome shew'th

Perhapps my semblance might deceave y= truth that I to manhood am arriv'd so neere & inward ripenesse doth much lesse appeare that some more tymely-happie spirits indu'th

Yet be it lesse or more, or soone or slow it shall be still in strictest measure even to that same lot however meane or high

toward wch Tyme leads me, & the will of heaven all is if I have grace to use it so as ever in my great task - maisters eye

This sonnet appears alone at the top of the last page of the manuscript containing writing, or on page 47.

Sonnet XXIII

@

Mee thought I saw my late espoused saint

brought to me like Alcestis from the grave whom Joves great son to her glad husband gave rescu'd from death by force though pale and faint. 5 Mine as whom ' washi from spot of childe-bed taint

purification in the old law did save, and such, as yet once more I trust to have full sight of her in heaven without restraint, came vested all in white, pure as her minde : 1 o her face was vaild, yet to my fancied sight

love, sweetness, goodness in her person shin'd soe cleare, as in no face with more delight. But o as to imbrace me she enclin'd, I wak'd, she fled, and day brought back my night.

47

TRINITY COLLEGE MANUSCRIPT

ARCADES

389

This concluding song ot Arcades appears alone at the top of page 3 of the manuscript.

1 rP

a. ?<jl*tr ^yU ^£^L ^V y+

This sonnet appears at the end of the First Draft of the Letter on page 6 of the manuscript.

[Sonnet VII]

%e~ J*»ni/*t/ 77*1 tit S**U tft<ft«fy*v4-t

t» nii«Ar^ **»*+¥& **ft i**^ lusty pVy**- *1L H fJ? X«fri <fr«<* farA* ?°

This sonnet appears alone at the top of the last page of the manuscript containing writing, or on page 47.

Sonnet XXIII

AiSuM*

c/fime-

m\r ntuia.fi. tffoufcd \aint

'■crm. the grave.

arta.1- *rn4o per, ft

(fmJVm

tifautiuiUW fiwli) .save

ainr.

aantYZ,

Unreal 77L-7u> fu£\nijg}^±lttiilt&

47

390

TRINITY COLLEGE MANUSCRIPT

baf'

,G>

Song

re of Sirens pledges of heavens joy e harmonious sisters voice & verse vine power & joynt force employ w"^ inbreath'd sense able to peirce. * equall whilst yo[_raptures temper'd sweet happie spousal meet tff" a while '

woes home-bredAbeguile fantasie d fancies then present of pure concent

saphire-colourd ay surrounds the ^soperaigne throne e v & sollemne crie . wjKsaintlie shout & sollemne jubilie

' e prlnclyrow M! .,

i 5 origini vo cis Heb : re spondet

'5

while

ounds eirce t versa

e the ser ire loud unsa the and the *youthf

in ten thous w* those just in hymnes d singing ever

trumpets blow lpud symphonie ofA trumpets blow

ubim sweet^winged squires

.,.•— r — \r Heavn's henshmen

es beareY

that^weafe \he *fresh greene palmes 'blooming

& sacrea Psalmes victorious palmes

y / \

e of hea/en and arches blue whilst the whole frame of

that all the f

resound and Eccho Hallefti. wth undiscordW while then all the starrie

that wee below may/learne w'% hart ^ voice frame may rightly to answere that melodious noise

by leaving out those harsh chromatick jarres, of sin that all /ur musick maires & in our lives/& in our song \

may keepe itr tune wth heaven till God ere long to" his celefrtiall consort us unite To live & sing wth him in *ever-endlesse light *ever-g\orious *uneclipsed

where day dwells wthout niS^

in/ endlesse Imorne of light

\cloudlesse/birth in never parting light Blest paire of Sitens pledges of heavens joy /

Spheare-borne harmonious sisters Voice, & Verse / Mixe yo" choise chords, & happiest sounds employ wed yor divine sounds,

dead things w1'

reath'd sense able to pierce & mix't power employ

and ^whilst yor equall raptures temper'd sweet

in high misterious *hoiie spousall nteet *happie

snatch us from earth\ a while

us of our selves & *home bred wo/s beguile "native

•up and to our high rays'd thantisie present up rays'd *high raysd that undisturbed song of \pure concent ay sung before the saphire - colour'd Throne to to him that sits tnereCn

w,h saintly shout, &/ solemne jubilie where the bright Seraphim in \*tripled row "burning uplifted thire high lifted loud Varch-zx^tW trumpets blow

and the Cherubfck hoast in thousand quires

touch thire irtimortall harps of golden wires

wth those just spirits that weare the\ "blooming palmes "blooming or

hymnes devout & "sacred Psalmes rholie victorious

singing everlastingly

while all the starrie rounds cV arches blue

resound and eccho Hallelu

1-20 whilst changed to while 2-12 & changed to to and to written in the margin. 2-14 tripled changed to triple and then struck out.

TRINITY COLLEGE MANUSCRIPT

SOLEMN MUSIC

391

"3

V LA*r ***»i^5 ififhrf &vi*4 fi Qmf\

< %,

>**- U*

■3w

&&S

<**#//

-C^

^H

&

^

fc

,v>

'

fain of Sir*™, fittyfc <ff i^teA/fnf

s

i ■

^iftTrf *"* *"M*« <*XV' W£ tf«k Uytf^rd <° *«<¥l- BO*

*^ */ .w itt& •*£ rlrf l.uiLvlU * ****** "l J i

9*n> 6uv-*5^'1

o..ii*ii:i:;:;-.::-:,q--^.

392

TRINITY COLLEGE MANUSCRIPT

on earth that weeAwth undiicordmg hart & voice may rightly answere /that melodious noise

rsh *chromatick jarres "ill soundii:g of e/ai clamourous/\sin that all our musick marres & in our lives &/in\our song may keepe in tune wh heaven, till God ere long to his celestiall/consort us unite to live & sitjfi wth Him in endlesse morne of light

'S

that wee on earth \vth may rightly answere as once wee *coul< against jarr'd drown' d natures chi broke the faire musi to thire great Lord in pfect diapason in first obedience/&

iscording voice lodious noise portion'd Sin *did

harsh e/& wth tumultuous din that all creatures made ose love thire motion swaid I^t they stood state of good

that till di

vhi thin

againe\ Oh may wee soone^renew that song & keepe in/tune wth heaven, till God ere long to his celestiall consort us unite To live & s/ng wth him in endlesse morne of light

At a solemn Musick

"S

Blest paire of Sirens, pledges of heavens joy,

,. Spheare borne, harmonious sisters Voice, & Verse

Wed yor divine sounds, & mixt power employ

dead things wth inbreath'd sense able to peirce

and to our high-rays'd phantasie praesent

that undisturbed song of pure concent

ay sung before the sapphire-coulour'd throne

to him that sitts theron

with saintly shout, & sollemne jubilie

where the bright Seraphim in burning row

thire loud up-lifted angell trumpetts blow

and the Cherubick hoast in thousand quires

touch thire immortall harps of golden wires

wth those just spirits that weare victorious palmes

hymns devout & holy psalmes

singing everlastingly.

That wee on earth w* undiscording voice

may rightly answere that melodious noise

did . , .

as once we ^could till disproportion d . sin

jarr'd against natures chime, & wth harsh din

broke the faire musick that all creatures made

to thire great Lord whose love thire motion sw sway'd

in pfect diapason whilst they- stood

in first obedience, & thire state of good

oh may wee soone againe renew that song

& keepe in tune wtb heav'n, till God e're long

to his celestiall consort us unite

To live & sing wth him in endlesse morne of light

TRINITY COLLEGE MANUSCRIPT

SOLEMN MUSIC

393

1%di

fTL

%

I

1

B

i

*i*

*iui W1

2*

^^MstffnP^^^ *****

m

vt »»'♦>«'

*» >**

V

>#4t*4t

M

&

ifcttf

■'• ■ - . « . - SN ' ■■'■ *** «*!?'•? *»* ox«t JiV.

7

^

A.? T} Scn*2f?i»S ***** f**s*"iw«f

l^ife

%

394

TRINITY COLLEGE MANUSCRIPT

15

On Time

set on a clock case

Fly envious Time till thou run out thy race

call on the lazie leaden-stepping howres

whose speed is but the heavie plummets pace

& glut thy selfe w* what thy wbmb devoures

wch is no more then what is false & vaine

& meerly mortall drosse

so little is our losse

so little is thy gaine

for when as each thing bad thou hast entomb'd

& last of all thy greedie selfe consum'd

then long ^Eternity shall greet our blisse

w* an individuall kisse

and Joy shall overtake us as a flood

when every thing y' is sincerely good

& pfectly divine

with Truth, & Peace, & Love shall ever shine

about the supreme throne

of him t' whose happy-making sight alone

when once our heavenly-guided soule shall clime

s then all this earthie grosnesse quit

attir'd wth starres wee shall for ever sit

Triumphing over Death, & Chance, & thee O Time.

15

2S

Upon the Circumcision

yee flaming Powers, & winged Warriours bright

that erst wth musick, & triumphant song

first heard by happie watchfull shepheards eare

so sweetly sung yor joy the clouds along

through the soft silence of the listening night

now mournt mourne & if sad share wth us to beare

yor fiery essence can distill no teare

burne in yor sighs, & borrow

seas wept from our deepe sorrow

he who w4 all heav'ns heraldry whileare

entred enter'd the world, now bleeds to • give us ease

alas how soone our sin

sore doth begin his infancie to sease

Oh more exceeding love or law more just just law indeed but more exceeding love for wee by rightfull doome remedilesse, were lost in death till he that dwelt above high-thron'd in secret blisse for us fraile dust emptied his glory even to nakednesse and y< great cov'nant wch wee still transgresse intirely satisfi'd and the full wrauth wrath beside

\ of vengefull Justice bore for our excesse

and seals obedience first w* wounding smart

this day, but Oh ere long

huge pangs & strong will peirce more neere his hart

8

Alas how soon our sin

sore doth begin' His infancy to sease

This day but O ere long

Huge pangs & strong Shall 'will peirce more neere his heart

On Time The heading was To be set on a clock case but the first three words have been pasted over, following this word in the MS. that looks like either a period or a comma.

13 flood ] There is a mark

TRINITY COLLEGE MANUSCRIPT

ON TIME

CIRCUMCISION

395

r

tn vh

Ttfx? fa**

JifiHufm.

i~fkj>*i

y t^*t

■ j c - »

?'? %***•» »«* *Hj i*^ ***"> tv*- <»t-mML

■»V *r

Uf><* +At

Or

r*lX

i

■v '

"if

yf/Jt-j /«

tin** )JITA (iVf .(it

J«rt Dir'( (j?J,y\\

**4 fcfiA

I

/!*/ J <«A

6i--<

j1 i^t.niy

~><r Air

396 TRINITY COLLEGE MANUSCRIPT

On his dore token y Citty expected an assault

When ^ assault was intended to y° Citty

Captaine, or Collonell, or Knight in armes

Whose chance on these defenselesse dores may sease

If ever deed of honour did thee please

Guard them, and him within protect from harmes.

He can requite thee, for he knows the charmes That call Fame on such gentle acts as these And he can spread thy name or"e lands and seas, What ever clime the sun's bright circle warmes.

Lift not thy speare against the Muses bowre The great Emathian conquerour bidd spare The house of Pindarus when temple' and towre

Went to ye ground . and the repeated aire Of sad Electra's poet had ye powre . To saue th' Athenian walls from mine bare

Ladie, that in the prime of earliest youth

wisely hast shun'd ye broad way & ye green

and with those few art eminently seen

that labour up y* hill of heavnly Truth The better part with Mary & with Ruth

chosen thou hast; and they y* overween

and at thy blooming vertue* fret their spleen ^prospering "growing vertues

no anger find in thee, but pitty & ruth. Thy care is fixt, & zealously attends

to fill thy odorous lamp with deeds of light

& Hope that reaps not shame. Therfore be sure (night

Thou when the Bridegroom with his feastfull freinds howr

opens the dore of Bliss, that, hovrc of night, passes to bliss at y midd A watch

hast gain'd thy entrance, Virgin wise & pure.

To y* Lady Margaret Ley

Daughter to that good Earle once President of Englands Counsel, & her Treasury

who left Jhem both, unstain'd with gold or fee Aliv"d in & left them both, more in himself content,

Till the sad breaking of that Parlament broke him, as that dishonest victory at Chaeronea, fatal to liberty kill'd with report that Old man eloquent,

Though later born then to have known y" da dales wherin yor Father flourisht, yet by you Madam, methinks I see him living yet ;

So well yor words his noble Vertues praise, that all both judge you to relate them true and to possess them, Honourd Margaret.

9

•

In the right margin to the first sonnet on this page the date 1642 has been struck out.

TRINITY COLLEGE MANUSCRIPT

SONNETS VIII IX X

397

. ^^-^j»d*i*.T

iSfiipffiu^tf- w*|; » \tf&i£h y* & //y

r -■■■ -v <">•.• J. ■" "T- WW

y

I

r>W»:.

1 ^V //-'.

iffi

/

trp*m£ Jey

IrfYl

1

I

«u A-,

^f "i.

■wtftum'i;-

398 TRINITY COLLEGE MANUSCRIPT

A maske 1634. 13

the first scene discovers a wild wood. A Guardian spirit, or Daemon *

Before the starrie threshold of Joves court

my mansion is, where those ifnortall shapes

of bright aereall spirits live insphear'd

in regions mild of calme & serene aire where the banks

amidst th« gardens] Hespiah gardens, on ^ whose bancks

aternall roses g\o?u isj hyacinth

bedew'd w* nectary S£ celestiall songs

"yeeld 1 / seternall roses grow, & hyacinth blow "grow *blosme

& fruits of golden firm, on whose faire tree

ever

the scalie-harnest wMctchfull dragons A keeps uninchanted m his never (harmed ffyb, & round the verge

& sacred limits of wis. xhappie Isle blissfull *blisfull

the jealous ocean fhatlold river winds

his farre-extended/armas till wIh steepe fall

halfe his wast flood y* Iwide Atlantique fills 1 5 & halfe the slow unfadpm'd poole of styx Stygian poole (wonder

/ doubt me gentle mortalls these may seeme but soft I was not sent to court yor

strange distances to heart cV unhnowne climes wth distant worlds, & strange removed clim

yet thence I /come and loft fro thence behold a above the smoke & stirre of this dim, narrow spot

20 Y!°h men call earth, & w* low-thoughted care

2 strive to keepe up a fraile & feavourish beeing

beyond the written date of mortall change 1 confin'd & pester'd in this pinfold heere unmindfull of the crowne that vertue gives

after this mortall change to her true servants 25 amoungst the enthron'd gods on sainted seates

yet some there be that by due steps aspire

.to lay thire just hands on that golden key

that xshews the palace of aetemity "ope's

to such my errand is, & but for such 30 I would not soyle these pure ambrosiall weeds

wth the ranck vapours of this sin-worne mould taske

but to my A buisnesse now. Neptune whose sway besids the sway

of every salt flood & each ebbing streame

tooke in by lot twixt high, and neather Jove all the •^ impiall the rule 6f title of each sea-girt Isles

that like to rich gemms inlay & various gems inlay

the unadorned bosome of ye deepe

vrch he to grace his tributarie gods

by course committs to severall goverment 40 and give them leave to weare thire saphire crowns

and weild thire little tridents, but this Isle

the greatest & the best of all his empire the maine

he quarters to his blu-hair'd dieties

and all this tract that fronts ye falling sun 45 a noble peere of mickle trust & power

has in his charge wth temper'd aw to guide

an old and haughtie nation proud in armes

where his faire ofspring nurs't in princely lore

are comming to attend thire fathers state 5° and new entrusted scepter, but thire way

lies through the perplext paths of this dreare wood

the nodding horror of whose shadie brows

threats the forlorne & wandring passinger

and heere thire tender age might surfer perill 55 but that by quick command from soveraigne Jove

I was dispatcht for thire defence, & guard

and listen why, for I will tell you now

what never yet was heard in tale or song from by old or moderne Bard in hall, or bowre 60 Bacchus, that first from out the purple grape

crush't the sweet poyson of mis-used wine

after the Tuscaine mariners transform'd

IO

TRINITY COLLEGE MANUSCRIPT

A MASK

399

'■/, f*€mf p - «. i i tin} '- pkfh. ;

cfM (TO

cffr**) ffWi

JA ji*i

K

p-x at

ccfa »

£

Vorw

.Oct^l

"\

vv

\jC* "'in

i^fa-tj.-

lot »>•) i^

if* <

^

at

SL'iv

1 WeJT' -unl Jc^Ia. M*#l /»uVv eLm'^refttS

off <■

^t;-,aii

<t*Jf

f3$

L

<

Mi,^

17 ^^k /

'rcwtf

M ^f

•S

<"'! ^^

/'(CI* w;-

r1*

«

A< H*

fji+f gjlurl

lOrt.lJ

/^H^C^^^./or,/

< :.*1~

10

400 TRINITY COLLEGE MANUSCRIPT

Coasting the Tyrrhene shore, as ye winds listed

on Circe's Island fell, (who knows not Circe

the Daughter of ye sun, whose charmed cup

whoever tasted lost his upright shape 5 & downeward fell into a groveling swine)

this nymph that gaz'd upon his clustring locks

w,h ivie berries wreath'd, & his blith youth

had by him ere he parted thence, a son

much like his father, but his mother more 10 wch therfore she brought up, and nam'd Mm Comus nam'd whome

who ripe & frolick of his full growne age

roaving the Celtick, & Iberian feilds

at last betaks him to this ominous wood

& in thick ^covert of black shade imbour'd "shelter mightie i 5 excells his mother at her potent art

offring to every wearie travailer

his orient like liquor in a crystall glasse

to quench the drouth of Phoebus, wch as they tast

fond (for most doe tast through weake intemperate thirst) jo soone as the potion* works thire humaine countnance

th' expresse resemblance of o' the gods is chang'd

into some brutish forme of wolfe or beare

or Ounce, or tiger, hog, or bearded goate

all other pts remaining as before they were _>5 and they, so pfect is thire miserie

not once pceave thire foule disfigurement

but boast themselves more comely then before

& all thire freinds & native home forget

to route w,h pleasure in a sensuall stie }o therfore when any favour'd of high Jove

chances to passe through this advent'orous glade

swift as the sparkle of a glaancing starre

I shoote from heaven to give him safe convoy

as now I doe, but first I must put off .15 these my sky robes spun out of Iris woofe

ar.d take ye weeds and liknesse of a swayne

that to the service of this house belongs

who w* his soft pipe & smoth dittied song

well knows to still the wild winds when they roare 4n & hush the waving woods, nor of lesse faith

and in this office of his mountaine watch the

neerest & likliest to give praesent aide chance aide f ys occasion of this occasion, but I heare the tread

hatefull of virgin steps I must be veiwlesse now. Exit goes out

wth a charming rod & glasse of liquor Comus enters with his rout all headed like some wild beasts thire

come on in garments some like mens & some like womens they begin a wild & humorous antick fashion intrant Ku>fidyovrcs. 4 5 Co. The starre that bids ye shepheard fold

now the top of heav'n doth hold and the gilded carre of day. his glowing axle doth allay

X

in the steepe Tartessian streame "Atlantick 50 & the slope sun his upward beame

shoots against the "northren pole "dusky

pacing toward the other goale

of his chamber in the east

meane while welcome Joy & feast 55 midnight shout & revelry

tipsie dance & jollity

braid yor locks w'h rosie twine

dropping odours, dropping wine

Rigor now is gon to bed do Advice & nice torn w,h her scrupulous head

II

Line 60. Wright's note reads 'Birch and other who follow him read the first words of this line "And quick Law," taking the tail of the "g" in the line above for a part of "Q." As I read them the words are "& nice" followed by something which ends in "torn," perhaps "custom." '

TRINITY COLLEGE MANUSCRIPT

A MASK

401

BHHBBS^ * ^

B ; <7 - ( ' „ I f ( i I. 1 I

f ♦* tlV^c { fjMjSIL., fu>{o lutmtf net- 6r<-i

j&*l%y1h0A. {A-**- fa-i'd i*tfet\ hy cU./r^i'Xf j-oc/J^f

\ 'la* L- L.,±J. L..l\- __,/' * **

■

iZf

\}> tisr/fiA.

a

■K ■

itfhr/

wl^ semi fr^ift -ASrml ef%t*tj* aSSf**, V

<*»

••

i

<TA<»^{5 Hp~t**- H^teu^k ^ a/b<uU+*<!<*} <fta4

**4 ™k<L\l»vu[i, f'U&ntfri. i£'*L?uiA>rr">

t -fsttayi

' 4i4f AZtJtJ iUss

v-ex

"lid, of*-}*-;

Co.

/i»"i

.-*«*. «%ru»-^

\AMAkH

^

II

402 TRINITY COLLEGE MANUSCRIPT

Strict age, & sowre severity

w,h thire grave saws in slumber lie

wee that are of purer fire

imitate the starrie quire 5 who in. thire nightly watchfull spheares

in lead wth swift round the months & yeares

the sounds & seas wth all thire finnie drove

now to the moone in wavering morrice move "tawnie

and on the yellow sands & shelves "tawnie

10 trip the pert fayries, & the dapper elves.

by dimpled brooke & fountayne brim

the wood nymphs deck't wth daysies trim

thire merrie wakes & pastimes keepe

what hath night to doe wth sleepe i 5 night has better sweets to prove

Venus now wakes, & wakens Love

Come let us our rights begin

tis. only daylight that makes sin

wch these dun shades will ne're report 20 Haile goddesse of nocturnall sport

Dark-vaild Cotytto, to whome the secret flame

of midnight torches burnes, mysterious Dame

that neere art call'd but when the dragon womb

of Stygian darknesse spitts her thickest glo°me xand makes one blot 25 x and makes a blot of nature and throws a blot A of all y aire

clowdie stay thy polisht ebon chaire (& befreind

$ none © wherin thou ridst ridst wth Hecate A

of till all thy dues bee don & nougjit left out &° favour our close revelrie jocondrie 30 ere the blabbing eastreane scout us thy vow'd preists till utmost end

the nice rnorne on th' Indian steepe from her cabin'd loopehple peepe and to y= telltale sun discry our conceal'd sollemnity 35 Come knit hands, & beate ye ground

in w'h a light 6° frolick fantastick round

the measure (in a wild rude & wanton antick)

Comus. Breake off, breake off, I heare feele the different pace of some chast footing neere about this ground some virgin sure benighted in these woods for so I can distinguish by myne art

run to yor shrouds w'hin these braks & trees they all scatter 4o our' number may affright. Some virgin sure

(for so I can distinguish by myne art) benighted in these woods; now to my traines charmes & to my mothers charmes wilie trains, I shall ere long be well stock't wth as faire a heard as graz'd 45 about my mother Circe thus I hurle

dazling my powder'd spells in to the spungie aire i/ind "bleare of power to cheate the eye wth ^sleight ^ illusion

lest ' and give it false presentments A else the place and my quaint habits breed astonishment 50 and put the damsell to suspicious flight

w1* must not be, for thats against my course I under faire praetence of freindly ends and well-plac't words of glozing courtesie baited w"1 reasons not unplausible 55 wind me into the easie hearted man

snares & hugge him into ^nets. when once her eye hath met the vertue of this magick dust I shall appeare some harmelesse villager whome thrift keeps up about his countrie geare | thirst 60 but heere she comes I fairly step aside

& hearken, if I may, her buisnesse heere.

the Ladie enters this way the noise was, if my eare -be true

best my A guide, now, me thought it was the sound of riot, & ill manag'd merriment

12

25 on changed to of 59 thirst] set off in right hand margin, Wright notes that this word seems to be in the same hand as hov'ring on page 13, and wild and pallat on page 15 of the manuscript.

TRINITY COLLEGE MANUSCRIPT

A MASK

403

|

/<«

.

uK h»<? yiribt }«"y ■»?',"*" t**' **c

■w\o ^ thin. -WiftH U *o a.J- eft fidLJp/ihajru,

£y ^? (i^y^ir**) e +** iff**- iUtfr

fKt "ded H-'wi*^ it^ wH 'Jmyfrif trio*

<\t

Cz*"i. /#• ** <"***: n^bf vf<yj*

hi

<a *4J& f**

%, *->

Isvcrn J

e^c

- fey" '

**U fey* ^/f ^A, SfJ^ 7^

Gr**< 4.^ /^< y, (feUc JL<yr*u,

Uj f-L he~'dj»4.ii}il M( Vj-Tdxfy. «H&

~*>1V\, rnr-

"VI

AAA'S ThA-r^

^

^ Z'7.

12

7/~$

W— L J

404 TRINITY COLLEGE MANUSCRIPT

such as the jocond flute or gamesome pipe when granges

stirrs up amoungst the loose unletter'd hinds that gar^ners full

adore > when for thire teeming flocks, &

in wanton dance they A praise the bounteous Pan 5 & thanke the gods amisse, I should be loath

to meet the rudenesse & swill'd insolence

of such late wassailers yet Oh where else

mazes tangled shall I informe my unacquainted feete

in the blind A alleys of these this arched wood i o my brothers when they saw me wearied out

wth this long way resolving heere to lodge

under the spredding favour of these pines

stept, as they sed, to the next thicket side

to bring me berries, or such cooling fruit i 5 as the kind hospitable woods provide

they left me then, when the gray-hoodded ev'n

like a sad votarist in palmers weeds

rose from the hindmost weeles of Phoebus chairc waine

but where they are and why they come not back 20 is now the labour of my thoughts, tiz likliest

wandring

they had ingadg'd thire youthly steps too farre

to the soone parting light and envious darknesse ere they could returne

had stolne them from me ; else O theevish night

why shouldst thou, but for some (ellonious end 25 in thy darke lanterne thus close up the starres

that nature hung in heaven & fill'd thire lamps

wth ever iasting 0y]e t0 gjve *thirt light "due

to the misled & lonely travailer

this isAplace as well as I may guesse 3° whence even now the tumult of loud mirth

was rife & perfect in my listening eare

yet nought but single darknesse doe I find

what mighf this be? a thousand fantasies

begin to throng into my memorie 35 of calling shaps, & beckning shadows dire

and ayrie tourigs "that lure night wanderers "that syllable mens nams

on sands, & shoars, & desert wildernesses.

these thoughts may startle well, but not astound

the vertuous mind, that ever walks attended 40 by a strong siding champion conscience

0 welcome pure-eyd Faith, white-handed Hope

thou "flittering angell girt w,h golden wings "hov'ring and thou ^unspotted forme of chastity "unblemish't

1 see yee visibly, 6° while I see yee

this dusky hollow is a paradise

& a° heaven gates ore my head A now / beleeve

he 45 thatA the supreme good to' whome all things ill

are but as slavish officers of vengeance would send a glistring *cherul> if need were "guardian to keepe my life, & honour unassaild. " ■

was I deceav*d, or did a sable cloud 50 turne forth her silver lining on the night

I did not erre, there dos a sable cloud turne forth her silver lining on the night & casts a gleame over this tufted grove I cannot hallow to my brothers, but 5 5 such noise as I can make to be heard fardest

He venter, for my new-enliv'nd spirits prompt me & they phapps are not farre hence Song. Sweet Ercho sweetest nymph that liv'st unseene

within thy ayrie "shell "cell

slow 6o by * Maeanders margent greene "slow

and in the violet-imbroider'd vale

where the love-lorne nightingale nightly to thee her sad song mourneth well

13

36 wandring changed to wanderers

TRINITY COLLEGE MANUSCRIPT

A MASK

405

*•*■

t

>efs e

I

r»mi my u.f\a.ca*c*4

~kJ-

"*i

rti

/«* JLm tt

X«5

it/4 of pM *«i

4v

«»*£

Aita ,2>«&r<A»-*t

+Mt

£

^-l^ft^rWl /**" *VA>«r AW*# crn^C- ^^ • •»

.y <**»*& Lath* 4c t»w brotLv^ 4ui- . f 1 vW

h»«h; «^^.5

»-U^.

o 1

'«i«<»»

IOcjC

T,

/^\t

U

13

406 TRINITY COLLEGE MANUSCRIPT

Canst thou not tell me of a gentle paire that likest thy Narcissus are?

Oh if thou have hid them in some flowrie cave 5 tell me but where

Sweet Queene of parlie, daughter of the spheare So mast maist thou be translated to the skies And hold a counterpoint xto all heavns harmonies *and give resounding grace

Comus enters, looks in and speaks Co. can any mortall mixture of earths mould 10 breath such divine encha^nting ravishment

sure som thing holy lodges in that brest and wth these raptures moves the vocall aire to testifie his hidden residence how sweetly did they flote upon the wings 1 5 of silence, through the empty vaulted night

at every fall smoothing the raven downe of darknesse till she smil'd, I have oft heard sitting

my mother Circe wlh the Sirens three ^amidst the flowrie-kirtlc'd Naiades

20 who as they sung would take the prison'd soule potent

& lap it in Elizium, Scylla would weepe wept culling thire potent hearbs, & balefull druggs and and chid* her barking waves into attention (powerful!)

and fell Charybdis murmur'd soft applause "'yghty

2% yet they in pleasing slumber lull'd the sense

and in sweet madnesse rob'd it of it selfe but such a sacred, & home felt delight such sober certainty of waking blisse I never heard till now. He speake to her 30 and she shall be my queene. Haile forreine wonder

certaine whome these rough shades did never breed unlesse the goddesse that in rurall shrine "liv'st heere wth Pan or Silvan, by blest song "dwell'st

forbidding every bleake unkindly fogge 35 to touch the "prospering- growth of this tall wood ^prosperous

Ladie Nay gentle shepheard ill is lost that praise that is addrest to unattending eares not any boast of skill, but extreme shift how to regaine my sever'd companie 40 compell'd me to awake the courteous Echo

to give me answere to give me from her mossie cou^ch Co. what chance good La. hath bereft you thus La. dim darknesse, & this leavie labyrinth

neere Co. Could that divide you from ^thire ushering hands guids 45 La. they left me wearied on a grassie terfe Co. by falsliood, or discourtesie or why

coole La. to seeke i'th valley some A freindly spring Co. and left yor faire side all unguarded Ladie La. they were but twaine, & purpos'd quick returne 50 Co. phapps fore stalling night prevented them La. how easie my misfortune is to hit Co. imports thire losse beside the praesent need La. no lesse then then if I should my brothers loose

o Co. were they of manly prime, or youthfull blome 55 La. as smooth as Hebe's thire unrazor'd lipps.

Co. such tow I saw what tyme the labour'd oxe in his loose traces from the furrow came & the swinck't hedger at his supper sate I saw' em under a greene mantling vine 60 that crawls along the side of yon smal hill

plucking ripe clusters from ye tender shoots thire port was more then humaine as they stood I tooke it for a faerie vision of some gay creatures of the element 65 that in the colours of ye rainbow live

& play ith plighted clowds, I was aw strooke & as I past, I worshipt, if those you seeke it were a journy like the path to heav'n

La

to helpe you find them out. Gentle villager

14

8 Wright was sure that the carefully obliterated words were And hold a counterpoint as in the Bridgewater Manuscript, which would free Lawes from Warton's charge of having tampered with the line. 21-22 The changes in these two lines go together. Wright thought that would weepe in 21 and and chide in 22 were first written; then changed to wept and chiding after which and chid was finally allowed to stand. That is, in 22 and was struck out and chide altered to chiding after which, and was restored and chiding altered to chid.

TRINITY COLLEGE MANUSCRIPT

A MASK

407

^ M.** 1r /«*■*>*

■ f*-

. ->

'*■> & film m V"J« ~£l6t***4 <a.%t

Hk ™* £,U k.<M , i • •/ ' ' 4

<*f**2 f* x/7^ JTZaZ ffijpr*. ; .

>M

>>•&&*/.

>**.-

«^5*<*rc*c€

.T

ami r I ...fjjj' . ,* _ 1 ;,

7 . 1/7 I

mx

ff? je

A.

•a.

ti?.

/o oTT .i'Vli^ * clot* 4 0- *v«j <«w r#TB«ec .

I*

14

408 TRINITY COLLEGE MANUSCRIPT

what readiest way would bring me to that place Co. due west it rises from this shrubbie point La. to find out that good Shepheard I suppose in such a scant allowance of starrelight 5 would overtaske the best land-pilots art

the wthoutAsure steerage of gucsse of well-practiz'd feet

Co. I know each lane, & every alley greene

dingle, or bushie dell of this "wide wood wild & every bosky bosky bosky bourne from side, to side 1 o my dayly walks, & ancient nighbour neighbourhood

and if yor stray attendance be yet lodg'd ed within or shroud ^w"'in these*limits / shall know I shall know "shroudie

ere the larke rowse rowse ere morrow wake or the low-roosted Larke from her thetch't rowse palate rowse, if otherwise pallat 1 5 I can conduct you Ladie to a low

but loyall cottage, where you may be safe till furder quest be made La. Shepheard I take thy word & trust thy honest offer'd courtesie W* oft is sooner found in lowly sheds .20 with cV smoakie rafters, then in tapstrie halls

h & courts of princes were where it first was nam'd

& is pratteiided yet yet is most prastended. in a place lesse warrante'd then this / cannot be or lesse secure I cannot be, that I should feare to change it

my •?5 .eye eye me blest providence, & squareAM;V tryall

to my proportion'd strength, shepheard lead on. Exeunt the tow brothers enter

i bro. unmuffle ye fafnt starres, & thou faire #moone

that wond'st wont'st to love the travailers benizon

stoope thy pale visage through an amber cloud 30 and disinherit Chaos, that raignes heere

in double night of darknesse & of shades.

or if yor influence be quite dam'd up -

w* black usurping 'mists, some gentle taper

though a rush candle from the wicker hole 35 of some clay habitation visit us

thy

wthAa long levell'd rule of streaming light

and thou shalt be our starre of Arcadie

or Tyrian Cynosure. 2 bro. of if our eyes

be barr'd that happinesse, might wee but heare

thire 40 the folded flocks pen'd in A watled cotes cotes

or sound of pastorall reed wth oaten stopps or wistle whistle from y« lodge, or village cock count the night watches to his featherie dames t'would be some solace yet, some little cheering this sad close 45 in A lone ^ dungeon of innumerous bowes.

ead the xbut oh that haplesse vergin our lost sister

wander per over where may sheAnow, whether betake her (amoungst rude burrs & thistles

phapps some cold hard banke gainst from the chill dew in this dead solitude surrounding wilde

perhaps some cold bank is 1 stead of phapps some cold bancke is her boulster now

50 do or gainst the rugged barke of some broad elme (fraught w* sad feares

wne she leans her thoughtfull head musing at our unkindnesse unpillow'd head frau

happs soe what if

old banke is or else in wild amazment, and affright so fares as did forsaken Proserpine

rowling when the big ^wallowing flakes of pitchie clowds

&" darknesse wound her in. 1 Bro. Peace, brother peace I doe not thinke my sister so to seeke \

or so unprincipl'd in vertues booke 5 5 and the sweet peace y' goodnesse bosomes ever

want as that the singleAof light & noise (not beeing in danger, as I trust she is n could stirre the steadie constant mood of her calme thoughts & put them into misbecomming plight

15

57 Wright, contrary to Birch, Newton, Warton, and Todd, correctly read steadie for their stable. 46 The marginal words are filled out by Wright as [r]ead the [pa]per over [ajgainst [i]nstead of . . . owne . . . [per]happs soe [c]old banke is

TRINITY COLLEGE MANUSCRIPT

A MASK

409

c.

\r$km*k

+z<L -ftu~

asp-

P+f4x fc'**'** £**"* fid*- .ft S"<L.

w \*^Ss-»Ir£- ^-f'V* *" kt*>L fit}?

n

'^UtgJJL

\ij**-r*

€vl

ti*- fr>**> {frofflvir] tWto-

^

t«- &A

•<t JiJi*>A**U' W**f, ***** ra/f*** X«ti «, /^ t/S*^f *v^fff '*~K •W'M *■*

"7* '!)""' r^X TVMJT^ J****-^. «»T**^l

ey i*UU <Jjkflk -fyrr* y+ fiXp.tt Vill^dl CccK

•fr+*g

*fd.d '

i 4« ^

«,pi**P4 m'fdj**"

e <x

^Y -^/itv- 5<5 "^ /«At

Aw< *«;*<■ i^$!fe£g£7.f- vet**. I*r&*

#r*&fk

<.*i

1

15

410 TRINITY COLLEGE MANUSCRIPT

Vertue could ad all her see to doe what vertue would

by her owne radiant light though sun & moone

were in the flat sea sunke : and wisdom's selfe

oft seeks to solitarie sweet retire oft seeks to sweet retired solitude 5 where w,h her best nurse Contemplation

she plum'es her feathers, & lets grow her wings

that in the various bustle of resort

were all to ruffi'd, and sometymes impair'd

owne

he that has light w^in his^cleere brest 10 may sit ith center, and enjoy bright day

but he that hides a darke soule, & foule thoughts

walks in black vapours, though the noontyde brand benighted walks under y

midday sun

blaze in the summer solstice. ^2 Bro. tis most true ^^himseUe is his owne

that musing meditation most affects dungeon

1 5 the pensive secrecie of desert cell

farre from the chejrfull haunt of mentor heards

and sits as safe as in a senate house weeds

for who would rob a Hermit of his beads gowne beads few or beads

hisAbooks, his Jiairie gowne, or maple dish 20 or doe his gray hairs any violence

but beautie like the faire Hesperian tree

laden v/'h blooming gold had need the guard

of dragon watch wth uninchaunted eye

to save her blossoms & defend her fr"ile fruite 25 from ye rash hand of bold incontinence.

you may as well spread out the unsun'd heapes

of misers treasure by an outlaws den

and tell me it is safe, as bid me thinke hope

danger will winke on opportunity 30 and let a single helplesse mayden passe

uninjur'd th in this vast, &• hideous wild wide surrounding wast.

of night, or lonlinesse it recks not me

I feare the dread events that dog them both

lest some ill greeting touch attempt the pson 35 of our unowned sister. 1 Bro: I doe not brother

inferre, as if I thought my sisters state

secure, wthout all doubt or question, no

beshrew me but I would I could be willing though now i'th darke to trie encounter

a tough ^passado w'h the shaggiest ruffian

4° that lurks by hedge or lane of this dead circuit

to have her by my side, though I were sure

she might be free from perill where she is

but where an equall poise of hope* & feare*

dos arbitrate the event my nature is

45 that I incline to hope, rather then feare

and gladly banish squint suspition suspicion 2 1

my sister is not so defencelesse left

as you imagine brother she has a hidden strength bu \vch you remember not 2 bro. what hidden strenth

50 wh unlesse the strength of heaven if you meane that g

fr 1 bro. I meane that too, but yet a hidden strenAth

p wcl>, if heaven gave it, may be term'd her owne

0 tis chastitie, my brother, chastitie

1 she that has that is clad in compleate Steele

up (keene

55 w c> may (^on any need/ull accident and like a quiverd nymph w"1 arrows

don in

or may be it not in pride or wil/ull tempting) prmsumption)

trace

0 mzy^walke through huge forrests, & unharbour'd heaths

1 infamous hills, & pe sandie perilous wilds

rays t where through the sacred aw* of chastitie "rays

no salvage feirce, bandite, or mountaneere 60 will shall dare to soile her virgin puritie

yea even where very desolation dwells •

by grots, and cavern's shag'd wth horrid shads 6" yawning dens where glaring monsters house she may passe on wth unblensh't majesde majestie bee it not don in pride or in prassumption

16

8 are changed to were

TRINITY COLLEGE MANUSCRIPT

A MASK

411

r#

«t

Trfc^^rfsft* h "hm<U *~*

*<*-•*<

<n} i

Jit

u04

3 ^7M« ^ ^ jfgr^ <*■ ■■ fegtp 1*1

s*#S fK8#£ fcas8 Jw^' ;

^JM^H^Mld' Pf— '■*****} w»-''*r C.-.J-,-.

At

V""

~f*f

I

c A*/>£

rayaeEagfc

fu.Yircu-nt)**.y to«^<

f«H

tf»-#/*Cr

?-h»~\t ~*ij-<L u*Z£ *0njh M -Ta>

4-c

"I

•J*

4

>nht.r*eu} 4'

v*< *y**

..J

16

412 TRINITY COLLEGE MANUSCRIPT

Nay more Some say

Some say Ano evill thing that walks by night in fog, or fire, by lake, or moorie fen xmeager wrincfd Blue A wrinckled hagge, or stubborne unlayd Ghost that breaks his magick chains at curfew tyme 5 no goblin, or swart faerie of the mine

hurtfull has power o'rer true virginity

doe yee beleeve me yet, or shall I call

antiquity from the old schootes of Greece

to testifie the arms of chastitie

hence had the huntresse Dian her dred bow fair£ silver.shafted Q for ever chast

wherwith she tarn d the bnnded nonesse

& spotted mountayne pard, but set at naught

the frivolous bolt of Cupid, gods & men i 5 fear"d her sterne frowne, & she was Q. o'th woods

what was that snakie-headed Gorgon sheild (unconquer'd

that wise Minerva wore, *<zternall virgin "unvanauisht

freezind wherwith she freez'd her foes to congeal'd stone

but rigid looks of chast austerity jo & noble grace that dasht brute violence an<j blank aw

w* suddaine adoration of her purenesse ^of bright rays

So deare to heaven is sainctly chastitie

is found that when it finds a souleAsincerely so

a thousand liveried angells lakey her_driving farre off each thing j^'g. lb and in cleere dreame & sollemne vision

that tell her of things no grosse eare can heare

till oft converse w,h heavnly habitants

begin* to cast a beame on th' outward shape 30 the unpolluted temple of the mind

and turnes by it by degrees to the sculs essence

till all be made immortall. but when lust

by unchast looks, loose gestures, & foule talke

lewd &* lavish

& most by the lascivious act of sin 35 lets in defilement to ye inward parts

the soule grows clotted by contagion

imbodies, and imbrutes till she loose quite

2 I

the divine propertie of her first beeing

such are those thick & gloomie shadows dampe 4° oft seene in charnel vaults, & monume sepulchers

hovering, & sitting by a new made grave

as loath to leave the bodie that it lov'd

& link't it selfe by camall sensualtie

to a degenerate, & degraded state, (phy 45 2 Bro. how charming is divine philoso Hallow within

not harsh, & crabbed as dull fooles suppose

but musicall as is Apollo's lute

and a ppetuall feast of necta^d sweets . (I heax^d

where no crude surfeit reigns. i Brother, list bro. list, me thought 5° some farre-of hallow breake the silent aire hallow farre off

2 Bro. mee thought so too, what should it be. i Bro. for certaine

either either some one like us night ' founder'd heere

or else some neighbour woodman, or at worst hedge someVoaving some curPd ^man of y swoord calling to his fellows robbeic 2 Bro. heav'n keepe my sister, yet agen, agen & neere.

?V \ i Bro. best draw, & stand upon our guard, i Bro. He hallow

if he be freindly he comes well, if not a just Defence is a u scratch he may chance ^had best looke to his forehead. heere be brambles

defence is a good cause & heav'n be for us

he hallows hallo the guardian Daemon hallows agen & enters in the habit of shepheard vou 6o that hallow, I should know, what are speake

leVoavL

iron Come not too neere, you fall outpointed stakes else

Dae. what voice is that? my yong lord? speake agen

2 Bro : oh. brother tis my fathers shepheard sure

17

6 over changed to o'er and then to ore

TRINITY COLLEGE MANUSCRIPT

A MASK

413

v* 40*~~<iiY&rK 6m /ajjT.or *«*<rm ft* , 1.11}

T

tt*k'dl»k/ -fre

A<»"K had Mf h*lU-n.

cka.fi k't

2*

d. bov

lUfr^AaJrrJp. T°\ <Aj*j* cK*JL

* t*»n« jA.rrt e$ £«a /v**V ff^*>»- |8T

6

^ *<Wl

>&«& M&

ft**- JY\>1+Jt Hit-*. «^--.l"_ t I- /•' L /. * -' )

5 J'*^f *♦.

h3e<*

i-L/iw

IP

«J^

Jet a^xJ5, ^/ tf*** ♦

1

^*

'raw

CaM.\

wn »i^-.

_/-

'■C-ffi

\<*-+fdfit*M. P4nurv\

LuLi

iu- a^> ^ ?a*u ArT^o^?«.ic "^

4*\

17

414 TRINITY COLLEGE MANUSCRIPT

i Broth. Thyrsis? whose artfull streines have oft delay'd

the huddling brooke to heare his madrigall

and sweetned every muskrose of the valley dale

how cam'st thou heere good shepheard, hath any ramme

from his fold or 5 slip't leapt ore A the penne young ki kid lost his damme

or straggling weather hath the pen't flock flock forsook ?

how couldst thou find this darke sequeste'rd nooke

Dae. O my lov'd maisters heire, & his next joy

I came not heere on such a triviall toy 1 o as a stray'd ewe, or to psue the stealth

of pilfering wolfe, not all the fleecie wealth

that doth enrich these downs is worth a thought

to this my errand, & the care it brought

but oh my virgin Ladie where is she 1 5 how chance she is not in yor companie

i Bro. to tell thee sadly shepheard; wthout blame

or our neglect wee lost her as wee came

Sheph. ay me unhappie ! then my fears are true

i bro. what feares, good "shep. preethee breifly shew "Thyrsis 20 Das. Shep. He tell you. Tis not vaine or fabulous

(though so esteem'd by shallow ignorance)

what the sage poets, taught by th' heav'nly Muse

storied of old in high immortall verse

of dire chimaera's and inchaunted Isles 25 & rifted rocks whose entrance leads to helL_for such there ^ ^ mhe\eile is blind

w^in the navill of this hideous wood

immur'd in cipresse shades a sorcerer dwells nt of Bacchus & of Circe borne, great Comus 3° deepe lear enur'd in all his mothers witcheries

skill'd and heere to every thirstie wanderer

by sly enticement gives his banefull cup

w4 many murmurs mixt, whose pleasing poison

the visage quite transforms of him y' drinks 35 and xthe inglorious likenesse of a beast "makes

fixes insteed, unmoulding reasons mintage

characterd in the face this have I learnt

hillie crofts tending my flocks hard by i'th ^pastur'd^ lawns

that brow* this bottome glade whence night by night 40 he & his monstrous rout are heard to howle

like stabl'd wolvs, or tigers at thire prey

doing abhorred rites to Hecate

in thire obscured haunts of inmost bowers

yet have they they many baits, & gil guilefull spells 45 to' inveigle & invite th' unwarie spell sense

of them y' passe unweeting by the way.

this evening late by then the chewing flocks

had tane thire supper on the savourie herbe

of knot grasse dew besprent, and were in fold 50 I sate me downe to watch, upon a banke

with ivie canopied, & interwove

blowing blowing

vr<h A suckling* honiesuckle, & began "flaunting "flaunting

2 to meditate my rural] minstrelsie 1 wrapt in a pleasing fit of melancholy 55 till fancie had her fill, but ere^the close '

the wonted roare was up amidst the woods

and fill'd the aire wlh barbarous dissonance

at W* I ceased, & listen" them awhile

till an unusuall stop of suddaine silence' 60 gave respit to the drousie flighted steeds

that draw the litter of close-curtain'd sleepe "still soft"

At last a softjz sollemne breathing sound "sweet "soft

a "slow

rose hke^the so/te steame of Adistill'd pfumes "slow rich

and stole upon the aire, that even silence

65 was tooke ere she was ware, & wish't she might

deny her nature & be never more

still to be^Pdisplac't, I was all eare

18

5 his changed to the then restored. 52 Wright was uncertain of the word struck out before honiesuckle and thought it might be suckling but certainly not 'spreading' as read by 'Birch and the rest.'

TRINITY COLLEGE MANUSCRIPT

A MASK

415

''ifmj.

ro»& (*> A*<*« A*} T^^^^ll

2tia^

y*x-mm€

/*• *A~—jS%a k> tojfcu- ■ A-^M« [<*U~ ?UcA j',m^A. -fv+SvoJ^ v

*&J»f

7 y^-gi

r-oto Cc •» iw^ cK r*t ti'r<it'n JW« **&**! V >^»

7

wmtn

'/**.4t'{<{ ■U« /«ff- AlV ctj v«t

Sffyu <,{ ftp* tf^^Jr^*^'

id*1.

p *

£ WfH<i ■»**£A.5 tvkoji {■nhrt**j:1 \<«~d-} <*«

Utr

«*A ^i«vi. &<^/«i- u.n6't^'4 ^ i»

•<

W

■

if 4

^

fr^^ fr thf «^y Hj, f tH r"'-^4^ jf*^ /^ *w«j Ue /y Mil

A*»'tf£

M

hVhi

»

*fu?&i r0*r%j*

««&+•

^v^.fW»vHtC«j

18

416 TRINITY COLLEGE MANUSCRIPT

and tooke in streins that might create a soule under the ribbs of Death . but oh ere long too well I might pceave it was ye voice of my most honour'd Ladie yor deare sister 5 amaz'd I stood, harrow'd wth greife & ;eare

and O poore haplesse nightingale thought I how sweet thou sing'st, how neere the deadly snare then downe the lawnes I ran w,h headlong hast through paths & turnings often trod by day i o till guided by myne eare I found the place

where that damn'd wisard hid in sly disguise (for so by certaine signes I knew) had met alreadie ere my best speed could praevent

aidlesse the Jielplesse innocent Ladie his wisht prey who tooke him

1 5 who gen who gently askt if he had seene such tow

supposing him some neighbour villager

longer I durst not stay, but soone I gues't

yee were the tow she meant, cV wth that I sprung

into swift flight till I had found you heere -o and this but furder know I not. 2 Bro. O night & shades

how are yee joyn'd wth hell in triple knot

against th' unarmed weakenesse of one virgin

alone, & helplesse, is this the confidence

you gave me brother? 1 Bro. yes: and keepe it still -'5 leane on it safely not a piod

shall be unsaid for me, against the threats

of malice, or of sorcerie, or that power

wch erring men call chance this I hold firme

vertue may be assayl'd but never hurt .1" surpris'd by unjust force, but not enthrall'd and

Yea even that wch mischeife ment most harme

shall in the happie triall prove most glory ,, but evill on it selfe shall back recoyle

till all to place & mixe no more w"1 goodnesse, when at last 35 gather'd like scum & setled to it selfe

it shall be in aeternall restlesse change

selfe fed, & selfe consum'd if this faile

the pillar'd firmament is rottennesse

and earths base built on stubble . but come lets on 4° against th' opposing will & arme of heav'n

may never this just swoord be lifted up.

but for y> damn'd magician, let him be girt

wth all the greisly legions that troope

under the sootie flag of Acheron 45 harpyes & Hydra's or ^ the monstrous buggs

twixt Africa & Inde. He find him out

and force him to release his new got prey restore his purchase back

or drag him by the curls & cleave his scalpe

downe to the hipps lowest hips. Dae. alas good ventrous youth 5° I love thy courage yet & bold emprise

swoord "swoord but heere thy swo ^Steele can doe thee little stead small availe

farre other arms & other weapons must

be those that quell the might of hellish charms

he wth hts bare wand can unquilt thy joynts "unthred all thy .5 5 & crumble every A sinews. 1 Bro. why preethee shep.

how durst thou then thy selfe approach so neere

as to make this relation. Dae. Care, & utmost shifts

how to secure the ladie from surprisal

brought to my mynd a certaine shepheard lad fio of small regard to see to yet well skill'd

in every vertuous plant, & healing herbe

that spreds her verdant leafe to th' morning ray

he lov'd me well, & oft would beg me sing

wch when I did he on the tender grasse

19

TRINITY COLLEGE MANUSCRIPT

A MASK

417

'<*«

&~A

*f my f^/l °&3uJtLLj;s y* $w

£W«rf fj»-3, >L~~~V w»* w/?r /? /**^

I Pr*j Vty. *.>$ fe*J><L.t4~<>Stlt

*W-

/-»•>» t

'tut

4i& .

mA-jLfl

•%

+^ai^^ ^.WjWlft ^ ^^t „i Aw,U

«rn

>

w-

^tktwd.

4

jj^oivJ ra-^ '""'^rt Hi IL'l-( oy**^ **•*■***

n

£<>*> &e a^twi f-ki («^-c /k^

ivfiin %■ atvV^

A«. ff^L

19

418 TRINITY COLLEGE MANUSCRIPT

This small sheet appears as page 20 in the manuscript and contains material to replace that struck out on page 21 of A Mask.

^ why should you be so cruell to yor

selfe, and to those daintie lims w"* nature lent for gentle usage, and soft delicacie, but you invert the cov'nants of her trust, and harshly deale like an ill borrower w* that W* you receav'd on other terms scorning

and first behold this cordiall julep heere y1 flams & dances in his crystall bounds w* spirits of baulme, & fragrant syrops mixt vrprevBU not that Nepenthes wch the wife of Thone S in ^Egypt gave to Jove bome Helena

is of such power to stirre up joy as this

to life so freindly or so coole to thirst

poore ladie thou hast need of some refreshing^/ the unexempt condition by W* all

. 5 that Jas) bin tir'd all day w*out repast mortal1 fraiItie must subsist

n [jut refreshment after toile, ease

& timely rest jiast wanted, heere faire virgin after paine, that have bin

this will restore all soone. La. t'will not false traitor tir'd &c.

t'will not restore the truth & honestie

that thou hast banisht from thy toungue w11" lies 20 was this the cottage & the safe abode

thou toldst me of? what grim aspects are these

these ougly headed monsters ? mercie guard me !

Hence w* thy hel brewd opiate foule brud brewd enchauntments foule deceaver

hast thou betrayd my credulous innocence 25 w* visor'd falshood & base forgeries

and wouldst thou seeke againe to trap me heere

w* lickerish baites fit to ensnare a brute ?

were it a draft for Juno when she banquets

I would not taste thy treasonous offer, none ■ .10 but such as are good men can give good things

and that wch is not good is not delicious to a well govern'd, & wise appetite

Co. O foolishnesse of men &c.

This piece of paper, about half the size of the regular sheets, is pasted before page 21, and is the pasted leafe referred to on that page. These lines 5-14 of Sonnet XXI and all of Sonnet XXII are alone on page 46 of the manuscript.

49

©

To day deep thoughts resolve with me to drench

In mirth, that after no repenting draws,

Let Euclid rest and Archimedes pause,

And what the Swede intends and what the French. To measure life learn thou betimes, and know 1 o Toward solid good what leads the nearest way ;

For other things mild Heaven a time ordains, And disapproves that care, though wise in show,

That •with superfluous burden loads the day,

"> And when God* sends a cheerfull houre, refrains.

x

22

Cyriack, this three years day these eys, though clear

To outward view, of blemish or of spot ;

Bereft of light thrir seeing have forgot,

Nor to thir idle orbs doth sight appear

5 Of Sun or Moon or Starre throughout the year,

Or man or woman. Yet I argue not

heavns Against *Gods hand or will, nor bate a jot "heavns

bear vp and Xv «

Of heart or hope ; but still ^attend to steer Dear vp s

Right onward „ Jgjft* TT&u . „

0 * Vphillward. What supports me dost thou ask?

1 0 The conscience, Friend, to have lost them overply'd

In libertyes defence, my noble task,

• . Of which all Europe talks from side to side.

This thought might lead, me through the worlds vain mask

Content though blind, had I no better guide.

x

46

All that remains in the MS. of a draft of Sonnet XXI are the lines 5-14 on this short sheet. This sheet is the next to the last page in the MS. or page 46, and is printed here, out of order, to save space.

TRINITY COLLEGE MANUSCRIPT

A MASK

SONNETS XXI XXII

419

This small sheet appears as page 20 in the manuscript and contains material to replace that struck out on page 21 of A Mask.

^fpiMf «£&**'£—■€ £j**p***t yyn>ft »wv«y*i4r w1> «« J- tt* «Kuf»kf / Mir

)YiC4o.\,d ok <s>rA«» L&r**f <£<*>!-

'«*•*-

y^u**1 ******* ***- h-*** f b**fa u 1

l+ai fU*, A^V. taMifk^^yam ^kv h>MT^ " "%

tiff* Jo-'itV £+*Utri**J i*>4i<w*4- refills £>«£lD«£t»1>«V

"^Tt "U-- <X-!)r<Z-fL fay! J~.*C ^LtYKyUi fa*fit€ff

These lines 5-14 of Sonnet XXI and all of Sonnet XXII are alone on page 46 of the manuscript.

©

t

;

I

I

-

if

s 1

]

^

tarrprh,

$71 mrrM tffaramr p0yrjbf»tr»o SraMJ, At £.uffr) rrvf ape drrfitpriou taau^ \tn<tk>p'<Lt1ni>$Mzit' wtrpcb aldupjit mtf/iw'h (Toftitojur&LrJe, team tnoiLvtiipied^nd nntrft rf$rtiirv /0/ioJaooo wpaf-ftadj tpe, rtrarrttway; rfTor otirrtirfnad Wtio fftaprp a trprt. ordaipj, jffiJ duapPHwrJ in at amfpouaPto/^ i» meto, ^fnat HJtv juMrJiuo-uj fardrT/foais tA Jajr, otn c/h'/r n fodj tep 0J a efimfufAtitr^ r?/ra//u ,

0.0,

Ol ***jfig*»*'*-jfttSifiiie, not

■m

ti

46

420

TRINITY COLLEGE MANUSCRIPT

IS It

med'cinall then

that

would sit and hearken even to extasie

a & in requitall ope his letherne scrip

& shew me simples of a thousand hejvs names

telling thire strange & vigorous faculties

amongst the rest a small unsightly root

but of divine effect he culld me out

the leafe was darkish & had prickles on it

but in an other countrie as he said

bore a bright golden flowre, but not in this soile

unknowne & like esteem'd & the dull swayne

treads on it dayly wth his clouted shoone^.& yet

wctl he call'd l\ Haemonyx & gave it me ent Moly, that Mercury to wise Ulysses

& bad me keepe it as of soveraine use gave (Hermes once )

gainst all enchauntments, mildew blast, or dampe

or gastly Furies apparition

I purs't it up, but little reckoning made

till now that this extremity compell'd

but now I find it true, for by this meanes

I knew the fowle enchanter though disguis'd

enter'd the very lime twigs of his spells

and yet came off, if you have this about you

"when on the way (as I will give you as wee goe) you may

"when we goe.

cers necroman/«'/4 hall

25

30

35

45

boldly assault hisy

where if he be w* suddainc violence dauntless hardyhood

& brandish't bladex rush on him, breake his glasse

shed and ^powre the lushious potion liquor on the ground

but and sease his wand . though he & his curs't crew

feirce signe of battaile make & menace high

or like the sons of Vulcan vomit smoake

yet they will soone retire if he but shrinke

' ' (before us 1 Bro. Thyrsis lead on apace I follow thee and some g00(j angell beare a sheild

6f good heaven cast his best regard upon us Ex

the scene cha changes to a stately pallace set out w* all manner tables spred wth all dainties . of deliciousnesse. A Comus is discovered w* his rabble . & the Ladie set in

an inchanted chaire. She offers to rise

Co. nay Ladie sit, if I but wave this wand u . foole thou art ^er proud doe not boast

yor nerves are all chain'd up in alablaster /thou canst not touch the freedome of my mind

or / wth all thy charmes although this corporall rind

and you a statue, fixt, as Daphne was / thou hast immanacl'd while heavn sees good

root-bound, that fled Apollo. ' why doe ye frowne Co- why are y°u vext La^e> why doe y° frow

heere fro heere dwell no frowns "or anger, from these gates

sorrow flies farre. see heere be all the pleasures

invent that youth cV fancie fancie can beget on youthfull thoughts

40

Co.

xfresh 1

when the briske blood retttrt grows lively & retumes

brisk as the Aprills budds in primrose season Oh foolishnesse of men !

"fresh

50

55

vthat w** follows heere is in the pasted leafe begins poore Ladie and first behold this &c.

do

65

70

that lerd thire eares

to those budge Doctors of the stoick gowne furre

and fetch thire precepts from the Cynick tub

praising the leane, & sallow abstinence

wherfore did nature powre her bounties forth

w* such a full, & unwithdrawing hand

covering the earth w,h odours, cV w'h fruits, & flocks

thronging cramming the seas w'1" spawne innumerable

the feilds w<h cattell cV the aire w'h fowle ^^-but all to please & sate the curious taste

and set to worke millions of spinning worms

that in thire greene shops weave the smooth haird silke

to adorne deck

^to^deck her sons, and that no corner might

be vacant of her plentie in her owne loynes

she hutch't the' all-worship't ore & precious gemms v

to store her children w*, if all the world

should in a pet of temperance feed on pulse fetches pulse

drinke the cleere streame, & nothing weare but freise

th' all giver would be' unthank't would be unprais'd

not halfe his riches knowne, & yet dispis'd

and wee should serve him as a grudging maister

& UmM^» natures bastards not her sons M a Penurious ni«!ard of his wealth

21

45 beget on changed to invent in then restored. 70 living changed to & live.

TRINITY COLLEGE MANUSCRIPT

A MASK

421

~wrr

f^ C^t%Ywi.fc.rfp

tit *rfc^a2«w & **>/*&* rj+

*«?\

\

/

^iJl^j firsts' *tesi3i*J

■/An ^'ofe

"IHj-i

'tgfr-ty

y**Aj

■U>A £* tut <f <<*%

La.

y r^P* |"A"'.'

*fc, raJili. ,

&<~ J*Jt'€^Jfl~--6i

1* J "

bhoet W<«i i d nr£j

kn»r%

m

$aJirl //if ii*viV^A»JM

xa u?etrr>-$ , jynechi/itu

r-i *"/^

>* — • 4i -A- .'...i*

y

21

julep bounds	\
mixt	\ *

422 TRINITY COLLEGE MANUSCRIPT

who would be quite surcharg'd wth her owne waight (dark't wth plumes

and strangl'd wth her wast fertilitie___ th' earth cumber'd & the wing'd aire

theheards would over multitude thire Lords

sea swell

5 the sea orefraught the ore orefraught would heave her waters up

above the shoare and th' unsought diamonds

would so be studde the center w'h thire starrelight would deepe

were they not taken /hence that they below \and*so emblaze the forhead of ye

light and so bestudde wth starres y1 they below

would grow enur'd to air & come at last to gaze upon the sun w'h shamelesse browes nor and i o list Ladie be not coy, nor be not cozen'd

with that same vaunted name virginity beautie is natures coine must not be hoorded

a but must be current, & the good therof

consists in mutuall & partaken blisse i 5 unsavoury in th' enjoyment of it selfe

if you let slip tyme like (an) neglected rose

it withers on the stalke & fades away wth languish't head

beautie is natures brag & must be shewne

in courts, at feasts, on high sollemnities 20 where most may wonder at the workmanship.

it is for homely features to keepe home from

they had thire nameAthence, coarse beetle bro brows complexions

and cheeks of sorrie graine will serve to ply

the sample, or to> teize the huswifes wooll 25 what need a vermeil tinctur'd lip for that , hence wth thy hel bni d liquor lest L

love-darting eyes, or tresses like the morne \ throw it against y ground were it a draft &c

there was a nother meaning in these guifts \

& be advis'd, you are but young yet

thinke what, ^6f looke upon this cordiall

that flames & dances in his ch crystall

w"1 spirits . of balme 6° fragrant syrops

not that nepenthes wck the wife of Thon [5 J in sEgypt gave to Jove borne Helena

is of such power to stirre up joy as this

to life freindly so, or so coole to thirst 3 1

poore Ladie tlwu hast need of some refreshing that hast bin tir'd all day w'hout repast [10] &"' timely rest hast wanted heere sweet Ladie faire virgin

this will restore all soone La stand back false traitor thou can'st not touch the freedome of my mynd w"1 all thy charmes although this corporall rind thou hast immanacl'd, while heaven sees good [■Si was this the cottage, &• the safe abode

what grim aspects are these t {mercie guard me me of} ougly these ougly headed monsters

thou toldst amoung'st these h musld monsters mercie guard me

how have L bin betrai'd

0 my simplicity what sights are these] w* darht disguises bruage whether deluded &• soothing flatteries

[20] and soothing lies A cV soothing flatteries, hence a>rt thy teacherous kindnesse

falshood \ bru'd sorcerie^ -

thou man of lies 6f falshood fraud, if thou give me it

1 throw II on the ground, were it a draft for Juno should reject

I hate it from thy hands treasonous offer, none

but such as are good men can give good things La. I had not thought to have unlockt my lips, 3° in this unhallowd aire, but that this juggler

would thinke to charme my judgement as mye eyes

obtruding false rules pranck't in reasons garbe

I hate when vice can boalt her arguments

and vertue has ' no tongue to check her pride not 35 impostor, doe^charge most innocent nature

would as if she ment her children should be riotous with her abundance, The good cateresse intends means her provision only to the good that live according to her sober laws 40 and holie dictate of spare temperance

if every just man that now pines wth want had but a moderate & beseeming share

22

This is the most altered page in the poem. The italic material in the lower half is the material to be replaced by a portion of the re- written fair copy on the pasted leafe. 8 air should read day [10] of struck out lines, fairest was changed to faire then entire line struck out. [17] of struck out lines. Wright states that this line is very 'obscure' which is putting the case mildly; he also suggests that h before musl'd indicated that Milton began to write headed but changed his mind.

TRINITY COLLEGE MANUSCRIPT

A MASK

423

r*&

I

A

, - .-yy-

'^1

f*J&&*

^ Tl iJ*rVfr**cti ***h* l**b m fim*t *******

i

Ll

22

424 TRINITY COLLEGE MANUSCRIPT

of that \vch lewdly-pamperd luxurie <s$

now heapes upon some few w,h vast excesse

natures full blessings would be well dispens't

in unsupfluous eeven proportion

5 and she no whit encumberd wlh her store

and th^n the giver would be better thankt

his praise due 'paid, for swinish gluttonie

ne're looks to heav'n amidst his gorgeous feast

but wth besotted base ingratitude no more

10 cramms & blasphems his feeder. Co. Come y'are too morall

your morall stuffe tilted

this is meere morall stuffe the very lee: this meere moral bable, & direct

. ... , , , , ., , A against the canon laws of our foundation

&• sellings of a melancholy blood f^ ^ suffer ^ ye( ^ but ^ ,ees

15 but this will cure all streite, one sip of this and setlings of a melancholy blood

will bath tjie drooping, spirits in delight

ye blisse beyond^ of dreames. be wise & tast.

the brothers rush in strike his glasse downe the monsters shapes make as though they would resist but are all driven in. Daemon enter wth them

Dae. what have you let the false enchaunter spasse scape ?

oh yee mistooke, yee should have snatch't his wand

rod 20 & bound him fast; w^out his ^art revers't

and backward mutters of dissevering power

wee cannot free the La. that remaines heere sits

in stonie fetters fixt & motionlesse.

yet stay, be not disturb'd, now I bethinke me some other meanes I have 25 there is another way that may be us.'d

wch once of Melibaeus old I learnt

the soothest shepheard that e're pip't on plaines

there is a gentle nymph not farre from hence

that wlh moist curbe swaies the smooth Severne streame 30 Sabrina is her name a virgin goddesse chast pure

whilome she was the daughter of Locrine

that had the scepter from his father Brute

she guiltlesse damsell flying the mad psuite

of her enraged stepdame Guendolen 35 commended her faire innocence to the floud * streame floud

that stayd her flight wlh his crosse flowing course

the waternymphs that in the bottome playd

pearled & carie take took

held up thire white wrists to receave^ her in straite bearing and bore her A to aged Nereus hall 40 who piteous of her woes, rear'd her lanck head

and gave her to his daughters to imbath

in nectar'd lavers strew'd wth Asphodil

and through the porch & inlet of each sence

dropt in ambrosiall oyles till she reviv'd 45 and underwent a quick immortall change

made goddesse of the river, still she retaines

her ma'den gentlenesse, and oft at eve

visits the heards along the twilight meadows

helping all urchin blasts, & ill luck signes

5° that the shrewd medling Elfe delights to leave make*

w"> and often takes our cattell w'k strange pinches

which she wlh precious viold liquors heales for wch the shepheards at thire festivals carroll her goodnesse loud in lovely layes "rustick 55 and throw sweet garland wreaths into her streame

pinks & x of pancies A &• of bonnie daffodils "gaudie

and as the old swaine sed, she can unlock

thaw the ihe.each clasping charme & secret holding spellbind! each nurning spell if she be right invok't in warbled song 60 for maidenhood she loves & will be swift

aide to A a virgin such as was her selfe

"m honourd verities cause, this will I trie "in hard distressed need

power and adde the power call of some strong verse adjuring

23

9 a sottish changed to besotted 54 The reading is lovely according to Wright and not lively according to Birch and others.

TRINITY COLLEGE MANUSCRIPT

A MASK

425

r

f*yUn £

*><t fa* ^ *w «>«■•&> <r 4c//«* /^o*4/

?*\

0r ^oin'L >ltr\. faff**

>#w-iw A 1

>A*nf

#*-

"1 1

«rv

-K>^&»»ijt f«t t*»«M A4* >«*vfv-f»-' <?t" i^fi-wi

elrtfti* lHYcai4 ^^M( 6u^il^ot^M " *&_ ^ , f f

kudu* Mdjg&i h^-a ^m^rf

f-l/"»"\.f it— 1-

•«<*£

>W-l*Iljl« £

"I

rah 01 ^ficli^

*

Hii

*2*-i rfc °U s«™»i set t&ca,* ukLJ ^ , .,

v 1 J i r*- t~ ™ ^ 'w ^4 farts*

23

426 TRINITY COLLEGE MANUSCRIPT

Song

Sabrina faire

Listen virgin where thou sil'st art sitting under the glassie coole translucent wave in twisted braids of lillies knitting 5 the loose faine traine of thy amber-dropping haire

listen for deare honours sake Goddesse of the silver lake Listen and save

Listen and appeare to us to be said

i o in name of great Oceanus by th' earth shaking neptunes mace

by Leucothea's lovely hands and Tethys grave majestick pace

& her son that rules the strands b>\ ho"ie Nereus wrincUd wrincled looke

_, . . ... ... and the Carpathian wizards hooke

by Thetis tinsel-shpperd feet by scaly Tritons winding she„ ,.

20 and the songs of Sirens sweet and old sooth -saying Glaucus spell

by dead Parthenope!^ deare tomb by Leucotheas &c

and faire Ligdas golden combe

wherew111 she sits /On\ diamond rocks

sleeking her son/ alliujng locks ~by all the nymphs that nightly dance 25

rise rise & heave thy rosie head "P°n thy streams w* wilie glance

from thy corall-paven bed

and bridle in thy headlong wave 30 till thou our summons answerd have

Listen & save

Sabrina rises attended wth the water nymphs

Sings

By the' rushie-fringed banck

where grows the willow, & the osier danck

my sliding chariot stayes

35 thick set wth Agat, and the azurne sheene

of turquis turkis blew, & emrald emrauld greene

that my rich wheeles inlaycs that in the channell straies

Whilst from off the waters fleet

thus I set my printlesse feet

40 ore the couslips velvet head

not that bends A as I tread

Gentle swaine at thy behe request

I am heere Dae. Goddesse deere 45 wee implore thy powerfull hand .

to undoe the mag charmed band

of true virgin heere distres't

through the force, & through the wile

of unblest enchanter vile. 50 Sa. Shepheard tis my office best

to helpe ensnared chastitie

veriuous Brightest ladie looke on me

thus I sprinckle on thy brest

drops that from my fountaine pure 55 I have kept of precious cure

thrice upon thy fingers tip

thrice upon thy rubied lip

next this marble venom'd seate

smearM wth gumms of glutenous heate 60 I touch wth chast palmes moist & cold Sabrina descends

now the spell hath lost his hold ■ — the ladie rises out

and I must hast ere morning howre of her seate

To waite in Amphitrites in her bowre Dae. Virgin daughter of Locrine 65 sprung of old Anchises line

24

28 corall-paved changed to corall-paven 63 on Amphitrite changed to in Amphitrites

TRINITY COLLEGE MANUSCRIPT

A MASK

427

-}<*-■

tllfir^ntf tuttPl

J/W rhvn/Af « *•''»

.* two/fv ■*ty?vn»/w"

£3« //.< V*/* f<rfi»'Mid

/ /

04-

t^V^1 hNKl a4'^

id

u*Un%f moid- f cetc -u, +m i^tt *^* //^^ /^ ^/^

24

428 TRINITY COLLEGE MANUSCRIPT

brimmed may thy crystal/ waves for this 2 7

thire full tribute never misse from a thousand petty rills

the that tumble downe from snowie hills 5 summer drouth, or singed aire

never scorch thy tresses faire nor wet Octobers torrent flood thy molten crystall fill vvth mud may thy billowes roule a shore io the beryll & ye golden ore

may thy loftyjiead be crownd wth many a tbwre, & terrace round and heere & there thy bancks upon wth groves of mirrhe, & cinnamon. Song ends

15 Come Ladie while heav'n lends us grace

let us fly this cursed place

lest the sorcerer us intice

w* some other new device

not a wast or needlesse sound 20 till wee come to holyer ground

I shall fce yor faithfull guide

through this gloomie covert wide

and not many furlongs thence

is yor fathers residence met 25 where this night are Acime in state

many a freind to gratulate his wish't presence, & beside all ' the swayns that neere abide w* Jiggs & rurall dance resort 30 wee shall catch them at thire sport

and our suddaine comming there will double all thire mirth & cheere come let us hast the starres xare high xgrow But night raignes sitts monarch yet in the mid skie Exeunt.

the scene changes and then is presented Ludlow towne & the presidents castle then enter countrie dances & such like gambols &c.

at After those sports the Daemon wth ye 2 bro. & the Ladie enter

the Daemon sings

Back shepheards back enough yor play '

35 till next sunshine Holyday

heere be wth out duck or nod other trippings to be trod such neate

of lighter toes, & such court guise

nimbler such neate

of lighter of speedier toeing, & courtly guise

* first such as Hermes did A devise Mercury "first 40 w* the mincing Dryades

on the lawns, & on the leas

Noble Lord & Ladie bright 2 song.

I have brought yee new delight heere behold so goodly growne 45 three faire branches of yor owne

Heav'n hath timely try'd thire youth patience

thire faith, thire "patience, & thire truth "temperance and sent them heere through hard assayes w,h to a crowne of Deathlesse bays praise

25

38 toeing changed to toes

TRINITY COLLEGE MANUSCRIPT

A MASK

429

r

,i

fUn y«il h*&»4<t ^'Hr%^. n+*ft^

far* c-h^e^i^A tt^ry^'Uf . <*y

-y ^

►•»

f««

4

/

*•«•■* «*i5txtt<:

-*»* ?LJ* *?**,&"* ***** ~^«

%/i^r

M* fadZjp?*1* "** ***> *«*.« ?<■** tsU

•+njfertf t£y

Mt Oas*** *-„

^

£><$*<+* wMy^s

f

'<&«</

9 Q.t( <)lipLl«rd*, i -.

6r*.£ w< /*<£*£ $*/$*,

■ '(-iv l*i) , £ fut-M i*m*V avi/^

*

f.Yjf

5('

J^ J-nj

4kJ

W-

25

430

TRINITY COLLEGE MANUSCRIPT

to triumph in victorious dance ore sensuall folly, & intemperance

they dance, the dances all endec

the Daemon sings, or sayes

To the Ocean now I fly

and those happie climes that lie

where day never shuts his eye

up in the * plains feilds of the skie x broad

farre Beyond yt earths end

Y Y low

where tfoe welltrr/ \cleere doth bend ther I sudk the liquid aire i o all amidst the gardens faire

Hesperus neeces of Atlas & his daughters three

that sing abWt the golden tree

there seternall summer dwells

and west winds w111 musky win] 1 5 about the mjMle* alleys fling / "cedar'ne

nard \ balmy

balme balme, and casia's fragrant stnells

X \ A /

Iris there w* gamish't bow / "garish humid

waters the odorous banks y'A>low

flowers of more mingled he purfl'd 20 then her watchet \c3xieJ can shew

yellow, watchet, greerie, & blew

and drenches oft w"l manna dew

beds of Hyacinth, & rqlfces

where many a cheruo soft reposes taske / smoothly •25 now my "message well is \ion "buisnesse

I can fly, or I can run\ earths

quickly to the ecjrths gree^e „ end

where the bow^fl welkin slW doth bend

and from thence can soare\as soone 30 to the corners of ye moone

mortalls tha/ would follow

love vertue/she alone is free

she can teach yee how to clime

higher then the sphaerie chime 35 or if vertue feeble were stoope

heav'n /it selfe would bow to heV. Exit

the end.

Finis.

26

TRINITY COLLEGE MANUSCRIPT

A MASK

431

fr—vfa-v

, ,o t-vV^-,^ ,„; *,,-<>« Hr»i <*»>»«

ttwii

•o

^M

TV**** M<

**f* *J iff.

tyfl

crc«^, ^<il,

"^»V^-- *->!

-"fc-Ulf , f

Hi**

.;

*fta »ih^^ /ii» »►•'•*

*<? *l<//.<*j.

*t

\fW^,

rr*i

A/ ^Lm

.-=> ^

- ' 1 •' 1 7 /

«*<»«*-*

Cr>j

▼■*

rt/

£*>■<*

X

**i

wU^X; /&•

/vt^i

t'*U

M< £h4 . ^J"t)W|W

\

26

432 TRINITY COLLEGE MANUSCRIPT

29

The Daemon sings or says

To the Ocean now I fly

and those happie climes that lie

where day never shuts his eye

up in the broad feilds of yc skie : 5 there I suck the liquid aire

all amidst the gardens faire

of Hespus & his daughters three

that sing about the golden tree

where grows the right-borne gold A upon his native tree

along the crisped shades and bowrs 1 o revells the spruce and jocond Spring

the Graces and the rosie-bosom'd Howrs

thither all thire bounties bring

that there eternall Summer dwells

& west winds wth muskie wing 1 5 about the cedar^e alleys fling

Nard & Cassia's baulmie smells

Iris there wth humid bow

waters the odorous banks that blow

flowers of more mingled hew jo then her purfl'd scarfe can shew

yellow, watchet, greene, cV blew

& drenches w"1 Sabzan dew "Elysian

beds of hyacinth & roses , (hst momls if F0' eares be true>

where young Adonis oft reposes

waxing well of his deepe wound 2 5 in slumber soft, & on the ground

sadly sits th' Assyrian Queene

but farre above in spangled sheene

celestiall Cupid her fam'd son advanc't

holds his deare Psyche sweet entranc't 3n after her wandring labours long

till free consent the gods among

make her his eternall bride

and from her faire unspotted side

tow blissfull twins are to be borne 35 Youth & Joy : so Jove hath sworne

But now my taske is smoothly don

I can fly, or I can run

quickly to the greene earths end

where the bow'd welkin slow doth bend 4° & from thence can soare as soone

to the comers of the Moone.

mortalls that would follow me

love vertue she alone is free

she can teach yee how to clime 45 higher then the sphearie chime

or if vertue feeble were

heaven it selfe would stoope to her.

The end.

27

TRINITY COLLEGE MANUSCRIPT

A MASK

433

V-

/

~~fnt U&nen Si* ft 2> J&f

l/CZan

Ufi •», fh.<L.<jri»*A j-Zitij'dJ-

yu i :

V *^TY*t~

;f/.'4H /

i!4±-J&j.-JUi**4litr-tr* «i

y%i

ds*

PiirA * tuffi'*./ la^itoil Julias V"*H^5 /*< </<l*rou~$ 1?<z<hA) hL*f- bleu

vAvrl y«**<? j[da\uj ojf*~ rtf0^

>A jUktvr Jo fa p on kit fre"«d jadty jCfx Ht'f y nan l_:/ *«£** c

/• ■ l' f j ?

t-itfc#7<iM. ^Kfta At,y jam W J*H- ■■ftbattct-

hdi<> Kid di*ri p.-jtht J^i**- i*-*ra*icf

W a ' rt*r- fry VH^rnatA. . fin/Li ' ■

fou/ bt^ipdi fuiiy^ «41 h* &£ OotTtf

y»«^ ^ •/&</: So -h/iii- j\*tJt iU/er/i^

■i \<*M. 44aj efir t OzA\ yv.rt

%tA-^-i fA'i l>eu>dk t«^^|M >/<>fc, o&dt Pi**d f P'l'^ t£*»t.C <utn j *«*t. «^ {eon*.

ntcrJtULf hk^ WcHJL p>^~ ™*

loyi tvA^f fit} <*t**Li ^ Ai( •>;■*. cox h*JLyi*. A*w /e c^***-

•?>-«•*- V»rA^ jW*^| tv,|-i

27

434 TRINITY COLLEGE MANUSCRIPT

yet once more O ye laurells and once more

ye myrtl's browne wlh Ivie never sere

I come to pluck yor berries harsh and crude

before the mellowing yeare and w* forc't ringers rude

and crop ycr young shatter yor leaves before y* mellowing yeare

bitter constraint, and sad occasion deare

compells me to disturbe yor season due

for young Lycidas is dead, dead ere his prime.

young Lycidas and hath not left his peere

not who would A sing for Lycidas he well knew

himselfe to sing & build the loftie rime

he must not flote upon his watrie beare

unwept, and welter to the parching wind

without the meed of some melodious teare

i S Bring the rathe primrose /&at unwedded dies

collu colouring the \ pale tiheeke of uninjoyd love and that sad floura that strove to write his owne woW on the vermeil graine next adde Narcissus /y\ still weeps in vaine

20 the woodbine and A* pancie freak't w"1 jet

the glowing viojet

the cowslip war/ that hangs his pensive head and every bup; that sorrows liverie weares

let Daffodillies fill thire cup\ w™ teares 2 5 bid Amarapthus all his beautik shed

to strew the laureat herse &c

Bring the rathe primrose that forsaken dies the tufted crowtoe and pale Gessamin

the white pinke, and \ pansie freakt w* jet 3° the glowing violet the well-attir'd woodbine

the muske rose and the garish columbine w,h cowslips wan that hang the pensive head

x weare x weares

and every flower that sad escutcheon A beares imbroidrie beares

2~let daffadillies fill thire cups wth teares 35 i bid Amaranthus all his beauties shed

to strew &c.

W what could the muse her selfe that Orpheus bore y\ the muse her selfe for her inchanting son . for her inchanting son did whome universal nature might lament 40 when by the rout that made the hideous roare

x gorie

goarie his divine^ visage downe the streame was sent downe the swift Hebrus to yc Lesbian shoare.

28

This page was originally the blank verso of the last sheet of A Mask in the Manuscript. It contains four drafts of three portions of Lycidas, one being struck out.

TRINITY COLLEGE MANUSCRIPT

LYCIDAS

435

HIT v r~%$K***<«~i< ***** u&*. f *»&***, f TVS *rfa* -° *** ***> uk. $ f"

'■rf-m.iL

ft #ru* ffa h»fc,

H^

'&

y$Le*Hi **+> Hry+l TmM*r*L /J*»K*+' l~7*>*»4- iw^t fa ***&P%i$<u* Q»+ i*~SU Art*** - W<M ^*^

28

436

TRINITY COLLEGE MANUSCRIPT

<3*

Novemb : 1637

In this Monodie the author Lycidas (^seas 1637

bewails a lerned freind unfortunatly drownd in his passage from Chester on the Irish

Yet once more O yee Laurells, and once more

Yee myrtle's browne wth Ivie never sere

I come to pluck yor berries harsh and crude

and wlh forc't fingers rude 5 shatter yor leaves before the mellowing yeare.

bitter constraint, and sad occasion deare

compells me to disturbe yor season due

for Lycidas is dead, dead ere his prime

young Lycidas, and hath not left his peere 1 o who would not sing for Lycidas ? he well knew

himselfe to sing, and build the loftie rime

he mus't not flote upon his watrie beare

unwept, and welter to the parching wind

without the meed of some melodious teare 1 5 Begin then Sisters of the sacred well

that from beneath the seate of Jove doth spring

begin, and somwhat loudly sweepe the string

hence wth denial vaine, and coy excuse

so may some gentle muse 20 wth luckie words favour my destin'd urne

and as he passes turne and to bid faire peace be to my sable shroud

for wee were nurs't upon the selfe same hill

fed ye same flock by fountaine, shade, and. rill 25 Together both ere the high Launs appear'd

X

under the glimmering eyelids of the morne opening wee drove afeild, and both together heard what tyme the gray fly winds her sultrie home batning our flocks w* the fresh dews of night 30 oft till the ev'n starre bright that rose in Evning bright

toward heavens descent had sloapt his burnisht weele westring

meane while the rurall ditties were not mute

tempd to th' oaten flute

rough Satyrs danc't ; and Fauns wth clov'en heele 3 5 from the glad sound would not be absent long

and old Damcetas lov'd to heare our song But O the heavie change now thou art gone gone

now thou art gon, and never must returne

fhee shepheard, thee the woods and desert caves 40 wth wild Thyme, and the gadding vine oregrowne

and all thire Eccho Echo's mourne

the willows, and the haze'l copses greene

shall now no more be seene

fanning thire joyous leavs to thy soft lays 45 as killing as the canker to the rose

or taint-worme to the weanling heards' that graze

or frost to flowrs that thire gay buttons weare beare wardrope weare

when first the white thorne blows

such Lycidas thy losse to shepheards eare 50 where were yee nymphs when ye remorselesse deepe

clos'd ore the head of yor youn lov'd Lycidas

for neither were yee playing on the steepe

where yor old bards the famous Druids lie

nor on the shaggie top of Mona high 55 nor yet where Deva sprcds her wisard streame

ay mee I fondly dreame

had yee bin there, for what could that have don ?

what could the golden hayrd Calliope

for her inchaunting son „ —

when shee beheld (the gods farre sighted bee)

his goarie scalpe rowle downc the Thracian lee

whome universal nature might lament

and heaven and hel deplore when shis divine head downe the streame was sent downe the swift Hebtus to the Lesbian shore .

60

29

TRINITY COLLEGE MANUSCRIPT

LYCIDAS

437

jjrrr&r'<U 4 ? W.?c«4r 9*. kit p*m%

'teLffc* *** 4& s~*l <**

"j+lffm. U**m* Jh* $

^/A/^rfe,^^

mfr-

>+

«*-

1w/$:

l»

A *

M7*l.

»»-*£

<pc>*'*<

trr^

ir *

£

,*■**«. u*t.

t

»**1 ****** w^

k-tnr f%L.

■**■■** * Jen I ™_

* •* K

A^»«s4*ijisi

29

438 TRINITY COLLEGE MANUSCRIPT

Lycidas

Alas what boots it wth incessant care to tend the homely slighted* shepheards trade and strictly meditate the thanklesse muse were it not better don as others use 5 to sport w* Amaryllis in the shade

or with A hid in the tangles of Neaera's haire ?

. fame is the spurre that the cleere spirit doth raise (that last infirmitie of noble mind) to scorne delights, and live laborious days i o but the faire guerdon when wee hope to find

and thinke to burst out into sudden blaze comes the blind Furie wth th' abhorred sheares and slits the thin-spun life . But not the praise Phoebus repli'd, and touch't my trembling eares,

on i s Fame is no plant that grows A mortall soile

nor in the glistering foile set off to th' world, nor in broad rumor lies but lives and spreds aloft by those pure eyes and pfect witnesse of all-judging Jove 20 as he pronounces lastly on each deed

of so much fame fn heav'n expect thy meed

X

Oh Fountaine Arethuse and thou smooth flood fam'd "honour'd smooth soft sliding Mincius crown'd w'h vocall reeds

that straine I heard . was of a higher mood

25 but now my oate proceeds

and listens to the Herald of the Sea

that came in Neptunes plea

he askt the waves, and askt the fellon winds

what hard mishap hath doom'd this gentle swaine ?

30 and question'd every gust of1 rugged wings

that blows from off each beaked promontorie they knew not of his storie and sage Hippotades thire answer brings that not a blast was from his dungeon straid

35 the aire was calme and on the levell brine

sleeke Panope w* all her sisters plaid it was y' fatall and pfidious barke built in th' eclipse, and rigg'd with curses dark that sunk so low that sacred head of thine

40 Next Camus reverend sire went footing slow

his mantle hairie, and his bonnet sedge "scraul'd ore w,h figures dim, and on the edge inwraught like to that sanguine flowre inscrib'd vi01 woe ah who hath reft, quoth he, my deerest pledge

45 last came and last did goe

the pylot of the Galilean lake,

tow massie keys he bore of mettalls twaine

the golden opes, the iron shuts amaine

he shooke his mitre'd locks and Sterne bespake

50 how well could I have spar'd for thee young swaine

anough of such as for thire bellies sake creepe, and intrude, and clime into the fold of other care they little reckning make then how to scramble at the shearers feast

55 and shove away the worthy bidden guest

blind mouths ! that scarse themselves know how to hold a sheephooke, or have learn't ought else the least that to the faithfull heardsmans art belongs what recks it them? what need they? they are sped

30

TRINITY COLLEGE MANUSCRIPT

LYCIDAS

439

iff 'it- U* '-»f$ff<t*h far* .

\0T'

V* ti« *yfa W/h***k ***** . •

'M«*- /^ «^ «v* 4/ *«, W*. 7W] '

H iCatni, ft&mhft <**d At* /«*sA»»«5 *"/* , /

«*>p/*l U^n&f Utd/AJLjt fife

'^rj*/?rct£#i .....

'**2*™9' /#>**»<♦$ Crou>*tl +>*+ 1"W fiAtty I

ufflsds&jh* JuJlThiuJrt)

fwwf meruit *«»»£ ami. t*j Vonnst—Sfjat ^ - X I!"

^/>/^ # JtZtiJj&n l*fa /rt/ ,

*J'm7*&t ksJu hit *P&MJfy f»~m ^A*f- rzki'4~ tf«*<i uJUnujtfkS uZc^SpJ

♦ ^

30

440 TRINITY COLLEGE MANUSCRIPT

Lycidas

and when they list, thire leane and flashie songs grate on thire scrannel pipes of wretched straw the hungrie sheepe looke up and are not fed but swolne wth wind, and the rank mist they draw 5 rot inwardly, and foule contagion spred

besides what the grim wolfe wvl> privie paw dayly devours apace, and nothing sed little

but that tow-handed engine at the dore stands readie to smite once and smite no more 10 Retume Alpheus the dred voice is past

that shrunk thy streams, retume Sicilian Muse and call the vales and bid them hither cast thire bells, and flowrets of a thousand hues yee vallies low where the mild wispers use

'5 of shades, and wanton winds, and gushing brooks x sparely

on whose fresh lap the swart starre sparely looks faintly "bring hither all yor quaint enamel'd eyes "throw

that on the greene terfe suck the honied showrs

and purple all the ground wlh vernal flowrs ^Bring the rathe &c.

to strew the laureat herse where Lycid' lies for so to interpose a little ease

XfraiIe xfraile

let our sad thoughts dally wth false surmise

A

Ay mee whilst thee y^ floods and sounding ser.s xshoars -'5 wash ' farre away, where ere thy bones are hurl'd

whether beyond the stormie Hebrides

where thou phapps under the humming tide

visit'st the bottome of the monstrous world

or whether thou to our moist vows deni'd 30 sleep'st by the fable of *Corineus old "Bellerus

where the great vision of the guarded mount

g

looks toward Namancos, antl Bayona's hold looke homeward Angel now and melt w* ruth and O yee Dolphins waft the haplesse youth 3 5 Weepe no more wofull shepheards weepe no more

for Lycidas yr

3i

33

TRINITY COLLEGE MANUSCRIPT

LYCIDAS

441

A r<*H, a * Mck I hi nnd pip if of u yiS<fi R jtr»»

Ks

a*0

Yd- -ntht+rdL ~ **>0 -fault &>*fi*fr*<** $**</

CH#

n4

Mmi~ String Hv/ ^rf**»5,r,^**w*/ ^ ii *^

°«* c^c Mf <hUu ** t& M«~ hMw'~fr-

*a tftt ffQu/rf.

/m*ri&- A iff f wtcti jCytot^l&t

31

442 TRINITY COLLEGE MANUSCRIPT

Lycidas

Weepe no more wofull shepherds weepe no more for Lycidas yor sorrow is not dead sunck though he be beneath the watrie floare so sinks the day starre in the Ocean bed 5 & yet anon repairs his drooping head

and tricks his beams & w,h newspangled ore

flams in the forhead of ye morning skie

so Lycidas sunk low but mounted high high

through the deare might of him that walkt -f waves :

10 where other groves and other streams along

w* nectar pure pure his oozie locks he laves & heares listening the unexpressive nuptiall song

in the blest kingdoms meek of joy & love there entertaine him all the SB above

is in sollemne troops, and sweet societies

that sing, & singing in thire glorie move and wipe the teares for ever fro his eyes now Lycidas the shepherds weepe no more henceforth thou art the Genius of y= shoare

20 in thy large recompence, & shalt be good

to all that wander in that peril/ous flood Thus sung ' the uncouth swaine to th' oakes & rills while v" still morne went out v/A sandals gray he toucht the tender stops of various quills

25 w"> eager thought warbling his Dorick lay

and now the Sun had stretcht out all the hills and now was dropt into westren the western bay at last he rose and twitcht his mantle blew To morrow to fresh woods and pasturs new

32

TRINITY COLLEGE MANUSCRIPT

LYCIDAS

443

■b^p *UJLl.« sJisJ^^rOiJ. mtrfcjt

^ f

444

TRINITY COLLEGE MANUSCRIPT

43

i 3 To my freind Mr Hen. Laws Feb. 9. 1645

Harry, whose tunefull & well-measur'd song

first taught our English Music how to span .

words with just note &• accent, not to scan when most were wont (. wont to scan

words with just note words with with just notes, * w<k till then us'd to scan when most were & accent, not to scan Cfwith Midas eares, committing short ,& long "misjoyning

wit \ /

5 Thy worth & skill exempts thee from t)ie throng

and gives thee praise above thgr pipe of Pan;

to after age thou shalt be ywritt a man

that didst reform thy artAthe cheif among

Thou honourst vers, & vets must lend her wing

10 to honour thee, the/rreist of Phoebus quire

that tun'st thir happiest lir\es in hymn or story

give / to

Dante shall A Fame by the Tusibris leav, A shall set thee higher

his y/ he .

then old ^Casella whom Dante\ woo d to sing

milder r met iif the A mildest shades \i Purgatory.

Casella

J-

M.

13

\

To M[ Hen : Laws on the publishing of his Aires

Harry, whose tunefull & well-measur'd song

First taught our English Music how to span

Words with just note & accent, not to scan

with Midas eares, committing short & long, Thy worth & skill exempts thee from y= throng,

with praise anough for Envy to look wan ;

To after-age thou shalt be writt the man

That with smooth aire* couldst cou'dst humor best our tongue. Thou honourst Vers, & Vers must lend her wing

To honour thee, the Preist of Phoebus quire

That tun'st th thir happiest lines in hymn, or story. Dante shall give Fame leav to set thee higher

Then his Casella, whom he woo'd to sing

Met in v* milder shades of Purgatory. x

11 On the dehaction w<* follow'd "Pon my writing certain treatises

I did but prompt the age to quit thir clogs •

By the known rules of ancient liberty

when strait a barbarous noise environs me

of Owls & buzzards, asses, apes & dogs As when those hindes that were transform'd

Rail'd at Latona's twin - born progeny

which after held the Sun & Moon in Fee.

But this is got by casting pearl to hogs ; That bawl for freedom in thir senseles mood,

And hate the truth wherby they should be free still

Licence they mean, when they cry liberty, For who loves that, must first be wise, & good

but from that mark how farr they roav, we see

for all this wast of wealth, & loss of blood, x

40

to frogs

revolt when Truth would set them free.

The manuscript pages 33-39 are filled with prose plans for Paradise Lost, lists of subjects and outlines of plots. First Draft of XIII. 13 Milton probably first wrote then old Casell' whom Dante won to sing Then, substituting he for Dante he altered Casell' to Casella but making a blot, he wrote Casella in the margin, and at the same time changed won to woo'd to the reading in the second draft.

TRINITY COLLEGE MANUSCRIPT

SONNETS XIII XII

445

f?

f>

* y/W l/fl f %^-fcusf y%.

(o

#-

v

J&mw$fr% ittJ$£p%C

(A

"J' p*ii*f»>H,

Wit

/font*

\dcd$ >*'*M\ j»$- Wc^ cut**^ mhJv f***} vOiU fth'J*i tor*, &T*iMHi>£jCrh £-£»£f

<JJa*<h> littULiyivtrJv.n^ lea* U ttiHttet Xi<*A><

-^Th€K fuj t*f4t{<*-/ tojLr7*- Ac 1*>o*<l /v Arn<* \

/Mel-* yt >t»'jJtrf{<*d<t} oj- ^p^^-^vru ■ X

11 'f-Aci fy- fctnntf. flc *jc & ?*l ti,^ cL*1

> VAfti. ffaryw M*det r**L- urrC Jrm>»ifcrrrr*d, to <

kr%S

fijulU. at jj[jfr£&n<a!-f h*>7n~btrm fih*&enu vh-'cL d^fer h*l<L tfc S*»^£flUenl& ^>J,

40

446 TRINITY COLLEGE MANUSCRIPT

a.

On y religious memorit of M" Catharine Thomson my christian freind deceased 16 Decern. 1646

M When Faith & Love, that parted from thee never,

Had rip'n'd thye thV just soul to dweU with God,

1 / a

Meekly thou didst Uesigne this earthy clod load

death call'd Ufa us Jife

Of Flesh & sin, v/'A man from /heavn doth sever.

anil 5 Thy Works, & Almes, A ill thy good Endeavor

staid not behinde Strait follow'd thee th\ patft that Saints have trod

nor in ye grave were trod when

But as Truth pointed Still as they journeyed /from this dark abode

with her golden rod y

follow'd thee up to joy Up to y Realm of /peace Gr Joy for ever,

& bliss for everA shew'd / \ shee who saw

Faith who led on yy way,\ & Jtncw them best 1 o thy handmaids, /clad them o're with purple beames

/ that

and azure /wings, thence up they new so drest

And spake th/ trurti of \hee in glorious theames

before the/ Judge, who ^henceforth bidd thee rest,

and dryfk thy fill of\ pure immortal streames

14 When Faith & Love W* parted fro thee never, Had rip'n'd thy just soul to dwell with God meekly thou didst resigne this earthy load of death, call'd life, wch us from life doth .sever. S Thy Works & Almes, & all thy good Endevor

staid not behind, nor in the grave were trod But, as Faith pointed with her golden rod, follow'd thee up to Joy joy & bliss for ever.

Love Love led +++■ on Faith knew

Faith shew'd the way, and ^she who saw them best

10 thy handmaids, clad them o're with purple beames

and azure wings, that up they flew so drest, And spake the truth of thee in glorious theames

before the Judge, who thenceforth bidd thee rest, and drink thy fill of pure immortal streames.

41

In the title at the top, the faint inserted a with caret below was put on Wright's printed page. It is barely visible in the MS. between, not above, the m and s and was first noticed and described by Smart. First Draft. 3 clod was first changed to load then struck out and load written clearly in the margin. Second Draft. 8 Wright's underscored joy should read joy as he stated in his notes. 9 The successive changes here seem to have been: 1. Faith shew'd the way, 2. Love shew'd the way, 3. Love led them on, with the changed to them by a macron with three vertical strokes through it over the e, as on page 45 the changed to then by placing a macron with two vertical strokes over the e.

TRINITY COLLEGE MANUSCRIPT

SONNET XIV

447

/

/*

A

M

7

hlttlJj.kt* £U

)^a<c( -net- lehindf'

9

•Uyf ft* e*

&r~*y*MH*e ^IrW*J&t2 ' *> /"t'L ^fTj7,]rit^>

■fa*- m C fpff4&a£ £*t+ h m te 4ncl

?«r

T

W

t&4&-

1 tahft "//< lUhnTf^- pity ** ^fttm-tcl ■

¥***- tofjeknj, K0r » fo. &»»<> ** ere. W-

fir* ffW tH frutt of lift 'm Ate*, fa**W }

hfinrt [U T**jii tm ^ct^tyfi falj fat rrvV} a*/ 4m'*Jl rfyf^l *ff*~rt> }»%mcyi~L ffrpa^4^ .

■ !

1*%** ffwv -fit* to drtjr-

■to <tttncut f^fa^n^S

tA^l^rrlA irjcxcL &4( '/&&

\ \

448 TRINITY COLLEGE MANUSCRIPT

45

13 e

To M: Hen. Laws on the publishing of V\s Aires

Harry whose tunefull & well measur'd Song

first taught our English Music how to span

words with just note & accent, not to scan

with Midas eares, committing short & long ; Thy worth & skill exempts thee from the throng,

with praise anough for Envy to looke wan ;

To after-age thou shalt be writ the man

That with smooth aire could'st humor best our tongue. Thou honourst Vers, & Vers must lend her wing

To honour thee, the Priest of Phoebus quire

That tun'st the h theire happiest lines in hymn, or story. Dante shall give Fame leave to set thee higher

Then his Casella, whom he woo'd to sing

Met in the milder shades of Purgatory.

X

1 4

When Faith & Love which parted from the never,

had rip'nd thy just soule to dwell with God,

meekly thou did'st resigne this earthy load

of death, call'd Life ; which us from bits life doth sever. Thy workes & Almes, & all thy good Endeavour

staid not behind, nor in the grave were trod ;

But as Faith pointed with her golden rod,

follow'd thee up to joy & blis for ever . Love led them on, & Faith who knew them best

thy handmaides, clad them o're with purple beames

& azure wings, that up they flew soe drest,

thee ,

And spake the th truth of A on glorious the*mes

before the Judge, who thenceforth bid thee res

& drinke thy fill of pure immortall streames.

X 42

TRINITY COLLEGE MANUSCRIPT

SONNETS XIII XIV

449

Ufa

Jffm

7

-cv-i.

non^-o^-

t-mn- ,<rt-

0*n.

. ffiZZk, Jib, Jifg^MU p fiZ 4m £f-&tfst~^

7-

T

7

42

450 TRINITY COLLEGE MANUSCRIPT

these sonnets follow y! 10. in y? printed booke

On the detraccon which followed upon my writeng certaine treatises vid. ante 12

I did but prompt the age to quit theire clogs

By the knowne rules of ancient liberty,

when strait a barbarous noise environs me

of Owles & Cuckoes, asses, apes & dogs;. As when those hindes that were transform'd to frogs

Rail'd at Latona's twin-born progeny

which after held the sun & moone in fee Fee

But this is got by casting peal pearle to hogs;

That bawl for freedome in their sensles mood,

sett And still revolt when tru Truth would make them free :

A

Licence they they meane when they cry liberty : For who loves that, must first be wise, & good ; but from that marke how far they roave we see for all this wast of wealth, & losse of blood.

X

12

A booke was writ of late call'd Tetrachordon ; And wov'n close both matter, frome, & stile ; the subject new: it walk'd the towne a while, numbring good intellects, now seldom por'd on.

Cries the stall-reader, bless us what a word on a title page is this ! & some in file stand spelling fals, while one might walke to Mile- end Greene. Why is it harder, sirs, the" Gordon,

Colkitto, or Macdonnell or Galasp?

those rugged names to our like mouthss grow sleek that would have made Quintilian stare & gasp.

Thy age, like ours, O soule of Sir John Cheek*, hated not learning wors then toad or Asp; when thou taught'st Cambridge, & King Edward Greek.

43

TRINITY COLLEGE MANUSCRIPT

SONNETS XII XI

451

L Yea. SUJU^,- \JiLjJL4* Ji'J ',,**» »** tl/^-Q-fc

*t^%fh ^sP^Fa-W fay ^Ey tt&^Xr.r

■--**•■

d'ffjr

k&*y)ff-

IP **" •

•*>

452 TRINITY COLLEGE MANUSCRIPT

47

I 2

A booke was writt / writ/ a book of late call'd Tetrachordon,

wov'n And weav'dit close both matter, form; & stile,

the subject new ; it walk'd

It went off well about Aye town a while,

intellects numbring good wits; but now is seldom por'd on.

Cries the stall-reader, bless us what a word on

a title page is this ! and som in file '

stand spelling fals, while one might walk to Mile- end Green. Why is it harder, Sirs, then Gordon

Colkitto, or Macdonnell, or Galasp?

* rough hewn rugged

those barbarous names to our like mouths grow sleek "rough hewn that would have made Quintilian stare & gasp.

Thy age, like ours, O soul of Sr John Cheek

hated not learning wors then toad or Asp, when thou taught'st Cambridge, & King Edward Greek. x on ye forcers of Conscience 15

to come in heer On f Lord Gen. Fairfax at f seige of Colchester. turn over the leafe

Fairfax, whose name in armes through Europe rings Filling each mouth with envy, or with praise, And all her jealous monarchs with amaze, And rumors loudd loud, that daunt remotest kings,

Thy firm unshak'n vertue ever brings

Victory home, though new rebtllions raise Thir Hydra heads, & the fals North displaies her brok'n league, to impe their serpent wings,

O yet a nobler task awaites thy hand ;

For what can Warr, but endless warr still breed, Till Truth, & Right from Violence be freed,

And An Public Faith cleard from the shamefull brand Of Public Fraud. In vain doth Valour bleed While Avarice, & Rapine share the land.

6 A

To the Lord\ Generefll Cromwell May 1652

\jr at ye Commtee On the proposalls of certpms. ministers A for Propagation of the Gospell.

Cromwell, our cheif of men, who through a cloud Not of warr onely, but detractions rude, Guided by faith & matchless Fortitude To peace & truth thy glorious way hast plough'd,

And on the neck of crowned Fortune proud

Hast reard Gods Trophies & his work pursu'd,

While Darwen stream wth blood 6f Scotts imbru'd,

Worsters laureat wreath And Dunbarr feild resounds thy praises loud,

Worsters laureat wreath And twentie battles more; yet much remaines

To conquer still ; peace hath her victories

No less renownd then warr, new foes aries

Threatning to bind our soules wth secular chaines :

Helpe us to save free Conscience from the paw

Of hireling wolves whose Gospell is their maw. y

44

Sonnet 16 (Cromwell). 7 embru'd changed to imbru'd.

TRINITY COLLEGE MANUSCRIPT

SONNETS XI XV XVI

453

!2-

4i

-fat cw<*Tji4r*4i^

a*e.f Uks ihvtjj $Jo*L

<rn<

I hum

*?l*<pi4 ~?»

n*.

fcmi-zG

':-?

a ^ fJLjduUs %5&k ***** fak-1& &£kfr* 6r~£

mwimfa**&

c

^/Co&H V'nn<n&l -m* to*r,r, *"". -fit} *r>U

z^L^^l^^

454 TRINITY COLLEGE MANUSCRIPT

i 7

To S" Henry Vane the younger

i

Vane, young in yeares, but in sage counsellx old, Then whome a better Senatour nere held The helme of Rome, when gownes not armes repelld The feirce Epeirote & the African bold, 5 Whether to settle peace or to unfold

The drifu of hollow states hard to be spelld, The to advise how warr may best, upheld,

by on Move on^ her two maine nerves, Iron & Gold In all her equipage ; besides to know i o Both spirituall powre & civill, what it meanes each meanes

What powre the Church &• what the civill meanes

hast learnt well, a praise which few have won Thou teachest best, which few have ever don What severs each

The bounds of either sword to thee wee ow. thou '*»** learnt- ** few hav dor

firme Therfore on thy right hand religion leanes

In peace, & reck'ns thee her eldest son. x

On the forcers' of Conscience. to come in as is directed in

the leafe before

Because you have thrown off your Prelate Lord

And w"1 stiff vowes renouncd his Liturgie

widow'd • To seise the vacant whore Plurality

ffrom them whose sin yee envi'd, nott abhorrd, 5 Dare yee for this adjure the civill sword

our To force the Consciences that Christ sett free, And ride us wth a classic Hierarchy Taught yee by meer A. S. & Rotherford. Men whose life, learning, faith & pure intent ,

to Would have bin held in high esteem w* Paul

Must now be namd & printed Hereticks shallow By hare \braind Edwards & Scotch what d'ye call ;

But wee doe hope to find out all your tricks, Your plotts & packings worse then those of Trent, 1 5 That so the Parlament

May wth their wholesome & preventive sheares lip your Phylacteries though bauke your eares

Cropp yee as close as marginall P — s eares

they And succour our just feares

When you shall read this cleerly in your charge

20 New Presbyter is but old Preist writt at large

X

45

Sonnet 17 (Vane) 7 And changed to Then by changing to The with macron with two vertical strokes through it over the e. New Forcers. 12 haire braind changed to hare braind then struck out.

TRINITY COLLEGE MANUSCRIPT

SONNET XVII

NEW FORCERS

455

"""*/**•?♦ '' "

1

~7L%

vth^or /kx> m-tun^n^tn^ / f-nnu y? p,

m-sa.n*s

if £«*££,,

, f'- .»

1 ?*j

\ cfa&v* 9L, QL% /?-ts €§to«A v .fco+cX */#U 9« ift c<l% j

<%WrJf€Hgt VpcU^rnp -W&jQv*. .milLvf- ^^

i JtyheA.'pipL yU&> read <*&t LUtxCf- vn ft***- ofartft- 1

45

I

"■^> eft..

-£.

I

AD JOANNEM ROUSIUM MANUSCRIPT

457

458 AD JOANNEM ROUSIUM MANUSCRIPT

T

ODE AD JOANNEM ROUSIUM

^HERE IS IN THE BODLEIAN LIBRARY, Oxford, a copy of Milton's Poems, 1645 m which, pasted to the verso of the Latin title page, is a two leaf twice folded document. This contains on its four unfolded pages a longhand copy of the Ode Ad Joannem Rousium written in Latin. The contents of the poem has to do with the lost copy of the 1645 Poems Milton himself had sent to the Library. The MS. is found in a copy of his Poems in the Bodleian, to which place Milton states in the verses that he had dispatched a substitute copy. The MS. has therefore been assumed by many persons to be in Milton's handwriting. Perhaps it is; but it is written in a most formal, set hand, unlike anything we possess today known to have been written by Milton. The MS. is reproduced here without collation or further comment by permission of the Bodleian Library, Oxford, where it is catalogued as MS. Lat. Misc. f.15.

AD JOANNEM ROUSIUM MANUSCRIPT

459

10

i5

20

25

£i/?bd.jyu:iri + ^kuus>. "x&i/fjisis Jejuttmil

icinf££'~!yw^.

1 Frfadr ace/ ' aemina \

reifc r-Wr

"» '\

L^V l**lt*,

• »

r-fy

£im.^m4us JiusoriiaJ xu/icj&r &**&•>. ^j^ y&n&'irttamuca. per *>ir&£z fuu \ >v\..fl.; . s

?SuiMUacc/ reuauis&g&? "_' ' * "-J* '.*

2& jfep 6?xJe&f iter, / C .'^* -

loiuatm, ttwaju. ta sacxr* v" ;

Strom e 2.

./

*••*•'

/.

■%' ►

r jz//< 7. -f$,.v-'J cai&fS d*4

w ■ r

-h r/A wiSt rafai udcw

The reduction in height is from about 8^ inches in the original to about 7 inches.

10

Ad Joannem Rousium Oxoniensis Academic Bibliotheca[r]ium. De libro poematum amisso quem ille sibi denuo mitti postulabat, ut cum aliis nostris in Bibliotheca publica reponeret, Ode. Joannis Miltonj. Strophe 1 Gemelle cultu simplici gaudens libe[r], Fronde licet gemina, Munditieq; nitens non operosa, Quam manus attulit Juvenilis olim,

Sedula tamen haud nimij poetae, Dum vagus Ausonias nunc per u[mb]ras Nunc Britannica per vireta lusi[t] Jnsons populi, barbitoq; devius Jndulsit patrio, mox itidem pect[ine] Daunio Longinquum intonuit melos

15

20

25

Vicinis, et humum vix tetigit pe[de] -

Antistrophe. Quis te, parve liber, quis te fra[tri]bus Subduxit reliquis dolo? [Cum tu] miss[us] a[b] [u]rbe, [Do]cto jugiter obsecrante amico, Jllustre tendebas iter Thamesis ad incunabula Caerulei patris, [F]ontes ubi limpidi Aonidum, thyasusq; sacer [0]rbi notus per immensos [TJemporum lapsus redeunte cae[l]o, [Cele]berq; futurus in aevum,

Strophe 2 [M]odo quis deus, aut editus deo [P]ristinam g[e]ntis mis[e]ratus indolem

460

AD JOANNEM ROUSIUM MANUSCRIPT

/v

30

35

40

45

50

55

• /

[.Si satii ntxd* Luim.iHJ rtfrgs

Jfyfa \Iujc* deferJj ilium) 7S^/ nefawfa civil * him J to ,

tf/rfuihe-S tsruniAenh ■ ^

<X,mji fa, iifell?, nu/& /ictf iruzbL s iC

Seu qui* te fen&zr^ >Ar,f ,*.'*? •, . $eu #u<i te fa isn\ : , / f:ra'/ una/9 1 ilt

LJjC^a.f'£? /five, fn $:?&*. &/>i w . ; JYa/n. fe.jlousuu Jul

• V * '

.V V

A>opa/^ lamias uu» cujur itic/ydk Jhutf.2 r<?y>oni auttou i ' ipf* pt&rufef

»*

-N

30

35

40

(Si satis noxas luimus [pjriores Molliq; luxu degene[r] otium) Tollat nefandos civi[u]m tumultus, Almaq; revocet studia sanctus, Et relegatas sine s[e]de Musas Jam pene totis fini[b]us Angligenum; Jmmundasq; volucre[s] Unguibus imminente[s] Figat Apollinea pharetra,

Phineamq; abigat [pest]em procul amne Pegaseo. Antifsjtrophe

Quin tu, libelle, nun[tii] licet mala

Fide, vel oscitantia

Semel erraveris a[g]mine fratrum,

Seu quis te teneat s[p]ecus,

Seu qua te latebra, [for]san unde vili

45

50

55

Callo tereris instito[ris] insulsi, Laetare felix, en it[er]um tibi Spes nova fulget po[ss]e profundam Fugere Lethen, vehi[q;] superam Jn Jov[is(?)] aulam remig[e] penna,

Strophe 3.

Nam te Rousius sui

Optat peculi, numerofq;] justo

Sibi pollicitum querit[u]r abesse,

Rogatq; venias ille cujus inclyta

Sunt data virum monu[m]enta curae:

Teq; adytis etiam sacr[is]

Voluit reponi quibus et ipse praesidet

/Eternorum operum cu[s]tos fidelis,

Questorq; gazae nobilic[r]is,

Quam cui praefuit Jon

AD JOANNEM ROUSIUM MANUSCRIPT

461

60

65

70

75

80

85

K.,tareti

/

• A'

PxjAutjtjjm fweau£

\<3ta&uu£ foe rfc/rie fua£f e^fenaun^ •ras* j&vPj'kaa&Ai spertre juke ~ *

z.4 £tt/eut da& sff/gts 3Loi'4i, / ,

Qui n£fu£ fmfua j>w&&> vwifene/nur&ydhfcUnje

3

r

Clarus Erectheides

Opulenta dei per templa parentis

Fulvosq; tripodas, donaq; Delphica, 60 Jon Actsea genitus Creusa. Antistrophe.

Ergo tu visere lucos

Musarum ibis amcenos,

Diamq; Phoebi rursus ibis in do mum

Oxonia quam valle colit 65 Delo posthabita,

Bifidoq; Parnassi jugo:

J bis honestus,

Postquam egregiam tu quoq; sortem

Nactus abis, dextri prece sollicitatus amici. 70 Jllic legeris inter alta nomina

Authorum, Graiae(blotted) simul et Lati[n]ae (JSargin)

Antiqua gentis lumina, et verum decus.

*Grai«

Epodos

Vos tandem haud vacui mei labores,

Quicquid hoc sterile fudit ingenium, 75 Jam sero placidam sperare jubeo

Perfunctam invidia requiem, scdcsq ; beatas

Quas bonus Hermes

Et tutela dabit solers Rousi,

Quo neque lingua procax vulgi pcnetrabit, atq; longe 80 Turba legentum prava facesset;

At ultimi nepotes,

Et cordatior setas

Judicia rebus aequiora forsitan

Adhibebit integro sinu. 85 Turn livore sepulto,

Siquid meremur, sana posteritas sciet

Rousio favente./

462

AD JOANNEM ROUSIUM MANUSCRIPT

-?v

10

Ode intut coyfai irF^^MuJgma a/t/itfrfifaif una de mMmepocw cf&usU^ qu&tj&metsi ffmr^s n&Tp&rswini nu. m&to nee ce.r£U ufil e\*s ex&c£& resppnd&uvi ^UtL tamw. secuiMus, commffede left *s/i f>&&/z4taua.Tn oaawiiaws en. cifi&uu modes, mfan&n stefiantesjtffffidjLlfcqaw

>jevcM pt* sv/v£y yttJ&uni ferfo /ozo f[$ &£& • lerid.

• .v •

.U' --N

\ .

■4

/

w, i^l-Misf 4 /.T

Ode tribus constat strophis, totidemq; antistrophis una de- mum epodo clausis, quas tametsi omnes nee versuum nu- mero nee certis ubiq; colis exacte respondeant, ita tamen secuimus, commode legendi potius, quam ad antiquos con- cinendi modos, rationem spectantes. Alioquin hoc genus

10

rectiiis fortasse dici monostrophicum debuerat. Me- tra partim sunt Kara ax*a<-v partim awoXeXv^ifa. Phaleucia quae sunt, spondaeum tertio loco bis admit- tunt, quod idem in secundo loco Catullus ad libitum fecit.

INDEX OF TITLES AND FIRST LINES

As most of the poems contained in this edition appear in more than one form, most of the entries in this Index carry more than one page number. The sonnet numbers are standardized according to the Columbia edition.

A Book was writ of late call'd Tctrachordon ; 42; 450-453

Ad Carolum Diodatum (Elegia I) 104; 221

(Elegia VI) 114; 231

Adhuc madentes rore squalebant genae, . . 127; 244

Ad Joannem Rousium 143:456

Ad Leonoram Romae Canentem 119:237

Ad Patrem 130; 247

Ad Salsillum Poetam 134; 251

Ad Thomam Junium (Elegia IV) .... 108; 225 Ah Constantine, of how much ill was cause . . . 376 Altera Torquatum cepit Leonora poetam, . . 119:237 A Mask {Comus) . . . 56; 189; 260; 300; 340; 398

Among the holy mountains high 95

And to be short, at last his guide him brings . . 376 Angelus unicuique suus (sic credite gentes) . . 119; 237

Answer me when I call 81

Apologus de Rustico et Hero 120

Arcades 49; 182:384

At a Solemn Music 27; 167; 390-393

At A Vacation Exercise in the College 46

Avenge O Lord thy slaughter'd Saints, whose Bones . 43

Be not thou silent now at length 90

Because you have thrown off your Prelate Lord, 49; 454 Before the starry threshold of Jove's

Court 56; 189; 260; 300; 398

Blessed is the man who hath not walked astray . . 79 Blest pair of Sirens, pledges of Heav'ns

joy 27; 167:390-393

Bridge-water Manuscript 300

Brutus far to the West, in the Ocean wide . . . 380

Canzone 40; 180

Captain or Colonel, or Knight in Arms, 41 ; 181 ; 396, 397

Comus 56; 189; 260; 300; 398

Credula quid liquidam Sirena Neapoli jactas, . 120; 237 Cromwell, our chief of men, who through a

cloud 372:452,453

Cum simul in regem nuper satrapasque

Britannos 118; 236

Curre per immensum subito mea littera pontum, 108; 225 Cyriack, this three years days these eyes, though

dear 373:418,419

Cyriack, whose Grandsire on the Royal

Bench 44; 418, 419

Daughter to that good Earl, once

President 42; 182; 396, 397

De Idea Platonica . .130; 247

Dicite sacrorum praesides nemorum deae, . . 130; 247 Diodati, e te'l diro con maraviglia, .... 40; 180 Donna leggiadra il cui bel nome honora . . . 39; 179

Elegia I 104

Elegia II 106

Elegia III . ' 106

Elegia IV 108

Elegia V in

Elegia VI 114

Elegia VII 116

Epitaph on the Marchioness of Winchester . . 28

Epitaphium Damonis 138; 254

Erewhile of Musick, and Ethereal mirth, . . 25

221 223 224 225 228 231

233 168

353 164

Fairfax, whose name in arms through Europe

rings 372:452,453

Fifth Ode of Horace 45-46

Fly envious Time, till thou run out thy

race 26; 166; 394, 395

Founded in chaste and humble Poverty, . . . 376

Gaudete Scrombri, et quicquid est piscium salo, . 379 Gemelle cultu simplici gaudens liber, . . . 143; 456 Giovane piano, e semplicetto amante . . . 40; 180 Goddess of Shades, and Huntress, who at will . . 380 God in the great assembly stands 82

463

464

INDEX OF TITLES AND FIRST LINES

Haec ego mente olim laeva, studoque supino . Haec quoque Manse tuae meditantur carmina

laudi

Hail native Language, that by sinews weak Harry whose tuneful and well measur'd

Song 43:368:444,445;

Hence loathed Melancholy

Hence vain deluding joyes,

Here lies old Hobson, Death hath broke

his girt, 30; 170;

Here lieth one who did most truly

prove 31; 171; 369;

Heu quam perpetuis erroribus acta fatiscit . Himerides nymphae (nam vos et Daphinin

et Hylan,) 138;

How lovely are thy dwellings fair! .... How soon hath time the suttle theef of

youth, 41; 181; 388, 389

118; 235

135; 252 . . 46

448, 449 32; 171 35: 175

37o;37i

370I37I 128; 245

254; 353 • • 9i

I did but prompt the age to quit their

doggs 42:444,445

II Penseroso

In adventum veris

In Effigei (sic) Ejus Sculptorem

In inventorem Bombardae

In obitum Praeconis Academici Cantabrigiensis .

In obitum Praesulis Eliensis

In obitum Praesulis Wintoniensis

In obitum Procancellarii medici

In Proditionem Bombardicam

In quintum Novembris

In Salmasii hundredam

In Salmasium

In se perpetuo Tempus revolubile gyro .

; 45. 45i

35 in

134 119 106 127 106 121 118 122

171

228

153 236 223 244 224 238 236

239 378

• 379

in; 228

Jam pius extrema veniens Iacobus ab arcto. . 122; 239 Jape tionidem laudavit caeca vetustas, . . . 119:236

Jehovah to my words give ear 82

Jesting decides great things 376

Lady that in the prime of earliest youth, 41 ; 181 ; 396, 397

V Allegro 32; 171

Laughing to teach the truth 376

Lawrence of vertuous Father vertuous Son, ... 44 Let us with a gladsom mind {Psalm CXXXV1) 21 ; 162 Look Nymphs, and Shepherds look, . . 49:182:384

Lord God that dost me save and keep 95

Lord how many are my foes 80

Lord in thine anger do not reprehend me .... 83

Lord my God to thee I flie 83

Lycidas 52; 185; 345; 434, 436

Mansus 135; 252

Methought I saw my late espoused Saint . 45; 388, 389 Mitto tibi sanam non pleno ventre salutem, . 114:231 Moestus eram, & tacitus nullo comitante

sedebam, 106; 224

Naturam non pati senium 128:245

Nondum blanda tuas leges Amathusia noram, . 116; 233

Now the bright morning Star, Dayes harbinger, 30; 169

Nunc mea Pierios cupiam per pectora fontes . 130; 247

O Fairest flower no sooner blown but blasted, ... 23 O Jehovah our Lord how wondrous great .... 85 O Musa gressum quae volens trains claudum, . 134; 251 O Nightingale, that on yon bloomy Spray . . 39; 178

On May Morning 30; 169

On Shakespear 30; 170; 365-367

On the Death of a fair Infant 23

On the late Massacher in Piemont (sic) 43

On the Morning of Christ's Nativity . . . . 15; 157

On the new forcers of Conscience 49; 454

On the University Carrier

I and II 30, 31; 170, 171; 369-371

On Time 26; 166; 394, 395

Parere fati discite legibus 1215238

Passion, The 25; 164

Per certo i bel vostr'occhi, Donna mia . . . 40; 180

Philosophus ad regem 134; 251

Psalm I 79

Psalm II 80

Psalm III 80

Psalm IV 81

Psalm V 82

INDEX OF TITLES AND FIRST LINES

465

Psalm VI 83

Psalm VII 83

Psalm VIII 85

Psalm LXXX 86

Psalm LXXXI 87

Psalm LXXX 1 1 89

Psalm LXXX III 90

Psalm LXXX1V 91

Psalm LXXXV 92

Psalm LXXXVI 93

Psalm LXXXVII • • 95

Psalm LXXXVIII 95

Psalm 114 (English) ........ 21; 162

(Greek) 133; 250

Psalm 136 21; 162

Purgatorem animae derisit Iiicobus ignem, . . 119; 236

Qual in colle aspro, al imbrunir di sera . . . 39; 179 Quern modo Roma suis devoverat impia diris, . 119; 236 Quis expedivit Salmasio suam Hundredam, . . 378

Ridonsi donne e giovani amorosi . . . . 40; 180 Rusticus ex Malo sapidissima poma quotannis . . 120

Siccine tentasti caelo donasse Jacobum . . . 118; 236

Sonnet I 39; 178

Sonnet II 39; 179

Sonnet III 39; 179

Sonnet IV 40; 180

Sonnet V 40; 180

Sonnet VI 40; 180

Sonnet VII 41; 181:388, 389

Sonnet VIII 41; 1811396, 397

Sonnet IX 41; 181 ; 396, 397

Sonnet X 42; 182:396, 397

Sonnet XI 42 ; 450-453

Sonnet XII 42:444,445:450,451

Sonnet XIII .... 43:368:444,445:448,449

Sonnet XIV 43:446,447:448,449

Sonnet XV 372:452,453

Sonnet XVI 372:452,453

Sonnet XVII 368:373:454-455

Sonnet XVIII (Milton's X V) 43

Sonnet XIX (Milton's XVI) 44

Sonnet XX (Milton's XVII) 44

Sonnet XXI (Milton's XVIII) .... 44:418,419

Sonnet XXII 373:418, 419

Sonnet XXIII (Milton's XIX) .... 45:388,389

Tandem, chare, tuae mihi pervenere tabellae, . 104; 221 Te, qui conspicuus baculo fulgente solebas . . 106; 223

There can be slaine 377

This is the Month, and this the happy morn . 15; 157 This is true Liberty when free born men . . . 377

This rich Marble doth enterr 28; 168

Thou Shepherd that dost Israel keep 86

Thy gracious ear, O Lord, encline, 93

Thy Land to favour graciously 92

Tis you that say it, not I, you do the deeds, . . 376 To God our strength sing loud, and clear .... 87 To Mr. H. Lawes, on his Aires 43; 368; 444, 445; 448, 449 Trinity College Manuscript 382

Upon the Circumcision 27; 166; 394, 395

Vacation Exercise 46

Vane, young in years, but in sage

counsel old, 368; 373; 454, 455

What needs my Shakespear for his honour'd

Bones, 30:170:365-367

What slender Youth bedew'd with liquid odours . . 45 When Faith and Love which parted from thee

never, 43:446,447:448,449

When I consider how my light is spent, .... 44 When I dye, let the earth be roul'd in flames. . . 376 When the blest seed of Terah's faithful Son, . 21 ; 162 Whom doe we count a good man, whom but he . 377 Why do the Gentiles tumult, and the Nations ... 80

Ye flaming Powers, and winged Warriours

bright, 27; 166:394, 395

Yet once more, O ye Laurels, and once

more 52; 185; 345; 434, 436

o!

Due	A Date College Returned	Due LIBRARY Due	Returned
rf^^h/f HP
rW^7
^sft^EESBPW
• rrrDX/P
pJSoc. /	x
/	\
	•■■■•.
SEP 2 2. '66	"5rP f c '66
Uvl "I		X**
	rfT	\
	V
	IW ■

UNIVERSITY OF FLORIDA

3 1262 04819 0382

laxooa voos ox

Ik

CO

<

i a